2H00A

Human methyltransferase 10 domain containing protein
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
250
structure length
225
Chain Sequence
VSLNFKDPEAVRALTCTLLREDFGLSIDIPLERLIPTVPLRLNYIHWVEDLIGHQDSDKSTLRRGIDIGTGASCIYPLLGATLNGWYFLATEVDDMCFNYAKKNVEQNNLSDLIKVVKVPQKTLLMDALKEESEIIYDFCMCNPPFFGITEIMAEGGELEFVKRIIHDSLQLKKRLRWYSCMLGKKCSLAPLKEELRIQGVPKVTYTEFCQGRTMRWALAWSFYD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Crystal Structure of Human methyltransferase 10 domain containing protein.
rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords methyltransferase 10 domain containing protein
total genus 70
structure length 225
sequence length 250
chains with identical sequence B, C
ec nomenclature ec 2.1.1.346: U6 snRNA m(6)A methyltransferase.
pdb deposition date 2006-05-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 2h00A00
5ICGA 5JR3A 1I9GA 3C6KA 2VZ9A 3VC1A 1M6YA 4CWAA 2HMYB 3MERA 3GRZA 1MJFA 5ERGB 5K01A 3R6TA 1WG8A 2AOTA 5HIJA 3V97A 3SX0A 5B1SA 5KQRA 1RJDA 5CVJA 3VC2A 4CKBA 3TLJA 2IIPA 4X1OA 3TR6A 2ZIGA 3SM3A 3KQPA 3A4TA 3GU3A 3HNRA 3DXZA 3VYWA 2YX1A 5D1NA 1R6AA 3DLCA 5U4XA 2P1DA 2FPOA 3X0DA 4C07A 4HTFA 1L9KA 3G2MA 1EAMA 3HCAA 3HCDA 4OX9Y 2C7RA 1Q0TA 1KHHA 3BWBA 5HEKA 2BR5A 2QRVA 4YUYA 4QVKA 3BWCA 3G89A 2OKCA 3A27A 3B89A 3SXJA 3HVKA 4KIFA 3SSMA 5LQUA 5JUWA 1JQ3A 1O54A 3AJDA 2IH4A 1EJ6A 3GO4A 1X1BA 5LR6A 2UYCA 5DX8A 3NTVA 4RX1A 4X61A 3FPFA 2CL5A 2XVAA 4RVGA 4RTNA 5FA5A 5K09A 4C06A 3FUVA 1VP3A 2P3LA 2ONYA 10MHA 2FK7A 4RTKA 3GRUA 2PX8A 3P2KA 4ER5A 2IFTA 3UJAA 2O57A 1AQIA 3GNLA 3I64A 4XUEA 2WA1A 1SVUA 3MCZA 4HRAA 5DTMA 1NV8A 3NDIA 4PINA 2YTZA 4YV1A 3OFKA 3KKZA 2IDKA 2JHAA 3LSTA 3QOWA 1JQEA 1I1NA 2P35A 4R8SA 3DH0A 5H02A 4E30A 3ERCA 1RI4A 1TW2A 2OYRA 4V0RA 1JG3A 1QAQA 2WK1A 1NW7A 3HCBA 1EQAA 2FCAA 2R3SA 3GWZA 3PFGA 5D1HA 3UZUA 2ZULA 5FADA 2YXEA 2XYVA 2FK8A 1KPGA 3CJTA 3EVZA 4MTLA 1BC5A 3NVKI 2AOUB 2Z6UA 5DSTA 2AN5A 2PJDA 3QV2A 2PT6A 2K4MA 2P7HA 4U7PB 2NXJA 3JWHA 5C1IA 5EMMA 2AOXA 3M70A 3HEMA 5ICCA 3HA5A 3P9CA 5E2AA 2CMHA 2V7EA 2HV9A 3HM2A 1BKYA 2OO3A 4RTJA 2ZBPA 3EVCA 4HTFB 4ATNA 3FPGA 1XCJA 1R8XA 2XYRA 3ELWA 5DWQA 3B5IA 3QOXA 5EKUA 4R6XA 3FRIA 3TKYA 5LQNA 1FJXA 2PXXA 2P7IA 3G88A 2BR3A 2PX5A 4QDKA 4CXMA 1XCLA 4PYMA 3M6VA 3UJ6A 4BLWA 2GPYA 1O9GA 3DTNA 1KYZA 1D2HA 2R6ZA 5FTWA 3BWYA 4R6WA 4C04A 1G38A 1PJZA 3NJRA 4OA8A 3G8BA 2A14A 4IV8A 3KQSA 5LQRA 4CKCA 3E7PA 3BKWA 3T0IA 1WY7A 2O06A 4ER6A 2AOVA 2G72A 4DA4A 5HZMA 1I4WA 2AN4A 1UWVA 3EPPA 1JSXA 3Q7EA 3KQQA 9MHTA 1ZG3A 4HGYA 5E9QA 3A7EA 4GOOD 5LSAA 1VP9A 4RTOA 2QYOA 1P1BA 4BLVA 1Y8CA 4GC5A 4DMGA 4LECA 3GRVA 3ELYA 1P91A 4RSRA 1G60A 2GS9A 1YUBA 4YUZA 3IYLW 1P39A 4LG1A 1SG9A 4DCGA 2XYQA 3FPHA 4PCAA 1JG1A 5EHIA 5EEHA 4F84A 4RTPA 3KQMA 4CKEA 3CC8A 3PX3A 3TKAA 5F2NA 2B3TA 3CBGA 1IY9A 2GA9A 5EIFA 1RI3A 2AZTA 2KW5A 4CTJA 5KS2A 2CKDA 3G8AA 2ZLBA 1NW6A 2PVCA 3S68A 1VIDA 3UWPA 3EEYA 2JHCA 3THSA 2FHPA 3LBYA 3UA3A 2E5WA 4RVHA 2H11A 1D2CA 2Q41A 2NXEA 2YQZA 2YVLA 2ZWVA 3LBFA 3SMQA 3TMAA 4GOLD 4F85A 5GWXA 4GEKA 2G1PA 2V74B 1M0EA 2PGXA 3P2IA 3JWIA 2B9EA 4C05A 2BM8A 2JHPA 4DCMA 2IH5A 5BP7A 2JH8A 4QDJA 1YF3A 3LPMA 4KDCA 4BP1A 2OXTA 1EJ0A 3AXTA 4X41A 5C0OE 2OPBA 3SVZA 5HIKA 4EK9A 5DM1A 8MHTA 5HILA 3R0QA 5C9ZA 3BZBA 5GM2A 5IH3A 5K0FA 4FR0A 2F8LA 4M37A 3LDUA 5GOZA 1INLA 1ORHA 3MAGA 1KYWA 3PT9A 5E1MA 4F86A 4POOA 2Z6AA 3M6WA 3G2PA 3LX6A 3GJYA 4XCXA 2VP3A 3SSOA 3E23A 4FT4A 5FHQA 4AX8A 4RTLA 2NXCA 3MB5A 1HMYA 3PFHA 1R74A 2NXNA 3M6XA 5EEGA 5LQAA 2ORED 5GIPE 3HVJA 4H0NA 5CVDA 4DKJA 1L3BA 3PX2A 4QQNA 3NWBA 5KQSA 3KU1A 1SKMA 2ZZKA 1XXLA 4PYIA 3LDFA 2Y1XA 2VS1A 5DLYA 4IV0A 4E31A 1KXZA 1QZZA 3E05A 4KW7A 4M7RA 4BY9E 1VBFA 4A6DA 3G5LA 3TM5A 3UJ9A 2ADMA 2BH2A 1D2GA 1KIAA 3KQWA 4E2YA 3ELDA 3HCCA 3B3JA 1G55A 4RVDA 1XJ5A 1ZGJA 2ZVJA 4OA5A 4HG2A 3G2QA 1JTEA 3PS9A 4LWPA 4KIGA 5CCXA 1QAMA 5KVAA 4E2WA 1BOOA 2ZCJA 4B17A 2AOUA 2ZWAA 5K8VA 1IXKA 3M4XA 4WVLA 3E8SA 5E9WA 1YFLA 2DULA 5MHTA 3NVMB 1HNNA 1RI2A 3I58A 5GINE 4YMGA 1XDUA 1YB2A 3P9KA 2H00A 3K6RA 4PYQA 4YUWA 3HA7A 2EJUA 2GAFA 4Y2HA 3DMGA 3EVGA 4L7VA 1OR8A 3KR0A 3D2LA 4YUVA 2ZSUA 5LQCA 2QM3A 2PX2A 4PGHA 1RJFA 1JQDA 3EVBA 5M5BA 3EVAA 5E1BA 4KWCA 3OPNA 4RV9A 3PVCA 5KYGA 1EG2A 2PXAA 3PTAA 4P7GA 4G56A 5GIOE 3OZSA 2YXDA 4XUDA 3ANXA 4PIPA 4PGGA 3KPJA 4GC9A 4EMSA 1BHJA 2IPXA 2AVDA 3ME5A 3EGIA 2JH9A 5HIMA 4RTQA 1TPYA 5LQKA 4R8RA 4GQBA 5EZQA 3TQSA 1VLMA 2JG3A 3TM4A 2BM9A 4MIKA 2CMGA 5CUQA 2AN3A 5EHGA 4PYLA 3MTEA 3T7SA 3UJ8A 3KQVA 1JG2A 4PWYA 1FP2A 3UJBA 2UYHA 2P41A 1MHTA 3A25A 3R9XB 4CTKA 3CGGA 4GBED 4ISCA 4PYJA 1L1EA 4UOEA 1KPHA 3FUTA 3GDHA 3L8DA 4HGZA 1ZHFA 3DR5A 5E9JA 3AXSA 4KDRA 5IKMA 5K0BA 3MCTA 4LWOA 1YZHA 1WXWA 3RODA 5BW4A 2PT9A 5EGSA 2PV0A 4C08A 3HCFA 4M38A 3IHTA 1N7IA 1R8YA 2PWPA 4YV2A 4FSDA 4YV0A 2NYUA 4FGZA 3FUWA 3PB3A 4ER3A 3ORHA 2P3QA 3O4FA 4GOMD 5DPMA 5DSXA 1AF7A 2IH2A 4BP3A 5E1DA 1Z3CA 5DRTA 4GF5A 1KR5A 4ER0A 4PYKA 2CWWA 3IV6A 3H2BA 2NNWB 3JWGA 3SR4A 2AOWA 3NMUF 1RJGA 2FRXA 3LKDA 3GXOA 3P8ZA 4ER7A 4AZWA 3C0KA 4IWNA 4QPNA 3KPUA 4YMHA 3ER8A 5ICEA 4X63A 3BGIA 3EGVA 5EG5A 1NKVA 3MQ2A 1FBNA 3OFJA 3FUXA 1NW3A 4HSGA 3UFBA 3K0BA 3KR2A 1NE2A 3CKKA 3DP7A 3DULA 3LCCA 3G2OA 4P58A 5BW5A 3KQYA 1VE3A 3BUSA 3DXXA 1JG4A 3SSNA 3BGVA 2IDJA 1H1DA 1JR4A 1RI1A 3A26A 5DX0A 5EMKA 3BWMA 5F2KA 5P8WA 4AUKA 5HOQA 4RYLA 5K0CA 2HTEA 4QTUB 4PONA 5EMJA 2I9KA 4P7JA 2XBMA 2HNKA 3ELUA 1RJEA 2BR4A 2OB1A 4C03A 4PYOA 5EQJB 1WXXA 3FYCA 2VDWA 3FPEA 1NW5A 1X1CA 3VSEA 2PWYA 2AR0A 3KPWA 4QPPA 1R18A 3DUWA 2GH1A 3R24A 4U7TB 4DZRA 2ZBRA 3DMFA 5DM0A 2XVMA 4RTRA 3FTEA 1NBIA 4O29A 4PYNA 5DM2A 5T6BA 3JWJA 3FZGA 4PIMA 2P40A 5CM2Z 2PY6A 1ORIA 4PCLA 1U2ZA 1QYRA 2Y1WA 3BXOA 5FQNA 5CVEA 2C7QA 5K05A 2IBTA 2NP6A 1XVAA 3KPVA 3MGGA 4FS8A 3WSTA 5G02A 1DUSA 5DXJA 1WS6A 2OBFA 1F38A 2ZW9A 3I53A 5FCDA 3C6MA 3OU2A 4NECA 3TRKA 3MTIA 2PKWA 3P9NA 1O9HA 2DPMA 2P8JA 4GUAA 1XTPA 5EMLA 2O07A 2PXCA 4MWZA 4QTTB 3TPZA 7MHTA 3CJQA 3B3GA 1TW3A 2EFJA 1G6Q1 5DT2A 3U81A 5EVJA 2Z6QA 3NDJA 1N2XA 2OB2A 4AZTA 1NT2A 4E33A 3RW9A 4EQZA 2C7OA 3KR9A 3EMDA 3A7DA 2VDUE 5E1OA 2AOTB 3KQOA 3O7WA 2UYOA 2ZZNA 5FQOA 2HR1A 3EMBA 2YXLA 3LECA 5EOVA 1KP9A 4E2XA 4FT2A 2G8NA 1YFJA 4R05A 1N7JA 1X19A 3BGDA 2PSSA 1XDZA 2N47A 2YUIA 5K0EA 4P7FA 4M36A 3FUUA 1G8SA 1M6EX 3NWEA 3FTDA 3OU6A 2B2CA 5GM1A 4P7KA 1DCTA 5EZSA 1T43A 2GB4A 5FA8A 4PNEA 2O0LA 2EJTA 5FULA 2HWKA 5HIIA 5LQJA 3P71T 1DL5A 3AY0A 3SGLA 5K0LA 5F2OA 3TFWA 4RTSA 5K0GA 5EKXA 3CCFA 1G8AA 4FZVA 2PBFA 2B78A 1IM8A 4FSXA 2ESRA 4MHTA 1FP1D 3GGDA 3DLIA 3PLAE 1SQFA 3I5UA 4V0QA 3DXYA 2P3OA 1V39A 4X60A 1VPTA 2EX4A 3OZRA 4FP9A 1AV6A 2PX4A 2UYQA 3KQTA 4Y30A 4EKGA 5ICFA 1JTFA 2I62A 5FWAA 1L3IA 3CJRA 1Q0SA 3OE5A 4JXJA 3FTFA 1EIZA 2QE6A 3LKZA 4HH4A 3OCJA 3KPYA 4IKPA 3MHTA 2IGTA 1VQ1A 3T7RA 2ERCA 2H1RA 4DQ0A 3HA3A 2ZFUA 5T64A 2I7CA 4DF3A 1NV9A 5CD1A 3EVFA 2LD4A 2NP7A 3T7TA 3BT7A 5EPEA 2UZ4A 2I6GA 1SQGA 2IP2A 3G5TA 3F4KA 4KRGA 3HTXA 1QAOA 4QVGA 4RVFA 4WXHA 3FPJA 2ZZMA 3UA4A 2G71A 2OY0A 2WA2A 5DRYA 5DXAA 4E70A 3OZTA 2YR0A 3GIWA 3P2EA 5HFJA 5CIYA 3ER9A 1XDSA 3LL7A 5GP1A 3DMHA 3THRA 2GLUA 3KR1A 4AZSA 1UIRA 4EVIA 3G7UA 2AVNA 2PLWA 4MQ4A 5K0JA 2OZVA 2C7PA 3BKXA 3OU7A 3GCZA 4RTMA 4OBXA 3B7PA 1YZ3A 3LCUA 1RI5A 2QY6A 3R3HA 5CVUA 5EIWA 4BLUA 3IEIA 3LGAA 3HVHA 1X1AA 5DM4A 5FWDA 3C3YA 5T67A 3AWIA 5BXYA 5E8JA 3Q87B 3GRRA 5DTQA 1SUSA 2FYTA 1UFKA 3EGEA 3GRYA 2QRVB 2VDVE 2EG5A 3FRHA 3P9IA 3UBTA 1R00A 1AQJA 2O05A 3ID6C 5DTRA 3UJDA 3KHKA 4GOND 5K03A 1B42A 1ZGAA 1L3CA 2AS0A 4E32A 2ZTHA 4XUCA 4EKIA 4A6EA 4YUXA 3CVOA 5CCBA 2ZBQA 2BZGA 3V8VA 5E2BA 1WZNA 2JJQA 1NBHA 2G70A 3OE4A 5EC8A 3FTCA 4C4AA 4HC4A 5FHRA 5K0NA 3C3PA 1FPQA 1QANA 1X1DA 4DM3A 1JSZA 1VL5A 1SUIA 3P97A 4KVZA 3LCVB 4Z2YA 2ZIEA 3M6UA 3LHDA 4AZVA 3EVDA 1F3LA 1P1CA 1PRYA 4ZTBA 3REOA 3HP7A 4OQDA 3B3FA 4QQKA 1NW8A 3EVEA 1ZKDA 3UJ7A 4E2ZA 3RIEA 2B25A 1ZQ9A 4OQEA 3NW9A 3TOSA 3HVIA 2ZIFA 2ONZA 5E8RA 3EEOA 5CVVA 5DX1A 2IBSA 4RWZA 3HCEA 3LDGA 1KPIA 3M33A 4K6MA 3FYDA 4OBWA 3O31A 3I9FA 5FUBA 3DOUA 3UJCA
chains in the Genus database with same CATH superfamily
1PYDA 3LYHA 1WD5A 3D64A 5IC6A 4F4UA 2WTUA 3I42A 4FJ2A 3UK7A 1JPJA 3DPSA 1QHHB 1XVUA 4PSDA 3AF1A 4QDXA 4ZV4A 5CBKA 4C0XA 4DUGD 1PN3A 4NARA 1OBCA 1DJPA 2ZOSA 4WINA 1HNWB 1UJ2A 3LP6A 5K20A 4RZ2A 4DTCA 1KMIY 1VSTA 4QM6A 1LKZA 4EFKA 1JLLA 5T41A 4PX9A 1BE0A 3VYWA 2IW3A 1CF4A 1JFTA 1M0SA 2V45A 3R3ZA 4RADA 2WP8J 4RL6A 5EQDA 5J5CA 1PJSA 3TLEA 2RHOA 2QTNA 1GKLA 2Y77A 3QE3A 4PPFA 4TS1A 4QFBA 3R8CA 5CT9A 3QVOA 1RAIA 4QT0A 5IWAB 4ZTZB 3MYRA 4YAWA 2MMGA 2FG6C 3GP5A 4R1OA 4P4TA 1HNZB 5COAA 8AT1A 1DKPA 3CZAA 3ESQA 2QRVA 1HT1E 4IF6A 1OJLA 1ZU5A 2D0PB 1KEUA 4UVEA 2TMYA 4C0WA 3EGCA 4PSAA 3SXJA 1MXHA 3ORSA 5G0TA 2PX3A 4C78A 4YHBA 1TD1A 1WNTA 3WIBA 3R4VA 1LDEA 1NVGA 1E60A 1SHJA 3RS4A 3WIVA 3HJUA 1TEXA 2KYRA 4IDHA 4U63A 5DX8A 5LR6A 4HN2A 4JHXA 4RA6B 4QPJC 4XJXA 1SIBE 4TROA 4YAOA 3U3MA 2VNSA 5K09A 2GTHA 4ARCA 2ZVPX 5JFOA 1P7PA 2P3LA 1PT9A 3IOYA 4EZEA 5ILQA 1GQSA 4OQ4A 3V8NA 4PPYA 3WGMA 1U6IA 3IIMA 4JJAA 1GGNA 2OO5A 1T2EA 2YTZA 2GFIA 3OQVA 2YHBA 3DVSX 4ID3A 1GILA 3LY7A 1M74A 3ZQ4A 4D3SA 5CB0A 2FWBA 3A2KA 2M2IA 3AHIA 4R8SA 1SKBA 4E30A 5K8CA 4URWR 5FIUA 3BFPA 4KQFA 4IHJF 1FUEA 4B0OA 5I45A 4L28A 3W7BA 5J23A 3OVMA 1LBTA 1KPGA 2A30A 3R0ZA 2WWIA 1ONNA 1AQ6A 1GPLA 1NQXA 2H18A 1YS9A 1QV7A 4UBNA 2NXJA 1E3DA 5EMMA 3UY4A 5COBA 4EARA 4CETA 1J00A 1XUOA 1TAHA 1TLLA 1NN5A 2CMHA 2DSTA 4XM0A 2CCJA 2DJ5A 2CEKA 2ZBPA 2C99A 4WLNA 5EIBC 4ZVOA 1N5OX 2K87A 4FFVA 5JTUA 2WTMA 1JDBC 2FE4A 5DWQA 1A8HA 5FUWA 4WNIA 4AB1A 2C96A 4C43A 1T6YA 1ZXXA 4GHWA 1BVYF 5DB4A 4A8TA 4CR8A 3LFTA 1Z34A 3OICA 1TJNA 2PXXA 2GETA 4G0NA 3ADDA 1D4ZA 2GHTA 2XWPA 1H3FA 3V32A 4BLWA 5LLTA 1QQ6A 2JLYA 4IXTA 3VPAA 4EFLA 1QTNA 2Q6LA 1NVKA 2O23A 1C7RA 2WU3A 2JK0A 2GK4A 1XD9A 4ZHQA 4WUVA 3UB4A 3FD8A 2QL9A 3DVLA 4YQZA 3TSWA 4YQEA 1XOIA 2ZYGA 3UMCA 4ER6A 1G8GA 2J30A 3ESRA 3TECE 2QSJA 4Y2QA 2LR0A 1T2DA 1VLHA 2O7RA 4A0RA 4YCMA 1JEOA 2P4EA 3GJ7A 2J3HA 3HLYA 4NYIQ 3LQQA 4U3JB 2F1IA 1R9GA 1Q12A 1LK7A 3UOGA 4GOOD 2YWHA 4HD8A 3F3MA 3NHMA 3K1AA 4K7JA 5THKA 2VTBB 5DYGA 4WESB 1YRBA 3KC2A 1KY4A 3UKJA 4BB6A 3EIOA 4DIFA 4HHEA 2R751 3RHZA 3OPYA 1G8JA 1SXGA 3UATA 1KBQA 2DMRA 3V5NA 1V25A 1DC6A 3KKOA 5EMNA 5K8TA 3FPHA 5D5PA 1V7CA 2XI4A 3PX3A 1FLNA 5D84A 2B3TA 5P21A 2C2XA 5FAXA 4IJMA 2QU7A 4ODIA 5EIFA 2DPHA 2P4SA 3GT0A 3EGWA 4MHOA 4Q4CA 2O59A 3KXDA 2LRHA 4TN1A 3FJ1A 3P4YA 4KDFA 2DTXA 1AHNA 4RH1A 4D9GA 4FI3C 4YCNA 4UFNA 1F60A 3PGXA 1OBVA 4JXKA 1GADO 1D2CA 2B21A 2OXFA 5ESRA 4RU1A 2ZWVA 3ETHA 3STVA 2FPIB 3QBJA 4R40A 3SKVA 4C3OB 3Q1LA 5T3YA 2XDQB 3JWIA 4MW2A 4D42A 5CDUA 3HKDA 3LG2A 4R9RA 4YJKA 4KE7A 4KDCA 5L6MB 2OXTA 2GBCA 2JLSA 2V7BA 5A0FA 1FF9A 2JLRA 5JWHA 3PYLA 4JL5A 5FNVA 4D8VA 1AD2A 3FAZA 3DWFA 2EARA 2AR7A 3LS2A 4EYQA 3BF8A 4R4JA 2IP4A 3PT9A 5LD2B 1GV0A 3Q15C 4UUOA 5HQJA 2EW2A 3O8QA 3RYCA 1XMOB 3EIHA 1K7CA 2DBZA 3LE8A 4PG7A 2ZZNA 1HRKA 1KS2A 4LJRA 2NXCA 3AR5A 1HMYA 4MJLA 3GG9A 1DRKA 1BS1A 2VEDA 4LTDA 2HAEA 2PKQP 5BQOA 3UWOA 4KO3S 4JC8A 3PX2A 2OWDA 3SC4A 5A3QA 3HXMA 2AH5A 1XXLA 3CNNA 4TZKA 1B6TA 3K0AA 5FRDA 2WWTA 3GZTB 3GRCA 4FWIB 1F2UA 1L7XA 1WCV1 4CF7A 4M4SA 1YS1X 3EXHC 2BGNA 3K16A 2J31A 2X8JA 1N2OA 3NOXA 3PC8A 4L6IA 4HTAA 1NPDA 3T5DA 3UJ9A 3DOIA 4BRZA 4XB6B 4HSEA 1GL6A 5AKGA 5BR7A 3SF0A 4ZJYA 2J0EA 4RFVA 3B3JA 1W5BA 2PVSA 3A11A 1E2MA 4NZNA 2VDOB 2G88A 4AY3A 4KN5A 2VJYA 3WHPA 1UT6A 2ORYA 3Q9UA 3L8MA 3R7LA 3JYQA 5FBHA 5EIEA 3T5MA 5KVAA 1NQTA 3DEAA 2C9DA 4ALIA 2R85A 3E3LA 5JARA 1KR2A 4CUZA 2W5UA 4DJDC 4E1BA 4KTTE 4OI1A 1PDVA 3IAM1 4LFCB 4WOKA 3U4QA 1ODIA 1HF3A 1Q14A 1XX6A 2PA3A 1Z88A 2YW2A 4JQYA 3BJEA 3A1WA 3UQZA 1QC5B 2PV7A 2ATIA 1QCCA 5EJ5A 4IUDS 4GNKA 2GN4A 1I13A 1RMYA 1M2EA 2GHRA 3AIKA 5BT9A 5A03A 1ZCBA 1OWNA 2VUTA 4WFKA 3EF3A 5HX7A 1S5PA 1NRXA 1T15A 3AHDA 3EVGA 1V43A 5FNVB 5JNWA 4P5EA 3QBTA 2ZSUA 4QHTA 3QKTA 4EGSA 4BLTA 5A3VA 1GQQA 1ONSA 4M2LA 1BVHA 2PXAA 2XA1A 4JQCA 3ABZA 1XU7A 3FGOA 4RW0A 2ZS7A 4B2IA 1UIMA 2GLTA 4G56A 2IOYA 5LPNA 3BZWA 2B2NA 4HMQA 5AMXA 3AU9A 1ZUHA 1CETA 4RE6A 4M1SA 2OD2A 4GRDA 3EGIA 1AZTA 4CG0A 3OG9A 5HKOA 1THZA 2NPFA 3GN1A 5M2QA 2HJSA 1U8ZA 3CRNA 1XLUA 1C0KA 3OZBA 3T7SA 1GSIA 1XHFA 5JALA 1CDDA 4C21A 1X7YB 4D5GA 3UANA 3GEIA 1FK8A 1H94A 1PS0A 3C4QA 5AM4A 4BNGA 1PR0A 2QD1A 3JX9A 4ISCA 4LJAA 3TOZA 1XCPA 2WAXA 1T8UA 1WDTA 4TXJA 3AVUA 1Z6PA 2X3UA 2V6IA 7REQA 2OYSA 3ZD8A 1BE8A 1DJMA 3E9DA 4WZAB 4CMEA 4PTLA 4IDGA 4WKOA 1UEIA 4CEJA 3A1VA 2DT8A 2PV0A 5DU2A 4JJ7A 1R8YA 4NLLA 5AW5A 2IUUA 3HRKA 4HUQB 5C3UA 3L7AA 4EMUA 4MVJE 3IMGA 3JALB 3ORHA 1FU4A 2BFOA 2P3QA 1QZXA 1YOVB 2YWRA 1DARA 3ABIA 3I0NA 1I2ZA 1E9SA 1HT0A 2XDAA 3MLEA 4UZFA 2UUOA 4GPIB 3C6XA 4G9BA 2B1RA 1B3BA 1JDPA 2NNWB 3IHLA 3C5VA 4KZPA 3ZE1B 1HLPA 4F1WA 3C8DA 1K88A 3GH1A 4ER7A 2EGGA 4HY3A 1KI6B 1Q7RA 1K98A 2CCKA 2XTMA 2B37A 3WMRA 1TZBA 1QIEA 4EG8A 1J9ZA 1JHZA 1NDUA 5A6VA 5IM4A 2F67A 3PDWA 2UU9B 1NW3A 5ICGA 2QTTA 5JISA 1NXQA 3DP7A 2VLIA 4P58A 3QSYA 3KQYA 1UJMA 4JU9A 4OQPA 4EKNB 2C00A 3O83A 4I66A 3BHMA 4DBLC 1QVVA 1X7YA 2DWQA 3K5PA 2PUVA 1KDZA 1VLJA 4N5DA 5DIZA 3BTSA 2UYYA 3O47A 9LDBA 5FAKA 2H29A 4M0UA 4EB8A 3R9WA 1JVSA 1NXOA 1QXSA 1R0WA 1WXXA 4N5LA 3LLSA 3RC1A 2W8ZA 5IYZA 1K6XA 1QKJA 4F6RB 3R24A 3B48A 2F1OA 1TZ2A 2ZRNA 1N9KA 1NBIA 4J90A 4PYNA 4X84A 4NCIA 5BW6B 4D44A 4D8WA 1KI4A 5SZHB 2A35A 3G9ZA 4C88A 1PJ3A 5L3QA 4NQZA 5CG1A 1XVAA 2IBTA 5KOHB 2ZR9A 4TRNA 4V2UA 3O2JA 4LOKA 2NUTA 3R8XA 1E7WA 2OBFA 1QGAA 3CLKA 2IZ1A 5AK4A 2PUDA 5H80A 1D07A 3BXFA 4DW8A 1YU6A 1VTKA 4QYWA 5KJ6A 1R4MA 4BO9A 5LXTA 5IG2A 4YP1A 4ZO6A 1DGQA 3E5NA 1HQCA 1TCAA 1K2VN 3SFVA 4WFQA 4BVLA 3CSDA 4IEFB 1VCMA 3NHLA 4M55A 4ZVRA 5TPZA 1CIJA 4MVJH 1Y4AE 3ZGYA 1N6IA 3A14A 1WEKA 2JDIA 2CVOA 2WPDD 1N2XA 2HSJA 3Q5EA 5DBEX 4ZMBA 1SQ0A 3COWA 1JPVA 2X9GA 3VYVA 3MTGA 3ZEAA 5JSZB 4P7BA 1UODA 1HGXA 2GXQA 5B64A 3IMFA 4R54A 1KFJB 1TM4E 4NCAA 1D04A 2W6QA 1E0DA 1YCFA 1SXIA 3DOFA 1T4GA 4KVAA 1N7JA 5AT1A 5DASA 1B8VA 4NEGA 4B3DA 2TSYB 1AX9A 1NUAA 4RK7A 4CQLA 2ES4A 1D6JA 5E6UA 2EL7A 4FE7A 4CEHB 2DG2A 1T5DX 2C4UA 1DIAA 2QLFA 2QAGC 4ZAFA 3JATB 2BSAA 4EA8A 1UQUA 3W7AA 3EULA 8ATCA 5KWSA 3AUKA 1GZUA 1SBHA 4H77A 4DANA 4EG1A 3NFRA 5HIIA 5LQJA 4ZYXA 1VKNA 3SGLA 4RMHA 5F2OA 3I0ZA 1A9TA 1BD4A 1YO6A 1EB9A 2VP5A 5BSKA 1U3FA 1I7QB 2WKRA 1T13A 2J5XA 4ZKDA 1JKXA 3LW8A 4Y2TA 1ZAYA 3BAZA 1OE0A 1ULUA 4YRJA 4CF3A 1BA3A 1FJGB 4UUMA 1J24A 3G9UA 3BDVA 1SVOA 1AV6A 4EKGA 1RYZA 2IYYA 1C7QA 3Q2KA 3AQ4A 3PJFA 3ZKWA 3UMRA 5K6TA 2WV7A 4WL0A 1YMUA 2WIAA 3H87A 4W5WA 3UV3A 4F9FA 4C2TA 1I80A 2I29A 2QVYX 1NW9B 1D4AA 4FYVA 2CEAA 1KYXA 4EHKA 3WLSA 3JASB 4U1RA 2G83A 1PL7A 2IYQA 2FW7A 4ZQEA 3RWOA 1KH2A 2SECE 1GIAA 3A36A 2B83A 2R8PA 2CV0A 5JW6A 3I32A 3T7TA 4WGFA 3CH4B 4OHWA 5EPEA 3TGPA 3T1YB 3O8OB 3LXRA 1YIDA 1U8FO 4D8YA 1NMXA 1NQWA 2JA2A 2O9JA 4E0BA 1OB5A 1Q1NA 2FFAA 3IAAA 4V0NA 5AJZA 1HYBA 5THQA 5JEDA 4IH9A 4DR3B 4EA9A 4Y0AA 1IPEA 4H7IA 1ZCFA 2IXDA 1N3YA 3AR3A 2HH9A 4PQRA 3G13A 1QF9A 1E5VA 5AUOB 5EJGA 4TV8B 4JBLA 3U16A 4FU0A 3VU9A 2C1ZA 2R68A 2RBEA 1MH1A 1Z16A 2GEBA 1P9WA 1G3QA 2RGWA 2C7PA 3EQ6A 1UOQA 2GSDA 3L7DA 5IDXA 3HU2A 1V8BA 3OX1A 5UKDA 2PLFA 3L92A 4GLFA 4V1CA 4JEUA 1CZUA 5F52A 1JHQA 2C95A 2PMCA 2XA2A 3VAYA 2DPXA 1VA5A 3PQ3A 5BUQA 3K94A 1A8UA 1Z2NX 4FFDA 1STOA 3NAZA 4ZAWA 4L27A 4GXTA 4WBNB 1O0BA 3N6XA 4HGNA 3R7NA 5JRJA 1UZMA 3P9XA 1IHOA 1XTZA 1D7AA 1E6LA 1HSZA 1VKZA 4FDMA 4Q37A 5J4KA 2ZB8A 1PT8A 3I9MA 4Z86A 2JEOA 2ZTHA 5TQ0A 1AZLA 3U4QB 1ZVJA 2IPMA 2W2TA 2DBRA 3LC0A 4F3RA 4XPZA 1V1RB 5CFZA 2O8EA 3WK5A 5HW0A 4HC4A 2P0AA 3TK1A 1QANA 1QZUA 1TCCA 4PHGA 4PQYA 2Y71A 3FNIA 5K8IA 1U1CA 4N41A 5HS4A 4ZOLF 2OAP1 3G0DA 4RLHA 1J8QA 3AKYA 5CNJA 1NM5C 2BBTA 2QY9A 4YR9A 3H5IA 4CFSA 5D5QA 5A5FA 2DUWA 2IE0A 3IEVA 1RPAA 4Z53A 3ECSA 1RWKA 4L9WA 5DX1A 5K6RA 3IE0A 5KQGA 4OB8A 3U80A 4DQKA 3FKSD 1FUIA 2WF8A 3WAGA 4GZLA 5TPWA 1XTJA 3F96A 3MLBA 4O08A 1QM5A 2OCIA 4XUGB 4U8GA 3TNFA 4DEXA 2XA9A 2Y1EA 2VPPA 3ESBA 1MP0A 1RJDA 3OTWA 2WFZA 5ABPA 1N78A 4UHBA 3ZE7A 1ZISA 3KKEA 4W6QA 4V03A 3MJHA 1DZ3A 2CXOA 2VRCA 4Z9BA 4ZZ1A 4LFAB 1Y3BE 2I6UA 4I19A 3GL9A 3OJ0A 5BR1A 5K6AC 4C07A 3DLCA 1EUYA 2G4VA 3EYWA 4CG3A 5BQ5A 5DJ5A 3G2MA 5E7MA 1U63A 4TOIA 1Y5NA 4L50A 2C9CA 2YVKA 2O7VA 1AS2A 4N7RA 2XOXA 1Q50A 1DV2A 1QC5A 4L1KA 1MFPA 3I1JA 3UH0A 2W4QA 4M1KA 4A9AA 1YQ9A 1F17A 5IVHA 1JFLA 5AW2A 1GNQA 1Z13A 3FMIA 3L1UA 3OFSA 3GPBA 3CR7A 1X1TA 2W4MA 3LY5A 2LCFA 3EIXA 3QKWA 3WB1A 5FH9A 4RV5A 4YLGA 2RGNC 4CIBA 1PFQA 4H3HB 3PEYA 4C06A 1XWWA 4NNOA 3I3OA 4RTKA 10MHA 1G5IA 1PJAA 1QHHA 2QN1A 4LYFA 1SC4A 3KTDA 4EZIA 1DX4A 2CHEA 3AV0B 5AI8A 3KNZA 4NJEA 1U2DC 3THOA 1DIGA 2ZJFA 3QLVC 1F0PA 1JQEA 2RGEA 1LA2A 2QI9C 4UBJA 4ZQCB 5FBLB 1RVDA 2JHFA 2OYRA 3KKPA 5K8LA 5WRFA 1USWA 3BE8A 2VZ0A 3PFGA 1VBKA 1K7EB 5D1HA 1TC1A 2OZEA 4PR0A 2VRBA 5G3ZA 1BYIA 4QYTA 4ZVQA 4AYWA 3VNRA 2VCHA 1JH9A 3DD5A 4G2TA 1P75A 1JBQA 2A0YA 1XTRA 2LPMA 3WBBA 1Z5OA 3T1TA 1ZYUA 3RAFC 5M04A 4K0KB 3PICA 2E55A 4CMEC 3M70A 2XTAA 4KQHA 3OJOA 2AR9A 2HV9A 2RHTA 3DZFA 4JKYA 3R9IA 3OPXA 2AE1A 1SBZA 5LUBA 1Z68A 1ZRSA 3BULA 5EWMB 5BV0A 3THWA 2I6TA 3JQ6A 5I7HA 2RGXA 1XZDA 2HSZA 3WGHA 3C1UA 1Z5NA 4W63A 4WOBA 2JJ2A 5C18A 2CVPA 2OILA 4ZVUA 4EGCB 4ES6A 1N77A 4CR7A 2CHUA 4CXMA 4GYJA 5LFAA 1N9GB 2E85A 4ESVA 4RXTA 4MKRA 4XXHA 2BH9A 4AJPA 3VBCA 1WJGA 4YA6A 1Z2EA 5FPYA 3UB3A 4EENA 3AUAA 1NG9A 3L7NA 1WXDA 4MYCA 2PKYX 3AFGA 3FNHA 4GGOA 3PEWA 3E5RA 3ADCA 2A14A 3KQUA 2ECOA 2FMUA 4LCBA 3GLGE 4H6VA 5L6LB 3A2MA 3VR4A 2AOVA 3HJGA 3QEAZ 3GGPA 3CURA 1GSOA 1SC6A 3I28A 1NSFA 4N03A 2FN9A 3DL0A 1P4RA 2CDBA 1YQGA 4BHTA 1YRHA 2H2GA 2WOJA 1CRZA 4IXDA 1C0LA 3SKYA 3DE2X 1N2CB 2XUDA 3GUHA 2EGUA 5DHQA 1UJBA 1Q7EA 1L6RA 1UZAA 3HC7A 3S40A 4YH1A 1M2OA 5JVDF 4ZOLA 1G60A 2ONCA 4LYDA 3C7CB 5DN6D 2FEPA 4B32A 2ODEA 4DLPA 4X71A 2YJ4A 3F2IA 4UNPA 2FP3A 4ECAA 2JJ2D 1SCNE 2Q4OA 3D81A 1PGNA 4FGLA 4PLYA 4Z8YA 4W9NC 3X1KA 2R1TB 5LZ4A 1YQQA 2ZBVA 5KKCA 1ODKA 4LDPA 4LHYA 4JJ6A 1KU6A 1OH5A 1C5KA 5SYAA 1MZVA 2UUPA 2BMWA 3SC3A 3UA3A 4DRZA 4P4LA 2E5WA 5DDIP 3KKQA 2ZXEA 2BMFA 3CR8A 2QW1A 5LLSA 1PVVA 3OJWA 3OZCA 1XGKA 3ITKA 1G8YA 1BCSA 3OCUA 3EF0A 1BRTA 4AZ0A 3NVKI 4EMBA 2O4CA 5BP7A 3GC6A 4MS1A 2DY0A 3NDRA 3TRDA 3UYLA 3TW8B 1ST3A 4UD6A 7ADHA 8MHTA 3UGKA 2H1WA 3HJHA 3HR4A 3OOJA 1N9GA 4FILA 4IJ5A 2WPNA 1EK1A 4Q93A 4UAGA 3S29A 5GM2A 5BV2P 4RACA 5JXWA 1E1NA 1FLVA 3OZIA 1DJNA 3KAKA 4G1MB 3FXAA 4JBGA 2ZSIA 2I3BA 2WG0A 2QVGA 3QTLA 3THWB 4KPGA 3T9DA 2GPSA 3B6KA 5BN3B 1O5TA 3TW6A 2PA0A 3BAFA 3MB5A 1UPXA 5GIPE 3BRWA 1JF8A 4H0NA 1G291 3T3MB 3D7MA 4CKBB 1MV5A 4N4AA 3NM4A 1CPYA 2Y0CA 5I7SA 4JC4A 5M7EA 2AB0A 3V3TA 2CLEB 1PUXA 5GAJA 2VQDA 2WW8A 4IM7A 3RUFA 3TM5A 2C07A 1A04A 2Y76A 3WKEA 4YRDA 1DTSA 1WB9A 3CE9A 1AKYA 1THMA 3LRPA 4KQMA 4RVDA 2NZUG 2NSLA 3L1VA 4DR5B 4EFMA 5JXHA 3C5WP 3G2QA 5L4NA 1J1UA 3C5HA 3PC4A 2ZE7A 4D6YA 4DDKA 4D4IA 3CT6A 3VRHA 3OLQA 4TYYA 2B1GA 2AOUA 2OFWA 4ZT2A 4X7RA 5G40A 5AVUA 2B69A 4HH0A 2ZSBA 3DSRA 2OCPA 4AWBA 4WIAA 5AKXA 3K0EA 3A9VA 1YDWA 1P74A 3TI7A 4LF6B 1YB2A 5FBKA 3S2SA 3IQEA 3DL7A 4IVQA 3TW0A 1E9BA 3LV8A 5BWCA 5I7VA 1L4FA 1XMIA 1X8XA 2W42A 3TJMA 5HKAA 1V9CA 2I67A 3B12A 3O7MA 1D6NA 3NP7A 3GPDG 6Q21A 2ZPUA 3OLXA 2IZ7A 5E6RB 3VX4A 5JRZA 1XZAA 4AJ4A 5LYJB 4HVAA 3EVAA 1NPYA 3LY8A 3QKSB 4BQFA 3DS8A 5BQXA 3NHPA 2QXYA 3K9BA 1I4OA 1KI9A 1WDWB 3AP1A 3GA5A 4N3BA 1FY2A 4BNZA 2OAQ1 5BV1A 1TO2E 4LRQA 4XJTA 4WNYA 3BE6A 5JVDB 1B26A 4JVOA 5HVNA 4H4DA 3RYTC 3HCNA 1ZCAA 3D2BA 1ZL2A 4BIMA 4ZAXA 2D06A 1M54A 1ZM9A 2UVPB 4MR7A 1EP1B 1V3TA 5JD6A 2JIDA 2YZNA 1C50A 3PT5A 3RD5A 4BVAA 3KQVA 4GKBA 1AKUA 4RENA 1Y80A 1JDUA 3IJPA 1EZ1A 1G64A 2C98A 3IAEA 2CFOA 4CTKA 2BDTA 3INYA 2WAAA 5FYQA 1SZPA 1O4VA 1EFKA 3DR5A 3WOHA 2PYZA 3PD0A 3ZHOA 1C9MA 4Q9AA 5CP8A 2EG9A 2MIIA 3AHGA 4IAOA 4PZ0A 4W8HA 2J9ZB 5DGXA 5FB3A 3IQHX 1BN7A 4DV1B 2DTDA 4R68A 2CNWA 2JJMA 2IPNA 4OUDA 3CVJA 1U98A 4Q16A 1N7IA 2PWPA 3RYFA 3TDKA 2FCRA 2LUOA 1H85A 2W8BA 5AW0A 5L7TA 3ZHVA 5A02A 3CA8A 1TYEB 5DSXA 2RJNA 2R97A 3L5KA 3M6LA 4K87A 4L0QA 3RRFA 4BO8A 4ESHA 5BMVA 3HCWA 3WWZA 1C3VA 3RTAA 1KO5A 1AKVA 3I01M 4LX0A 2X1MA 1UMCA 2AYYA 4QYMA 2XNCA 4DPMA 2A9JA 1YMVA 2A6PA 4CMAA 4W9MC 4JLNA 4DNXA 3AF3A 2XJ9A 4F2GA 4D3ZA 3PHCA 3KJIA 2VPIA 2J3KA 2D7JA 1U0OC 2WF7A 3HY3A 3KPUA 3CO5A 3LQ4A 4W9RA 1N32B 1P33A 5HE9A 1QX3A 3ZHXA 1E2BA 1I4LD 3DQQA 1F6WA 1QV9A 1YB1A 1R5NA 1P6XA 4K86A 2IITA 1GVHA 5MF6A 1O96A 3AEZA 2CBGA 3ER6A 4KR7A 2WNIA 4DBZA 3ZYZA 3GLFB 1E0SA 2HJWA 4RABA 3LXUX 1WCIB 1IJFA 3EEBA 4HPJB 3A32A 4CT4B 1K08A 4CM4A 4KUEA 4HZUA 3K72B 4PONA 4FQ7A 3N0TA 2P4UA 3SHOA 3AI1A 3RSGA 1UM9B 1EJBA 3BXXA 1MX9A 3HKBA 2FX5A 1G7SA 1W2HA 1YS4A 5EQJB 3ZXYA 1GR1A 2EQAA 1P1FA 1HG1A 4PC1A 3H5AA 1ISSA 5ER6A 4G5FA 3SVTA 3LLCA 2GH1A 4FX5A 5F33A 3VJKA 1OGYA 5DHFA 4D0RA 4UVDA 5T6BA 4MW5A 2L19A 3ICQB 4JYZA 1ORIA 3RLIA 4JLDA 4S2UA 1U6KA 4JP3A 1XZBA 4UQPA 2PL5A 5CH3A 2R8OA 5TE9A 4CM6A 1G3UA 2XMQA 4J7CA 4I5IA 3KB8A 1I2CA 5CB4A 3R5FA 1NXTA 1E0KA 1W47A 1Z73A 2E5FA 3QUSA 2O48X 3WDKA 3PL1A 5DNYB 1EWVA 4NBWA 4L3WA 5KQMA 1L7NA 3AHCA 2BTQA 4TQGA 1X7GA 4XX0B 3MCWA 4OHFA 1ZD3A 2QN7A 3RKRA 3ZVLA 4BQSA 2NUPA 5JWRA 4OXKA 3T52A 5L53A 3G7NA 2X7XA 3TLXA 1G6Q1 4IGKA 2P6RA 3P0IA 1C0IA 5FEMA 1KORA 3OQNA 3V4RA 2W83A 1TPZA 3B3QA 1G4UR 1VI2A 3WGTA 1J0BA 3KR9A 2BFDB 3LPLA 4GM0A 2EGHA 4FYHA 3T4PA 3EXFB 3NBYC 2GUWA 3QY0A 4BX8A 3RJ5A 4Q9DA 1QP7A 1OU4A 1QFSA 4MEJA 1FNCA 3MG9A 1KP9A 2CV2A 1VPLA 4E2XA 4Q1EA 4TTSA 4CQNA 5LKAA 4H0CA 1OI7A 4DUPA 3B1JA 2BEWB 1WZIA 4GGMX 3MPUA 2YHAA 5CPBA 2A0WA 2VCYA 5T4BA 3T61A 3N07A 3FUUA 3SIPA 4LF7B 3FTDA 1HDOA 3L0DA 3OF2A 4M49A 1CQIA 4AURA 5FL7D 3LT4A 2L2QA 5CFMA 3IMKA 4EMTA 5DNAA 1XPUA 2P30A 2RC6A 5FULA 4C87A 4LNUB 4F72A 2VR1A 3STWA 5JH7F 3EPLA 1SXJC 2QG9A 3FVWA 1X94A 3R5SA 1Z8DA 1ENZA 2GMWA 3K0CA 5EKXA 2DQ4A 4IHKA 1DADA 4TRJA 2DKNA 3ZY5A 3QG5A 2RE8A 1IM8A 2J7KA 2REQB 3FX2A 3QF4B 1I6WA 1QSGA 1QHXA 1M6VA 2TYSB 1QWOA 3QQPA 2DR3A 1CSEE 3WGYA 3EH1A 3D43A 3B9QA 3VDXA 3WQRA 4XFJA 1S9HA 1U7TA 1GZ6A 1DP4A 2NU9A 3KQTA 3MWLA 4BN0A 4RA9B 3K32A 3ZY4A 5KQLA 4E4YA 2WYIA 1J8FA 1YKGA 4UTNA 4YP0A 5F98A 2FQYA 3OJFA 1E4OA 1MG0A 1XPOA 2LDBA 4MQUA 4E14A 5AI0A 1OCEA 1VB5A 3T95A 4ZICA 3F9CA 4RULA 1VQ1A 3T12A 1M5TA 4J1NA 3LTNC 2H7XA 2V9CA 4XEUA 1KNQA 4EO7A 3A4MA 3CNEA 2OHXA 4ARUA 5K3CA 3R6LA 3HBFA 5K2MA 3K53A 1K8QA 3BWEA 4LYAA 1ORDA 4DMFA 4QU8A 2I6GA 1SQGA 1TJ3A 3GLGA 1WTCA 1L5OA 1XI2A 3HYLA 4DM7A 3IP7A 4A2CA 1UDWA 3GNSA 3UA4A 4CG1A 1PP4A 3LVRE 4I9FA 1EUDA 4II2A 1M2NA 2QLNA 3L0PA 3VKUA 4UTVA 2GLXA 3H4VA 3CRRA 3QUTA 3LDHA 4BV8A 2HT6A 2VK2A 1BVRA 5AOCA 2R65A 1D2AA 2VYFA 4KRFA 4PPNA 3R4CA 4LHWA 3HCOA 1SHLA 4KN9S 4LXHA 3QLUA 2BMAA 2UVDA 1M1NA 1HK7A 1TE2A 1CUCA 4CMIA 4Z4QA 1EWTA 4GO1A 3UN1A 2ZYVX 3TEMA 5IWCA 2O19A 2YMLA 2AJLI 3KOZA 2WZBA 2Q29A 3QFTA 4IS2A 3A1NA 4RO0A 3C3YA 3VR4H 2EZ4A 3A70A 2QBYA 2OK8A 3GRRA 2QUAA 4CR6A 1T9GR 1VJ1A 2FYTA 1SUSA 1XLTC 2BHTA 3JQFC 2C5HA 4FKMA 1QGYA 5D3QA 4UJ3A 3P9IA 1KI3A 1R00A 4OHBA 2O05A 3WFJA 1GAWA 3FA2A 2QQGA 2F2TA 4B6FA 1JJ7A 1L3CA 3A6HA 3RRZA 4I1VA 1MC4A 1CEEA 1KJ9A 3G7SA 1DAEA 3B20A 3FG9A 3H3XA 5CDGA 3A1SA 3P9QA 4RVSA 4A8HA 4BNYA 4B85A 4IIYA 4TSKA 3RVMA 1CY2A 5JJLA 1TUGA 3CNHA 3NOOA 1L5QA 3QU5A 1U5AA 1OX5A 3RM3A 2IIVA 5C4MA 2OZKA 3N0RA 2CFRA 2H59A 5KSOA 4LVCA 4QQKA 4U7JA 4WXEA 5DCYA 3E9RA 4HH1A 4A3SA 4C4RA 3O8BA 2OV4A 1ZZGA 3PC8C 4JP1A 3UJ7A 1KEPA 2YV1A 1E63A 5A4KA 2NU9B 3UWMA 4GZMA 1R12A 2M98A 3TD6A 1IZ8A 1TI7A 2FOXA 1RCFA 2GTPA 2O2YA 1PL6A 1XCMA 3AV3A 3EC7A 5F5LA 4L9AA 4BO7A 4NX2A 3TR0A 4UTPA 3Q41A 1WVGA 2OV2A 2VZ9A 5AK5A 5IJ9A 1M6YA 1VGVA 3N0XA 1ZIOA 2N42A 5C37A 4FC6A 3GJ0A 2I54A 4LGCA 3DBHB 1MD9A 4W99A 4HVLA 1RZRA 4BMCA 1T2AA 2H5IA 2P75A 3TZLA 3P2JA 3SF8A 3NVDA 1Z22A 2Q4EA 8GPBA 3PRYA 3AUXA 4QXMA 3WS7A 2XB4A 3MT8A 4PO1A 1T4CB 3VYTB 2C5BA 1JAHA 2K7ZA 3VU8A 2FSPA 2NVBA 3RC3A 4FFBB 5CW1A 2J87A 3GLHE 3S27A 2FPOA 3H42B 2EZTA 4K6CA 4O3FA 1SKYE 2W6IA 4P1ZA 1V5FA 4G41A 3ZE9A 2GN2A 1ONBA 4B3BA 5JNTA 4PGAA 1JHOA 1RYHA 4FGJA 1PKXA 1KJYA 4MAMA 4CIYA 1L4LA 4DB2A 3ICCA 4JBYA 1MQ9A 4W5JA 4X62B 1QU2A 3GF4A 3DFUA 4N47A 1GUAA 1D0IA 3C4JA 2PUAA 1K5HA 3FSGA 3QRWA 4ZYLA 1GFSA 3O3CA 4J6EA 1LC0A 3AJDA 3CX4A 1LI5A 4EG5A 1US8B 5ALDA 1N36B 2RKWA 3H7AA 4BO5A 4HO1X 4JVLA 4DYVA 4HFMA 5JHHB 3OTQA 2UDPA 3AFMA 2G9UA 4RIFA 4UBMA 3PRKE 3GRUA 3DBRB 4X90A 5D01A 5C4GB 2IXGA 3GNLA 4QDOA 2NN3C 3KLBA 1COZA 1FTGA 3HGMA 2ZWMA 1NBMD 2PZBA 4Q4HB 1HL7A 2YFHA 1DAHA 3L0SA 4OHZA 5JXGA 4ENTA 3R20A 3DNFA 1SD5A 1MB3A 1RXYA 2PFGA 1E98A 2L17A 2GM9A 2PFKA 3N7TA 4RVCA 4WZZA 2UVPA 4MR7B 1OW3B 1Y7PA 2IYEA 2A9QA 2HHAA 4K81B 2C2BA 2RK3A 2QXTA 4TV9B 1XHLA 3OQHA 2IXEA 3VAAA 3AHEA 1AJEA 2D2XA 4WQMA 1YJQA 4B74A 4RA9A 2AOXA 1F12A 4XZ3A 4HB3A 2OV3A 1HA3A 4WK0B 3UAXA 5ICSA 5IRCD 1QRAA 1AO3A 4TWAA 4GRIA 3CUWA 1OXXK 2JLQA 3KB6A 4NHOA 4X3CA 3G8DA 2YHIA 2Q3EA 3FRIA 4Q1VA 1CJSA 4MQ6A 5J1TB 3TL3A 2ZBGA 1K66A 1JSLA 3G88A 3AIIA 1W96A 5KINB 4C6RA 1KU0A 2JGJA 4KMSA 4BDTA 4Z4HA 3FF1A 3GG2A 4AS3A 4N3GA 3KQNA 3ZR4B 2IQIA 3JTEA 4WECA 2WJPA 1UBMS 5FFMA 5LQRA 3SZUA 1C8LA 1EEHA 2PL9A 1EK0A 1QWSA 2X2OA 4OJNA 1WY7A 4P4NA 3FI0A 4BFXA 1DAKA 4E7OA 2IHZA 1HZJA 4RANA 4AY2A 4MICA 1DMRA 1F4VA 2OE2A 2LZ0A 5DBFA 4EKYA 3SJCA 9MHTA 2BUCA 3DPIA 4KWEA 1TXGA 4BYGA 1A9XA 2XV1A 1DFGA 1RKXA 1NT4A 3A9RA 4EHAA 1UDCA 3GRVA 1RJWA 2KM1A 1ISPA 4QNMA 1GPDG 1JU9A 1UBOS 2A9PA 4RSRA 4FOSA 3LT1A 3U5TA 2ODNA 2ZB2A 3ML1A 3RSQA 4ETMA 1U5BB 1UXOA 3C97A 3IYLW 3CW9A 2DCUA 4ZVLA 1SG9A 2PMWB 2VQSA 4OXXA 1BHSA 2PAFA 2GYWA 4N48A 4L8YA 4A73A 4CKEA 1GA1A 1BX3A 3TKAA 4ZPXA 4PWZA 3K5WA 3HB5X 5EWLA 1FSGA 3SX2A 1U0JA 2KW5A 4MV0A 4S1OA 2Q6IA 1UBCA 3WYAA 4QLOA 4CM5A 5JDCA 1J9EA 3WYFA 2H9IA 1JEJA 4CT5A 1RPJA 1U3DA 5I7AA 3RS5A 4CCAA 1XJ0A 2CY0A 4MGEA 3ZLBA 4R1TA 2VC2B 3BIOA 3CT4A 3ZUGA 2ZWPA 1CJCA 5C80A 1NGSA 3SMQA 1NY5A 4UHEA 4D5EA 2N9UA 3BIJA 2V5UA 4EF6A 4F12A 1UC8A 5CNKA 4AD8A 4ZI2A 1M0EA 1KVSA 3VYSB 2WG1A 4CQMB 1II8A 1W34A 3WDSA 1FX0A 5HJ5A 3AF6A 5BORA 2G3YA 2JZCA 5MDHA 1V5GA 3F7NA 1EJ0A 1PGQA 3ELBA 3QBEA 4QLBA 5HIKA 4KGXA 4X54A 3MIIA 2C5AA 4X44A 4P35A 4DNOA 2O5CA 2CDNA 3F73A 4XLZA 2WB4A 1YJAA 1YQTA 2ACVA 4FR0A 1USKA 1RMQA 4M37A 1INLA 5KJFA 1KGSA 2PH5A 4CVNA 4Q3LA 3E0XA 3F8TA 3OQIA 2BP7B 3VPCA 3HN6A 3L82B 4OYYA 4BO2A 1SRRA 3F6PA 4GBGA 1T9HA 3BHIA 1N3IA 3U44B 2CNKA 5BPFA 2VPYA 3H04A 3SS8A 2YZKA 3IMEA 3KU1A 3EWNA 5B58T 3ZGLA 1RWNA 4IV0A 4ND8B 2IOFA 3CV3A 4K9QA 3QP9A 1SD2A 1U11A 1X3SA 1CG6A 1YI0A 2X0EA 4CZ2A 4ZCTA 5A5EA 1J42A 2HF2A 2C94A 3D7LA 1KDTA 3RKUA 1LPPA 4R69A 1O08A 4BJ3A 1MTOA 4POAA 4JUBA 3DHVA 4H4CA 1H0SA 3TUZC 4EHLA 5EHZA 2MYNA 2VPZA 3QELA 2XMPA 1P1JA 3TBKA 1OC4A 3GLHA 2H31A 3S2UA 1Z5ZA 1QAMA 4FINA 3Q72A 1LI7A 1YDMA 1GJRA 4LVUA 5TDHA 2XT9A 1E1MA 2PMBA 1C4KA 4OL9A 3WLPA 1YFLA 1ULHA 2UKDA 3MTDA 4IS3A 1NPTO 1FLAA 3BL6A 1FYEA 3DFZA 1HNNA 4P08A 4F04A 5DYTA 5MHTA 3AJAA 4W7HA 1X15A 5T4HA 2B36A 2G1JA 1IJEA 2V65A 2HUNA 4UW9A 3A1UA 3X2FA 4EW6A 1K5DA 1C9YA 2GSWA 1Q95A 3DMGA 3EG5A 3V2UA 2A0XA 4FNOA 5IJWA 1G0NA 1TIBA 1UWKA 2MSCB 3PPIA 4P3YA 1ECJA 2PKEA 5AJUA 2WDPA 3G0OA 1E1DA 2VSXA 4B5KA 4BBJA 1PS8A 2D0DA 1U7HA 1WSAA 4IGAA 3P9RA 1CV2A 2H2AA 2WY2D 4MW6A 4S3MA 5FWYA 1ZXBA 1XE3A 3KPJA 4YXWD 3LX4A 1E96A 5HIMA 5GVRA 4YVFA 3JD4A 1MB4A 3RBXA 3PSAA 2CNBA 2FWMX 1XL1A 3ZGNA 4CMKA 1A69A 4X1KB 4F8YA 3DMDA 5CT5A 5C53B 1U0BB 2R25B 2AN3A 2WLSA 4MS3B 1AB5A 1TAQA 2A0KA 2PPLA 2QD4A 3CUEF 4DG9A 3GVHA 2X9QA 1PD1A 4RPHA 2MT9A 3A25A 3LP5A 4DIUA 1EVYA 3ZEIA 2WM8A 4HXFB 2IUFA 1EK5A 1T3GA 4I0WB 1O95C 1ABFA 1AKQA 1GZDA 3CIFA 4AECA 9GPBA 1NDQA 2P2NA 5B7NA 1T6BY 3MCTA 2FSGA 1FNSA 1LF0A 2VDMB 4DSUA 1G7TA 2DFTA 2VAXA 5BSWA 5A62A 1MJ5A 2PT9A 2OMEA 5D3MB 1XMQB 2KLHA 3EN0A 2G0TA 1ZUNA 2RMKA 2G0AA 3KFLA 3R6GA 4IPTA 4YV2A 2XDWA 2BMEA 3MWYW 4OYHA 2XGSA 5J58A 2IHUA 4JC5A 5EZYF 3DZHA 2WUFA 5F1OA 2RAPA 4H31A 2QV0A 1P5ZB 1RQGA 2ZP1A 4XYEA 1AN0A 1FQWA 2HCRA 2APJA 2VHEA 3DM9B 4MVJF 4ETIA 5MN5A 4ICIA 4ECEA 3BRQA 1QH1A 5LP6C 3B7GA 4D97A 4OHYA 2JAUA 1VL6A 2AOWA 3ZV3A 2CV1A 1TO1E 1XQWA 5LBIA 3LKDA 3RVQA 2DE0X 1RYYA 1Z35A 5F4BA 2GD0A 1CBUA 5JI3E 4PZDA 2COEA 3PXUA 4XOIA 2I4NA 3DVAA 1AE1A 2QAJA 4Q12A 1FRVA 1PHPA 1B2RA 1HDCA 3ZZ0A 5AI6A 2O1EA 3JVVA 4HATA 1P2BA 3FOFC 3AL0C 3Q8XB 1EQUA 2YWFA 3OM8A 5JSHA 4LHEA 4KQ2A 4ND4A 2R6AA 4YJFB 1RXUA 1EESA 4IOMA 1JL3A 1ZN9A 2Z6VA 3BL5A 5F4ZA 3WFZA 4ZDIA 5GZ1A 2D0IA 4TPKA 2OZLA 3WZ2A 1CY7A 1DX9A 1IDN1 1T5IA 3R5JA 4CIXA 2JFNA 3LOPA 1OZGA 2VDWA 3R5TA 4KXLA 4PY2A 1GWNA 3E9MA 4PANA 2PWYA 3KPWA 4U7TB 5E6SB 3DMFA 5KNCD 4HGPA 4QOSA 2JFYA 2BDUA 1G5HA 1TAGA 5T6MA 4AJIA 2QTLA 1PTKA 4TS9A 4TTAA 2X4LA 4ZCSA 4TWIA 4AVYA 5FQNA 3MT7A 4M60A 5AHXA 2JFZA 2VIIA 4ZI7F 2E82A 2QT9A 4XD7A 3I8OA 2IPLA 1C7FA 2EWMA 2PZAA 3E0QA 3I30X 3A1TA 4IKOA 4X1YB 4YONB 1KBZA 5ALQA 1XD2A 1GLGA 4RZ3A 2RHDA 4TQAA 4QBTA 3WQQA 4PGMA 1YJBA 1X8JA 4MB6A 4RKFA 2X6RA 4A0HA 2OGTA 3A58B 2A59A 4C5CA 4DMCA 4S24A 1TW3A 3F7MA 3O1JC 4CL0A 3F4LA 3WYGA 4KNWA 4U9UA 4QAQA 1ZOSA 2JFWA 1RWQA 3GUUA 4MKFA 5DHTA 1G19A 1YFKA 3AFHA 3AY3A 2NQ2C 1XTBA 1XNHA 1LPOA 1W29A 1ZRNA 3LECA 1E4EA 2HJGA 2V6JA 3SEQA 2ZCVA 2J0QA 1H2XA 3ET5A 1D0SA 2VK4A 1P1IA 1LV7A 2PSSA 4MPJA 4CKYA 4J16A 3A2LA 5CURA 1H66A 1COWA 2X77A 3OOYA 2B2CA 2C3MA 2IGBA 4KAJA 2OUKA 2LCIA 3WYCA 4WADA 1VGQA 1KJZA 1U9YA 1EYZA 1S8FA 1QGZA 1ZMRA 1RR6A 3B52X 3BMXA 3AP3A 3FHOA 2YIDA 2PZMA 3LQ2A 5IKEA 4DIDA 2JI9A 5BQFA 4DLTA 3TG8A 3H5NA 2ZUFA 2NQ8A 2FP4A 2NO6A 2P6UA 1IPFA 3HE3A 3U4DA 5FPTA 1IBMB 1VL2A 3K9QO 5EXXA 1GUDA 1MZPA 1NOJA 1YI8A 4Z0HO 2I4IA 3H1AA 3RTCA 4V0QA 4L0MA 4AX4A 5AJVB 1UQRA 2JATA 3DBLB 4L02A 1G9SA 3I83A 4LZNA 3PQ8A 1LQUA 4I8IA 1RYEA 4PIVA 4XH9B 5AJHA 5TEWA 2IVZA 1GKKA 4GX5A 1LX6A 4IILA 1JIQA 1B16A 2XUIA 1C7JA 3MEQA 5FTKA 1IHPA 1MDFA 1EIZA 3AM4A 1OA0A 1YHYA 1JR3D 2YMMA 4LBZA 5LDGA 4DA6A 1RBMA 2IX3A 3BJMA 3QPBA 2IU6A 1BAPA 3RLFA 4C0QC 3ZHBA 1XG5A 4KXFB 3BTVA 1CXZA 1JHUA 1NLZA 2G17A 3OF3A 2WSLA 4XA8A 4B31A 5KSPA 3TZ6A 5IARA 1XSEA 4BUJA 4ZK6A 3CE6A 3KEOA 2MMCA 2CVHA 2HY7A 2P4HX 1CIPA 2VJNA 3IUNA 5AOBA 4TXMA 1GUFA 4MW0A 1NXPA 2OGSA 3E9QA 5LDDC 1NAHA 2W37A 2Q07A 2WYHA 1PQPA 1T6ZA 3AI7A 4GI7A 2Z57A 4H3KB 4LQCA 5DRYA 4ZVNA 3NC4A 5H83A 1MVLA 5IZCC 3OZFA 4C2UA 3MJTA 3P2EA 1E8DA 2DXIA 3OEED 1SVMA 1QCDA 4LQ4A 1W4CA 1KYYA 5GP1A 5A6SB 2QXUA 2WQZA 1BN6A 2CVQA 2GLUA 2WIDA 2Z95A 1Z2DA 3KR1A 3LCJA 3WI7A 2F64A 3K2QA 4NZYA 1ZP6A 1K3UB 1ICIA 1X8LA 2AVNA 4MQ4A 1Z8NA 4C5BA 4CF4A 3O9ZA 1R0ZA 2VL7A 4LZWA 2FJUA 3KFXA 4A0SA 2JGDB 1F8XA 1PJRA 4Z0TA 5DHPA 5J5VA 3W3AH 4BVGA 3WAJA 4GS5A 5ENZA 2VPWA 5FX2A 1UM8A 2B8JA 4IOLA 1NDHA 3OWOA 4CNBA 1A77A 4WCFB 1WV1A 1Y82A 4OP3A 5FKJA 4RJJA 4YRSA 2ZYHA 3NGXA 5DWVA 5JSQA 5LJLA 1T5HX 5FD8A 3BGOS 4L8GA 4EJMA 4DLBA 3LT5A 4CDNA 4O63O 1ZGAA 3II6X 4YUXA 2OV1A 1NF8A 3L4KA 4YI3A 3T41A 1LSUA 1ZJJA 4QOIA 1LW6E 4IFEA 5IMBA 1DV1A 1EGQA 3AT1A 3IKVA 4EG4A 3F6EX 5T57A 1XZMA 4UHDA 4WZAE 4RM2A 4YT2A 4L07A 3ZVRA 5ANRB 3T3OA 1X1DA 1AH2A 1W88B 3MS7A 2JCVA 2VJBA 5EFZA 1N1MA 3WWDA 4EABA 4HK4A 4NV0A 1UMDB 4FEGA 2JL1A 2B30A 1R6BX 1RRMA 1QG0A 1X7ZA 3EGDA 2H8KA 3HP7A 4JODA 2XIQA 3X2SA 5HQ3B 2I91A 1GNRA 3K05A 1C7EA 1ZKDA 4MV3A 3SQMA 2NTYC 2QQEA 1ZQ9A 3PQ2A 4MIYA 4OKIA 3ICVA 4OQEA 4YPVA 3HADA 3PQDA 4OU4A 3ZLVA 2PO5A 3QPDA 3PQ4A 5CVVA 5KTPA 3PEFA 3GLIA 4JKIA 3WKBA 1JG6A 3FYDA 4JJFA 5ERXA 3UXYA 2GNOA 3UUWA 2GHQA 2ZDHA 3F7TA 3V2GA 4KU4A 3H9GA 3SKXA 2F4VB 2Q3HA 5ADVA 2E4YA 5EXPA 1ECBA 2O2EA 3OTOB 3TYXA 3FPBA 3SXPA 2C4HA 4BX3A 2RI1A 1JHYA 2POCA 1YH3A 3M7IA 3GUVA 5JNRA 4A0FA 2X8LA 3RG8A 2ZIGA 1SCIA 4LJ9A 2QGNA 1AGYA 3OOHA 4UPDA 4UHHA 2PTHA 3WIOA 2P1DA 3KJZA 2ZI3A 4QC2A 5PNTA 2QLMA 1RWOA 4ILEA 1MN6A 1C4WA 1BE6A 1L9KA 3VH3A 2GCGA 4UCFA 3H5RA 4EKDA 3PPWA 3VI4B 1H9AA 5FOSA 3H4TA 1N2JA 1SXQA 3GRKA 5CHYA 1E1CB 2JFBA 4OCZA 4HDRA 1DELA 1U31A 3KYCB 1O54A 1HDZA 3BQ9A 2ZJ7A 1HLFA 2O5RA 1T1SA 2G7ZA 3NEJA 3O92A 1T2VA 4TVBA 1U0TA 3UKDA 4D9CA 1C1DB 2JCXA 2QKYA 4KHZA 4Q7KA 4E3WA 1B73A 4NY1A 5CX1B 2F3RA 1Y1TA 1XPJA 3QKIA 3WRWA 3GLTA 2TMGA 3SC2A 1JI3A 1TYZA 3P9ZA 4C7OA 5CFQA 1C9KA 2P11A 4QQ8A 4J9UE 4H1UA 4UBOA 5G53C 4DWVA 2FXVA 3ERCA 4B8ZA 4CKCB 4E15A 1TVKA 3DOHA 1MLDA 3RKSA 1NQVA 2PQ6A 1Z4IA 3J7AC 2BEVB 4AG5A 1XEAA 3FVQA 3B9PA 3SHQA 4YJDA 1NMQA 2C04A 2VAWA 3HFJA 3UK6A 4LE2A 1T36A 3UMFA 3QV2A 2VHWA 3S2FA 3O74A 3JWHA 3UOAB 2PZEA 3E4DA 3EH2A 3PVSA 3QJYA 3W2EA 2GAAA 1YR8A 2VHQA 3ACBA 2Z56A 2RAUA 4FDUA 4XLLA 4AK9A 4D1YA 2WC1A 3HP1A 4KQKA 2HLDA 2AWNA 1LTHR 2B35A 3IBGA 4ZQHA 4WCVA 5ENDA 1VPDA 3N53A 3KUDA 4BCDA 3LLUA 2YQ5A 4QUKA 3EG9B 1LEHA 2Q0QA 1T2FA 3MCUA 2HMAA 3VISA 3OZWA 4H4EA 1GQYA 1AUQA 4QDKA 2J9FA 2VQ6A 3BD6A 2FEOA 3O6VA 1AMNA 1K0FA 2I0FA 2C20A 4O4HF 4RZHA 4PBTA 3IFSA 1ZBQA 3NWOA 3WB0A 3LBAA 3P32A 4C0JA 4QUHA 4LV6A 1JJAA 1GP2A 2VHUA 2AFVA 1ZSNA 1YZFA 2AFIB 3K31A 1EUCA 1OLXA 1RTTA 2C2ZA 1L4YA 4XJVA 5D7BA 3PSHA 2DH5A 1V47A 1DRVA 2Y4NA 3CLSC 4TUYA 1I5EA 4YJGB 1YRWA 2Q0SA 3EA4A 4MLZA 3UT6A 1I4WA 3VOTA 5CA0F 4DA4A 5B7PA 1KQGA 1Y8AA 3TB4A 1D8TA 3C70A 4IG9A 1I51A 1NYQA 2Z2JA 4IZIA 2K6GA 2BUAA 2OCXA 3MAAC 3LBNA 3VX3A 2QX7A 3C6YA 3VH2A 2XRYA 3BFJA 4HKTA 1A3CA 1FOEB 1LFDB 1Y4ZA 1VIAA 4J6FA 2PYDA 4BGUA 1OXKB 1MC8A 1PFGA 3IHKA 1ILEA 2VSQA 1TGYA 1ORVA 1QFZA 2OLJA 4LG1A 1T1RA 5D3KA 5EEHA 1E1RD 4ZV9A 1U3GA 5I7RA 2BFPA 2ZROA 3KQMA 4BV2A 3SHFA 5JYCA 1KNXA 1IY9A 3MRVA 3RF6A 5JYBA 4LQDA 1ZI6A 4H7PA 5DXFA 2DAPA 2GRUA 2BKEA 1P19A 1SWVA 1NJFA 1DEKA 1VI5A 1AXEA 4TLBA 1JQLB 2RKBA 4UUNA 5FOXA 5J5AA 5AVYA 1UH5A 2GZMA 3V4PB 3LBIA 1J6UA 5BWLA 2IYNA 4EDHA 5GWXA 5JANA 3INGA 3BIFA 2D3WA 2VUUA 5K3OA 3P2IA 4IZOA 3TE7A 1LVHA 4KR0A 2VNKA 1S01A 2W43A 2A86A 3KEGA 1KVUA 2O8NA 1QFXA 2VK8A 2OPBA 3NJ8A 3KZOA 4LZOA 1ECFA 3I04M 3NHJA 4FCCA 3BZBA 4JB0A 2G9QA 5K0FA 1LCIA 3EDRA 1AS0A 1CUIA 4QGFA 1OFUX 4ZQBA 5L3ZA 5A3SA 1NJGA 1S2LA 1TA4A 1W4ZA 3H4MA 3A6LA 4R8VA 4RWEA 1Z4LA 1NRIA 2IZ6A 3E23A 1B7GO 3VR2A 1XVLA 2XUZA 4LJ5A 4RD1A 1VLQA 3NDBB 5DBIA 4U2FA 2QTBA 2DBYA 5B6JA 3VR3D 1BXKA 5DFAA 2IYZA 3TIIA 2DFVA 3GEPA 3MOIA 4A0GA 1GNTA 2E18A 3ZXIA 1QZZA 3I4CA 2BEWA 3P9YA 3HXQA 4DVGA 4QBHA 3OZVA 2Q3BA 3ZBPA 4Q4AA 3T1HB 2JNWA 1PK8A 3OETA 1U2EA 3VDNB 4IZ6A 4DBLE 1SBTA 1JLMA 4XD7D 4BNDA 3OCVA 4JASB 4HG2A 1ISMA 1U0GA 2WKPA 3PS9A 4LWPA 2AI3A 4JN6B 4Q3BA 5F9MA 1TJPB 2HMVA 1GV1A 2LGJA 4OHRA 4BO3A 3BA6A 5LXTB 2WTEA 1O5OA 1Q1EA 3PXBA 5C8YA 5TVKA 1AHPA 4WVLA 3JQBC 3NHBA 3P4XA 5JNLA 5L9AA 4QASA 5JQGB 3K09A 3GPLA 1E79D 1SUAA 2IK8A 2PG3A 1GARA 2XOKA 3DCIA 2GAFA 3T5BA 2IYWA 3KR0A 3OIYA 1L5FA 3B6MA 4G8CA 4M1TA 5TQJA 3CUUA 3WC4A 2Y2UA 1DBPA 4C4OA 4C4PA 1WABA 4BVHA 4BLPA 1D4OA 1Y3IA 3FI9A 1AUPA 1OGIA 1H1LA 5T5QA 2FNAA 2WWVD 1WP9A 4M9XA 1GAJA 3IE2A 2XUJA 3BMQB 3CEPB 1JEQA 4G86A 5A4MS 5KOIA 3VR1A 3PDJA 3WR5A 1P9RA 2H57A 1HFKA 3PE4A 4IIFA 4EZBA 4F3TA 4PIPA 3HFRA 4PZPA 1GR0A 1WIWA 2QRPA 2HEGA 1C9NA 2HPZA 2WD8A 3DMTA 4MVJP 2CZQA 3EXHA 3CWZA 5CJPA 5EP2A 4KQ1A 3KTFA 3THXA 4X24A 2QE7D 3HKDB 5EZQA 2R7MA 1GL3A 3AUJB 1V9SA 4G97A 5DV9A 2CYCA 4PYLA 2MSWA 3UJ8A 1Z6YA 2Q2QA 2IKSA 1MG5A 2WSMA 1OLSB 2EBUA 2PD4A 3L7BA 4ALNA 2X5XA 4TTVA 4GKAA 2HN9A 2RBKA 1BSVA 2I2DA 5DW3A 3TDMA 2B7CA 3DMRA 3AXSA 1NBAA 2K2WA 3IULA 1HEUA 1JIXA 1YZHA 3U3OA 4Z0PA 4HDMB 3WLIA 2WHPB 1CEXA 3DONA 4BBAA 4C08A 2CW5A 3TLCA 4P81A 4WH0A 5CGZA 4B3IA 4D8UA 4L9RA 1GGKA 3FUWA 1V1JA 5JIBA 1PQYA 4GOMD 4ZHQF 1L0BA 2BCGY 4IV5A 1AO0A 1H2FA 1PDOA 5E1DA 1H0RA 2C83A 2O2ZA 3EWAA 1XNQB 3TVTA 4JSYA 1KR5A 1EDZA 1RM0A 5ADUS 2WQ6A 3HGTA 3P20A 3B9RA 2VZLA 3O0TA 4URXR 2E4VA 2QE7A 5JHGB 3ROKA 1CUXA 3OFVA 4G4GA 5HBGA 1KFKB 1LDBA 5LCXA 3ZCPA 3NMUF 4RDCA 4KXQA 1XCOA 1VFNA 4AZWA 1P29A 3VA7A 1F8GA 2P2ZA 2GEVA 4RVUA 3C1AA 2A33A 2BZ0A 2SHKA 3X2EA 1RCTE 1YQXA 3EGVA 4P33A 1NKVA 3IVRA 3HL4A 4OQNA 4O4IB 4X6YA 1BROA 1FXSA 1CQJA 4HSGA 1Z47A 3FCEA 3OOEA 2JD2A 4NDAA 1UUFA 2VP0A 4D4GA 4EY5A 3K0FA 3H1GA 1X86B 3BUSA 4BU1A 5ALVA 4Y8VA 5P8WA 3MRTA 1KZ7B 4G0MA 4C01A 5BY2A 4HN9A 3ZIUA 2XBMA 4IX9A 4TWJA 1GZ3A 4LI3X 4Y1GA 2VFAA 4KSYA 1I9CA 3SR0A 1NI3A 4XYLA 1HQKA 1QFMA 2HA0A 2NAFA 3QIAA 4NL4H 4PRYA 4G4SO 2W6ID 4UUAA 3ZHSA 4BZZA 1BX1A 2A5GA 1CU1A 2BGKA 4QWWA 2C4KA 1R18A 4M8LA 2HRZA 2P65A 1CT9A 4X7PA 3D7KA 2QT0A 4O29A 1X74A 3I92A 6REQA 3D2CA 5H7XA 4IMRA 5F3RA 5JC8A 2JFXA 1CP3A 2MR6A 1U3WA 2Y1WA 3HL0A 2WINI 3LUDA 1PV1A 3ESAA 3N87A 4U9HS 4WOCA 1KKUA 1LLCA 2O3TA 2VP4A 3DDHA 1EWRA 4BB9A 1JLRA 1F38A 1SBYA 2WF6A 2R7KA 2ZW9A 1KTVA 1R0BA 3OSZA 1IU9A 1P9LA 5AUNB 2G82A 2I4MA 1GPKA 2OG2A 4H0FA 1KQFA 4G65A 2Z9DA 3IO3A 1VRWA 1CZOA 2QJOA 2VT2A 4R1NA 3AR2A 2WYUA 2RFLA 3NHWA 5I9BA 4EBFA 4EX6A 4GKKB 1O8CA 2QD3A 1KFCB 3EE6A 4KXXA 4R2KA 4BFTA 2H7CA 4UD2A 5EVJA 1KGDA 2R8BA 2OB2A 5F9FA 1QS0B 3DW3X 3KVRA 2VUHB 3QPCA 4GD3Q 4BUCA 3AVYA 1IQUA 5ECGC 3AHHA 2KQUA 3ZLUA 1W59A 2PUGA 5JNUA 1KO4A 1L7AA 4DR6B 1SUBA 5FOVA 4J0FA 2VNHA 1BEUB 2R1ZA 3VZPA 4FT2A 2G8NA 2PL3A 3RI3A 2CHGA 3AX6A 5DE3A 3RSFA 4CCSA 4HT3B 4JCOA 1QYVA 3LZDA 1F20A 5DKFA 3RSSA 4RHXA 4RCYA 3HP4A 3EBLA 4YAFA 2EOAA 4PLFA 2NACA 2X86A 1T43A 2YW9A 3D5QA 4Q3OA 3W1EA 4B5LA 4DILA 1XRRA 5HZGA 4Z4CA 3I9OA 1PEYA 5KWIA 1PE0A 3CRW1 5CYFA 3VV3A 4TSFA 1SH7A 3DW1X 1ZC3A 1YA4A 3PE3A 4X94A 1GUZA 2L0XA 2XQIA 2ZIAA 3CCFA 3QBDA 5EJ9A 3K30A 1QF7A 5LQAA 2OKGA 3FTNA 3DE6X 2ESRA 3DGEC 3O95A 2G25A 3GGDA 3NTXA 3U37A 3VJMA 2PFSA 2YWXA 1Y81A 4HWTA 4R2WA 2H0AA 1SQFA 3MUOA 4IRXA 4B80A 3AVVA 3ILHA 3NOVA 1MAHA 3GFOA 5TMBA 4TZ0A 3QVJA 3U6BA 2W11A 4JDPA 3H0KA 4TRRA 3FIJA 2DKOA 3IP8A 2OP1A 2VF5X 5DK6A 1DIBA 3BZUA 3S1AB 5EP1A 4XX1A 5F1PA 1ZFNA 2XBLA 3KPYA 4IKPA 5CIQA 2FWAA 4PTZA 3QEMB 1W85A 4DQXA 2QUIA 1JEAA 1VJTA 4JNKA 5EWJA 3QH4A 1H8ED 1UDXA 4S1WA 5LYYA 4LXIA 5K9ZA 3UCEA 4XRRA 4RE5A 1W36C 1CHNA 1E99A 1W0JA 4DF3A 1RQ2A 1DAIA 3H8VA 5EXDA 2GQ0A 1NFQA 3BT7A 1CJBA 1PJCA 2OVFA 2V7GA 3B2QA 3F4KA 2Y0PA 4I4LA 4GP9A 1M2VB 4DXDA 4OMFG 4ZO7A 1Z0FA 1ZNQO 3FPJA 4YT8A 1D1PA 1PW5A 4ZXPA 1TFUA 3PDIA 1VBMA 3OI7A 2VJAA 4M9ZA 4RL4A 1M34B 1RJ9A 3OTGA 4RHCA 1GN9A 1TYAE 5TY0A 7YASA 3PUJA 1KSHA 3D6FA 3HWRA 3LL7A 3PNVA 4K26A 5KJ1A 4QNNA 2B8EA 1FSPA 3CYFA 3WA6A 1RQXA 4WCFC 2Z9CA 8OHMA 1PUJA 1SXJB 2HZ7A 1RI5A 3BXEA 4R1SA 3G0IA 3TD9A 4PC7A 4C30A 3SN6A 2R60A 4YLEA 1XJCA 4WLFA 5BYKA 3C98A 2XCLA 1WBBA 3ROXA 1M33A 1ISRA 4G85A 1TKAA 4GL2A 2HJ9A 3IKMB 1T35A 2ZETA 4FLFA 4REOA 2C9YA 1GQFA 2EG5A 4ZI5A 4I5DA 5AR1A 5CCBA 3MUEA 2CHFA 4XB2A 4FGUA 4DR2B 1NZFA 2BZGA 4K0RA 1BE1A 2GYUA 2NYVA 2YNMA 3FFAA 1WMEA 4YB8A 5AKKA 1CQWA 3BD9A 4ZVKA 4DDWA 1KA9H 3GLVA 1R6DA 2HD4A 4NMHA 5TMDA 4B3TB 2C3UA 4OYLA 5ILGA 3SG0A 5AKJA 1EP3B 3OEWA 1JEQB 2JW5A 3IDQA 4NH0A 1IBLB 1RYNA 4CCYB 5JATA 4OQDA 5EIBD 4Q3CA 5HCUA 1RYMA 1VHDA 1MT0A 1VJ5A 4IIEA 3TFOA 5IYZF 1ECGA 3E6AA 4LYYA 5CX1A 1ZICA 5C32A 1II9A 1ND5A 3IAXA 4B2YA 1BQ3A 2V4ZA 3FSGD 2QL7A 3LDGA 5AKIA 2VT3A 2J4FA 1P8AA 1QV6A 2XGJA 1JZSA 2GN8A 4AN4A 3IKLA 2H92A 1G2QA 3T06B 4AZ3B 2E1PA 4L3OA 1UADA 2D5IA 1JVBA 5FUVA 4FK8A 2OXCA 2XRZA 3OX4A 1X70A 1YBHA 2GFHA 2QRJA 2BE7A 2Q5QA 4URZR 1IBRA 3A9CA 4PXYA 4CQMD 4D0SA 5LN1A 2Y1GA 3IQGX 4OJMX 3QE0A 4Z3KA 1YXMA 2WB2A 3UAVA 1JDSA 2AHRA 2R79A 4GQIA 1I1HA 3C7AA 1M6WA 3G0CA 3HEAA 4MAAA 5ALNA 4YYZA 1P4AA 1KAOA 3W8FA 1WMSA 3C14C 1Z0KA 1YC5A 3D8HA 1JDZA 3DDZX 3ZY2A 1JE1A 1UOPA 1H2ZA 3DEIA 3TI9A 4LTMA 4CHTA 4YUYA 5AVTA 5IN5A 5FDFA 2YFQA 5AQEA 1XCBA 2A1UB 3HVKA 2BFMA 4KIFA 5LQUA 4BP8A 5JUWA 1HE3A 1FP7A 1RWPA 1WUHS 4CV2A 1JHPA 1SQ5A 2UZ1B 4G5OA 4OHKA 5LDHA 1PEDA 4KI0A 4D9KA 4YJHB 1YV9A 1ZLXA 4A8JC 2H1FA 2W98A 3FUVA 2X1HA 1J09A 1VCIA 3P2KA 3LHKA 2ZRKA 4QPDA 4EJSB 1P7CA 1F06A 1T0BA 2E21A 4BP9A 3LX8A 1TF5A 1ABBA 3YASA 4UARA 3SE7A 4FB5A 4JYAB 4PBSA 2IDKA 5GJCA 3W5SA 4MTCA 4DDMA 5DBOA 5FR2A 1FFXB 3WK7A 4HQLA 1FDOA 1S7GA 1LF5A 2O2HA 3ITNA 3LQYA 3ZTWA 3A06A 4WMLA 1H2BA 1EQAA 1M6VB 3WKCA 1MRSA 2OQIA 3WNVA 1GTVA 2QDXA 1H6AA 2NO9A 2ZRHA 2YY7A 3GPCA 4EG3A 2AX4A 4KE6A 5LP6F 3LZ6A 4YHHB 2PT6A 2G5CA 2PR7A 2WJ4A 4FOTA 4J29A 5C1IA 5BSFA 4E5YA 4JL6A 2PQ0A 5ELMA 4UM7A 3JQ9C 2O8CB 1BKYA 4CG2A 1VE6A 4BASA 3DKRA 4PVCA 1JAZA 4MH0R 3T5AA 3FPGA 3TG2A 2JFPA 3MILA 5BO5A 5F7OA 4X8HA 5DULA 3DFKA 1QR6A 2NU7A 3TKYA 1R5JA 3RDPA 4L9SA 2HRQA 3KUUA 1JDTA 1UXJA 3M4YA 4DLAA 2C7VA 2X9VA 4TT3A 3M6VA 3E7DA 1W2WB 3W5UA 4EY4A 2Z2YA 1KZ9A 2BFFB 2WYOA 3O75A 5TJ9A 4E7PA 3AF5A 2ZTUA 2QTHA 2WF9A 3DBVO 3KS9A 5E4JA 5FEUA 1M76A 1XA0A 1ZGHA 4LRTB 4EO4A 2VZEA 2JD0A 2WMNB 3E7PA 3L1HA 4N5IX 5H5JA 3FMGA 4M0MA 3HQ4O 4II3A 3W8DA 2ZUEA 4OM7A 1TIPA 2GZ2A 4GBJA 4ABYA 1R3DA 1BS2A 1SZDA 1ZK1A 1H2YA 1ZG3A 4E2FA 3NORA 3EHDA 4FB4A 3ZQUA 2WBLC 2IYRA 3WMGA 1BD3A 2P2GA 2WUEA 3CBQA 3ZWVA 1E0AA 4L4ZA 1ULZA 3IEPA 5K3BA 1RKVA 3L8CA 4HQ0A 4PFSA 3MN1A 1QTRA 4AUNA 3S5JA 2GS9A 1OKKD 1B6RA 1IHUA 1J0CA 4P5DA 4ZOBA 5ED0A 3DEJA 1AKRA 2D1SA 3G2LA 1IK6A 5JY6A 4G37A 3UYKA 2AZXA 2AD1A 1BEEA 2Y1DA 1ZZEA 1VL8A 2WNHA 1II0A 4BO4A 2C42A 3TKLA 4CTJA 2GK7A 1BKSB 4UXIA 5IT9A 2A8YA 2RSLA 3H1EA 5ELXA 2GBIA 2BT4A 1KE2A 1G21B 1K6JA 3OD1A 4BQNA 1X7XA 5LMCA 3EWIA 4M0CA 3D0KA 4YASA 3UHFA 4R3UC 2IKQA 3W9BA 1QO0D 2V7QA 3J7TA 3HSKA 2Q3CA 1GUYA 4FFOA 4US0R 2H4JA 1XQXA 3PC7A 1N5DA 4GEKA 1TVKB 4AJHA 4WD3A 4CN8A 1DSSG 1UPUA 3VTAA 4WACA 2AF3C 2WSIA 4BRSA 1Y9DA 4IDPA 3ZDZB 3U4IA 4EHBA 3IVXA 3ANNA 4MRSA 1CR6A 1ONOA 1V16B 2HRRA 3QZUA 5THXA 2W7TA 5IVIA 3SVZA 5ULLA 4CLXA 3GHHA 4FFNA 1QU3A 4PO9A 1T10A 4HFNA 2YQ4A 2GM3A 2DFLA 3ND6A 3VTZA 4E1VA 3JYPA 2XQGA 2WVHA 4BXOA 5IVKA 1BXGB 2SCUB 1OASA 1TKRA 2V0NA 4R9NA 3DJYA 3K1TA 4I1PA 1YBFA 1EU1A 2XE6A 1I6LA 5J2UB