2H01A

Py00414- plasmodium yoelii thioredoxin peroxidase i
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
174
structure length
174
Chain Sequence
AFQGQAPSFKAEAVFGDNTFGEVSLSDFIGKKYVLLYFYPLDFTFVCPSEIIALDKALDSFKERNVELLGCSVDSKFTHLAWKKTPLSQGGIGNIKHTLISDISKSIARSYDVLFNESVALRAFVLIDKQGVVQHLLVNNLALGRSVDEILRLIDALQHHEKYGDVCPANWQKG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 2-CYS PEROXIREDOXIN
publication title Crystal structure of PY00414 - a Plasmodium yoelii thioredoxin peroxidase I
rcsb
source organism Plasmodium yoelii
molecule tags Oxidoreductase
total genus 54
structure length 174
sequence length 174
ec nomenclature ec 1.11.1.-:
pdb deposition date 2006-05-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10417 1-cysPrx_C C-terminal domain of 1-Cys peroxiredoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 2h01A00
3C1RA 1FB6A 4I8BA 5D9VA 1FHEA 3OR5A 2CVBA 3F0IA 1WOUA 2A2SA 4MZCA 3GMFA 5G5EA 1OKDA 3TKSE 3P7XA 3KZQA 1K3YA 1T00A 1XOBA 4POLA 1Z9HA 4WBJA 4L5LA 2LUSA 2P0GA 2L6DA 1XFLA 3L4NA 3EVIA 3TKPA 5JWRB 1AC1A 1PD21 3HY2A 4E8HA 4L0WA 4JRRA 2GDRA 1K0BA 2MYGA 1Y6EA 4KAEA 1ZGNA 2O89A 1GTIA 2R3XA 2L4CA 3ED3A 3LFLA 2H66A 1JZDA 1DUGA 3FR9A 3IAS2 4RUVA 4OFTA 5F07A 2GSRA 3S9FA 1TI3A 2K18A 4MJCA 2K8SA 3ZITA 4HJ2A 1LBKA 3IA1A 4IS0A 3LYPA 2WULA 4AJ7A 4BVXA 4K8MA 1AQWA 3UL3A 2H71A 2N5FA 1GWCA 3KMOA 5IM9A 2RM5A 2JZTA 1SENA 4KGIA 1ZCPA 1XWAA 2H8LA 3NOFA 1GTUA 5J9CA 2A2RA 3WT2A 4NXIA 3DMLA 3TJBA 1AQXA 3HA9A 1O81A 3CSJA 4RI7A 1M9AA 1U3AA 1MDJA 5ECRB 4O5RA 2H6ZA 2DJ3A 3CTGA 1F6MC 2FWHA 4K0GA 1CQGA 1R7HA 2VCTA 5DJLA 3RBTA 3A5WA 4MMMA 2FNOA 3I6AA 2C8UA 2XPDA 2VUPA 5D93A 3VWVA 5CYYA 1V40A 1XZOA 4NV5A 2GZPA 3IOSA 2CAIA 1EP7A 1V2AA 3FYGA 4I6XA 2J9HA 2O85A 4JR6A 2YOIA 2LTKA 2WDUA 3EU3A 3J7Yb 3TJGA 2WCIA 5KN2A 1EZKA 3HVXA 5CRGA 2CQ9A 2DBCA 1HNCA 1JLVA 3VI7A 1SL1B 3QCPA 3I69A 2B1LA 1RK4A 3NIVA 3ZVJD 1EWXA 1GP1A 4ZBAA 3EYTA 2E0QA 1GTBA 1MEKA 3UVTA 5ID2A 3F3RA 4I5QA 3VK9A 1MD3A 4N10A 3KM6A 2L4QA 1SD9A 1U88A 2G2QA 1ERVA 4KCEA 1TJDA 3LJRA 3A2VA 1UVZA 3L0HA 1X9SB 2MMNA 4MP4A 1Z3EA 4LMWA 3WT1A 2CA8A 4Q5FA 3UEMA 3WGDA 4O7HA 3DRNA 2IMIA 2GQKA 4NHWA 1FVJA 1TRSA 3IBHA 3UAPA 5CREA 3UMAA 1XW6A 1UC7A 5B8AA 2YANA 4MF6A 4HDEA 4PNFA 3D5JA 3IPZA 4K9ZA 3EURA 4QL7A 1XWGA 5H5QA 1KNGA 1OYJA 1N2AA 4ZILA 1K3LA 2YJ7A 2I9HA 5INYA 1HNAA 2P31A 4GSTA 4MZWA 4TR0A 3C71A 1JZRA 3BCKA 3RPNA 3CRUA 3FHKA 2B7JA 1GULA 4GWRA 2FD3A 2HFDA 3F4SA 4PX1A 2J23A 4WEYA 3H1NA 3SWLA 3GA4A 4HI7A 5F05A 2CT6A 1TRWA 3HXSA 1BQ7A 1A24A 3KP8A 2VAFA 1TK8B 3UVHA 2CAQA 2LNSA 4HU9A 5FHIA 3HZ8A 3KGKA 4H86A 2MBTA 2L6CA 3TDGA 5HR2A 3QOUA 4KDXA 1ZL9A 1FG4A 4K2DA 3ME8A 2VD0A 2H70A 1A8YA 3QR6A 3IRAA 3F63A 4ML6A 4XS1A 1ML6A 3F4RA 3FZAA 2QKEA 1J08A 1SYXA 3GKMA 17GSA 2IFQA 4JZQA 3TJFA 2I4AA 4ZBBA 3P90A 2DMMA 2LJAA 5LCZA 1IYHA 1XW9A 1HNBA 3IC4A 2WB9A 1SK1A 3I9V2 3LWAA 1KTEA 2LS5A 3GL3A 3Q6OA 1YDKA 2HZEA 1I9DA 2C0GA 1USBA 2GLRA 1O73A 4WF4A 2VCWA 1GSDA 4P3YB 1TOFA 2DLXA 1A2MA 12GSA 4FYUA 4Q5QA 3KP9A 1OE7A 2YN1A 1Q4JA 4GTUA 3CXGA 4HQZA 1PSQA 5GAND 4GF0A 3IK7A 2DJ0A 3CSIA 3MSZA 3QD9A 4ECCA 3IXRA 5COHA 4KSOA 2HZFA 3D4TA 4IP1A 1MDIA 1EEMA 1YKAA 5DALA 2YCDA 1M0UA 2A4VA 3VLNA 5CAXA 1M2DA 1WE0A 2HE3A 4MLYA 3KIJA 4MJEA 2B7KA 1SU9A 2I1UA 3ZRDA 3DYRA 1T8EB 13GSA 3HDCA 1VGLA 4NHZA 2FCHA 5AIVA 19GSA 1QGVA 2LKUA 3LGCA 5B7CA 4E8EA 4BWQA 4LA1A 4ZXGA 1OE8A 4K7OA 2IMEA 4DSSB 4Z7XA 2AV4A 4EDZA 4IQAA 2YNXA 4ZB9A 3M8NA 5KN0A 1N8JA 5B8BA 1K0MA 2GSSA 4WETA 1PGTA 1YF1A 1FOVA 4OCFA 3TB2A 2H0IA 5IMDA 4F9ZA 5G31A 2ES7A 5ABRA 4GCIA 2MMAA 1ZMAA 3SBCA 3GKXA 3TOUA 3N9JA 3GKNA 3GNJA 2BJXA 4POBA 2F8AA 1AAZA 2GVPA 4L5OA 4KA0A 3HVVA 2DIZA 1GRXA 2LRTA 1B48A 2LRNA 5KEJA 16GSA 4G9HA 2OKAA 3FY7A 3GIXA 3UOMA 6GSWA 2H01A 1XWBA 2GTUA 1FB0A 1OAZA 2OE3A 4KE3A 2XPEA 3FZ9A 3ISOA 1TP9A 1HYUA 1WPIA 6GSTA 5GAPD 1U3IA 1F3AA 1JZWA 1QFNA 20GSA 4BL7A 1LU4A 2AJQB 4DSSA 1XIYA 3TOTA 2IJYA 3KJYA 5CO3A 1PL1A 4ML1A 5KN3A 1JFUA 2GZZA 3VI5A 2CVKA 3IK9A 1XXUA 4I2UA 1B9YC 6GSSA 4N11A 3GSSA 2V32A 4TW5A 1SK0A 1MDKA 2X8HA 2X64A 4RQRA 2DC5A 2O87A 1Z5YE 3DXBA 4ECBA 4NWYA 3ZFBA 3A2XA 4GLTA 2AYTA 2OE0A 3CBUA 2NDOA 2B1KA 3RAZA 3Q19A 3C8EA 3HCZA 4MPFA 4O32A 2X8GA 2F3MA 2LJRA 2B6MA 3PH9A 5JCWA 2PUKC 3GX8A 1XVQA 4V1Ag 3FRCA 1YY7A 2VLUA 4KX4A 2K9FA 1QXHA 4FYBA 3EWLA 1NSWA 5C00A 1A23A 3RPPA 1X5EA 3RDWA 2H6YA 1M9BA 2GT6A 2X99A 5GZZB 2WRTA 4I2TA 5H5RA 2YZHA 2B5YA 2R5GA 1JZOA 3FR6A 4TRXA 1EP8A 4HUAA 4XRDA 4AF2A 1G0TA 4MDCA 3UIWA 3UBLA 4MA9A 2JZSA 3GV1A 3HHVA 1T3BA 1ZYEA 4HS1A 3WYWA 4EO3A 3Q18A 4N30A 4WR5A 3US3A 3EMXA 3LXTA 1V57A 5D8IA 4ZL7A 4ID0A 1I5GA 1BJXA 4CDOA 2OACA 2IWTA 3ME7A 4D73A 5ID2B 1U87A 2AAWA 2H1BA 1YKCA 2YWNA 2AHEA 3QFBC 3I43A 4HQSA 3BCIA 4K7NA 1O7UA 4PXOA 4MJAA 2H73A 1PKWA 2X8CA 2H76A 4EE0A 3E0UA 2R6KA 1GL8A 4NMUA 3VPQA 1F2EA 4ZB6A 2V6KA 1BAYA 3ZL5A 3BOAA 3GL5A 5ECNB 5D9WA 3DEXA 1ILOA 1XBSA 3A3TA 1AUCA 2TRCP 2VL2A 4J57E 3APSA 5ECIB 2KLXA 3M0FA 2C3QA 3ZTLA 5FT3A 4XIHA 2VIMA 4IJIA 3UARA 2KUCA 2H72A 4G19A 4PQ1A 1VF2A 4TOPA 2VO4A 3BJ5A 2OADA 2F51A 4GQFA 3GFKA 4K7IA 2RM6A 2WGRA 2XC2A 3V1WA 2IIYA 1S3AA 1O85A 4QQ7A 4MK3A 2HRFA 3HVSA 3WD6A 4IJ3A 2NBSA 2GQMA 1LJRA 2LNTA 4IW9A 2DJJA 4EXJA 2C1YA 4MF5A 2RUFA 5HR0A 2JL4A 3CSHA 5DDLA 1OC9A 4V2MA 2PVOC 2LEGA 4MF7A 1A2LA 4K1FA 3TKRA 3VWWA 6GSUA 2MZCA 1B4PA 4YQVA 1UA5A 5DBQA 2LQQA 1OC8A 2E2GA 3PGTA 5CNWA 5ECSA 1RQMA 3EMPA 3TJKA 3TJJA 4EC0A 2ZUPA 4F0CA 1GUMA 4POKA 2PGTA 5EL8A 3GSTA 3TKQA 4WR4A 2K8VA 3ZZXA 2IFQB 4PURA 2YPMA 2C3TA 1PKZA 2JU5A 3KD0A 1DE2A 2KHPA 1T7PB 5CRWA 2V2GA 3F9UA 1WJKA 2QGVA 2IMDA 1Z6NA 5HFIA 1A0RP 4BWSA 2HZEB 3D21A 1T1VA 2RIIA 1PQNA 2YP6A 1BG5A 3GHAA 1SL2B 1AQVA 1ZYQB 2WJUA 1GUHA 5IPHA 5F0GA 3DVXA 2B3SA 1QUWA 5A5KA 4EF0A 4FH8A 4YQUA 4OFNA 3KH7A 5B6NA 1PMTA 1ERWA 3NZNA 1AIUA 4ACSA 1SL0B 1TKDB 4JE1A 4JEDA 4IKHA 2Z9SA 1O8WA 3MAKA 1VF4A 2LJKA 4KDYA 1TRUA 5DALB 4EVMA 1GLPA 3TRPA 1WRYA 4KH7A 1HQOA 2MMOA 3W8JA 1J9BA 4BVYA 2VCQA 4AJ8A 1TTZA 5ECOB 3ZMKA 2C0EA 3WGXA 2CV4A 1DSBA 3VWUA 2IMKA 3G7JA 4KDUA 2GSQA 4ZL8A 5HFGA 4TR1A 1ERUA 2TIRA 2K6VA 5DAKA 3H4KA 1R5AA 3E9JB 3P8WA 4PQHA 14GSA 5GSTA 1G7EA 3O3TA 4EKZA 2WFCA 1BX9A 2YWIA 3GRXA 1UN2A 3LQ7A 4BA7A 1M2BA 2QSIA 3ERWA 1GSFA 4X43A 3FK8A 3VURA 2FLSA 1O6JA 3LORA 4IP6A 4MZBA 1TI1A 1XOAA 3ZLPA 4HZ2A 2V1MA 5L71A 3C73A 3HD5A 5AN1A 1AW9A 4F82A 1GSSA 3O76A 3HJMA 5DQYA 1TRVA 2DSAA 5HFKA 5IQYA 1GTAA 2GS3A 1SKSB 4NV2A 4EUYA 5LNKe 1THOA 1K0AA 1TXXA 4IGJA 1GNEA 4KNDA 5G1KA 4WBRD 1BYEA 3LYKA 1QQ2A 3ZVJA 3RHBA 2ON7A 4TXOA 5ELAA 1M2AA 1SD8A 1NW2A 4MH2A 2V41A 1MD4A 1F9MA 2E2MA 1X9MB 4YAVA 2M72A 2YV7A 1SJ6A 3QDNA 3HKRA 4YAPA 5DJMA 1TK5B 3L9SA 1AXDA 3U5RE 5H5SA 4J56E 2P5RA 5HR3A 7GSSA 4WF5A 2L5LA 2H74A 3J7Yk 1TU8A 4BPYA 6GSYA 1FW1A 4HZ4A 1Y25A 2NVLA 3N5OA 4PQIA 2H30A 3ERGA 3HJOA 2OA7A 5AGYA 2C0FA 1VF1A 2BTOT 2FWGA 5CP1A 1M99A 2DJ2A 2L59A 4ILFA 2E7PA 1V9WA 2CVDA 2AUVA 3IHQA 3TUEA 1PRXA 4O92A 3PINA 3P2AA 1URMA 2VCZA 2EIQA 3L9UA 1THXA 3GN3A 2FA8A 1BEDA 1B8XA 1E6BA 1H75A 4ZB8A 1Z6MA 4G10A 1T4YA 1A2JA 2LQOA 5IO0A 2EC4A 3ZYWA 1WMJA 3GURA 3F6DA 3DVWA 1A8LA 10GSA 2C3NA 2JSYA 4TXVA 1TK0B 2KOKA 3JCML 1XW5A 3DIEA 4JU5A 1PN9A 3IE3A 1YF0A 3EE2A 3ZIJA 1TDIA 4PNGA 1PX6A 1PL2A 1ERTA 1KEBA 5J41A 4IN0A 5D73A 4TKYA 3CYNA 3TCOA 3DGQA 4POMA 3KCMA 5ECHB 4DVCA 1X0RA 2RUEA 3LXZA 4XCSA 4X0XA 8GSSA 5IO2A 1YQ1A 2BMXA 2AB6A 1G7OA 2EIRA 2MMZA 4F0BA 2WS2A 1YEXA 4MJBA 1OC3A 2VM2A 4XS4A 1ABAA 4KB3A 3TKSC 1WIKA 5HR1A 5F06A 4DSQA 4N0VA 3ZFLA 5ECMB 4D73B 1PX7A 3F8UA 5E59A 1O8XA 2C4JA 3KTLA 4OO5A 1K0OA 2PBJA 2R37A 3LEFA 1B9XC 2NPBA 2IPAA 5KN1A 1ZZYA 4GXZA 4HU7A 1H4OA 3HYPA 3R2QA 2H0HA 1U6TA 4ZL9A 5EVOA 3H8QA 2HLSA 1NM3A 1EEJA 6GSVA 2VLVA 2PMTA 1HD2A 4MH3A 2VCVA 5CRDA 3APQA 4XS6A 4J2FA 4TR4A 2FWFA 1XWKA 2D2ZA 2L5OA 2GGTA 1Z7PA 1GSUA 2H1DA 1DE1A 1XVWA 3GTUA 4IVFA 2PPTA 2WZ9A 1X5CA 3QFAC 3FKFA 4CHSA 2PWJA 1Z7RA 4OMVA 5G30A 1SJIA 5G5FA 2HRNA 3CTFA 2PERA 2P5QA 2CX3A 3QAWA 1TU7A 4WXTA 3G9BA 1EGOA 2JSZA 2HT9A 11GSA 3CMIA 2C80A 2DJ1A 5A4VA 3M3MA 4ZIJA 5C04A 4GSSA 2CZ2A 4ECIA 1GUKA 5ENUA 4HJMA 2GQLA 3DD3A 2VM1A 5J5NA 1GSEA 5A4WA 5GSSA 2B5XA 3PR8A 3FEUA 3FR3A 5CRHA 3L78A 1XWCA 4JBBA 1JLWA 4F2IA 4MPGA 5IIZA 2YV9A 2M46A 3HZ4A 1OC9B 1ST9A 4XHMA 5J3RA 3M9JA 3IAM2 3ZMLA 5LD0A 2FA4A 2PN8A 1C72A 4Q5RA 2YZUA 3DKSA 1SKWB 1GH2A 2M80A 3BBYA 1TW9A 4WKWA 5D9XA 3KH9A 1ZOFA 3L9VA 1VRSD 1WP0A 4ECJA 4FYCA 4DEJA 2HSYA 1W4VA 3QAGA 3QPMA 2OJLA 2FHEA 6GSXA 1SJZA 3E3EA 2HYXA 5DCHA 3KMNA 2QC7A 3IV4A 4OFMA 4F03A 1PA3A 3WGEA 3ZREA 5EY6A 4OD7A 1S3DA 2I3YA 4KCAA 1K3OA 5IPGA 5A4UA 2LV3A 2H1GA 4V2NA 1F37A 2R4VA 2OE1A 1K0CA 3CRTA 4ZBDA 5EPFA 3TKSA 4DSRA 2YWMA 1NHOA 4V2LA 2C0DA 1EOGA 4IBPA 2YJHA 3O6TA 3VPTA 3C1SA 2F9SA 5J4UA 1QK8A 1F3BA 2EIOA 5IOWA 1E2YA 2OBIA 4GSNA 3GYKA 4GQCA 4XTSA 3VWXA 2DJKA 22GSA 4I97A 5G1LA 5DQSA 4IQ1A 5DCGA 2CX4A 1ACVA 4IHUA 1FVKA 3D22A 4TR1B 1GSQA 2YWOA 3HJPA 1WWJA 5DAKB 3FZ5A 3Q74A 1SK2A 3A2WA 4G2EA 2VL9A 3GKKA 3KEBA 3F6FA 3FZ4A 3QAVA 2JADA 2N5AA 1EV4A 3UJ1A 4K6XA 5IMZA 1XPVA 4TVEA 4LMVA 2LSTA 2GSTA 3G7IA 2IMFA 3LSZA 1T4ZA 2ON5A 3MNGA 3KTBA 5IOXA 2ZNMA 3GH6A 4OWYA 3F4TA 2DIYA 2VOCA 1SKRB 4JR4A 1R4WA 2IL3A 4N0ZA 4PUAA 4MABA 2PVQA 1EGRA 5ECLB 2HI7A 3K8NA 1W89A 2R2JA 5G2ZA 3TRXA 1CQHA 1OVNA 18GSA 4NPBA 3U6VA 5B6MA 3UBKA 4EL1A 2B5EA 5IMAA 4TXOB 2F8FA 3GUSA 2H0GA 3IR4A 2H6XA 2L57A 1RW1A 4YQMA 2HSHA 1FO5A 4AJ6A 1MTCA 2O7KA 3H93A 1S3CA 2FUG2 5FWGA 4LL1B 3RHCA 4TN8A 4AGSA 5J9BA 2GT5A 5IMCA 3TRQA 3MWHA 2VD1A 4OCEA 1EV9A 1A0FA 2IN3A 4FO5A 4QL9A 3QMXA 2VLTA 3W6GA 4Q5NA 4K0NA 2FGXA 5F8BA 1G6YA 1IYIA 5DVBA 4FIWA 4TR3A 2MBSA 4CW9A 4KW6A 2I81A 2NTOA 2O8VB 2HXKA 5HQPA 4PUFC 1R26A 2HNLA 3M1GA 9GSSA 2DMLA 2N5BA 5ECKB 1G6WA 1K0DA 1YEPA 1GLQA 2XBIA 1ON4A 4HOJA 4YH2A 5ECPB 2RLIA 1K0NA 1X9WB 1XCCA 5ECQB 4RQXA 1V58A 3D0ZA 4KUNA 2LRCA 4OO4A 4NAXA 4GRFA 1EOHA 1GSYA 4KSMA 5JCUA 2H75A 3BD2A 1X5DA 4IELA 2G0FA 2GZYA 5JWQB 2V6OA 2FWEA 3VFIA 1GNWA 1B4QA 4ISDA 5IMFA 2ZCTA 1YJ6A 3F3QA 4LL4B 3W8SA 3FW2A 3GH9A 4L8EA 1DBYA 3G7YA 1NHYA 3IDVA 4ULXA 2CZ3A 5D9TA 4L0UA 1M7TA 2VCXA 3EC3A 5JCGA 5E4WA 3EU4A 1J0FA 3ERFA 1V98A 1JHBA 4X1UA 5IMVA 1R5PA 3D6IA 4V1Ap 5D96A 4XS4B 4PGTA 3C7MA 2H1AA 1KBNA 3H79A 3KXOA 2FY6A 2REMA 2TRXA 2ALBA 4RI6A 5JWOB 3APOA 2PU9C 3M9KA 5AISA 2VL2C 3D4MA 1Q98A 4LLRA 1QMVA 3AY8A 3TGZA 2JACA 1YZXA 5AIXA 4XRAA 3GX0A 1OKTA 3EINA 2KP2A 3ZIVA 5ELGA 4EDYA 2XBQA 2VL3A 3DWVA 1VF3A 4MCUA 2XHFA 2OBKA 4HEA2 1SYRA 2KP1A 2JZRA 2H19A 3MDKA 3GTUB 1FAAA 3LG6A
chains in the Genus database with same CATH superfamily
3C1RA 1FB6A 4I8BA 5D9VA 1FHEA 3OR5A 2CVBA 3F0IA 1WOUA 2A2SA 4MZCA 3GMFA 5G5EA 1OKDA 3TKSE 3P7XA 3KZQA 1K3YA 1T00A 1XOBA 4POLA 1Z9HA 4WBJA 4L5LA 2LUSA 2P0GA 2A2PA 2L6DA 1XFLA 3L4NA 3EVIA 3TKPA 5JWRB 4K2XA 1AC1A 1PD21 3HY2A 4E8HA 4L0WA 4JRRA 2GDRA 3A5IA 1K0BA 2MYGA 1Y6EA 4KAEA 1ZGNA 2O89A 1GTIA 2R3XA 2L4CA 3ED3A 3LFLA 2H66A 1JZDA 1DUGA 3FR9A 3IAS2 4RUVA 4OFTA 5F07A 2GSRA 2HRKA 4G0IA 3S9FA 1TI3A 2K18A 4MJCA 2K8SA 3ZITA 4HJ2A 1LBKA 3IA1A 4IS0A 3LYPA 2WULA 4AJ7A 4BVXA 4K8MA 1AQWA 3UL3A 2H71A 2N5FA 1GWCA 3KMOA 5IM9A 2RM5A 2JZTA 1SENA 4KGIA 1ZCPA 1XWAA 2H8LA 3NOFA 2UZ8A 1GTUA 5BMUA 5J9CA 2A2RA 3WT2A 4NXIA 3DMLA 3TJBA 1AQXA 3HA9A 1O81A 3CSJA 4RI7A 1M9AA 1U3AA 1MDJA 3FMWA 5ECRB 4O5RA 4EIQA 2H6ZA 2DJ3A 3CTGA 1F6MC 2FWHA 4K0GA 1CQGA 1R7HA 2VCTA 5DJLA 3RBTA 3A5WA 4MMMA 2FNOA 3I6AA 2C8UA 2XPDA 2VUPA 5D93A 3VWVA 5CYYA 1V40A 1XZOA 4NV5A 2GZPA 3IOSA 2CAIA 1EP7A 1V2AA 3FYGA 4I6XA 2J9HA 2O85A 4JR6A 4FQUA 2YOIA 2LTKA 2WDUA 3EU3A 3J7Yb 3TJGA 2WCIA 5KN2A 1EZKA 3HVXA 5CRGA 2CQ9A 2DBCA 1HNCA 1JLVA 3VI7A 1SL1B 3QCPA 3I69A 2B1LA 1RK4A 3NIVA 3ZVJD 1EWXA 1GP1A 4ZBAA 3EYTA 2E0QA 1GTBA 1MEKA 3UVTA 5ID2A 3F3RA 5KOWA 4I5QA 3VK9A 1MD3A 4N10A 3KM6A 2QA1A 2L4QA 1SD9A 1U88A 2G2QA 1ERVA 4KCEA 1TJDA 3LJRA 3A2VA 1UVZA 3L0HA 1X9SB 2MMNA 4MP4A 1Z3EA 4LMWA 3WT1A 2CA8A 4Q5FA 3UEMA 3WGDA 4O7HA 3DRNA 2IMIA 2GQKA 4NHWA 1FVJA 1TRSA 3IBHA 3UAPA 5CREA 3UMAA 2A4HA 1XW6A 1UC7A 5B8AA 2YANA 4MF6A 4HDEA 4PNFA 3D5JA 3IPZA 4K9ZA 3EURA 4QL7A 1XWGA 5H5QA 1KNGA 1OYJA 1N2AA 4ZILA 1K3LA 2YJ7A 2I9HA 2DKIA 5INYA 1HNAA 2P31A 4GSTA 4MZWA 4TR0A 3C71A 1JZRA 3BCKA 3RPNA 3CRUA 3FHKA 2B7JA 1GULA 4GWRA 2FD3A 2HFDA 3F4SA 4PX1A 2J23A 4WEYA 1S3RA 3H1NA 3SWLA 3GA4A 4HI7A 2CT6A 3HXSA 1TRWA 5F05A 1BQ7A 1A24A 3KP8A 2VAFA 1TK8B 3UVHA 2CAQA 2LNSA 4HU9A 5FHIA 3HZ8A 3KGKA 4H86A 2MBTA 2L6CA 3TDGA 5HR2A 3QOUA 4KDXA 1ZL9A 1FG4A 4K2DA 2QA2A 3ME8A 2VD0A 4USSA 2H70A 1A8YA 3QR6A 3IRAA 3MIXA 3F63A 4ML6A 4XS1A 1ML6A 3F4RA 3FZAA 2QKEA 1J08A 1SYXA 3GKMA 17GSA 2IFQA 4JZQA 3TJFA 2I4AA 4ZBBA 3P90A 2DMMA 2LJAA 5LCZA 1IYHA 1XW9A 1HNBA 3IC4A 2WB9A 1SK1A 3I9V2 3LWAA 1KTEA 2LS5A 3GL3A 3Q6OA 1YDKA 2HZEA 1I9DA 2C0GA 1USBA 2GLRA 1O73A 4WF4A 2VCWA 1GSDA 4P3YB 1TOFA 2DLXA 1A2MA 12GSA 4FYUA 4Q5QA 3KP9A 1OE7A 2YN1A 1Q4JA 4GTUA 3CXGA 4HQZA 1PSQA 5GAND 4GF0A 3IK7A 2DJ0A 3CSIA 3MSZA 3QD9A 4ECCA 3IXRA 5COHA 4KSOA 2HZFA 3D4TA 4IP1A 1MDIA 1EEMA 1YKAA 5DALA 2YCDA 1M0UA 2A4VA 4G0KA 3VLNA 5CAXA 1M2DA 1WE0A 2HE3A 4MLYA 3KIJA 4MJEA 2B7KA 1SU9A 2I1UA 3ZRDA 3DYRA 1T8EB 13GSA 3HDCA 1VGLA 4NHZA 2FCHA 5AIVA 19GSA 1QGVA 2LKUA 3LGCA 5B7CA 4E8EA 4BWQA 4LA1A 4ZXGA 1OE8A 4K7OA 3IC8A 2IMEA 4DSSB 4Z7XA 2AV4A 4EDZA 4IQAA 2YNXA 4ZB9A 3M8NA 5KN0A 4YKGA 1N8JA 5B8BA 1K0MA 2GSSA 4WETA 1PGTA 1YF1A 1FOVA 4OCFA 3TB2A 2H0IA 5IMDA 4F9ZA 5G31A 2ES7A 5ABRA 4GCIA 2MMAA 1ZMAA 3SBCA 3GKXA 1PN0A 3TOUA 3N9JA 3GKNA 3GNJA 2BJXA 4POBA 2F8AA 1AAZA 2GVPA 4L5OA 4KA0A 3HVVA 2DIZA 1GRXA 2LRTA 1B48A 2LRNA 5KEJA 16GSA 4G9HA 2OKAA 3FY7A 3GIXA 3UOMA 6GSWA 2H01A 1XWBA 2GTUA 1FB0A 1OAZA 2OE3A 4KE3A 2XPEA 3FZ9A 3ISOA 1TP9A 1HYUA 1WPIA 6GSTA 5GAPD 1U3IA 1F3AA 1JZWA 1QFNA 20GSA 4BL7A 1LU4A 2AJQB 4DSSA 1XIYA 3TOTA 2IJYA 3KJYA 5CO3A 1PL1A 4ML1A 5KN3A 1JFUA 2GZZA 3VI5A 4BVXB 2CVKA 3IK9A 1XXUA 4I2UA 1B9YC 6GSSA 4N11A 3GSSA 2V32A 4TW5A 1SK0A 1MDKA 2X8HA 2X64A 4RQRA 2DC5A 2O87A 1Z5YE 3DXBA 4ECBA 4NWYA 3ZFBA 3A2XA 4GLTA 2AYTA 2OE0A 3CBUA 2NDOA 2B1KA 3RAZA 3Q19A 3C8EA 3HCZA 4MPFA 4O32A 2X8GA 2F3MA 2LJRA 2B6MA 3PH9A 5JCWA 2PUKC 3GX8A 1XVQA 4V1Ag 1M3JA 3FRCA 4K5SA 1YY7A 2VLUA 4KX4A 2K9FA 1QXHA 4FYBA 3EWLA 1NSWA 5C00A 1A23A 3RPPA 1X5EA 2R0CA 3RDWA 2H6YA 1M9BA 2GT6A 2X99A 5GZZB 2WRTA 4I2TA 5H5RA 2YZHA 2B5YA 2R5GA 1JZOA 3FR6A 4TRXA 1EP8A 4HUAA 4XRDA 4AF2A 1G0TA 4MDCA 3UIWA 3UBLA 4MA9A 2JZSA 3GV1A 3HHVA 1T3BA 4EIPA 1ZYEA 4HS1A 3WYWA 4EO3A 3Q18A 4N30A 3R3EA 4WR5A 3US3A 3EMXA 3LXTA 1V57A 5D8IA 4ZL7A 4ICYA 4ID0A 1I5GA 1BJXA 4CDOA 2OACA 2IWTA 3ME7A 4D73A 5ID2B 1U87A 2AAWA 2H1BA 1YKCA 2YWNA 2AHEA 3QFBC 3I43A 4HQSA 3BCIA 4K7NA 4O5UA 1O7UA 4PXOA 4MJAA 3HVNA 2H73A 1PKWA 2X8CA 2H76A 4EE0A 3E0UA 2R6KA 1GL8A 4NMUA 3VPQA 1F2EA 4ZB6A 2V6KA 1BAYA 4MNNA 3ZL5A 3BOAA 3GL5A 5ECNB 5D9WA 4CY6A 3DEXA 1ILOA 1XBSA 3A3TA 1AUCA 2TRCP 2VL2A 4J57E 3APSA 5ECIB 2KLXA 3M0FA 2C3QA 3ZTLA 5FT3A 4XIHA 5BRTA 2VIMA 4IJIA 3UARA 2KUCA 2H72A 4G19A 4PQ1A 1VF2A 4TOPA 2VO4A 3BJ5A 2OADA 2F51A 4GQFA 3GFKA 4K7IA 2R0GA 2RM6A 2WGRA 2XC2A 2HRAA 3V1WA 2IIYA 1S3AA 1O85A 4QQ7A 4MK3A 2HRFA 3HVSA 3WD6A 4IJ3A 2NBSA 2GQMA 1LJRA 2LNTA 4IW9A 2DJJA 4EXJA 2C1YA 4MF5A 2RUFA 5HR0A 2JL4A 3CSHA 4K5RA 5DDLA 1OC9A 4V2MA 2PVOC 2LEGA 4MF7A 1A2LA 4K1FA 3TKRA 3VWWA 6GSUA 2MZCA 1B4PA 4YQVA 2R0PA 1UA5A 5DBQA 2LQQA 2HSMA 1OC8A 2E2GA 3PGTA 5CNWA 5ECSA 1RQMA 3EMPA 3TJKA 3TJJA 4EC0A 2ZUPA 4F0CA 1GUMA 4POKA 2PGTA 5EL8A 3GSTA 3TKQA 4WR4A 2K8VA 3ZZXA 2IFQB 4PURA 2YPMA 2C3TA 1PKZA 2JU5A 3KD0A 1DE2A 2KHPA 1T7PB 5CRWA 2V2GA 3F9UA 1WJKA 2QGVA 2IMDA 1Z6NA 5HFIA 1A0RP 4BWSA 2HZEB 3D21A 1T1VA 2RIIA 1PQNA 2YP6A 1BG5A 3GHAA 1SL2B 1AQVA 1ZYQB 4X4JA 2WJUA 1GUHA 5IPHA 5F0GA 3DVXA 2B3SA 1QUWA 1ZYNA 5A5KA 4EF0A 4FH8A 4CY8A 4YQUA 4OFNA 3KH7A 5B6NA 1PMTA 1ERWA 3NZNA 1AIUA 4ACSA 1SL0B 1TKDB 4JE1A 4JEDA 4IKHA 2Z9SA 1O8WA 3MAKA 1VF4A 2LJKA 4KDYA 1TRUA 5DALB 4EVMA 1GLPA 3TRPA 1WRYA 4KH7A 1HQOA 2MMOA 3W8JA 1J9BA 4BVYA 2VCQA 4AJ8A 1TTZA 5ECOB 3ZMKA 2C0EA 3WGXA 2CV4A 1DSBA 3VWUA 2IMKA 3G7JA 4KDUA 2GSQA 4ZL8A 5HFGA 4TR1A 1ERUA 2TIRA 2K6VA 5DAKA 3H4KA 1R5AA 3E9JB 3P8WA 4PQHA 14GSA 5GSTA 1G7EA 3O3TA 4EKZA 2WFCA 1BX9A 2YWIA 3GRXA 1UN2A 3LQ7A 4BA7A 3MYDA 1M2BA 2QSIA 3ERWA 1GSFA 4X43A 3FK8A 3VURA 2FLSA 1O6JA 3LORA 4IP6A 4MZBA 1TI1A 1XOAA 3ZLPA 4HZ2A 2V1MA 5L71A 3C73A 3HD5A 5AN1A 1AW9A 4F82A 1GSSA 3O76A 3HJMA 5DQYA 1TRVA 2DSAA 5HFKA 5IQYA 1GTAA 2GS3A 1SKSB 4NV2A 4EUYA 5LNKe 1THOA 1K0AA 1TXXA 4IGJA 1GNEA 4KNDA 5G1KA 4WBRD 1BYEA 3LYKA 1QQ2A 3ZVJA 3RHBA 2ON7A 4TXOA 5ELAA 1M2AA 1SD8A 1NW2A 4MH2A 2V41A 1MD4A 1F9MA 2E2MA 1X9MB 4YAVA 2M72A 2YV7A 1SJ6A 4BL7B 3QDNA 3HKRA 4YAPA 5DJMA 1TK5B 3L9SA 1AXDA 3U5RE 5H5SA 4J56E 2P5RA 5HR3A 7GSSA 4WF5A 2L5LA 2H74A 3J7Yk 1TU8A 4BPYA 6GSYA 1FW1A 3EPTA 4HZ4A 1Y25A 2NVLA 3N5OA 4PQIA 2H30A 3ERGA 3HJOA 2OA7A 5AGYA 2C0FA 1VF1A 2BTOT 2FWGA 5CP1A 1M99A 2DJ2A 2L59A 4ILFA 4PTSA 2E7PA 1V9WA 2CVDA 2AUVA 3IHQA 3TUEA 1PRXA 4O92A 3PINA 3P2AA 1URMA 2VCZA 2EIQA 3L9UA 1THXA 3GN3A 2FA8A 1BEDA 1B8XA 1E6BA 1H75A 4ZB8A 1Z6MA 4G10A 1T4YA 1A2JA 2LQOA 3IHGA 1PFOA 5IO0A 2EC4A 3ZYWA 1WMJA 3GURA 3F6DA 3DVWA 1A8LA 10GSA 2C3NA 1M3IA 2JSYA 4TXVA 1TK0B 2KOKA 3JCML 1XW5A 3DIEA 4JU5A 1PN9A 3IE3A 1YF0A 3EE2A 3ZIJA 1TDIA 4PNGA 1PX6A 1PL2A 1ERTA 1KEBA 4Z2RA 5J41A 4IN0A 5D73A 4TKYA 3CYNA 3TCOA 3DGQA 4POMA 3KCMA 5ECHB 4DVCA 1X0RA 2RUEA 3LXZA 4XCSA 4X0XA 8GSSA 5IO2A 1YQ1A 2BMXA 2AB6A 1G7OA 2EIRA 2MMZA 4F0BA 2WS2A 1YEXA 4MJBA 1OC3A 2VM2A 4XS4A 1ABAA 4KB3A 3TKSC 1WIKA 5HR1A 5F06A 4DSQA 4N0VA 3ZFLA 5ECMB 4D73B 1PX7A 3F8UA 5E59A 1O8XA 2C4JA 3CQFA 3KTLA 4OO5A 1K0OA 2PBJA 2R37A 3LEFA 1B9XC 2NPBA 2IPAA 5KN1A 1ZZYA 4GXZA 4HU7A 1H4OA 2X4AA 3HYPA 3R2QA 2H0HA 1U6TA 4ZL9A 5EVOA 3H8QA 2HLSA 1NM3A 1EEJA 5KOXA 6GSVA 2VLVA 2PMTA 1HD2A 4MH3A 2VCVA 5CRDA 3APQA 4XS6A 4J2FA 4TR4A 2FWFA 1XWKA 2D2ZA 2L5OA 2GGTA 1Z7PA 1GSUA 2H1DA 1DE1A 1XVWA 3GTUA 4IVFA 2PPTA 2WZ9A 1X5CA 3QFAC 3FKFA 4CHSA 2PWJA 1Z7RA 4OMVA 5G30A 1SJIA 5G5FA 2HRNA 3CTFA 2PERA 2P5QA 4BIKA 2CX3A 3QAWA 1TU7A 4WXTA 4A5PA 3G9BA 1EGOA 2JSZA 2HT9A 11GSA 3CMIA 2C80A 2DJ1A 5A4VA 3M3MA 4ZIJA 5C04A 4GSSA 2CZ2A 4ECIA 1GUKA 5ENUA 4HJMA 2DKHA 2GQLA 3DD3A 2VM1A 5J5NA 1GSEA 5A4WA 5GSSA 2B5XA 3PR8A 3FEUA 3FR3A 1ZYPA 5CRHA 3L78A 1XWCA 4JBBA 1JLWA 4F2IA 4MPGA 5IIZA 2YV9A 2M46A 3HZ4A 1OC9B 1ST9A 4XHMA 5J3RA 3M9JA 3IAM2 3ZMLA 5LD0A 2FA4A 2PN8A 1C72A 4Q5RA 2YZUA 3DKSA 1SKWB 1GH2A 2M80A 3BBYA 1TW9A 4WKWA 5D9XA 3KH9A 1ZOFA 3L9VA 1VRSD 1WP0A 4ECJA 4Z2UA 4FYCA 4DEJA 4Z2TA 2HSYA 1W4VA 3QAGA 3QPMA 2OJLA 2FHEA 6GSXA 1SJZA 3E3EA 2HYXA 5DCHA 3KMNA 2QC7A 3IV4A 4OFMA 4F03A 1XG8A 1PA3A 3WGEA 3ZREA 5EY6A 4OD7A 1S3DA 2I3YA 4KCAA 1K3OA 5IPGA 5A4UA 2LV3A 2H1GA 4V2NA 1F37A 2R4VA 2OE1A 1K0CA 3CRTA 4ZBDA 5EPFA 3TKSA 4DSRA 2YWMA 1NHOA 4V2LA 2C0DA 1EOGA 4IBPA 2YJHA 4G0LA 3O6TA 3VPTA 3C1SA 2F9SA 5J4UA 1QK8A 1F3BA 2EIOA 5IOWA 1E2YA 2OBIA 4GSNA 4BVYB 3GYKA 4GQCA 4XTSA 4KF9A 3VWXA 2DJKA 22GSA 4I97A 5G1LA 5DQSA 4IQ1A 5DCGA 2CX4A 1ACVA 4IHUA 1FVKA 3D22A 4TR1B 1GSQA 2YWOA 3HJPA 1WWJA 5DAKB 3FZ5A 3Q74A 1SK2A 3A2WA 4G2EA 2VL9A 3GKKA 3KEBA 3F6FA 3FZ4A 3QAVA 2JADA 2N5AA 1EV4A 3UJ1A 4K6XA 5IMZA 1XPVA 4TVEA 4LMVA 2LSTA 2GSTA 3G7IA 2IMFA 3LSZA 1T4ZA 2ON5A 3MNGA 3KTBA 5IOXA 2ZNMA 3GH6A 4OWYA 3F4TA 2DIYA 2VOCA 1SKRB 4JR4A 1R4WA 2IL3A 4N0ZA 4PUAA 4MABA 2PVQA 1EGRA 5ECLB 2HI7A 3K8NA 4HSCX 1W89A 2R2JA 5G2ZA 3TRXA 1CQHA 1OVNA 18GSA 4NPBA 3U6VA 3LW9A 5B6MA 3UBKA 4EL1A 2B5EA 5IMAA 4TXOB 2F8FA 3GUSA 2H0GA 3IR4A 2H6XA 2L57A 1RW1A 4YQMA 2HSHA 1FO5A 4AJ6A 1MTCA 2O7KA 3H93A 1S3CA 2FUG2 5FWGA 4LL1B 3RHCA 4TN8A 4AGSA 5J9BA 2GT5A 5IMCA 3TRQA 4O5QA 3MWHA 2VD1A 4OCEA 1EV9A 1A0FA 2IN3A 4FO5A 4QL9A 3QMXA 2VLTA 3W6GA 4Q5NA 4K0NA 2FGXA 5F8BA 1G6YA 1IYIA 5DVBA 4FIWA 4TR3A 2MBSA 4CW9A 4KW6A 2I81A 2NTOA 2O8VB 2HXKA 2X49A 5HQPA 4PUFC 1R26A 2HNLA 3M1GA 9GSSA 2DMLA 2N5BA 5ECKB 1G6WA 1K0DA 1YEPA 1GLQA 2XBIA 1ON4A 4HOJA 4YH2A 5ECPB 2RLIA 1K0NA 1X9WB 1XCCA 5ECQB 4RQXA 1V58A 3D0ZA 4KUNA 2LRCA 4OO4A 4NAXA 4GRFA 1EOHA 1GSYA 4KSMA 5JCUA 2H75A 3BD2A 1X5DA 4IELA 2G0FA 2GZYA 5JWQB 2V6OA 2FWEA 3VFIA 1GNWA 1B4QA 4ISDA 5IMFA 2ZCTA 1YJ6A 3F3QA 4LL4B 3W8SA 3FW2A 3GH9A 4L8EA 1DBYA 3PPUA 3G7YA 1NHYA 3IDVA 4ULXA 2CZ3A 5D9TA 4L0UA 1M7TA 2VCXA 3EC3A 5JCGA 5E4WA 3EU4A 1J0FA 3ERFA 1V98A 1JHBA 4X1UA 5IMVA 1R5PA 3D6IA 4V1Ap 5D96A 4XS4B 4PGTA 3C7MA 2H1AA 1KBNA 3H79A 3KXOA 2FY6A 2REMA 1FOHA 2TRXA 2ALBA 4RI6A 5JWOB 3APOA 2PU9C 3M9KA 5AISA 2VL2C 3D4MA 1Q98A 4LLRA 1QMVA 3AY8A 3TGZA 2JACA 1YZXA 5AIXA 4XRAA 3GX0A 1OKTA 3EINA 2KP2A 4YKFA 3ZIVA 5ELGA 4EDYA 2XBQA 2VL3A 3DWVA 1VF3A 4MCUA 2XHFA 2OBKA 4HEA2 1SYRA 2KP1A 2JZRA 2H19A 3MDKA 3GTUB 1FAAA 3LG6A
chains in the Genus database with same CATH topology
3C1RA 1FB6A 4I8BA 5D9VA 1FHEA 3OR5A 2CVBA 3F0IA 1WOUA 2A2SA 4MZCA 3GMFA 5G5EA 1OKDA 3TKSE 3P7XA 3KZQA 1K3YA 1T00A 1XOBA 4POLA 1Z9HA 4WBJA 4L5LA 2LUSA 2P0GA 2A2PA 2L6DA 1XFLA 3L4NA 3EVIA 3TKPA 5JWRB 4K2XA 1AC1A 1PD21 3HY2A 4E8HA 4L0WA 4JRRA 2GDRA 3A5IA 1K0BA 2MYGA 1Y6EA 4KAEA 1ZGNA 2O89A 1GTIA 2R3XA 2L4CA 3ED3A 3LFLA 2H66A 1JZDA 1DUGA 3FR9A 3IAS2 4RUVA 4OFTA 5F07A 2GSRA 2HRKA 4G0IA 3S9FA 1TI3A 2K18A 4MJCA 2K8SA 3ZITA 4HJ2A 1LBKA 3IA1A 4IS0A 3LYPA 2WULA 4AJ7A 4BVXA 4K8MA 1AQWA 3UL3A 2H71A 2N5FA 1GWCA 3KMOA 5IM9A 2RM5A 2JZTA 1SENA 4KGIA 1ZCPA 1XWAA 2H8LA 3NOFA 2UZ8A 1GTUA 5BMUA 5J9CA 2A2RA 3WT2A 4NXIA 3DMLA 3TJBA 1AQXA 3HA9A 1O81A 3CSJA 4RI7A 1M9AA 1U3AA 1MDJA 3FMWA 5ECRB 4O5RA 4EIQA 2H6ZA 2DJ3A 3CTGA 1F6MC 2FWHA 4K0GA 1CQGA 1R7HA 2VCTA 5DJLA 3RBTA 3A5WA 4MMMA 2FNOA 3I6AA 2C8UA 2XPDA 2VUPA 5D93A 3VWVA 5CYYA 1V40A 1XZOA 4NV5A 2GZPA 3IOSA 2CAIA 1EP7A 1V2AA 3FYGA 4I6XA 2J9HA 2O85A 4JR6A 4FQUA 2YOIA 2LTKA 2WDUA 3EU3A 3J7Yb 3TJGA 2WCIA 5KN2A 1EZKA 3HVXA 5CRGA 2CQ9A 2DBCA 1HNCA 1JLVA 3VI7A 1SL1B 3QCPA 3I69A 2B1LA 1RK4A 3NIVA 3ZVJD 1EWXA 1GP1A 4ZBAA 3EYTA 2E0QA 1GTBA 1MEKA 3UVTA 5ID2A 3F3RA 5KOWA 4I5QA 3VK9A 1MD3A 4N10A 3KM6A 2QA1A 2L4QA 1SD9A 1U88A 2G2QA 1ERVA 4KCEA 1TJDA 3LJRA 3A2VA 1UVZA 3L0HA 1X9SB 2MMNA 4MP4A 1Z3EA 4LMWA 3WT1A 2CA8A 4Q5FA 3UEMA 3WGDA 4O7HA 3DRNA 2IMIA 2GQKA 4NHWA 1FVJA 1TRSA 3IBHA 3UAPA 5CREA 3UMAA 2A4HA 1XW6A 1UC7A 5B8AA 2YANA 4MF6A 4HDEA 4PNFA 3D5JA 3IPZA 4K9ZA 3EURA 4QL7A 1XWGA 5H5QA 1KNGA 1OYJA 1N2AA 4ZILA 1K3LA 2YJ7A 2I9HA 2DKIA 5INYA 1HNAA 2P31A 4GSTA 4MZWA 4TR0A 3C71A 1JZRA 3BCKA 3RPNA 3CRUA 3FHKA 2B7JA 1GULA 4GWRA 2FD3A 2HFDA 3F4SA 4PX1A 2J23A 4WEYA 3H1NA 3SWLA 3GA4A 4HI7A 2CT6A 3HXSA 1TRWA 5F05A 1BQ7A 1A24A 3KP8A 2VAFA 1TK8B 3UVHA 2CAQA 2LNSA 4HU9A 5FHIA 3HZ8A 3KGKA 4H86A 2MBTA 2L6CA 3TDGA 5HR2A 3QOUA 4KDXA 1ZL9A 1FG4A 4K2DA 2QA2A 3ME8A 2VD0A 4USSA 2H70A 1A8YA 3QR6A 3IRAA 3MIXA 3F63A 4ML6A 4XS1A 1ML6A 3F4RA 3FZAA 2QKEA 1J08A 1SYXA 3GKMA 17GSA 2IFQA 4JZQA 3TJFA 2I4AA 4ZBBA 3P90A 2DMMA 2LJAA 5LCZA 1IYHA 1XW9A 1HNBA 3IC4A 2WB9A 1SK1A 3I9V2 3LWAA 1KTEA 2LS5A 3GL3A 3Q6OA 1YDKA 2HZEA 1I9DA 2C0GA 1USBA 2GLRA 1O73A 4WF4A 2VCWA 1GSDA 4P3YB 1TOFA 2DLXA 1A2MA 12GSA 4FYUA 4Q5QA 3KP9A 1OE7A 2YN1A 1Q4JA 4GTUA 3CXGA 4HQZA 1PSQA 5GAND 4GF0A 3IK7A 2DJ0A 3CSIA 3MSZA 3QD9A 4ECCA 3IXRA 5COHA 4KSOA 2HZFA 3D4TA 4IP1A 1MDIA 1EEMA 1YKAA 5DALA 2YCDA 1M0UA 2A4VA 4G0KA 3VLNA 5CAXA 1M2DA 1WE0A 2HE3A 4MLYA 3KIJA 4MJEA 2B7KA 1SU9A 2I1UA 3ZRDA 3DYRA 1T8EB 13GSA 3HDCA 1VGLA 4NHZA 2FCHA 5AIVA 19GSA 1QGVA 2LKUA 3LGCA 5B7CA 4E8EA 4BWQA 4LA1A 4ZXGA 1OE8A 4K7OA 3IC8A 2IMEA 4DSSB 4Z7XA 2AV4A 4EDZA 4IQAA 2YNXA 4ZB9A 3M8NA 5KN0A 4YKGA 1N8JA 5B8BA 1K0MA 2GSSA 4WETA 1PGTA 1YF1A 1FOVA 4OCFA 3TB2A 2H0IA 5IMDA 4F9ZA 5G31A 2ES7A 5ABRA 4GCIA 2MMAA 1ZMAA 3SBCA 3GKXA 1PN0A 3TOUA 3N9JA 3GKNA 3GNJA 2BJXA 4POBA 2F8AA 1AAZA 2GVPA 4L5OA 4KA0A 3HVVA 2DIZA 1GRXA 2LRTA 1B48A 2LRNA 5KEJA 16GSA 4G9HA 2OKAA 3FY7A 3GIXA 3UOMA 6GSWA 2H01A 1XWBA 2GTUA 1FB0A 1OAZA 2OE3A 4KE3A 2XPEA 3FZ9A 3ISOA 1TP9A 1HYUA 1WPIA 6GSTA 5GAPD 1U3IA 1F3AA 1JZWA 1QFNA 20GSA 4BL7A 1LU4A 2AJQB 4DSSA 1XIYA 3TOTA 2IJYA 3KJYA 5CO3A 1PL1A 4ML1A 5KN3A 1JFUA 2GZZA 3VI5A 4BVXB 2CVKA 3IK9A 1XXUA 4I2UA 1B9YC 6GSSA 4N11A 3GSSA 2V32A 4TW5A 1SK0A 1MDKA 2X8HA 2X64A 4RQRA 2DC5A 2O87A 1Z5YE 3DXBA 4ECBA 4NWYA 3ZFBA 3A2XA 4GLTA 2AYTA 2OE0A 3CBUA 2NDOA 2B1KA 3RAZA 3Q19A 3C8EA 3HCZA 4MPFA 4O32A 2X8GA 2F3MA 2LJRA 2B6MA 3PH9A 5JCWA 2PUKC 3GX8A 1XVQA 4V1Ag 3FRCA 4K5SA 1YY7A 2VLUA 4KX4A 2K9FA 1QXHA 4FYBA 3EWLA 1NSWA 5C00A 1A23A 3RPPA 1X5EA 2R0CA 3RDWA 2H6YA 1M9BA 2GT6A 2X99A 5GZZB 2WRTA 4I2TA 5H5RA 2YZHA 2B5YA 2R5GA 1JZOA 3FR6A 4TRXA 1EP8A 4HUAA 4XRDA 4AF2A 1G0TA 4MDCA 3UIWA 3UBLA 4MA9A 2JZSA 3GV1A 3HHVA 1T3BA 4EIPA 1ZYEA 4HS1A 3WYWA 4EO3A 3Q18A 4N30A 3R3EA 4WR5A 3US3A 3EMXA 3LXTA 1V57A 5D8IA 4ZL7A 4ICYA 4ID0A 1I5GA 1BJXA 4CDOA 2OACA 2IWTA 3ME7A 4D73A 5ID2B 1U87A 2AAWA 2H1BA 1YKCA 2YWNA 2AHEA 3QFBC 3I43A 4HQSA 3BCIA 4K7NA 4O5UA 1O7UA 4PXOA 4MJAA 2H73A 1PKWA 2X8CA 2H76A 4EE0A 3E0UA 2R6KA 1GL8A 4NMUA 3VPQA 1F2EA 4ZB6A 2V6KA 1BAYA 4MNNA 3ZL5A 3BOAA 3GL5A 5ECNB 5D9WA 4CY6A 3DEXA 1ILOA 1XBSA 3A3TA 1AUCA 2TRCP 2VL2A 4J57E 3APSA 5ECIB 2KLXA 3M0FA 2C3QA 3ZTLA 5FT3A 4XIHA 5BRTA 2VIMA 4IJIA 3UARA 2KUCA 2H72A 4G19A 4PQ1A 1VF2A 4TOPA 2VO4A 3BJ5A 2OADA 2F51A 4GQFA 3GFKA 4K7IA 2R0GA 2RM6A 2WGRA 2XC2A 2HRAA 3V1WA 2IIYA 1S3AA 1O85A 4QQ7A 4MK3A 2HRFA 3HVSA 3WD6A 4IJ3A 2NBSA 2GQMA 1LJRA 2LNTA 4IW9A 2DJJA 4EXJA 2C1YA 4MF5A 2RUFA 5HR0A 2JL4A 3CSHA 4K5RA 5DDLA 1OC9A 4V2MA 2PVOC 2LEGA 4MF7A 1A2LA 4K1FA 3TKRA 3VWWA 6GSUA 2MZCA 1B4PA 4YQVA 2R0PA 1UA5A 5DBQA 2LQQA 2HSMA 1OC8A 2E2GA 3PGTA 5CNWA 5ECSA 1RQMA 3EMPA 3TJKA 3TJJA 4EC0A 2ZUPA 4F0CA 1GUMA 4POKA 2PGTA 5EL8A 3GSTA 3TKQA 4WR4A 2K8VA 3ZZXA 2IFQB 4PURA 2YPMA 2C3TA 1PKZA 2JU5A 3KD0A 1DE2A 2KHPA 1T7PB 5CRWA 2V2GA 3F9UA 1WJKA 2QGVA 2IMDA 1Z6NA 5HFIA 1A0RP 4BWSA 2HZEB 3D21A 1T1VA 2RIIA 1PQNA 2YP6A 1BG5A 3GHAA 1SL2B 1AQVA 1ZYQB 4X4JA 2WJUA 1GUHA 5IPHA 5F0GA 3DVXA 2B3SA 1QUWA 1ZYNA 5A5KA 4EF0A 4FH8A 4CY8A 4YQUA 4OFNA 3KH7A 5B6NA 1PMTA 1ERWA 3NZNA 1AIUA 4ACSA 1SL0B 1TKDB 4JE1A 4JEDA 4IKHA 2Z9SA 1O8WA 3MAKA 1VF4A 2LJKA 4KDYA 1TRUA 5DALB 4EVMA 1GLPA 3TRPA 1WRYA 4KH7A 1HQOA 2MMOA 3W8JA 1J9BA 4BVYA 2VCQA 4AJ8A 1TTZA 5ECOB 3ZMKA 2C0EA 3WGXA 2CV4A 1DSBA 3VWUA 2IMKA 3G7JA 4KDUA 2GSQA 4ZL8A 5HFGA 4TR1A 1ERUA 2TIRA 2K6VA 5DAKA 3H4KA 1R5AA 3E9JB 3P8WA 4PQHA 14GSA 5GSTA 1G7EA 3O3TA 4EKZA 2WFCA 1BX9A 2YWIA 3GRXA 1UN2A 3LQ7A 4BA7A 3MYDA 1M2BA 2QSIA 3ERWA 1GSFA 4X43A 3FK8A 3VURA 2FLSA 1O6JA 3LORA 4IP6A 4MZBA 1TI1A 1XOAA 3ZLPA 4HZ2A 2V1MA 5L71A 3C73A 3HD5A 5AN1A 1AW9A 4F82A 1GSSA 3O76A 3HJMA 5DQYA 1TRVA 2DSAA 5HFKA 5IQYA 1GTAA 2GS3A 1SKSB 4NV2A 4EUYA 5LNKe 1THOA 1K0AA 1TXXA 4IGJA 1GNEA 4KNDA 5G1KA 4WBRD 1BYEA 3LYKA 1QQ2A 3ZVJA 3RHBA 2ON7A 4TXOA 5ELAA 1M2AA 1SD8A 1NW2A 4MH2A 2V41A 1MD4A 1F9MA 2E2MA 1X9MB 4YAVA 2M72A 2YV7A 1SJ6A 4BL7B 3QDNA 3HKRA 4YAPA 5DJMA 1TK5B 3L9SA 1AXDA 3U5RE 5H5SA 4J56E 2P5RA 5HR3A 7GSSA 4WF5A 2L5LA 2H74A 3J7Yk 1TU8A 4BPYA 6GSYA 1FW1A 3EPTA 4HZ4A 1Y25A 2NVLA 3N5OA 4PQIA 2H30A 3ERGA 3HJOA 2OA7A 5AGYA 2C0FA 1VF1A 2BTOT 2FWGA 5CP1A 1M99A 2DJ2A 2L59A 4ILFA 4PTSA 2E7PA 1V9WA 2CVDA 2AUVA 3IHQA 3TUEA 1PRXA 4O92A 3PINA 3P2AA 1URMA 2VCZA 2EIQA 3L9UA 1THXA 3GN3A 2FA8A 1BEDA 1B8XA 1E6BA 1H75A 4ZB8A 1Z6MA 4G10A 1T4YA 1A2JA 2LQOA 3IHGA 5IO0A 2EC4A 3ZYWA 1WMJA 3GURA 3F6DA 3DVWA 1A8LA 10GSA 2C3NA 2JSYA 4TXVA 1TK0B 2KOKA 3JCML 1XW5A 3DIEA 4JU5A 1PN9A 3IE3A 1YF0A 3EE2A 3ZIJA 1TDIA 4PNGA 1PX6A 1PL2A 1ERTA 1KEBA 4Z2RA 5J41A 4IN0A 5D73A 4TKYA 3CYNA 3TCOA 3DGQA 4POMA 3KCMA 5ECHB 4DVCA 1X0RA 2RUEA 3LXZA 4XCSA 4X0XA 8GSSA 5IO2A 1YQ1A 2BMXA 2AB6A 1G7OA 2EIRA 2MMZA 4F0BA 2WS2A 1YEXA 4MJBA 1OC3A 2VM2A 4XS4A 1ABAA 4KB3A 3TKSC 1WIKA 5HR1A 5F06A 4DSQA 4N0VA 3ZFLA 5ECMB 4D73B 1PX7A 3F8UA 5E59A 1O8XA 2C4JA 3KTLA 4OO5A 1K0OA 2PBJA 2R37A 3LEFA 1B9XC 2NPBA 2IPAA 5KN1A 1ZZYA 4GXZA 4HU7A 1H4OA 2X4AA 3HYPA 3R2QA 2H0HA 1U6TA 4ZL9A 5EVOA 3H8QA 2HLSA 1NM3A 1EEJA 5KOXA 6GSVA 2VLVA 2PMTA 1HD2A 4MH3A 2VCVA 5CRDA 3APQA 4XS6A 4J2FA 4TR4A 2FWFA 1XWKA 2D2ZA 2L5OA 2GGTA 1Z7PA 1GSUA 2H1DA 1DE1A 1XVWA 3GTUA 4IVFA 2PPTA 2WZ9A 1X5CA 3QFAC 3FKFA 4CHSA 2PWJA 1Z7RA 4OMVA 5G30A 1SJIA 5G5FA 2HRNA 3CTFA 2PERA 2P5QA 2CX3A 3QAWA 1TU7A 4WXTA 4A5PA 3G9BA 1EGOA 2JSZA 2HT9A 11GSA 3CMIA 2C80A 2DJ1A 5A4VA 3M3MA 4ZIJA 5C04A 4GSSA 2CZ2A 4ECIA 1GUKA 5ENUA 4HJMA 2DKHA 2GQLA 3DD3A 2VM1A 5J5NA 1GSEA 5A4WA 5GSSA 2B5XA 3PR8A 3FEUA 3FR3A 1ZYPA 5CRHA 3L78A 1XWCA 4JBBA 1JLWA 4F2IA 4MPGA 5IIZA 2YV9A 2M46A 3HZ4A 1OC9B 1ST9A 4XHMA 5J3RA 3M9JA 3IAM2 3ZMLA 5LD0A 2FA4A 2PN8A 1C72A 4Q5RA 2YZUA 3DKSA 1SKWB 1GH2A 2M80A 3BBYA 1TW9A 4WKWA 5D9XA 3KH9A 1ZOFA 3L9VA 1VRSD 1WP0A 4ECJA 4Z2UA 4FYCA 4DEJA 4Z2TA 2HSYA 1W4VA 3QAGA 3QPMA 2OJLA 2FHEA 6GSXA 1SJZA 3E3EA 2HYXA 5DCHA 3KMNA 2QC7A 3IV4A 4OFMA 4F03A 1PA3A 3WGEA 3ZREA 5EY6A 4OD7A 1S3DA 2I3YA 4KCAA 1K3OA 5IPGA 5A4UA 2LV3A 2H1GA 4V2NA 1F37A 2R4VA 2OE1A 1K0CA 3CRTA 4ZBDA 5EPFA 3TKSA 4DSRA 2YWMA 1NHOA 4V2LA 2C0DA 1EOGA 4IBPA 2YJHA 4G0LA 3O6TA 3VPTA 3C1SA 2F9SA 5J4UA 1QK8A 1F3BA 2EIOA 5IOWA 1E2YA 2OBIA 4GSNA 4BVYB 3GYKA 4GQCA 4XTSA 4KF9A 3VWXA 2DJKA 22GSA 4I97A 5G1LA 5DQSA 4IQ1A 5DCGA 2CX4A 1ACVA 4IHUA 1FVKA 3D22A 4TR1B 1GSQA 2YWOA 3HJPA 1WWJA 5DAKB 3FZ5A 3Q74A 1SK2A 3A2WA 4G2EA 2VL9A 3GKKA 3KEBA 3F6FA 3FZ4A 3QAVA 2JADA 2N5AA 1EV4A 3UJ1A 4K6XA 5IMZA 1XPVA 4TVEA 4LMVA 2LSTA 2GSTA 3G7IA 2IMFA 3LSZA 1T4ZA 2ON5A 3MNGA 3KTBA 5IOXA 2ZNMA 3GH6A 4OWYA 3F4TA 2DIYA 2VOCA 1SKRB 4JR4A 1R4WA 2IL3A 4N0ZA 4PUAA 4MABA 2PVQA 1EGRA 5ECLB 2HI7A 3K8NA 1W89A 2R2JA 5G2ZA 3TRXA 1CQHA 1OVNA 18GSA 4NPBA 3U6VA 3LW9A 5B6MA 3UBKA 4EL1A 2B5EA 5IMAA 4TXOB 2F8FA 3GUSA 2H0GA 3IR4A 2H6XA 2L57A 1RW1A 4YQMA 2HSHA 1FO5A 4AJ6A 1MTCA 2O7KA 3H93A 1S3CA 2FUG2 5FWGA 4LL1B 3RHCA 4TN8A 4AGSA 5J9BA 2GT5A 5IMCA 3TRQA 4O5QA 3MWHA 2VD1A 4OCEA 1EV9A 1A0FA 2IN3A 4FO5A 4QL9A 3QMXA 2VLTA 3W6GA 4Q5NA 4K0NA 2FGXA 5F8BA 1G6YA 1IYIA 5DVBA 4FIWA 4TR3A 2MBSA 4CW9A 4KW6A 2I81A 2NTOA 2O8VB 2HXKA 2X49A 5HQPA 4PUFC 1R26A 2HNLA 3M1GA 9GSSA 2DMLA 2N5BA 5ECKB 1G6WA 1K0DA 1YEPA 1GLQA 2XBIA 1ON4A 4HOJA 4YH2A 5ECPB 2RLIA 1K0NA 1X9WB 1XCCA 5ECQB 4RQXA 1V58A 3D0ZA 4KUNA 2LRCA 4OO4A 4NAXA 4GRFA 1EOHA 1GSYA 4KSMA 5JCUA 2H75A 3BD2A 1X5DA 4IELA 2G0FA 2GZYA 5JWQB 2V6OA 2FWEA 3VFIA 1GNWA 1B4QA 4ISDA 5IMFA 2ZCTA 1YJ6A 3F3QA 4LL4B 3W8SA 3FW2A 3GH9A 4L8EA 1DBYA 3PPUA 3G7YA 1NHYA 3IDVA 4ULXA 2CZ3A 5D9TA 4L0UA 1M7TA 2VCXA 3EC3A 5JCGA 5E4WA 3EU4A 1J0FA 3ERFA 1V98A 1JHBA 4X1UA 5IMVA 1R5PA 3D6IA 4V1Ap 5D96A 4XS4B 4PGTA 3C7MA 2H1AA 1KBNA 3H79A 3KXOA 2FY6A 2REMA 1FOHA 2TRXA 2ALBA 4RI6A 5JWOB 3APOA 2PU9C 3M9KA 5AISA 2VL2C 3D4MA 1Q98A 4LLRA 1QMVA 3AY8A 3TGZA 2JACA 1YZXA 5AIXA 4XRAA 3GX0A 1OKTA 3EINA 2KP2A 4YKFA 3ZIVA 5ELGA 4EDYA 2XBQA 2VL3A 3DWVA 1VF3A 4MCUA 2XHFA 2OBKA 4HEA2 1SYRA 2KP1A 2JZRA 2H19A 3MDKA 3GTUB 1FAAA 3LG6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3C1R A;  1FB6 A;  4I8B A;  5D9V A;  1FHE A;  3OR5 A;  2CVB A;  3F0I A;  1WOU A;  2A2S A;  4MZC A;  3GMF A;  5G5E A;  1OKD A;  3TKS E;  3P7X A;  3KZQ A;  1K3Y A;  1T00 A;  1XOB A;  4POL A;  1Z9H A;  4WBJ A;  4L5L A;  2LUS A;  2P0G A;  2L6D A;  1XFL A;  3L4N A;  3EVI A;  3TKP A;  5JWR B;  1AC1 A;  1PD2 1;  3HY2 A;  4E8H A;  4L0W A;  4JRR A;  2GDR A;  1K0B A;  2MYG A;  1Y6E A;  4KAE A;  1ZGN A;  2O89 A;  1GTI A;  2R3X A;  2L4C A;  3ED3 A;  3LFL A;  2H66 A;  1JZD A;  1DUG A;  3FR9 A;  3IAS 2;  4RUV A;  4OFT A;  5F07 A;  2GSR A;  3S9F A;  1TI3 A;  2K18 A;  4MJC A;  2K8S A;  3ZIT A;  4HJ2 A;  1LBK A;  3IA1 A;  4IS0 A;  3LYP A;  2WUL A;  4AJ7 A;  4BVX A;  4K8M A;  1AQW A;  3UL3 A;  2H71 A;  2N5F A;  1GWC A;  3KMO A;  5IM9 A;  2RM5 A;  2JZT A;  1SEN A;  4KGI A;  1ZCP A;  1XWA A;  2H8L A;  3NOF A;  1GTU A;  5J9C A;  2A2R A;  3WT2 A;  4NXI A;  3DML A;  3TJB A;  1AQX A;  3HA9 A;  1O81 A;  3CSJ A;  4RI7 A;  1M9A A;  1U3A A;  1MDJ A;  5ECR B;  4O5R A;  2H6Z A;  2DJ3 A;  3CTG A;  1F6M C;  2FWH A;  4K0G A;  1CQG A;  1R7H A;  2VCT A;  5DJL A;  3RBT A;  3A5W A;  4MMM A;  2FNO A;  3I6A A;  2C8U A;  2XPD A;  2VUP A;  5D93 A;  3VWV A;  5CYY A;  1V40 A;  1XZO A;  4NV5 A;  2GZP A;  3IOS A;  2CAI A;  1EP7 A;  1V2A A;  3FYG A;  4I6X A;  2J9H A;  2O85 A;  4JR6 A;  2YOI A;  2LTK A;  2WDU A;  3EU3 A;  3J7Y b;  3TJG A;  2WCI A;  5KN2 A;  1EZK A;  3HVX A;  5CRG A;  2CQ9 A;  2DBC A;  1HNC A;  1JLV A;  3VI7 A;  1SL1 B;  3QCP A;  3I69 A;  2B1L A;  1RK4 A;  3NIV A;  3ZVJ D;  1EWX A;  1GP1 A;  4ZBA A;  3EYT A;  2E0Q A;  1GTB A;  1MEK A;  3UVT A;  5ID2 A;  3F3R A;  4I5Q A;  3VK9 A;  1MD3 A;  4N10 A;  3KM6 A;  2L4Q A;  1SD9 A;  1U88 A;  2G2Q A;  1ERV A;  4KCE A;  1TJD A;  3LJR A;  3A2V A;  1UVZ A;  3L0H A;  1X9S B;  2MMN A;  4MP4 A;  1Z3E A;  4LMW A;  3WT1 A;  2CA8 A;  4Q5F A;  3UEM A;  3WGD A;  4O7H A;  3DRN A;  2IMI A;  2GQK A;  4NHW A;  1FVJ A;  1TRS A;  3IBH A;  3UAP A;  5CRE A;  3UMA A;  1XW6 A;  1UC7 A;  5B8A A;  2YAN A;  4MF6 A;  4HDE A;  4PNF A;  3D5J A;  3IPZ A;  4K9Z A;  3EUR A;  4QL7 A;  1XWG A;  5H5Q A;  1KNG A;  1OYJ A;  1N2A A;  4ZIL A;  1K3L A;  2YJ7 A;  2I9H A;  5INY A;  1HNA A;  2P31 A;  4GST A;  4MZW A;  4TR0 A;  3C71 A;  1JZR A;  3BCK A;  3RPN A;  3CRU A;  3FHK A;  2B7J A;  1GUL A;  4GWR A;  2FD3 A;  2HFD A;  3F4S A;  4PX1 A;  2J23 A;  4WEY A;  3H1N A;  3SWL A;  3GA4 A;  4HI7 A;  5F05 A;  2CT6 A;  1TRW A;  3HXS A;  1BQ7 A;  1A24 A;  3KP8 A;  2VAF A;  1TK8 B;  3UVH A;  2CAQ A;  2LNS A;  4HU9 A;  5FHI A;  3HZ8 A;  3KGK A;  4H86 A;  2MBT A;  2L6C A;  3TDG A;  5HR2 A;  3QOU A;  4KDX A;  1ZL9 A;  1FG4 A;  4K2D A;  3ME8 A;  2VD0 A;  2H70 A;  1A8Y A;  3QR6 A;  3IRA A;  3F63 A;  4ML6 A;  4XS1 A;  1ML6 A;  3F4R A;  3FZA A;  2QKE A;  1J08 A;  1SYX A;  3GKM A;  17GS A;  2IFQ A;  4JZQ A;  3TJF A;  2I4A A;  4ZBB A;  3P90 A;  2DMM A;  2LJA A;  5LCZ A;  1IYH A;  1XW9 A;  1HNB A;  3IC4 A;  2WB9 A;  1SK1 A;  3I9V 2;  3LWA A;  1KTE A;  2LS5 A;  3GL3 A;  3Q6O A;  1YDK A;  2HZE A;  1I9D A;  2C0G A;  1USB A;  2GLR A;  1O73 A;  4WF4 A;  2VCW A;  1GSD A;  4P3Y B;  1TOF A;  2DLX A;  1A2M A;  12GS A;  4FYU A;  4Q5Q A;  3KP9 A;  1OE7 A;  2YN1 A;  1Q4J A;  4GTU A;  3CXG A;  4HQZ A;  1PSQ A;  5GAN D;  4GF0 A;  3IK7 A;  2DJ0 A;  3CSI A;  3MSZ A;  3QD9 A;  4ECC A;  3IXR A;  5COH A;  4KSO A;  2HZF A;  3D4T A;  4IP1 A;  1MDI A;  1EEM A;  1YKA A;  5DAL A;  2YCD A;  1M0U A;  2A4V A;  3VLN A;  5CAX A;  1M2D A;  1WE0 A;  2HE3 A;  4MLY A;  3KIJ A;  4MJE A;  2B7K A;  1SU9 A;  2I1U A;  3ZRD A;  3DYR A;  1T8E B;  13GS A;  3HDC A;  1VGL A;  4NHZ A;  2FCH A;  5AIV A;  19GS A;  1QGV A;  2LKU A;  3LGC A;  5B7C A;  4E8E A;  4BWQ A;  4LA1 A;  4ZXG A;  1OE8 A;  4K7O A;  2IME A;  4DSS B;  4Z7X A;  2AV4 A;  4EDZ A;  4IQA A;  2YNX A;  4ZB9 A;  3M8N A;  5KN0 A;  1N8J A;  5B8B A;  1K0M A;  2GSS A;  4WET A;  1PGT A;  1YF1 A;  1FOV A;  4OCF A;  3TB2 A;  2H0I A;  5IMD A;  4F9Z A;  5G31 A;  2ES7 A;  5ABR A;  4GCI A;  2MMA A;  1ZMA A;  3SBC A;  3GKX A;  3TOU A;  3N9J A;  3GKN A;  3GNJ A;  2BJX A;  4POB A;  2F8A A;  1AAZ A;  2GVP A;  4L5O A;  4KA0 A;  3HVV A;  2DIZ A;  1GRX A;  2LRT A;  1B48 A;  2LRN A;  5KEJ A;  16GS A;  4G9H A;  2OKA A;  3FY7 A;  3GIX A;  3UOM A;  6GSW A;  2H01 A;  1XWB A;  2GTU A;  1FB0 A;  1OAZ A;  2OE3 A;  4KE3 A;  2XPE A;  3FZ9 A;  3ISO A;  1TP9 A;  1HYU A;  1WPI A;  6GST A;  5GAP D;  1U3I A;  1F3A A;  1JZW A;  1QFN A;  20GS A;  4BL7 A;  1LU4 A;  2AJQ B;  4DSS A;  1XIY A;  3TOT A;  2IJY A;  3KJY A;  5CO3 A;  1PL1 A;  4ML1 A;  5KN3 A;  1JFU A;  2GZZ A;  3VI5 A;  2CVK A;  3IK9 A;  1XXU A;  4I2U A;  1B9Y C;  6GSS A;  4N11 A;  3GSS A;  2V32 A;  4TW5 A;  1SK0 A;  1MDK A;  2X8H A;  2X64 A;  4RQR A;  2DC5 A;  2O87 A;  1Z5Y E;  3DXB A;  4ECB A;  4NWY A;  3ZFB A;  3A2X A;  4GLT A;  2AYT A;  2OE0 A;  3CBU A;  2NDO A;  2B1K A;  3RAZ A;  3Q19 A;  3C8E A;  3HCZ A;  4MPF A;  4O32 A;  2X8G A;  2F3M A;  2LJR A;  2B6M A;  3PH9 A;  5JCW A;  2PUK C;  3GX8 A;  1XVQ A;  4V1A g;  3FRC A;  1YY7 A;  2VLU A;  4KX4 A;  2K9F A;  1QXH A;  4FYB A;  3EWL A;  1NSW A;  5C00 A;  1A23 A;  3RPP A;  1X5E A;  3RDW A;  2H6Y A;  1M9B A;  2GT6 A;  2X99 A;  5GZZ B;  2WRT A;  4I2T A;  5H5R A;  2YZH A;  2B5Y A;  2R5G A;  1JZO A;  3FR6 A;  4TRX A;  1EP8 A;  4HUA A;  4XRD A;  4AF2 A;  1G0T A;  4MDC A;  3UIW A;  3UBL A;  4MA9 A;  2JZS A;  3GV1 A;  3HHV A;  1T3B A;  1ZYE A;  4HS1 A;  3WYW A;  4EO3 A;  3Q18 A;  4N30 A;  4WR5 A;  3US3 A;  3EMX A;  3LXT A;  1V57 A;  5D8I A;  4ZL7 A;  4ID0 A;  1I5G A;  1BJX A;  4CDO A;  2OAC A;  2IWT A;  3ME7 A;  4D73 A;  5ID2 B;  1U87 A;  2AAW A;  2H1B A;  1YKC A;  2YWN A;  2AHE A;  3QFB C;  3I43 A;  4HQS A;  3BCI A;  4K7N A;  1O7U A;  4PXO A;  4MJA A;  2H73 A;  1PKW A;  2X8C A;  2H76 A;  4EE0 A;  3E0U A;  2R6K A;  1GL8 A;  4NMU A;  3VPQ A;  1F2E A;  4ZB6 A;  2V6K A;  1BAY A;  3ZL5 A;  3BOA A;  3GL5 A;  5ECN B;  5D9W A;  3DEX A;  1ILO A;  1XBS A;  3A3T A;  1AUC A;  2TRC P;  2VL2 A;  4J57 E;  3APS A;  5ECI B;  2KLX A;  3M0F A;  2C3Q A;  3ZTL A;  5FT3 A;  4XIH A;  2VIM A;  4IJI A;  3UAR A;  2KUC A;  2H72 A;  4G19 A;  4PQ1 A;  1VF2 A;  4TOP A;  2VO4 A;  3BJ5 A;  2OAD A;  2F51 A;  4GQF A;  3GFK A;  4K7I A;  2RM6 A;  2WGR A;  2XC2 A;  3V1W A;  2IIY A;  1S3A A;  1O85 A;  4QQ7 A;  4MK3 A;  2HRF A;  3HVS A;  3WD6 A;  4IJ3 A;  2NBS A;  2GQM A;  1LJR A;  2LNT A;  4IW9 A;  2DJJ A;  4EXJ A;  2C1Y A;  4MF5 A;  2RUF A;  5HR0 A;  2JL4 A;  3CSH A;  5DDL A;  1OC9 A;  4V2M A;  2PVO C;  2LEG A;  4MF7 A;  1A2L A;  4K1F A;  3TKR A;  3VWW A;  6GSU A;  2MZC A;  1B4P A;  4YQV A;  1UA5 A;  5DBQ A;  2LQQ A;  1OC8 A;  2E2G A;  3PGT A;  5CNW A;  5ECS A;  1RQM A;  3EMP A;  3TJK A;  3TJJ A;  4EC0 A;  2ZUP A;  4F0C A;  1GUM A;  4POK A;  2PGT A;  5EL8 A;  3GST A;  3TKQ A;  4WR4 A;  2K8V A;  3ZZX A;  2IFQ B;  4PUR A;  2YPM A;  2C3T A;  1PKZ A;  2JU5 A;  3KD0 A;  1DE2 A;  2KHP A;  1T7P B;  5CRW A;  2V2G A;  3F9U A;  1WJK A;  2QGV A;  2IMD A;  1Z6N A;  5HFI A;  1A0R P;  4BWS A;  2HZE B;  3D21 A;  1T1V A;  2RII A;  1PQN A;  2YP6 A;  1BG5 A;  3GHA A;  1SL2 B;  1AQV A;  1ZYQ B;  2WJU A;  1GUH A;  5IPH A;  5F0G A;  3DVX A;  2B3S A;  1QUW A;  5A5K A;  4EF0 A;  4FH8 A;  4YQU A;  4OFN A;  3KH7 A;  5B6N A;  1PMT A;  1ERW A;  3NZN A;  1AIU A;  4ACS A;  1SL0 B;  1TKD B;  4JE1 A;  4JED A;  4IKH A;  2Z9S A;  1O8W A;  3MAK A;  1VF4 A;  2LJK A;  4KDY A;  1TRU A;  5DAL B;  4EVM A;  1GLP A;  3TRP A;  1WRY A;  4KH7 A;  1HQO A;  2MMO A;  3W8J A;  1J9B A;  4BVY A;  2VCQ A;  4AJ8 A;  1TTZ A;  5ECO B;  3ZMK A;  2C0E A;  3WGX A;  2CV4 A;  1DSB A;  3VWU A;  2IMK A;  3G7J A;  4KDU A;  2GSQ A;  4ZL8 A;  5HFG A;  4TR1 A;  1ERU A;  2TIR A;  2K6V A;  5DAK A;  3H4K A;  1R5A A;  3E9J B;  3P8W A;  4PQH A;  14GS A;  5GST A;  1G7E A;  3O3T A;  4EKZ A;  2WFC A;  1BX9 A;  2YWI A;  3GRX A;  1UN2 A;  3LQ7 A;  4BA7 A;  1M2B A;  2QSI A;  3ERW A;  1GSF A;  4X43 A;  3FK8 A;  3VUR A;  2FLS A;  1O6J A;  3LOR A;  4IP6 A;  4MZB A;  1TI1 A;  1XOA A;  3ZLP A;  4HZ2 A;  2V1M A;  5L71 A;  3C73 A;  3HD5 A;  5AN1 A;  1AW9 A;  4F82 A;  1GSS A;  3O76 A;  3HJM A;  5DQY A;  1TRV A;  2DSA A;  5HFK A;  5IQY A;  1GTA A;  2GS3 A;  1SKS B;  4NV2 A;  4EUY A;  5LNK e;  1THO A;  1K0A A;  1TXX A;  4IGJ A;  1GNE A;  4KND A;  5G1K A;  4WBR D;  1BYE A;  3LYK A;  1QQ2 A;  3ZVJ A;  3RHB A;  2ON7 A;  4TXO A;  5ELA A;  1M2A A;  1SD8 A;  1NW2 A;  4MH2 A;  2V41 A;  1MD4 A;  1F9M A;  2E2M A;  1X9M B;  4YAV A;  2M72 A;  2YV7 A;  1SJ6 A;  3QDN A;  3HKR A;  4YAP A;  5DJM A;  1TK5 B;  3L9S A;  1AXD A;  3U5R E;  5H5S A;  4J56 E;  2P5R A;  5HR3 A;  7GSS A;  4WF5 A;  2L5L A;  2H74 A;  3J7Y k;  1TU8 A;  4BPY A;  6GSY A;  1FW1 A;  4HZ4 A;  1Y25 A;  2NVL A;  3N5O A;  4PQI A;  2H30 A;  3ERG A;  3HJO A;  2OA7 A;  5AGY A;  2C0F A;  1VF1 A;  2BTO T;  2FWG A;  5CP1 A;  1M99 A;  2DJ2 A;  2L59 A;  4ILF A;  2E7P A;  1V9W A;  2CVD A;  2AUV A;  3IHQ A;  3TUE A;  1PRX A;  4O92 A;  3PIN A;  3P2A A;  1URM A;  2VCZ A;  2EIQ A;  3L9U A;  1THX A;  3GN3 A;  2FA8 A;  1BED A;  1B8X A;  1E6B A;  1H75 A;  4ZB8 A;  1Z6M A;  4G10 A;  1T4Y A;  1A2J A;  2LQO A;  5IO0 A;  2EC4 A;  3ZYW A;  1WMJ A;  3GUR A;  3F6D A;  3DVW A;  1A8L A;  10GS A;  2C3N A;  2JSY A;  4TXV A;  1TK0 B;  2KOK A;  3JCM L;  1XW5 A;  3DIE A;  4JU5 A;  1PN9 A;  3IE3 A;  1YF0 A;  3EE2 A;  3ZIJ A;  1TDI A;  4PNG A;  1PX6 A;  1PL2 A;  1ERT A;  1KEB A;  5J41 A;  4IN0 A;  5D73 A;  4TKY A;  3CYN A;  3TCO A;  3DGQ A;  4POM A;  3KCM A;  5ECH B;  4DVC A;  1X0R A;  2RUE A;  3LXZ A;  4XCS A;  4X0X A;  8GSS A;  5IO2 A;  1YQ1 A;  2BMX A;  2AB6 A;  1G7O A;  2EIR A;  2MMZ A;  4F0B A;  2WS2 A;  1YEX A;  4MJB A;  1OC3 A;  2VM2 A;  4XS4 A;  1ABA A;  4KB3 A;  3TKS C;  1WIK A;  5HR1 A;  5F06 A;  4DSQ A;  4N0V A;  3ZFL A;  5ECM B;  4D73 B;  1PX7 A;  3F8U A;  5E59 A;  1O8X A;  2C4J A;  3KTL A;  4OO5 A;  1K0O A;  2PBJ A;  2R37 A;  3LEF A;  1B9X C;  2NPB A;  2IPA A;  5KN1 A;  1ZZY A;  4GXZ A;  4HU7 A;  1H4O A;  3HYP A;  3R2Q A;  2H0H A;  1U6T A;  4ZL9 A;  5EVO A;  3H8Q A;  2HLS A;  1NM3 A;  1EEJ A;  6GSV A;  2VLV A;  2PMT A;  1HD2 A;  4MH3 A;  2VCV A;  5CRD A;  3APQ A;  4XS6 A;  4J2F A;  4TR4 A;  2FWF A;  1XWK A;  2D2Z A;  2L5O A;  2GGT A;  1Z7P A;  1GSU A;  2H1D A;  1DE1 A;  1XVW A;  3GTU A;  4IVF A;  2PPT A;  2WZ9 A;  1X5C A;  3QFA C;  3FKF A;  4CHS A;  2PWJ A;  1Z7R A;  4OMV A;  5G30 A;  1SJI A;  5G5F A;  2HRN A;  3CTF A;  2PER A;  2P5Q A;  2CX3 A;  3QAW A;  1TU7 A;  4WXT A;  3G9B A;  1EGO A;  2JSZ A;  2HT9 A;  11GS A;  3CMI A;  2C80 A;  2DJ1 A;  5A4V A;  3M3M A;  4ZIJ A;  5C04 A;  4GSS A;  2CZ2 A;  4ECI A;  1GUK A;  5ENU A;  4HJM A;  2GQL A;  3DD3 A;  2VM1 A;  5J5N A;  1GSE A;  5A4W A;  5GSS A;  2B5X A;  3PR8 A;  3FEU A;  3FR3 A;  5CRH A;  3L78 A;  1XWC A;  4JBB A;  1JLW A;  4F2I A;  4MPG A;  5IIZ A;  2YV9 A;  2M46 A;  3HZ4 A;  1OC9 B;  1ST9 A;  4XHM A;  5J3R A;  3M9J A;  3IAM 2;  3ZML A;  5LD0 A;  2FA4 A;  2PN8 A;  1C72 A;  4Q5R A;  2YZU A;  3DKS A;  1SKW B;  1GH2 A;  2M80 A;  3BBY A;  1TW9 A;  4WKW A;  5D9X A;  3KH9 A;  1ZOF A;  3L9V A;  1VRS D;  1WP0 A;  4ECJ A;  4FYC A;  4DEJ A;  2HSY A;  1W4V A;  3QAG A;  3QPM A;  2OJL A;  2FHE A;  6GSX A;  1SJZ A;  3E3E A;  2HYX A;  5DCH A;  3KMN A;  2QC7 A;  3IV4 A;  4OFM A;  4F03 A;  1PA3 A;  3WGE A;  3ZRE A;  5EY6 A;  4OD7 A;  1S3D A;  2I3Y A;  4KCA A;  1K3O A;  5IPG A;  5A4U A;  2LV3 A;  2H1G A;  4V2N A;  1F37 A;  2R4V A;  2OE1 A;  1K0C A;  3CRT A;  4ZBD A;  5EPF A;  3TKS A;  4DSR A;  2YWM A;  1NHO A;  4V2L A;  2C0D A;  1EOG A;  4IBP A;  2YJH A;  3O6T A;  3VPT A;  3C1S A;  2F9S A;  5J4U A;  1QK8 A;  1F3B A;  2EIO A;  5IOW A;  1E2Y A;  2OBI A;  4GSN A;  3GYK A;  4GQC A;  4XTS A;  3VWX A;  2DJK A;  22GS A;  4I97 A;  5G1L A;  5DQS A;  4IQ1 A;  5DCG A;  2CX4 A;  1ACV A;  4IHU A;  1FVK A;  3D22 A;  4TR1 B;  1GSQ A;  2YWO A;  3HJP A;  1WWJ A;  5DAK B;  3FZ5 A;  3Q74 A;  1SK2 A;  3A2W A;  4G2E A;  2VL9 A;  3GKK A;  3KEB A;  3F6F A;  3FZ4 A;  3QAV A;  2JAD A;  2N5A A;  1EV4 A;  3UJ1 A;  4K6X A;  5IMZ A;  1XPV A;  4TVE A;  4LMV A;  2LST A;  2GST A;  3G7I A;  2IMF A;  3LSZ A;  1T4Z A;  2ON5 A;  3MNG A;  3KTB A;  5IOX A;  2ZNM A;  3GH6 A;  4OWY A;  3F4T A;  2DIY A;  2VOC A;  1SKR B;  4JR4 A;  1R4W A;  2IL3 A;  4N0Z A;  4PUA A;  4MAB A;  2PVQ A;  1EGR A;  5ECL B;  2HI7 A;  3K8N A;  1W89 A;  2R2J A;  5G2Z A;  3TRX A;  1CQH A;  1OVN A;  18GS A;  4NPB A;  3U6V A;  5B6M A;  3UBK A;  4EL1 A;  2B5E A;  5IMA A;  4TXO B;  2F8F A;  3GUS A;  2H0G A;  3IR4 A;  2H6X A;  2L57 A;  1RW1 A;  4YQM A;  2HSH A;  1FO5 A;  4AJ6 A;  1MTC A;  2O7K A;  3H93 A;  1S3C A;  2FUG 2;  5FWG A;  4LL1 B;  3RHC A;  4TN8 A;  4AGS A;  5J9B A;  2GT5 A;  5IMC A;  3TRQ A;  3MWH A;  2VD1 A;  4OCE A;  1EV9 A;  1A0F A;  2IN3 A;  4FO5 A;  4QL9 A;  3QMX A;  2VLT A;  3W6G A;  4Q5N A;  4K0N A;  2FGX A;  5F8B A;  1G6Y A;  1IYI A;  5DVB A;  4FIW A;  4TR3 A;  2MBS A;  4CW9 A;  4KW6 A;  2I81 A;  2NTO A;  2O8V B;  2HXK A;  5HQP A;  4PUF C;  1R26 A;  2HNL A;  3M1G A;  9GSS A;  2DML A;  2N5B A;  5ECK B;  1G6W A;  1K0D A;  1YEP A;  1GLQ A;  2XBI A;  1ON4 A;  4HOJ A;  4YH2 A;  5ECP B;  2RLI A;  1K0N A;  1X9W B;  1XCC A;  5ECQ B;  4RQX A;  1V58 A;  3D0Z A;  4KUN A;  2LRC A;  4OO4 A;  4NAX A;  4GRF A;  1EOH A;  1GSY A;  4KSM A;  5JCU A;  2H75 A;  3BD2 A;  1X5D A;  4IEL A;  2G0F A;  2GZY A;  5JWQ B;  2V6O A;  2FWE A;  3VFI A;  1GNW A;  1B4Q A;  4ISD A;  5IMF A;  2ZCT A;  1YJ6 A;  3F3Q A;  4LL4 B;  3W8S A;  3FW2 A;  3GH9 A;  4L8E A;  1DBY A;  3G7Y A;  1NHY A;  3IDV A;  4ULX A;  2CZ3 A;  5D9T A;  4L0U A;  1M7T A;  2VCX A;  3EC3 A;  5JCG A;  5E4W A;  3EU4 A;  1J0F A;  3ERF A;  1V98 A;  1JHB A;  4X1U A;  5IMV A;  1R5P A;  3D6I A;  4V1A p;  5D96 A;  4XS4 B;  4PGT A;  3C7M A;  2H1A A;  1KBN A;  3H79 A;  3KXO A;  2FY6 A;  2REM A;  2TRX A;  2ALB A;  4RI6 A;  5JWO B;  3APO A;  2PU9 C;  3M9K A;  5AIS A;  2VL2 C;  3D4M A;  1Q98 A;  4LLR A;  1QMV A;  3AY8 A;  3TGZ A;  2JAC A;  1YZX A;  5AIX A;  4XRA A;  3GX0 A;  1OKT A;  3EIN A;  2KP2 A;  3ZIV A;  5ELG A;  4EDY A;  2XBQ A;  2VL3 A;  3DWV A;  1VF3 A;  4MCU A;  2XHF A;  2OBK A;  4HEA 2;  1SYR A;  2KP1 A;  2JZR A;  2H19 A;  3MDK A;  3GTU B;  1FAA A;  3LG6 A; 
#chains in the Genus database with same CATH topology
 3C1R A;  1FB6 A;  4I8B A;  5D9V A;  1FHE A;  3OR5 A;  2CVB A;  3F0I A;  1WOU A;  2A2S A;  4MZC A;  3GMF A;  5G5E A;  1OKD A;  3TKS E;  3P7X A;  3KZQ A;  1K3Y A;  1T00 A;  1XOB A;  4POL A;  1Z9H A;  4WBJ A;  4L5L A;  2LUS A;  2P0G A;  2A2P A;  2L6D A;  1XFL A;  3L4N A;  3EVI A;  3TKP A;  5JWR B;  4K2X A;  1AC1 A;  1PD2 1;  3HY2 A;  4E8H A;  4L0W A;  4JRR A;  2GDR A;  3A5I A;  1K0B A;  2MYG A;  1Y6E A;  4KAE A;  1ZGN A;  2O89 A;  1GTI A;  2R3X A;  2L4C A;  3ED3 A;  3LFL A;  2H66 A;  1JZD A;  1DUG A;  3FR9 A;  3IAS 2;  4RUV A;  4OFT A;  5F07 A;  2GSR A;  2HRK A;  4G0I A;  3S9F A;  1TI3 A;  2K18 A;  4MJC A;  2K8S A;  3ZIT A;  4HJ2 A;  1LBK A;  3IA1 A;  4IS0 A;  3LYP A;  2WUL A;  4AJ7 A;  4BVX A;  4K8M A;  1AQW A;  3UL3 A;  2H71 A;  2N5F A;  1GWC A;  3KMO A;  5IM9 A;  2RM5 A;  2JZT A;  1SEN A;  4KGI A;  1ZCP A;  1XWA A;  2H8L A;  3NOF A;  2UZ8 A;  1GTU A;  5BMU A;  5J9C A;  2A2R A;  3WT2 A;  4NXI A;  3DML A;  3TJB A;  1AQX A;  3HA9 A;  1O81 A;  3CSJ A;  4RI7 A;  1M9A A;  1U3A A;  1MDJ A;  3FMW A;  5ECR B;  4O5R A;  4EIQ A;  2H6Z A;  2DJ3 A;  3CTG A;  1F6M C;  2FWH A;  4K0G A;  1CQG A;  1R7H A;  2VCT A;  5DJL A;  3RBT A;  3A5W A;  4MMM A;  2FNO A;  3I6A A;  2C8U A;  2XPD A;  2VUP A;  5D93 A;  3VWV A;  5CYY A;  1V40 A;  1XZO A;  4NV5 A;  2GZP A;  3IOS A;  2CAI A;  1EP7 A;  1V2A A;  3FYG A;  4I6X A;  2J9H A;  2O85 A;  4JR6 A;  4FQU A;  2YOI A;  2LTK A;  2WDU A;  3EU3 A;  3J7Y b;  3TJG A;  2WCI A;  5KN2 A;  1EZK A;  3HVX A;  5CRG A;  2CQ9 A;  2DBC A;  1HNC A;  1JLV A;  3VI7 A;  1SL1 B;  3QCP A;  3I69 A;  2B1L A;  1RK4 A;  3NIV A;  3ZVJ D;  1EWX A;  1GP1 A;  4ZBA A;  3EYT A;  2E0Q A;  1GTB A;  1MEK A;  3UVT A;  5ID2 A;  3F3R A;  5KOW A;  4I5Q A;  3VK9 A;  1MD3 A;  4N10 A;  3KM6 A;  2QA1 A;  2L4Q A;  1SD9 A;  1U88 A;  2G2Q A;  1ERV A;  4KCE A;  1TJD A;  3LJR A;  3A2V A;  1UVZ A;  3L0H A;  1X9S B;  2MMN A;  4MP4 A;  1Z3E A;  4LMW A;  3WT1 A;  2CA8 A;  4Q5F A;  3UEM A;  3WGD A;  4O7H A;  3DRN A;  2IMI A;  2GQK A;  4NHW A;  1FVJ A;  1TRS A;  3IBH A;  3UAP A;  5CRE A;  3UMA A;  2A4H A;  1XW6 A;  1UC7 A;  5B8A A;  2YAN A;  4MF6 A;  4HDE A;  4PNF A;  3D5J A;  3IPZ A;  4K9Z A;  3EUR A;  4QL7 A;  1XWG A;  5H5Q A;  1KNG A;  1OYJ A;  1N2A A;  4ZIL A;  1K3L A;  2YJ7 A;  2I9H A;  2DKI A;  5INY A;  1HNA A;  2P31 A;  4GST A;  4MZW A;  4TR0 A;  3C71 A;  1JZR A;  3BCK A;  3RPN A;  3CRU A;  3FHK A;  2B7J A;  1GUL A;  4GWR A;  2FD3 A;  2HFD A;  3F4S A;  4PX1 A;  2J23 A;  4WEY A;  1S3R A;  3H1N A;  3SWL A;  3GA4 A;  4HI7 A;  2CT6 A;  3HXS A;  1TRW A;  5F05 A;  1BQ7 A;  1A24 A;  3KP8 A;  2VAF A;  1TK8 B;  3UVH A;  2CAQ A;  2LNS A;  4HU9 A;  5FHI A;  3HZ8 A;  3KGK A;  4H86 A;  2MBT A;  2L6C A;  3TDG A;  5HR2 A;  3QOU A;  4KDX A;  1ZL9 A;  1FG4 A;  4K2D A;  2QA2 A;  3ME8 A;  2VD0 A;  4USS A;  2H70 A;  1A8Y A;  3QR6 A;  3IRA A;  3MIX A;  3F63 A;  4ML6 A;  4XS1 A;  1ML6 A;  3F4R A;  3FZA A;  2QKE A;  1J08 A;  1SYX A;  3GKM A;  17GS A;  2IFQ A;  4JZQ A;  3TJF A;  2I4A A;  4ZBB A;  3P90 A;  2DMM A;  2LJA A;  5LCZ A;  1IYH A;  1XW9 A;  1HNB A;  3IC4 A;  2WB9 A;  1SK1 A;  3I9V 2;  3LWA A;  1KTE A;  2LS5 A;  3GL3 A;  3Q6O A;  1YDK A;  2HZE A;  1I9D A;  2C0G A;  1USB A;  2GLR A;  1O73 A;  4WF4 A;  2VCW A;  1GSD A;  4P3Y B;  1TOF A;  2DLX A;  1A2M A;  12GS A;  4FYU A;  4Q5Q A;  3KP9 A;  1OE7 A;  2YN1 A;  1Q4J A;  4GTU A;  3CXG A;  4HQZ A;  1PSQ A;  5GAN D;  4GF0 A;  3IK7 A;  2DJ0 A;  3CSI A;  3MSZ A;  3QD9 A;  4ECC A;  3IXR A;  5COH A;  4KSO A;  2HZF A;  3D4T A;  4IP1 A;  1MDI A;  1EEM A;  1YKA A;  5DAL A;  2YCD A;  1M0U A;  2A4V A;  4G0K A;  3VLN A;  5CAX A;  1M2D A;  1WE0 A;  2HE3 A;  4MLY A;  3KIJ A;  4MJE A;  2B7K A;  1SU9 A;  2I1U A;  3ZRD A;  3DYR A;  1T8E B;  13GS A;  3HDC A;  1VGL A;  4NHZ A;  2FCH A;  5AIV A;  19GS A;  1QGV A;  2LKU A;  3LGC A;  5B7C A;  4E8E A;  4BWQ A;  4LA1 A;  4ZXG A;  1OE8 A;  4K7O A;  3IC8 A;  2IME A;  4DSS B;  4Z7X A;  2AV4 A;  4EDZ A;  4IQA A;  2YNX A;  4ZB9 A;  3M8N A;  5KN0 A;  4YKG A;  1N8J A;  5B8B A;  1K0M A;  2GSS A;  4WET A;  1PGT A;  1YF1 A;  1FOV A;  4OCF A;  3TB2 A;  2H0I A;  5IMD A;  4F9Z A;  5G31 A;  2ES7 A;  5ABR A;  4GCI A;  2MMA A;  1ZMA A;  3SBC A;  3GKX A;  1PN0 A;  3TOU A;  3N9J A;  3GKN A;  3GNJ A;  2BJX A;  4POB A;  2F8A A;  1AAZ A;  2GVP A;  4L5O A;  4KA0 A;  3HVV A;  2DIZ A;  1GRX A;  2LRT A;  1B48 A;  2LRN A;  5KEJ A;  16GS A;  4G9H A;  2OKA A;  3FY7 A;  3GIX A;  3UOM A;  6GSW A;  2H01 A;  1XWB A;  2GTU A;  1FB0 A;  1OAZ A;  2OE3 A;  4KE3 A;  2XPE A;  3FZ9 A;  3ISO A;  1TP9 A;  1HYU A;  1WPI A;  6GST A;  5GAP D;  1U3I A;  1F3A A;  1JZW A;  1QFN A;  20GS A;  4BL7 A;  1LU4 A;  2AJQ B;  4DSS A;  1XIY A;  3TOT A;  2IJY A;  3KJY A;  5CO3 A;  1PL1 A;  4ML1 A;  5KN3 A;  1JFU A;  2GZZ A;  3VI5 A;  4BVX B;  2CVK A;  3IK9 A;  1XXU A;  4I2U A;  1B9Y C;  6GSS A;  4N11 A;  3GSS A;  2V32 A;  4TW5 A;  1SK0 A;  1MDK A;  2X8H A;  2X64 A;  4RQR A;  2DC5 A;  2O87 A;  1Z5Y E;  3DXB A;  4ECB A;  4NWY A;  3ZFB A;  3A2X A;  4GLT A;  2AYT A;  2OE0 A;  3CBU A;  2NDO A;  2B1K A;  3RAZ A;  3Q19 A;  3C8E A;  3HCZ A;  4MPF A;  4O32 A;  2X8G A;  2F3M A;  2LJR A;  2B6M A;  3PH9 A;  5JCW A;  2PUK C;  3GX8 A;  1XVQ A;  4V1A g;  1M3J A;  3FRC A;  4K5S A;  1YY7 A;  2VLU A;  4KX4 A;  2K9F A;  1QXH A;  4FYB A;  3EWL A;  1NSW A;  5C00 A;  1A23 A;  3RPP A;  1X5E A;  2R0C A;  3RDW A;  2H6Y A;  1M9B A;  2GT6 A;  2X99 A;  5GZZ B;  2WRT A;  4I2T A;  5H5R A;  2YZH A;  2B5Y A;  2R5G A;  1JZO A;  3FR6 A;  4TRX A;  1EP8 A;  4HUA A;  4XRD A;  4AF2 A;  1G0T A;  4MDC A;  3UIW A;  3UBL A;  4MA9 A;  2JZS A;  3GV1 A;  3HHV A;  1T3B A;  4EIP A;  1ZYE A;  4HS1 A;  3WYW A;  4EO3 A;  3Q18 A;  4N30 A;  3R3E A;  4WR5 A;  3US3 A;  3EMX A;  3LXT A;  1V57 A;  5D8I A;  4ZL7 A;  4ICY A;  4ID0 A;  1I5G A;  1BJX A;  4CDO A;  2OAC A;  2IWT A;  3ME7 A;  4D73 A;  5ID2 B;  1U87 A;  2AAW A;  2H1B A;  1YKC A;  2YWN A;  2AHE A;  3QFB C;  3I43 A;  4HQS A;  3BCI A;  4K7N A;  4O5U A;  1O7U A;  4PXO A;  4MJA A;  3HVN A;  2H73 A;  1PKW A;  2X8C A;  2H76 A;  4EE0 A;  3E0U A;  2R6K A;  1GL8 A;  4NMU A;  3VPQ A;  1F2E A;  4ZB6 A;  2V6K A;  1BAY A;  4MNN A;  3ZL5 A;  3BOA A;  3GL5 A;  5ECN B;  5D9W A;  4CY6 A;  3DEX A;  1ILO A;  1XBS A;  3A3T A;  1AUC A;  2TRC P;  2VL2 A;  4J57 E;  3APS A;  5ECI B;  2KLX A;  3M0F A;  2C3Q A;  3ZTL A;  5FT3 A;  4XIH A;  5BRT A;  2VIM A;  4IJI A;  3UAR A;  2KUC A;  2H72 A;  4G19 A;  4PQ1 A;  1VF2 A;  4TOP A;  2VO4 A;  3BJ5 A;  2OAD A;  2F51 A;  4GQF A;  3GFK A;  4K7I A;  2R0G A;  2RM6 A;  2WGR A;  2XC2 A;  2HRA A;  3V1W A;  2IIY A;  1S3A A;  1O85 A;  4QQ7 A;  4MK3 A;  2HRF A;  3HVS A;  3WD6 A;  4IJ3 A;  2NBS A;  2GQM A;  1LJR A;  2LNT A;  4IW9 A;  2DJJ A;  4EXJ A;  2C1Y A;  4MF5 A;  2RUF A;  5HR0 A;  2JL4 A;  3CSH A;  4K5R A;  5DDL A;  1OC9 A;  4V2M A;  2PVO C;  2LEG A;  4MF7 A;  1A2L A;  4K1F A;  3TKR A;  3VWW A;  6GSU A;  2MZC A;  1B4P A;  4YQV A;  2R0P A;  1UA5 A;  5DBQ A;  2LQQ A;  2HSM A;  1OC8 A;  2E2G A;  3PGT A;  5CNW A;  5ECS A;  1RQM A;  3EMP A;  3TJK A;  3TJJ A;  4EC0 A;  2ZUP A;  4F0C A;  1GUM A;  4POK A;  2PGT A;  5EL8 A;  3GST A;  3TKQ A;  4WR4 A;  2K8V A;  3ZZX A;  2IFQ B;  4PUR A;  2YPM A;  2C3T A;  1PKZ A;  2JU5 A;  3KD0 A;  1DE2 A;  2KHP A;  1T7P B;  5CRW A;  2V2G A;  3F9U A;  1WJK A;  2QGV A;  2IMD A;  1Z6N A;  5HFI A;  1A0R P;  4BWS A;  2HZE B;  3D21 A;  1T1V A;  2RII A;  1PQN A;  2YP6 A;  1BG5 A;  3GHA A;  1SL2 B;  1AQV A;  1ZYQ B;  4X4J A;  2WJU A;  1GUH A;  5IPH A;  5F0G A;  3DVX A;  2B3S A;  1QUW A;  1ZYN A;  5A5K A;  4EF0 A;  4FH8 A;  4CY8 A;  4YQU A;  4OFN A;  3KH7 A;  5B6N A;  1PMT A;  1ERW A;  3NZN A;  1AIU A;  4ACS A;  1SL0 B;  1TKD B;  4JE1 A;  4JED A;  4IKH A;  2Z9S A;  1O8W A;  3MAK A;  1VF4 A;  2LJK A;  4KDY A;  1TRU A;  5DAL B;  4EVM A;  1GLP A;  3TRP A;  1WRY A;  4KH7 A;  1HQO A;  2MMO A;  3W8J A;  1J9B A;  4BVY A;  2VCQ A;  4AJ8 A;  1TTZ A;  5ECO B;  3ZMK A;  2C0E A;  3WGX A;  2CV4 A;  1DSB A;  3VWU A;  2IMK A;  3G7J A;  4KDU A;  2GSQ A;  4ZL8 A;  5HFG A;  4TR1 A;  1ERU A;  2TIR A;  2K6V A;  5DAK A;  3H4K A;  1R5A A;  3E9J B;  3P8W A;  4PQH A;  14GS A;  5GST A;  1G7E A;  3O3T A;  4EKZ A;  2WFC A;  1BX9 A;  2YWI A;  3GRX A;  1UN2 A;  3LQ7 A;  4BA7 A;  3MYD A;  1M2B A;  2QSI A;  3ERW A;  1GSF A;  4X43 A;  3FK8 A;  3VUR A;  2FLS A;  1O6J A;  3LOR A;  4IP6 A;  4MZB A;  1TI1 A;  1XOA A;  3ZLP A;  4HZ2 A;  2V1M A;  5L71 A;  3C73 A;  3HD5 A;  5AN1 A;  1AW9 A;  4F82 A;  1GSS A;  3O76 A;  3HJM A;  5DQY A;  1TRV A;  2DSA A;  5HFK A;  5IQY A;  1GTA A;  2GS3 A;  1SKS B;  4NV2 A;  4EUY A;  5LNK e;  1THO A;  1K0A A;  1TXX A;  4IGJ A;  1GNE A;  4KND A;  5G1K A;  4WBR D;  1BYE A;  3LYK A;  1QQ2 A;  3ZVJ A;  3RHB A;  2ON7 A;  4TXO A;  5ELA A;  1M2A A;  1SD8 A;  1NW2 A;  4MH2 A;  2V41 A;  1MD4 A;  1F9M A;  2E2M A;  1X9M B;  4YAV A;  2M72 A;  2YV7 A;  1SJ6 A;  4BL7 B;  3QDN A;  3HKR A;  4YAP A;  5DJM A;  1TK5 B;  3L9S A;  1AXD A;  3U5R E;  5H5S A;  4J56 E;  2P5R A;  5HR3 A;  7GSS A;  4WF5 A;  2L5L A;  2H74 A;  3J7Y k;  1TU8 A;  4BPY A;  6GSY A;  1FW1 A;  3EPT A;  4HZ4 A;  1Y25 A;  2NVL A;  3N5O A;  4PQI A;  2H30 A;  3ERG A;  3HJO A;  2OA7 A;  5AGY A;  2C0F A;  1VF1 A;  2BTO T;  2FWG A;  5CP1 A;  1M99 A;  2DJ2 A;  2L59 A;  4ILF A;  4PTS A;  2E7P A;  1V9W A;  2CVD A;  2AUV A;  3IHQ A;  3TUE A;  1PRX A;  4O92 A;  3PIN A;  3P2A A;  1URM A;  2VCZ A;  2EIQ A;  3L9U A;  1THX A;  3GN3 A;  2FA8 A;  1BED A;  1B8X A;  1E6B A;  1H75 A;  4ZB8 A;  1Z6M A;  4G10 A;  1T4Y A;  1A2J A;  2LQO A;  3IHG A;  1PFO A;  5IO0 A;  2EC4 A;  3ZYW A;  1WMJ A;  3GUR A;  3F6D A;  3DVW A;  1A8L A;  10GS A;  2C3N A;  1M3I A;  2JSY A;  4TXV A;  1TK0 B;  2KOK A;  3JCM L;  1XW5 A;  3DIE A;  4JU5 A;  1PN9 A;  3IE3 A;  1YF0 A;  3EE2 A;  3ZIJ A;  1TDI A;  4PNG A;  1PX6 A;  1PL2 A;  1ERT A;  1KEB A;  4Z2R A;  5J41 A;  4IN0 A;  5D73 A;  4TKY A;  3CYN A;  3TCO A;  3DGQ A;  4POM A;  3KCM A;  5ECH B;  4DVC A;  1X0R A;  2RUE A;  3LXZ A;  4XCS A;  4X0X A;  8GSS A;  5IO2 A;  1YQ1 A;  2BMX A;  2AB6 A;  1G7O A;  2EIR A;  2MMZ A;  4F0B A;  2WS2 A;  1YEX A;  4MJB A;  1OC3 A;  2VM2 A;  4XS4 A;  1ABA A;  4KB3 A;  3TKS C;  1WIK A;  5HR1 A;  5F06 A;  4DSQ A;  4N0V A;  3ZFL A;  5ECM B;  4D73 B;  1PX7 A;  3F8U A;  5E59 A;  1O8X A;  2C4J A;  3CQF A;  3KTL A;  4OO5 A;  1K0O A;  2PBJ A;  2R37 A;  3LEF A;  1B9X C;  2NPB A;  2IPA A;  5KN1 A;  1ZZY A;  4GXZ A;  4HU7 A;  1H4O A;  2X4A A;  3HYP A;  3R2Q A;  2H0H A;  1U6T A;  4ZL9 A;  5EVO A;  3H8Q A;  2HLS A;  1NM3 A;  1EEJ A;  5KOX A;  6GSV A;  2VLV A;  2PMT A;  1HD2 A;  4MH3 A;  2VCV A;  5CRD A;  3APQ A;  4XS6 A;  4J2F A;  4TR4 A;  2FWF A;  1XWK A;  2D2Z A;  2L5O A;  2GGT A;  1Z7P A;  1GSU A;  2H1D A;  1DE1 A;  1XVW A;  3GTU A;  4IVF A;  2PPT A;  2WZ9 A;  1X5C A;  3QFA C;  3FKF A;  4CHS A;  2PWJ A;  1Z7R A;  4OMV A;  5G30 A;  1SJI A;  5G5F A;  2HRN A;  3CTF A;  2PER A;  2P5Q A;  4BIK A;  2CX3 A;  3QAW A;  1TU7 A;  4WXT A;  4A5P A;  3G9B A;  1EGO A;  2JSZ A;  2HT9 A;  11GS A;  3CMI A;  2C80 A;  2DJ1 A;  5A4V A;  3M3M A;  4ZIJ A;  5C04 A;  4GSS A;  2CZ2 A;  4ECI A;  1GUK A;  5ENU A;  4HJM A;  2DKH A;  2GQL A;  3DD3 A;  2VM1 A;  5J5N A;  1GSE A;  5A4W A;  5GSS A;  2B5X A;  3PR8 A;  3FEU A;  3FR3 A;  1ZYP A;  5CRH A;  3L78 A;  1XWC A;  4JBB A;  1JLW A;  4F2I A;  4MPG A;  5IIZ A;  2YV9 A;  2M46 A;  3HZ4 A;  1OC9 B;  1ST9 A;  4XHM A;  5J3R A;  3M9J A;  3IAM 2;  3ZML A;  5LD0 A;  2FA4 A;  2PN8 A;  1C72 A;  4Q5R A;  2YZU A;  3DKS A;  1SKW B;  1GH2 A;  2M80 A;  3BBY A;  1TW9 A;  4WKW A;  5D9X A;  3KH9 A;  1ZOF A;  3L9V A;  1VRS D;  1WP0 A;  4ECJ A;  4Z2U A;  4FYC A;  4DEJ A;  4Z2T A;  2HSY A;  1W4V A;  3QAG A;  3QPM A;  2OJL A;  2FHE A;  6GSX A;  1SJZ A;  3E3E A;  2HYX A;  5DCH A;  3KMN A;  2QC7 A;  3IV4 A;  4OFM A;  4F03 A;  1XG8 A;  1PA3 A;  3WGE A;  3ZRE A;  5EY6 A;  4OD7 A;  1S3D A;  2I3Y A;  4KCA A;  1K3O A;  5IPG A;  5A4U A;  2LV3 A;  2H1G A;  4V2N A;  1F37 A;  2R4V A;  2OE1 A;  1K0C A;  3CRT A;  4ZBD A;  5EPF A;  3TKS A;  4DSR A;  2YWM A;  1NHO A;  4V2L A;  2C0D A;  1EOG A;  4IBP A;  2YJH A;  4G0L A;  3O6T A;  3VPT A;  3C1S A;  2F9S A;  5J4U A;  1QK8 A;  1F3B A;  2EIO A;  5IOW A;  1E2Y A;  2OBI A;  4GSN A;  4BVY B;  3GYK A;  4GQC A;  4XTS A;  4KF9 A;  3VWX A;  2DJK A;  22GS A;  4I97 A;  5G1L A;  5DQS A;  4IQ1 A;  5DCG A;  2CX4 A;  1ACV A;  4IHU A;  1FVK A;  3D22 A;  4TR1 B;  1GSQ A;  2YWO A;  3HJP A;  1WWJ A;  5DAK B;  3FZ5 A;  3Q74 A;  1SK2 A;  3A2W A;  4G2E A;  2VL9 A;  3GKK A;  3KEB A;  3F6F A;  3FZ4 A;  3QAV A;  2JAD A;  2N5A A;  1EV4 A;  3UJ1 A;  4K6X A;  5IMZ A;  1XPV A;  4TVE A;  4LMV A;  2LST A;  2GST A;  3G7I A;  2IMF A;  3LSZ A;  1T4Z A;  2ON5 A;  3MNG A;  3KTB A;  5IOX A;  2ZNM A;  3GH6 A;  4OWY A;  3F4T A;  2DIY A;  2VOC A;  1SKR B;  4JR4 A;  1R4W A;  2IL3 A;  4N0Z A;  4PUA A;  4MAB A;  2PVQ A;  1EGR A;  5ECL B;  2HI7 A;  3K8N A;  4HSC X;  1W89 A;  2R2J A;  5G2Z A;  3TRX A;  1CQH A;  1OVN A;  18GS A;  4NPB A;  3U6V A;  3LW9 A;  5B6M A;  3UBK A;  4EL1 A;  2B5E A;  5IMA A;  4TXO B;  2F8F A;  3GUS A;  2H0G A;  3IR4 A;  2H6X A;  2L57 A;  1RW1 A;  4YQM A;  2HSH A;  1FO5 A;  4AJ6 A;  1MTC A;  2O7K A;  3H93 A;  1S3C A;  2FUG 2;  5FWG A;  4LL1 B;  3RHC A;  4TN8 A;  4AGS A;  5J9B A;  2GT5 A;  5IMC A;  3TRQ A;  4O5Q A;  3MWH A;  2VD1 A;  4OCE A;  1EV9 A;  1A0F A;  2IN3 A;  4FO5 A;  4QL9 A;  3QMX A;  2VLT A;  3W6G A;  4Q5N A;  4K0N A;  2FGX A;  5F8B A;  1G6Y A;  1IYI A;  5DVB A;  4FIW A;  4TR3 A;  2MBS A;  4CW9 A;  4KW6 A;  2I81 A;  2NTO A;  2O8V B;  2HXK A;  2X49 A;  5HQP A;  4PUF C;  1R26 A;  2HNL A;  3M1G A;  9GSS A;  2DML A;  2N5B A;  5ECK B;  1G6W A;  1K0D A;  1YEP A;  1GLQ A;  2XBI A;  1ON4 A;  4HOJ A;  4YH2 A;  5ECP B;  2RLI A;  1K0N A;  1X9W B;  1XCC A;  5ECQ B;  4RQX A;  1V58 A;  3D0Z A;  4KUN A;  2LRC A;  4OO4 A;  4NAX A;  4GRF A;  1EOH A;  1GSY A;  4KSM A;  5JCU A;  2H75 A;  3BD2 A;  1X5D A;  4IEL A;  2G0F A;  2GZY A;  5JWQ B;  2V6O A;  2FWE A;  3VFI A;  1GNW A;  1B4Q A;  4ISD A;  5IMF A;  2ZCT A;  1YJ6 A;  3F3Q A;  4LL4 B;  3W8S A;  3FW2 A;  3GH9 A;  4L8E A;  1DBY A;  3PPU A;  3G7Y A;  1NHY A;  3IDV A;  4ULX A;  2CZ3 A;  5D9T A;  4L0U A;  1M7T A;  2VCX A;  3EC3 A;  5JCG A;  5E4W A;  3EU4 A;  1J0F A;  3ERF A;  1V98 A;  1JHB A;  4X1U A;  5IMV A;  1R5P A;  3D6I A;  4V1A p;  5D96 A;  4XS4 B;  4PGT A;  3C7M A;  2H1A A;  1KBN A;  3H79 A;  3KXO A;  2FY6 A;  2REM A;  1FOH A;  2TRX A;  2ALB A;  4RI6 A;  5JWO B;  3APO A;  2PU9 C;  3M9K A;  5AIS A;  2VL2 C;  3D4M A;  1Q98 A;  4LLR A;  1QMV A;  3AY8 A;  3TGZ A;  2JAC A;  1YZX A;  5AIX A;  4XRA A;  3GX0 A;  1OKT A;  3EIN A;  2KP2 A;  4YKF A;  3ZIV A;  5ELG A;  4EDY A;  2XBQ A;  2VL3 A;  3DWV A;  1VF3 A;  4MCU A;  2XHF A;  2OBK A;  4HEA 2;  1SYR A;  2KP1 A;  2JZR A;  2H19 A;  3MDK A;  3GTU B;  1FAA A;  3LG6 A; 
#chains in the Genus database with same CATH homology
 3C1R A;  1FB6 A;  4I8B A;  5D9V A;  1FHE A;  3OR5 A;  2CVB A;  3F0I A;  1WOU A;  2A2S A;  4MZC A;  3GMF A;  5G5E A;  1OKD A;  3TKS E;  3P7X A;  3KZQ A;  1K3Y A;  1T00 A;  1XOB A;  4POL A;  1Z9H A;  4WBJ A;  4L5L A;  2LUS A;  2P0G A;  2A2P A;  2L6D A;  1XFL A;  3L4N A;  3EVI A;  3TKP A;  5JWR B;  4K2X A;  1AC1 A;  1PD2 1;  3HY2 A;  4E8H A;  4L0W A;  4JRR A;  2GDR A;  3A5I A;  1K0B A;  2MYG A;  1Y6E A;  4KAE A;  1ZGN A;  2O89 A;  1GTI A;  2R3X A;  2L4C A;  3ED3 A;  3LFL A;  2H66 A;  1JZD A;  1DUG A;  3FR9 A;  3IAS 2;  4RUV A;  4OFT A;  5F07 A;  2GSR A;  2HRK A;  4G0I A;  3S9F A;  1TI3 A;  2K18 A;  4MJC A;  2K8S A;  3ZIT A;  4HJ2 A;  1LBK A;  3IA1 A;  4IS0 A;  3LYP A;  2WUL A;  4AJ7 A;  4BVX A;  4K8M A;  1AQW A;  3UL3 A;  2H71 A;  2N5F A;  1GWC A;  3KMO A;  5IM9 A;  2RM5 A;  2JZT A;  1SEN A;  4KGI A;  1ZCP A;  1XWA A;  2H8L A;  3NOF A;  2UZ8 A;  1GTU A;  5BMU A;  5J9C A;  2A2R A;  3WT2 A;  4NXI A;  3DML A;  3TJB A;  1AQX A;  3HA9 A;  1O81 A;  3CSJ A;  4RI7 A;  1M9A A;  1U3A A;  1MDJ A;  3FMW A;  5ECR B;  4O5R A;  4EIQ A;  2H6Z A;  2DJ3 A;  3CTG A;  1F6M C;  2FWH A;  4K0G A;  1CQG A;  1R7H A;  2VCT A;  5DJL A;  3RBT A;  3A5W A;  4MMM A;  2FNO A;  3I6A A;  2C8U A;  2XPD A;  2VUP A;  5D93 A;  3VWV A;  5CYY A;  1V40 A;  1XZO A;  4NV5 A;  2GZP A;  3IOS A;  2CAI A;  1EP7 A;  1V2A A;  3FYG A;  4I6X A;  2J9H A;  2O85 A;  4JR6 A;  4FQU A;  2YOI A;  2LTK A;  2WDU A;  3EU3 A;  3J7Y b;  3TJG A;  2WCI A;  5KN2 A;  1EZK A;  3HVX A;  5CRG A;  2CQ9 A;  2DBC A;  1HNC A;  1JLV A;  3VI7 A;  1SL1 B;  3QCP A;  3I69 A;  2B1L A;  1RK4 A;  3NIV A;  3ZVJ D;  1EWX A;  1GP1 A;  4ZBA A;  3EYT A;  2E0Q A;  1GTB A;  1MEK A;  3UVT A;  5ID2 A;  3F3R A;  5KOW A;  4I5Q A;  3VK9 A;  1MD3 A;  4N10 A;  3KM6 A;  2QA1 A;  2L4Q A;  1SD9 A;  1U88 A;  2G2Q A;  1ERV A;  4KCE A;  1TJD A;  3LJR A;  3A2V A;  1UVZ A;  3L0H A;  1X9S B;  2MMN A;  4MP4 A;  1Z3E A;  4LMW A;  3WT1 A;  2CA8 A;  4Q5F A;  3UEM A;  3WGD A;  4O7H A;  3DRN A;  2IMI A;  2GQK A;  4NHW A;  1FVJ A;  1TRS A;  3IBH A;  3UAP A;  5CRE A;  3UMA A;  2A4H A;  1XW6 A;  1UC7 A;  5B8A A;  2YAN A;  4MF6 A;  4HDE A;  4PNF A;  3D5J A;  3IPZ A;  4K9Z A;  3EUR A;  4QL7 A;  1XWG A;  5H5Q A;  1KNG A;  1OYJ A;  1N2A A;  4ZIL A;  1K3L A;  2YJ7 A;  2I9H A;  2DKI A;  5INY A;  1HNA A;  2P31 A;  4GST A;  4MZW A;  4TR0 A;  3C71 A;  1JZR A;  3BCK A;  3RPN A;  3CRU A;  3FHK A;  2B7J A;  1GUL A;  4GWR A;  2FD3 A;  2HFD A;  3F4S A;  4PX1 A;  2J23 A;  4WEY A;  3H1N A;  3SWL A;  3GA4 A;  4HI7 A;  2CT6 A;  3HXS A;  1TRW A;  5F05 A;  1BQ7 A;  1A24 A;  3KP8 A;  2VAF A;  1TK8 B;  3UVH A;  2CAQ A;  2LNS A;  4HU9 A;  5FHI A;  3HZ8 A;  3KGK A;  4H86 A;  2MBT A;  2L6C A;  3TDG A;  5HR2 A;  3QOU A;  4KDX A;  1ZL9 A;  1FG4 A;  4K2D A;  2QA2 A;  3ME8 A;  2VD0 A;  4USS A;  2H70 A;  1A8Y A;  3QR6 A;  3IRA A;  3MIX A;  3F63 A;  4ML6 A;  4XS1 A;  1ML6 A;  3F4R A;  3FZA A;  2QKE A;  1J08 A;  1SYX A;  3GKM A;  17GS A;  2IFQ A;  4JZQ A;  3TJF A;  2I4A A;  4ZBB A;  3P90 A;  2DMM A;  2LJA A;  5LCZ A;  1IYH A;  1XW9 A;  1HNB A;  3IC4 A;  2WB9 A;  1SK1 A;  3I9V 2;  3LWA A;  1KTE A;  2LS5 A;  3GL3 A;  3Q6O A;  1YDK A;  2HZE A;  1I9D A;  2C0G A;  1USB A;  2GLR A;  1O73 A;  4WF4 A;  2VCW A;  1GSD A;  4P3Y B;  1TOF A;  2DLX A;  1A2M A;  12GS A;  4FYU A;  4Q5Q A;  3KP9 A;  1OE7 A;  2YN1 A;  1Q4J A;  4GTU A;  3CXG A;  4HQZ A;  1PSQ A;  5GAN D;  4GF0 A;  3IK7 A;  2DJ0 A;  3CSI A;  3MSZ A;  3QD9 A;  4ECC A;  3IXR A;  5COH A;  4KSO A;  2HZF A;  3D4T A;  4IP1 A;  1MDI A;  1EEM A;  1YKA A;  5DAL A;  2YCD A;  1M0U A;  2A4V A;  4G0K A;  3VLN A;  5CAX A;  1M2D A;  1WE0 A;  2HE3 A;  4MLY A;  3KIJ A;  4MJE A;  2B7K A;  1SU9 A;  2I1U A;  3ZRD A;  3DYR A;  1T8E B;  13GS A;  3HDC A;  1VGL A;  4NHZ A;  2FCH A;  5AIV A;  19GS A;  1QGV A;  2LKU A;  3LGC A;  5B7C A;  4E8E A;  4BWQ A;  4LA1 A;  4ZXG A;  1OE8 A;  4K7O A;  3IC8 A;  2IME A;  4DSS B;  4Z7X A;  2AV4 A;  4EDZ A;  4IQA A;  2YNX A;  4ZB9 A;  3M8N A;  5KN0 A;  4YKG A;  1N8J A;  5B8B A;  1K0M A;  2GSS A;  4WET A;  1PGT A;  1YF1 A;  1FOV A;  4OCF A;  3TB2 A;  2H0I A;  5IMD A;  4F9Z A;  5G31 A;  2ES7 A;  5ABR A;  4GCI A;  2MMA A;  1ZMA A;  3SBC A;  3GKX A;  1PN0 A;  3TOU A;  3N9J A;  3GKN A;  3GNJ A;  2BJX A;  4POB A;  2F8A A;  1AAZ A;  2GVP A;  4L5O A;  4KA0 A;  3HVV A;  2DIZ A;  1GRX A;  2LRT A;  1B48 A;  2LRN A;  5KEJ A;  16GS A;  4G9H A;  2OKA A;  3FY7 A;  3GIX A;  3UOM A;  6GSW A;  2H01 A;  1XWB A;  2GTU A;  1FB0 A;  1OAZ A;  2OE3 A;  4KE3 A;  2XPE A;  3FZ9 A;  3ISO A;  1TP9 A;  1HYU A;  1WPI A;  6GST A;  5GAP D;  1U3I A;  1F3A A;  1JZW A;  1QFN A;  20GS A;  4BL7 A;  1LU4 A;  2AJQ B;  4DSS A;  1XIY A;  3TOT A;  2IJY A;  3KJY A;  5CO3 A;  1PL1 A;  4ML1 A;  5KN3 A;  1JFU A;  2GZZ A;  3VI5 A;  4BVX B;  2CVK A;  3IK9 A;  1XXU A;  4I2U A;  1B9Y C;  6GSS A;  4N11 A;  3GSS A;  2V32 A;  4TW5 A;  1SK0 A;  1MDK A;  2X8H A;  2X64 A;  4RQR A;  2DC5 A;  2O87 A;  1Z5Y E;  3DXB A;  4ECB A;  4NWY A;  3ZFB A;  3A2X A;  4GLT A;  2AYT A;  2OE0 A;  3CBU A;  2NDO A;  2B1K A;  3RAZ A;  3Q19 A;  3C8E A;  3HCZ A;  4MPF A;  4O32 A;  2X8G A;  2F3M A;  2LJR A;  2B6M A;  3PH9 A;  5JCW A;  2PUK C;  3GX8 A;  1XVQ A;  4V1A g;  3FRC A;  4K5S A;  1YY7 A;  2VLU A;  4KX4 A;  2K9F A;  1QXH A;  4FYB A;  3EWL A;  1NSW A;  5C00 A;  1A23 A;  3RPP A;  1X5E A;  2R0C A;  3RDW A;  2H6Y A;  1M9B A;  2GT6 A;  2X99 A;  5GZZ B;  2WRT A;  4I2T A;  5H5R A;  2YZH A;  2B5Y A;  2R5G A;  1JZO A;  3FR6 A;  4TRX A;  1EP8 A;  4HUA A;  4XRD A;  4AF2 A;  1G0T A;  4MDC A;  3UIW A;  3UBL A;  4MA9 A;  2JZS A;  3GV1 A;  3HHV A;  1T3B A;  4EIP A;  1ZYE A;  4HS1 A;  3WYW A;  4EO3 A;  3Q18 A;  4N30 A;  3R3E A;  4WR5 A;  3US3 A;  3EMX A;  3LXT A;  1V57 A;  5D8I A;  4ZL7 A;  4ICY A;  4ID0 A;  1I5G A;  1BJX A;  4CDO A;  2OAC A;  2IWT A;  3ME7 A;  4D73 A;  5ID2 B;  1U87 A;  2AAW A;  2H1B A;  1YKC A;  2YWN A;  2AHE A;  3QFB C;  3I43 A;  4HQS A;  3BCI A;  4K7N A;  4O5U A;  1O7U A;  4PXO A;  4MJA A;  2H73 A;  1PKW A;  2X8C A;  2H76 A;  4EE0 A;  3E0U A;  2R6K A;  1GL8 A;  4NMU A;  3VPQ A;  1F2E A;  4ZB6 A;  2V6K A;  1BAY A;  4MNN A;  3ZL5 A;  3BOA A;  3GL5 A;  5ECN B;  5D9W A;  4CY6 A;  3DEX A;  1ILO A;  1XBS A;  3A3T A;  1AUC A;  2TRC P;  2VL2 A;  4J57 E;  3APS A;  5ECI B;  2KLX A;  3M0F A;  2C3Q A;  3ZTL A;  5FT3 A;  4XIH A;  5BRT A;  2VIM A;  4IJI A;  3UAR A;  2KUC A;  2H72 A;  4G19 A;  4PQ1 A;  1VF2 A;  4TOP A;  2VO4 A;  3BJ5 A;  2OAD A;  2F51 A;  4GQF A;  3GFK A;  4K7I A;  2R0G A;  2RM6 A;  2WGR A;  2XC2 A;  2HRA A;  3V1W A;  2IIY A;  1S3A A;  1O85 A;  4QQ7 A;  4MK3 A;  2HRF A;  3HVS A;  3WD6 A;  4IJ3 A;  2NBS A;  2GQM A;  1LJR A;  2LNT A;  4IW9 A;  2DJJ A;  4EXJ A;  2C1Y A;  4MF5 A;  2RUF A;  5HR0 A;  2JL4 A;  3CSH A;  4K5R A;  5DDL A;  1OC9 A;  4V2M A;  2PVO C;  2LEG A;  4MF7 A;  1A2L A;  4K1F A;  3TKR A;  3VWW A;  6GSU A;  2MZC A;  1B4P A;  4YQV A;  2R0P A;  1UA5 A;  5DBQ A;  2LQQ A;  2HSM A;  1OC8 A;  2E2G A;  3PGT A;  5CNW A;  5ECS A;  1RQM A;  3EMP A;  3TJK A;  3TJJ A;  4EC0 A;  2ZUP A;  4F0C A;  1GUM A;  4POK A;  2PGT A;  5EL8 A;  3GST A;  3TKQ A;  4WR4 A;  2K8V A;  3ZZX A;  2IFQ B;  4PUR A;  2YPM A;  2C3T A;  1PKZ A;  2JU5 A;  3KD0 A;  1DE2 A;  2KHP A;  1T7P B;  5CRW A;  2V2G A;  3F9U A;  1WJK A;  2QGV A;  2IMD A;  1Z6N A;  5HFI A;  1A0R P;  4BWS A;  2HZE B;  3D21 A;  1T1V A;  2RII A;  1PQN A;  2YP6 A;  1BG5 A;  3GHA A;  1SL2 B;  1AQV A;  1ZYQ B;  4X4J A;  2WJU A;  1GUH A;  5IPH A;  5F0G A;  3DVX A;  2B3S A;  1QUW A;  1ZYN A;  5A5K A;  4EF0 A;  4FH8 A;  4CY8 A;  4YQU A;  4OFN A;  3KH7 A;  5B6N A;  1PMT A;  1ERW A;  3NZN A;  1AIU A;  4ACS A;  1SL0 B;  1TKD B;  4JE1 A;  4JED A;  4IKH A;  2Z9S A;  1O8W A;  3MAK A;  1VF4 A;  2LJK A;  4KDY A;  1TRU A;  5DAL B;  4EVM A;  1GLP A;  3TRP A;  1WRY A;  4KH7 A;  1HQO A;  2MMO A;  3W8J A;  1J9B A;  4BVY A;  2VCQ A;  4AJ8 A;  1TTZ A;  5ECO B;  3ZMK A;  2C0E A;  3WGX A;  2CV4 A;  1DSB A;  3VWU A;  2IMK A;  3G7J A;  4KDU A;  2GSQ A;  4ZL8 A;  5HFG A;  4TR1 A;  1ERU A;  2TIR A;  2K6V A;  5DAK A;  3H4K A;  1R5A A;  3E9J B;  3P8W A;  4PQH A;  14GS A;  5GST A;  1G7E A;  3O3T A;  4EKZ A;  2WFC A;  1BX9 A;  2YWI A;  3GRX A;  1UN2 A;  3LQ7 A;  4BA7 A;  3MYD A;  1M2B A;  2QSI A;  3ERW A;  1GSF A;  4X43 A;  3FK8 A;  3VUR A;  2FLS A;  1O6J A;  3LOR A;  4IP6 A;  4MZB A;  1TI1 A;  1XOA A;  3ZLP A;  4HZ2 A;  2V1M A;  5L71 A;  3C73 A;  3HD5 A;  5AN1 A;  1AW9 A;  4F82 A;  1GSS A;  3O76 A;  3HJM A;  5DQY A;  1TRV A;  2DSA A;  5HFK A;  5IQY A;  1GTA A;  2GS3 A;  1SKS B;  4NV2 A;  4EUY A;  5LNK e;  1THO A;  1K0A A;  1TXX A;  4IGJ A;  1GNE A;  4KND A;  5G1K A;  4WBR D;  1BYE A;  3LYK A;  1QQ2 A;  3ZVJ A;  3RHB A;  2ON7 A;  4TXO A;  5ELA A;  1M2A A;  1SD8 A;  1NW2 A;  4MH2 A;  2V41 A;  1MD4 A;  1F9M A;  2E2M A;  1X9M B;  4YAV A;  2M72 A;  2YV7 A;  1SJ6 A;  4BL7 B;  3QDN A;  3HKR A;  4YAP A;  5DJM A;  1TK5 B;  3L9S A;  1AXD A;  3U5R E;  5H5S A;  4J56 E;  2P5R A;  5HR3 A;  7GSS A;  4WF5 A;  2L5L A;  2H74 A;  3J7Y k;  1TU8 A;  4BPY A;  6GSY A;  1FW1 A;  3EPT A;  4HZ4 A;  1Y25 A;  2NVL A;  3N5O A;  4PQI A;  2H30 A;  3ERG A;  3HJO A;  2OA7 A;  5AGY A;  2C0F A;  1VF1 A;  2BTO T;  2FWG A;  5CP1 A;  1M99 A;  2DJ2 A;  2L59 A;  4ILF A;  4PTS A;  2E7P A;  1V9W A;  2CVD A;  2AUV A;  3IHQ A;  3TUE A;  1PRX A;  4O92 A;  3PIN A;  3P2A A;  1URM A;  2VCZ A;  2EIQ A;  3L9U A;  1THX A;  3GN3 A;  2FA8 A;  1BED A;  1B8X A;  1E6B A;  1H75 A;  4ZB8 A;  1Z6M A;  4G10 A;  1T4Y A;  1A2J A;  2LQO A;  3IHG A;  5IO0 A;  2EC4 A;  3ZYW A;  1WMJ A;  3GUR A;  3F6D A;  3DVW A;  1A8L A;  10GS A;  2C3N A;  2JSY A;  4TXV A;  1TK0 B;  2KOK A;  3JCM L;  1XW5 A;  3DIE A;  4JU5 A;  1PN9 A;  3IE3 A;  1YF0 A;  3EE2 A;  3ZIJ A;  1TDI A;  4PNG A;  1PX6 A;  1PL2 A;  1ERT A;  1KEB A;  4Z2R A;  5J41 A;  4IN0 A;  5D73 A;  4TKY A;  3CYN A;  3TCO A;  3DGQ A;  4POM A;  3KCM A;  5ECH B;  4DVC A;  1X0R A;  2RUE A;  3LXZ A;  4XCS A;  4X0X A;  8GSS A;  5IO2 A;  1YQ1 A;  2BMX A;  2AB6 A;  1G7O A;  2EIR A;  2MMZ A;  4F0B A;  2WS2 A;  1YEX A;  4MJB A;  1OC3 A;  2VM2 A;  4XS4 A;  1ABA A;  4KB3 A;  3TKS C;  1WIK A;  5HR1 A;  5F06 A;  4DSQ A;  4N0V A;  3ZFL A;  5ECM B;  4D73 B;  1PX7 A;  3F8U A;  5E59 A;  1O8X A;  2C4J A;  3KTL A;  4OO5 A;  1K0O A;  2PBJ A;  2R37 A;  3LEF A;  1B9X C;  2NPB A;  2IPA A;  5KN1 A;  1ZZY A;  4GXZ A;  4HU7 A;  1H4O A;  2X4A A;  3HYP A;  3R2Q A;  2H0H A;  1U6T A;  4ZL9 A;  5EVO A;  3H8Q A;  2HLS A;  1NM3 A;  1EEJ A;  5KOX A;  6GSV A;  2VLV A;  2PMT A;  1HD2 A;  4MH3 A;  2VCV A;  5CRD A;  3APQ A;  4XS6 A;  4J2F A;  4TR4 A;  2FWF A;  1XWK A;  2D2Z A;  2L5O A;  2GGT A;  1Z7P A;  1GSU A;  2H1D A;  1DE1 A;  1XVW A;  3GTU A;  4IVF A;  2PPT A;  2WZ9 A;  1X5C A;  3QFA C;  3FKF A;  4CHS A;  2PWJ A;  1Z7R A;  4OMV A;  5G30 A;  1SJI A;  5G5F A;  2HRN A;  3CTF A;  2PER A;  2P5Q A;  2CX3 A;  3QAW A;  1TU7 A;  4WXT A;  4A5P A;  3G9B A;  1EGO A;  2JSZ A;  2HT9 A;  11GS A;  3CMI A;  2C80 A;  2DJ1 A;  5A4V A;  3M3M A;  4ZIJ A;  5C04 A;  4GSS A;  2CZ2 A;  4ECI A;  1GUK A;  5ENU A;  4HJM A;  2DKH A;  2GQL A;  3DD3 A;  2VM1 A;  5J5N A;  1GSE A;  5A4W A;  5GSS A;  2B5X A;  3PR8 A;  3FEU A;  3FR3 A;  1ZYP A;  5CRH A;  3L78 A;  1XWC A;  4JBB A;  1JLW A;  4F2I A;  4MPG A;  5IIZ A;  2YV9 A;  2M46 A;  3HZ4 A;  1OC9 B;  1ST9 A;  4XHM A;  5J3R A;  3M9J A;  3IAM 2;  3ZML A;  5LD0 A;  2FA4 A;  2PN8 A;  1C72 A;  4Q5R A;  2YZU A;  3DKS A;  1SKW B;  1GH2 A;  2M80 A;  3BBY A;  1TW9 A;  4WKW A;  5D9X A;  3KH9 A;  1ZOF A;  3L9V A;  1VRS D;  1WP0 A;  4ECJ A;  4Z2U A;  4FYC A;  4DEJ A;  4Z2T A;  2HSY A;  1W4V A;  3QAG A;  3QPM A;  2OJL A;  2FHE A;  6GSX A;  1SJZ A;  3E3E A;  2HYX A;  5DCH A;  3KMN A;  2QC7 A;  3IV4 A;  4OFM A;  4F03 A;  1PA3 A;  3WGE A;  3ZRE A;  5EY6 A;  4OD7 A;  1S3D A;  2I3Y A;  4KCA A;  1K3O A;  5IPG A;  5A4U A;  2LV3 A;  2H1G A;  4V2N A;  1F37 A;  2R4V A;  2OE1 A;  1K0C A;  3CRT A;  4ZBD A;  5EPF A;  3TKS A;  4DSR A;  2YWM A;  1NHO A;  4V2L A;  2C0D A;  1EOG A;  4IBP A;  2YJH A;  4G0L A;  3O6T A;  3VPT A;  3C1S A;  2F9S A;  5J4U A;  1QK8 A;  1F3B A;  2EIO A;  5IOW A;  1E2Y A;  2OBI A;  4GSN A;  4BVY B;  3GYK A;  4GQC A;  4XTS A;  4KF9 A;  3VWX A;  2DJK A;  22GS A;  4I97 A;  5G1L A;  5DQS A;  4IQ1 A;  5DCG A;  2CX4 A;  1ACV A;  4IHU A;  1FVK A;  3D22 A;  4TR1 B;  1GSQ A;  2YWO A;  3HJP A;  1WWJ A;  5DAK B;  3FZ5 A;  3Q74 A;  1SK2 A;  3A2W A;  4G2E A;  2VL9 A;  3GKK A;  3KEB A;  3F6F A;  3FZ4 A;  3QAV A;  2JAD A;  2N5A A;  1EV4 A;  3UJ1 A;  4K6X A;  5IMZ A;  1XPV A;  4TVE A;  4LMV A;  2LST A;  2GST A;  3G7I A;  2IMF A;  3LSZ A;  1T4Z A;  2ON5 A;  3MNG A;  3KTB A;  5IOX A;  2ZNM A;  3GH6 A;  4OWY A;  3F4T A;  2DIY A;  2VOC A;  1SKR B;  4JR4 A;  1R4W A;  2IL3 A;  4N0Z A;  4PUA A;  4MAB A;  2PVQ A;  1EGR A;  5ECL B;  2HI7 A;  3K8N A;  1W89 A;  2R2J A;  5G2Z A;  3TRX A;  1CQH A;  1OVN A;  18GS A;  4NPB A;  3U6V A;  3LW9 A;  5B6M A;  3UBK A;  4EL1 A;  2B5E A;  5IMA A;  4TXO B;  2F8F A;  3GUS A;  2H0G A;  3IR4 A;  2H6X A;  2L57 A;  1RW1 A;  4YQM A;  2HSH A;  1FO5 A;  4AJ6 A;  1MTC A;  2O7K A;  3H93 A;  1S3C A;  2FUG 2;  5FWG A;  4LL1 B;  3RHC A;  4TN8 A;  4AGS A;  5J9B A;  2GT5 A;  5IMC A;  3TRQ A;  4O5Q A;  3MWH A;  2VD1 A;  4OCE A;  1EV9 A;  1A0F A;  2IN3 A;  4FO5 A;  4QL9 A;  3QMX A;  2VLT A;  3W6G A;  4Q5N A;  4K0N A;  2FGX A;  5F8B A;  1G6Y A;  1IYI A;  5DVB A;  4FIW A;  4TR3 A;  2MBS A;  4CW9 A;  4KW6 A;  2I81 A;  2NTO A;  2O8V B;  2HXK A;  2X49 A;  5HQP A;  4PUF C;  1R26 A;  2HNL A;  3M1G A;  9GSS A;  2DML A;  2N5B A;  5ECK B;  1G6W A;  1K0D A;  1YEP A;  1GLQ A;  2XBI A;  1ON4 A;  4HOJ A;  4YH2 A;  5ECP B;  2RLI A;  1K0N A;  1X9W B;  1XCC A;  5ECQ B;  4RQX A;  1V58 A;  3D0Z A;  4KUN A;  2LRC A;  4OO4 A;  4NAX A;  4GRF A;  1EOH A;  1GSY A;  4KSM A;  5JCU A;  2H75 A;  3BD2 A;  1X5D A;  4IEL A;  2G0F A;  2GZY A;  5JWQ B;  2V6O A;  2FWE A;  3VFI A;  1GNW A;  1B4Q A;  4ISD A;  5IMF A;  2ZCT A;  1YJ6 A;  3F3Q A;  4LL4 B;  3W8S A;  3FW2 A;  3GH9 A;  4L8E A;  1DBY A;  3PPU A;  3G7Y A;  1NHY A;  3IDV A;  4ULX A;  2CZ3 A;  5D9T A;  4L0U A;  1M7T A;  2VCX A;  3EC3 A;  5JCG A;  5E4W A;  3EU4 A;  1J0F A;  3ERF A;  1V98 A;  1JHB A;  4X1U A;  5IMV A;  1R5P A;  3D6I A;  4V1A p;  5D96 A;  4XS4 B;  4PGT A;  3C7M A;  2H1A A;  1KBN A;  3H79 A;  3KXO A;  2FY6 A;  2REM A;  1FOH A;  2TRX A;  2ALB A;  4RI6 A;  5JWO B;  3APO A;  2PU9 C;  3M9K A;  5AIS A;  2VL2 C;  3D4M A;  1Q98 A;  4LLR A;  1QMV A;  3AY8 A;  3TGZ A;  2JAC A;  1YZX A;  5AIX A;  4XRA A;  3GX0 A;  1OKT A;  3EIN A;  2KP2 A;  4YKF A;  3ZIV A;  5ELG A;  4EDY A;  2XBQ A;  2VL3 A;  3DWV A;  1VF3 A;  4MCU A;  2XHF A;  2OBK A;  4HEA 2;  1SYR A;  2KP1 A;  2JZR A;  2H19 A;  3MDK A;  3GTU B;  1FAA A;  3LG6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...