2H01A

Py00414- plasmodium yoelii thioredoxin peroxidase i
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
174
structure length
174
Chain Sequence
b'AFQGQAPSFKAEAVFGDNTFGEVSLSDFIGKKYVLLYFYPLDFTFVCPSEIIALDKALDSFKERNVELLGCSVDSKFTHLAWKKTPLSQGGIGNIKHTLISDISKSIARSYDVLFNESVALRAFVLIDKQGVVQHLLVNNLALGRSVDEILRLIDALQHHEKYGDVCPANWQKG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 2-CYS PEROXIREDOXIN
publication title Crystal structure of PY00414 - a Plasmodium yoelii thioredoxin peroxidase I
rcsb
source organism Plasmodium yoelii
molecule tags Oxidoreductase
total genus 54
structure length 174
sequence length 174
ec nomenclature ec 1.11.1.-:
pdb deposition date 2006-05-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10417 1-cysPrx_C C-terminal domain of 1-Cys peroxiredoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 2h01A00
4GSNA 1Q98A 2CT6A 2VAFA 3EE2A 4IP1A 2H73A 1DSBA 4N11A 4JRRA 2P5RA 3JCML 1ON4A 3HDCA 1VF2A 1F9MA 4G9HA 1ERTA 3M9JA 4TXOA 1PX6A 2RM5A 4YAPA 1ZYQB 1YJ6A 1PGTA 4ISDA 3ZL5A 2JSZA 1XWCA 2H6YA 2OACA 3BCIA 3GMFA 1F37A 5KN0A 4KA0A 4K0NA 5HFIA 4DSSA 3L9UA 3M3MA 5FT3A 5IPGA 5IOXA 1SL2B 2HSHA 3LORA 1PL2A 2V32A 4V2NA 1Y25A 2HZEB 2LJAA 4AGSA 5J5NA 1GSQA 2IIYA 1BYEA 16GSA 3GX8A 4HDEA 1XWKA 1K0BA 2IMFA 2C0GA 3DEXA 2HXKA 3LEFA 4OFTA 1MTCA 1PX7A 2ON5A 3A5WA 1KBNA 3QOUA 2VCQA 4G10A 4ECCA 2HSYA 3BOAA 1HD2A 3IOSA 2OA7A 3RHCA 3HCZA 4TOPA 3KEBA 1AAZA 5HQPA 5A4VA 2ALBA 3M0FA 4RQXA 2J9HA 4AJ7A 3HJPA 2GQLA 2BMXA 5KN3A 5ECIB 1WJKA 4E8HA 1AQVA 4KH7A 5DAKB 1XWAA 4MZCA 3D4MA 2OKAA 3G9BA 2PWJA 3C71A 3LQ7A 2RLIA 2CVKA 3N5OA 4MH3A 4TR1A 1I5GA 1LBKA 2H1AA 4ECIA 2B6MA 1A24A 4HJMA 4RUVA 2G0FA 1B9YC 3UL3A 3ZZXA 1UA5A 2PU9C 1Z9HA 3TKSE 3FHKA 3IAM2 1KNGA 1YQ1A 3LGCA 5ECLB 1YDKA 2R4VA 4IW9A 4N0VA 3UVTA 3VWVA 4ZBBA 3TJBA 3VWUA 3CMIA 4KSOA 4ILFA 3FR3A 3KTLA 4ZB6A 2K8SA 4EDZA 3ERGA 3F6FA 4HQSA 3F0IA 3D4TA 3HY2A 5CYYA 3HZ4A 2B5XA 4OO4A 1N2AA 4WETA 4Z7XA 4MJCA 1GNWA 1OE7A 1CQGA 3ZFLA 5ELGA 2F8AA 4OCFA 4ZL9A 4RI6A 1MDIA 5KN2A 1IYIA 2M80A 5IO0A 4QL7A 3TKSC 2ZUPA 4HS1A 4HUAA 1JLWA 2WFCA 3HZ8A 2WGRA 1T7PB 4F0BA 4O92A 1S3DA 2FWEA 3ZMLA 2YWMA 1EEJA 5DCHA 2GZZA 3H93A 4GQCA 4LMVA 4ZBDA 3PINA 1F2EA 3UJ1A 2H8LA 3EINA 3KXOA 2LNSA 3J7Yk 3WT1A 5D9VA 1XWGA 2HNLA 2NTOA 3ZIVA 1LJRA 1YZXA 1FB0A 2XPDA 4HZ2A 4WF4A 3LJRA 4YQUA 3TCOA 1EOGA 1HQOA 1SL0B 3WD6A 1GTIA 4FH8A 4HQZA 1R7HA 2IL3A 5HR3A 2F3MA 2EIQA 2JACA 5CRGA 1Z6NA 3IHQA 5D9WA 5EY6A 1SK0A 5LCZA 3TOUA 1X9WB 3ZVJD 2HZFA 2B7KA 4IKHA 2YZHA 5AGYA 3GL5A 1K3LA 3GKNA 1T4ZA 1H4OA 3HA9A 4PQ1A 4BVYA 4KDUA 2DJ1A 2K18A 3HKRA 1E6BA 4K7NA 3D22A 4MCUA 2LQOA 1WRYA 3TRPA 1FHEA 5G1LA 1Z7RA 2WCIA 2IPAA 1XOBA 2CA8A 1DE1A 1W89A 4HEA2 5DAKA 2AB6A 2H1BA 3RPNA 3GHAA 1FVKA 3EYTA 5A4WA 6GSTA 2H6ZA 1T3BA 1TK0B 1GTUA 1BEDA 2WB9A 1SD8A 4PXOA 5B6NA 2P0GA 3L9SA 3N9JA 4F0CA 5CAXA 3VWWA 4F82A 5AIXA 2HFDA 6GSWA 2LEGA 1EP7A 1GUHA 5E59A 1H75A 4XHMA 1MD4A 3LSZA 4D73B 2H01A 2C3NA 2WULA 5B6MA 2X8CA 2C3QA 2HRNA 1TDIA 1EP8A 4N0ZA 1RQMA 4PX1A 4TN8A 1S3CA 5ID2A 4GQFA 4J57E 3FKFA 4IBPA 1XFLA 4QL9A 3UBLA 1AQXA 1XWBA 1TJDA 2CVDA 4JU5A 3UEMA 4L0WA 2YJ7A 4FIWA 1GLQA 4OO5A 3L9VA 4ML6A 1SK1A 4KAEA 4V2MA 5JCUA 1QMVA 2YWOA 3O3TA 3QFBC 1A23A 2H76A 5IMAA 6GSXA 1OVNA 3DWVA 4Q5QA 5DVBA 3FZ9A 2H0IA 2FA8A 1Y6EA 4JR4A 1SKSB 4GWRA 3O6TA 3CRUA 2H70A 5B7CA 3GSSA 4WBJA 4EC0A 2GT5A 5GZZB 1V40A 3KM6A 4F2IA 5DDLA 4G2EA 22GSA 5EVOA 2VD1A 3GSTA 1G6WA 3FZ4A 4P3YB 3MSZA 2GSSA 3TUEA 1QGVA 3BCKA 2I81A 1O73A 2AAWA 2L5OA 2R3XA 4KDXA 4K6XA 4WXTA 4JZQA 5ECSA 3KH9A 3F6DA 18GSA 4V1Ap 4BVXA 1M9AA 2AUVA 2K6VA 2LV3A 3LXZA 2GSTA 4EXJA 1WIKA 1TKDB 4MDCA 1GSUA 4GXZA 4RQRA 1U6TA 3UAPA 2CX4A 1FAAA 1Z6MA 1VF3A 3GRXA 1EZKA 1TW9A 4I8BA 3Q6OA 1DE2A 1K0DA 1K3OA 2FUG2 4N30A 4NHWA 1GULA 4FYUA 3UIWA 3DRNA 2CAIA 2OADA 4ZXGA 2V1MA 2FY6A 3ZYWA 5F8BA 2OE3A 5IOWA 2G2QA 1GSFA 1M7TA 3GL3A 2MBTA 10GSA 2X64A 4DEJA 2VL2C 2NBSA 2BTOT 2HLSA 2L6DA 5CRDA 1GSSA 3IAS2 4L8EA 1ZYEA 2GSQA 5F0GA 4PQIA 4KNDA 3C8EA 5D9TA 5CRWA 2AV4A 4LLRA 5G1KA 1BX9A 3KMNA 4PURA 1B8XA 1V98A 1X5EA 3M1GA 2LRTA 1R26A 4D73A 5A5KA 6GSUA 2MMOA 3VURA 4MLYA 4PUAA 2TIRA 4YQVA 2FNOA 3HVVA 2DIYA 2CZ3A 2GS3A 3F9UA 1SENA 3L0HA 2KP1A 2REMA 4TVEA 2CZ2A 1JZDA 2DJJA 5FHIA 1Z5YE 1RW1A 3EMXA 1OAZA 3G7IA 2H72A 1VGLA 3D21A 2K8VA 1TTZA 3RPPA 3I43A 4NAXA 1SKRB 13GSA 1PSQA 1DBYA 4X0XA 3MAKA 3PGTA 3VK9A 3I6AA 5G2ZA 4MJEA 2O85A 4GSSA 3K8NA 2YPMA 4MZBA 2C3TA 5AIVA 4DSQA 3TOTA 3LYPA 3P8WA 2KHPA 2YJHA 1TU8A 3IK9A 1TRVA 20GSA 3EU4A 3ED3A 4POBA 4I5QA 1T8EB 2K9FA 3KCMA 4EVMA 2FWFA 4KX4A 4IHUA 2C80A 4JR6A 3QAVA 6GSVA 4I97A 2I9HA 3HD5A 4E8EA 3KD0A 4KW6A 1EV9A 4YQMA 2HI7A 3EMPA 5JCGA 3DXBA 2JZRA 2O87A 4TR3A 2CX3A 3Q18A 5D96A 4IP6A 2B3SA 3QAWA 1PN9A 1U3AA 3G7YA 2TRXA 3EVIA 3FW2A 4ZBAA 2P5QA 1TRWA 3MDKA 2R5GA 3EURA 1WE0A 1GH2A 4GSTA 4PQHA 2JADA 5J3RA 4K7IA 2OE1A 4NXIA 2M72A 4TW5A 3KJYA 4OWYA 5HR1A 3H79A 3D0ZA 1GTAA 2FWGA 1DUGA 2VLTA 2YNXA 4MJBA 2WDUA 4KUNA 1VF4A 1XW6A 1WOUA 5IMFA 4F9ZA 5DJLA 3VPTA 3L4NA 2MMAA 4CDOA 2GT6A 1X5CA 2LRCA 2KLXA 4LL4B 5ID2B 3ZIJA 5J9CA 1I9DA 5ECMB 4YH2A 3UOMA 3DIEA 3ZITA 2VIMA 4K7OA 4O5RA 1U88A 2IFQB 4GTUA 1A2LA 3VFIA 1X5DA 5J4UA 2FHEA 2O8VB 4I6XA 1TRSA 3GYKA 2FCHA 3TJJA 1OYJA 3A2XA 1ZCPA 2AYTA 11GSA 2FA4A 2NPBA 4PNFA 5DCGA 1AC1A 1F3AA 3Q74A 3WYWA 1YEXA 1PL1A 2FD3A 5IMDA 1YF0A 5CO3A 1PKZA 3APSA 2LTKA 4EKZA 2OBIA 1GTBA 4MJAA 3W8SA 2L59A 1A0FA 5DQYA 2VLUA 1GUMA 9GSSA 2BJXA 1T1VA 4EL1A 1GSYA 4BL7A 2RM6A 1CQHA 1XVQA 3J7Yb 3GKKA 3EWLA 5G30A 3FZAA 3IXRA 2D2ZA 2HRFA 3NIVA 1J08A 1YF1A 1GP1A 1SD9A 1O6JA 1OE8A 5DQSA 2O7KA 1Q4JA 3H4KA 1QK8A 4L5OA 4MABA 3LFLA 3MNGA 5D8IA 2NVLA 2VL3A 2IMIA 2VOCA 1AUCA 5D73A 4HJ2A 3E0UA 4XS1A 5CP1A 1XXUA 5DJMA 3FR6A 4PNGA 4ACSA 1XOAA 2YWNA 2CV4A 6GSSA 2PPTA 5INYA 5KN1A 2WZ9A 5CNWA 4AJ8A 2LNTA 2F8FA 1G7EA 3EC3A 1URMA 4NPBA 3TKQA 2XPEA 1BAYA 1FG4A 2MYGA 3O76A 3WGXA 2OJLA 3FYGA 3APQA 1XVWA 4I2TA 2LUSA 4OD7A 2VLVA 3IC4A 5COHA 3BD2A 5DALB 5ELAA 1YKAA 2LRNA 3DVWA 5L71A 3H8QA 1X9MB 2PUKC 1SL1B 4LA1A 4KSMA 3CTGA 3CBUA 3EU3A 4LL1B 5ECRB 4MK3A 2N5BA 3VI5A 3GUSA 3TKPA 5H5RA 5ABRA 2PMTA 3APOA 1KTEA 1A2MA 1MDKA 1R4WA 1XCCA 3KZQA 3QR6A 5IMZA 1MEKA 1MD3A 1XW5A 3UBKA 8GSSA 3GIXA 5IMVA 2RUEA 2AHEA 4N10A 3U5RE 4O32A 2JSYA 2NDOA 3TKSA 2IFQA 1V2AA 1WWJA 3GX0A 2B1KA 2J23A 2V6OA 5B8AA 1A8YA 2JZSA 1JFUA 2RIIA 3GA4A 4PGTA 1ACVA 1OKTA 2LJKA 3GN3A 1SK2A 3F4TA 3ME8A 4IGJA 3QDNA 2VCWA 4FYCA 3NOFA 4PUFC 3L78A 3DGQA 5KEJA 3G7JA 1FVJA 5H5SA 3FK8A 2XBIA 2CAQA 5HFKA 4HOJA 3ZMKA 3Q19A 4MF7A 4YAVA 5HFGA 1A0RP 3FR9A 3A3TA 2H0HA 2X8GA 4IN0A 1S3AA 2L5LA 3IRAA 1EGOA 1LU4A 5G31A 1M99A 1UC7A 1EGRA 4TKYA 4G19A 3HVSA 4KCAA 1O8WA 4K0GA 2YV7A 4GF0A 6GSYA 4ID0A 2GQMA 5IO2A 4DSRA 2H75A 2DC5A 1B9XC 5GSTA 1AQWA 2HT9A 4XRDA 2E2MA 4IJ3A 1K0AA 4I2UA 3OR5A 3ZFBA 19GSA 3CSJA 7GSSA 2LS5A 2IMEA 1NHOA 2IMKA 3QAGA 3PR8A 1X9SB 5IIZA 3P90A 3DKSA 4KB3A 2GLRA 4MPFA 5HR2A 4TXVA 1K0MA 2DJ2A 2H6XA 4TR0A 1V58A 1BJXA 1XZOA 2IN3A 5C04A 2MZCA 2R37A 5JWQB 4DVCA 1QXHA 1PQNA 1PRXA 3F3RA 3W8JA 3DYRA 3HJMA 1VRSD 2L57A 4WEYA 1ERVA 1QFNA 1WP0A 4XS4B 4ZB8A 3PH9A 4K8MA 1THXA 1R5AA 3IV4A 2I4AA 4K9ZA 4V1Ag 1ABAA 1ST9A 1K0OA 3KP8A 1GRXA 5CRHA 3ZREA 4CW9A 5F06A 2GZYA 1M2AA 5DALA 5ECPB 3RHBA 3M8NA 3DMLA 2VM1A 2EC4A 4KGIA 3H1NA 17GSA 3KGKA 2ZNMA 1WPIA 1V57A 2DLXA 3CSHA 4TRXA 3I9V2 3I69A 4ZB9A 1TP9A 5DBQA 2PVOC 4KCEA 2QKEA 4L0UA 1O8XA 2DSAA 2KOKA 1GLPA 3VWXA 1AIUA 3KIJA 5J41A 1GWCA 3ZRDA 4EUYA 1UVZA 1OC3A 5ECOB 3LWAA 3GV1A 1O85A 2N5FA 4HZ4A 2DMMA 1TI1A 2WS2A 4Q5FA 3UVHA 4EO3A 3BJ5A 1PKWA 3R2QA 4IS0A 1YY7A 2LJRA 1QUWA 2GGTA 4MMMA 1YEPA 3QPMA 3IPZA 2GTUA 2DJKA 4OFNA 4MP4A 2ZCTA 1ERUA 3WGDA 4MA9A 1NM3A 5AISA 1FOVA 2FLSA 1N8JA 3GH6A 2VO4A 5IPHA 1YKCA 3FEUA 5G5FA 2B5EA 3V1WA 3RBTA 1M2DA 5A4UA 1FW1A 4KE3A 5D93A 2ON7A 3DD3A 1QQ2A 3QD9A 5ECKB 2F51A 4XCSA 3FY7A 3S9FA 1FB6A 2WJUA 2YN1A 2L6CA 1Z3EA 2H0GA 4O7HA 3UMAA 3C7MA 3TRXA 3F63A 3F4SA 3TKRA 2YZUA 4K2DA 14GSA 2JZTA 1C72A 3IDVA 4J56E 3ZVJA 4MZWA 3QMXA 1EWXA 3GTUA 5EPFA 1ZZYA 4XIHA 1XPVA 4MF5A 5ECQB 1ERWA 2VCXA 2FGXA 1T00A 3TJFA 1EV4A 4XTSA 1PMTA 4H86A 2VL2A 3LXTA 4JE1A 2E7PA 5ENUA 5CREA 4EDYA 3IE3A 2P31A 5ECNB 2CVBA 1OC8A 4XS4A 3FRCA 3HJOA 2PN8A 1R5PA 1J9BA 5LD0A 1PA3A 1THOA 1G0TA 4ECJA 1BQ7A 2LKUA 4OFMA 4WF5A 1F6MC 1M2BA 2F9SA 2TRCP 1SYRA 3CRTA 2L4CA 2YANA 3W6GA 5J9BA 2QSIA 4BWQA 2EIRA 2EIOA 2A4VA 2HYXA 1ZMAA 1OC9B 4IQ1A 1SJZA 1TXXA 2X8HA 2QGVA 2H19A 2C0FA 4GRFA 3HHVA 1GNEA 3GFKA 2RUFA 4WR5A 3E3EA 3E9JB 5GAPD 5E4WA 4JEDA 5F05A 2HE3A 1K3YA 5GAND 2OBKA 5JWRB 4X43A 1M9BA 3ZLPA 1O7UA 3RDWA 4ECBA 2H1DA 4L5LA 4EF0A 3GNJA 4GLTA 1SJ6A 1T4YA 1TOFA 2PERA 4WR4A 3A2VA 5JCWA 2L4QA 1ML6A 1U3IA 3GH9A 1JZWA 1MDJA 1ILOA 3QFAC 3HVXA 4RI7A 1X0RA 3TJGA 1HNCA 3P2AA 2GQKA 1WMJA 2GVPA 2C4JA 5G5EA 3TGZA 2C0EA 4Q5NA 4KDYA 3UARA 5JWOB 2H74A 3GKXA 2HZEA 1B4PA 4IJIA 4FO5A 1ZOFA 2C0DA 2H71A 2LSTA 4POKA 4F03A 1UN2A 3CTFA 5C00A 1RK4A 2PGTA 5HR0A 1JZRA 3DVXA 4ZILA 1G7OA 2VD0A 4LMWA 3D5JA 2YOIA 1OKDA 2PVQA 3AY8A 1O81A 1GUKA 4NMUA 2R6KA 2O89A 2Z9SA 2JL4A 3LG6A 3RAZA 1ZL9A 4QQ7A 1A8LA 2C8UA 4ZIJA 1SU9A 2MMNA 1W4VA 3HXSA 3LYKA 2E2GA 2H1GA 3SWLA 3CSIA 5F07A 5IQYA 4IQAA 1SKWB 1JLVA 1Z7PA 3C1RA 4ML1A 1VF1A 1GL8A 2B7JA 5LNKe 3IK7A 1XW9A 2H30A 3VI7A 2A2RA 1G6YA 1GSEA 3NZNA 3WGEA 3IA1A 4XRAA 2I3YA 1NW2A 4OMVA 1AW9A 2YWIA 3FZ5A 1V9WA 4IELA 5AN1A 2GSRA 1NSWA 2YCDA 4HU7A 5GSSA 4EE0A 2XBQA 4J2FA 2MBSA 2X99A 4HI7A 4V2LA 4HU9A 3F3QA 3TB2A 2VM2A 2V2GA 3F8UA 3ME7A 3US3A 4NWYA 2DJ3A 2QC7A 4TXOB 5D9XA 3ZTLA 2M46A 2JU5A 3GURA 1HNAA 4CHSA 1USBA 1XBSA 3TJKA 2PBJA 4FYBA 3WT2A 4DSSB 2GDRA 3P7XA 3D6IA 1TK8B 4MF6A 1J0FA 2GZPA 3MWHA 1OC9A 2V6KA 3TRQA 2YV9A 2DMLA 3GKMA 2VL9A 4ULXA 1K0NA 4GCIA 1AXDA 1HNBA 4MPGA 5IM9A 3QCPA 1BG5A 2WRTA 2KP2A 1U87A 3VPQA 2LQQA 2VCTA 1JHBA 2IWTA 3CYNA 4IVFA 4POLA 1PD21 5FWGA 4BWSA 3KTBA 2A2SA 5EL8A 2AJQB 5B8BA 3IR4A 3KH7A 3M9KA 3VLNA 2DBCA 3GTUB 4NV5A 2FWHA 1EOHA 2XHFA 4MH2A 1B48A 1HYUA 2OE0A 2ES7A 3CXGA 4ZL7A 4WBRD 3ERFA 2YP6A 4AJ6A 12GSA 1B4QA 2IJYA 4TR1B 2R2JA 1TRUA 1FO5A 2IMDA 1TI3A 3F4RA 1EEMA 4Q5RA 3BBYA 4TR4A 2E0QA 2DIZA 2VCVA 4OCEA 3HYPA 3ERWA 5ECHB 4BPYA 2C1YA 2N5AA 4BA7A 2MMZA 1ZGNA 4WKWA 1IYHA 1XIYA 5H5QA 3C1SA 3ISOA 4NV2A 1E2YA 3C73A 2B1LA 3KP9A 4K1FA 1SJIA 5IMCA 2B5YA 1KEBA 1SYXA 4POMA 4NHZA 2VUPA 2XC2A 1A2JA 2KUCA 1K0CA 1M0UA 1TK5B 3U6VA 1JZOA 4X1UA 1NHYA 3KMOA 1GSDA 2H66A 4XS6A 1F3BA 3A2WA 2CQ9A 3SBCA 3IBHA 4ZL8A 2I1UA 2VCZA 4AF2A 3TDGA 1TU7A 2DJ0A 2V41A 4JBBA
chains in the Genus database with same CATH superfamily
4GSNA 1Q98A 2CT6A 2VAFA 3EE2A 4IP1A 2H73A 1DSBA 4N11A 4JRRA 2P5RA 3JCML 1ON4A 3HDCA 1VF2A 1F9MA 4G9HA 1ERTA 1PN0A 3M9JA 4TXOA 1PX6A 2RM5A 4YAPA 1ZYQB 1YJ6A 1PGTA 4ISDA 3ZL5A 2JSZA 1XWCA 2H6YA 2OACA 3BCIA 3GMFA 1F37A 5KN0A 4KA0A 4K0NA 5HFIA 4DSSA 3L9UA 3M3MA 5FT3A 5IPGA 5IOXA 1SL2B 2HSHA 3LORA 1PL2A 2V32A 4V2NA 1Y25A 2HZEB 2LJAA 4AGSA 5J5NA 1GSQA 2IIYA 1BYEA 16GSA 3GX8A 4HDEA 1XWKA 1K0BA 2IMFA 2C0GA 3DEXA 2HXKA 3LEFA 4OFTA 1MTCA 1PX7A 2ON5A 2DKHA 3A5WA 1KBNA 3QOUA 2VCQA 4G10A 4ECCA 2HSYA 3BOAA 4K2XA 1HD2A 3IOSA 2OA7A 3RHCA 3HCZA 4TOPA 3KEBA 1AAZA 5HQPA 5A4VA 2ALBA 3M0FA 4RQXA 2J9HA 4AJ7A 3HJPA 2GQLA 2BMXA 5KN3A 5ECIB 1WJKA 4E8HA 1AQVA 4KH7A 5DAKB 1XWAA 4MZCA 3D4MA 2OKAA 3G9BA 2PWJA 3C71A 3LQ7A 2RLIA 2CVKA 3N5OA 4MH3A 4TR1A 1I5GA 1LBKA 2H1AA 4ECIA 2B6MA 1A24A 4HJMA 4RUVA 2G0FA 1B9YC 3UL3A 3ZZXA 1UA5A 2PU9C 1Z9HA 4G0KA 3TKSE 3FHKA 3IAM2 1KNGA 1YQ1A 3LGCA 5ECLB 1YDKA 2R4VA 4IW9A 4N0VA 3UVTA 3VWVA 4ZBBA 3TJBA 3VWUA 3CMIA 4KSOA 4ILFA 4HSCX 3FR3A 3KTLA 4ZB6A 2K8SA 4EDZA 3ERGA 3F6FA 4HQSA 3F0IA 3D4TA 3HY2A 2DKIA 5CYYA 3HZ4A 2B5XA 4OO4A 1N2AA 4WETA 4Z7XA 4MJCA 1GNWA 1OE7A 1CQGA 4KF9A 3ZFLA 5ELGA 2F8AA 4OCFA 4ZL9A 4RI6A 1MDIA 5KN2A 1IYIA 2M80A 5IO0A 4QL7A 3TKSC 2ZUPA 4HS1A 4HUAA 1JLWA 3MIXA 2WFCA 3HZ8A 2WGRA 1T7PB 4F0BA 4O92A 1S3DA 2FWEA 3ZMLA 4YKFA 2YWMA 1EEJA 5DCHA 2GZZA 3H93A 4GQCA 4LMVA 4ZBDA 3PINA 1F2EA 3UJ1A 2H8LA 3EINA 3KXOA 2LNSA 3J7Yk 3WT1A 5D9VA 1XWGA 2HNLA 2NTOA 3ZIVA 4BVXB 1LJRA 1YZXA 1FB0A 2XPDA 4HZ2A 4WF4A 3LJRA 4YQUA 3TCOA 1EOGA 1HQOA 1SL0B 3WD6A 1GTIA 4FH8A 4HQZA 1R7HA 2IL3A 5HR3A 2F3MA 2EIQA 2JACA 5CRGA 1Z6NA 3IHQA 5D9WA 5EY6A 1SK0A 5LCZA 3TOUA 1X9WB 3ZVJD 2HZFA 2B7KA 4IKHA 2YZHA 5AGYA 3GL5A 1K3LA 3GKNA 1T4ZA 1H4OA 3HA9A 4PQ1A 4BVYA 4KDUA 2DJ1A 2K18A 3HKRA 1E6BA 4K7NA 3D22A 4MCUA 2LQOA 1WRYA 3TRPA 1FHEA 5G1LA 1Z7RA 2WCIA 2IPAA 1XOBA 2CA8A 1DE1A 1W89A 4HEA2 5DAKA 2AB6A 2H1BA 3RPNA 3GHAA 1FVKA 3EYTA 5A4WA 6GSTA 2H6ZA 1T3BA 1TK0B 1GTUA 1BEDA 2WB9A 1SD8A 4PXOA 5B6NA 2P0GA 3L9SA 3N9JA 4F0CA 5CAXA 3VWWA 4F82A 5AIXA 2HFDA 6GSWA 2LEGA 1EP7A 1GUHA 5E59A 1H75A 4XHMA 1MD4A 3LSZA 4D73B 2H01A 2C3NA 2WULA 5B6MA 2X8CA 2C3QA 2HRNA 1TDIA 1EP8A 4N0ZA 1RQMA 4PX1A 4TN8A 2HSMA 1S3CA 5ID2A 4GQFA 4J57E 3FKFA 4IBPA 1XFLA 4QL9A 3UBLA 1AQXA 1XWBA 1TJDA 2CVDA 4JU5A 3UEMA 4L0WA 2YJ7A 4FIWA 4OO5A 1GLQA 3L9VA 4ML6A 1SK1A 4KAEA 4V2MA 5JCUA 1QMVA 2YWOA 3O3TA 3QFBC 1A23A 2H76A 5IMAA 6GSXA 1OVNA 3DWVA 4Q5QA 5DVBA 3FZ9A 2H0IA 2FA8A 1Y6EA 4JR4A 1SKSB 4GWRA 3O6TA 3CRUA 2H70A 5B7CA 3GSSA 4WBJA 4EC0A 2GT5A 5GZZB 1V40A 3KM6A 4F2IA 5DDLA 4G2EA 22GSA 5EVOA 2VD1A 3GSTA 1G6WA 3FZ4A 4P3YB 3MSZA 2GSSA 3TUEA 1QGVA 3BCKA 2I81A 1O73A 2AAWA 2L5OA 2R3XA 4KDXA 4K6XA 4WXTA 4JZQA 5ECSA 3KH9A 3F6DA 18GSA 4G0LA 4V1Ap 4BVXA 1M9AA 2AUVA 2K6VA 5BMUA 2LV3A 5BRTA 3LXZA 2GSTA 4EXJA 1WIKA 1TKDB 4MDCA 1GSUA 4GXZA 4RQRA 1U6TA 3UAPA 2CX4A 1FAAA 1Z6MA 1VF3A 3GRXA 1EZKA 1TW9A 4I8BA 3Q6OA 1DE2A 1K0DA 1K3OA 2FUG2 4N30A 4NHWA 1GULA 4FYUA 3UIWA 3DRNA 2CAIA 2OADA 4ZXGA 2V1MA 2FY6A 3ZYWA 5F8BA 2OE3A 5IOWA 2G2QA 1GSFA 1M7TA 3GL3A 2MBTA 10GSA 2X64A 4DEJA 2VL2C 2NBSA 2BTOT 2HLSA 2L6DA 5CRDA 1GSSA 3IAS2 4L8EA 1ZYEA 2QA1A 2GSQA 5F0GA 4PQIA 4KNDA 3C8EA 5D9TA 5CRWA 2AV4A 4LLRA 5G1KA 1BX9A 3KMNA 4PURA 4G0IA 1B8XA 1V98A 1X5EA 3M1GA 2LRTA 1R26A 4D73A 5A5KA 6GSUA 1S3RA 2MMOA 3VURA 4MLYA 4PUAA 2TIRA 4YQVA 2FNOA 3HVVA 2DIYA 2CZ3A 2GS3A 4FQUA 3F9UA 1SENA 3L0HA 2KP1A 2REMA 4TVEA 2CZ2A 1JZDA 2DJJA 5FHIA 1Z5YE 1RW1A 3EMXA 4BL7B 1OAZA 3G7IA 2H72A 1VGLA 3D21A 2K8VA 1TTZA 3RPPA 3I43A 4NAXA 1SKRB 13GSA 1PSQA 1DBYA 4X0XA 3MAKA 3PGTA 3VK9A 4CY8A 3I6AA 5G2ZA 4MJEA 2O85A 4GSSA 3K8NA 1ZYPA 2YPMA 4MZBA 2C3TA 5AIVA 4DSQA 3TOTA 3LYPA 3P8WA 2KHPA 2YJHA 1TU8A 3IK9A 1TRVA 2A2PA 20GSA 3EU4A 3ED3A 4POBA 4Z2TA 4I5QA 1T8EB 2K9FA 3KCMA 4EVMA 2FWFA 4KX4A 4IHUA 2C80A 4JR6A 4Z2UA 3QAVA 4BVYB 6GSVA 4I97A 2I9HA 3HD5A 4E8EA 4ICYA 3KD0A 4KW6A 1EV9A 4YQMA 2HI7A 3EMPA 5JCGA 3DXBA 2UZ8A 2JZRA 2O87A 4TR3A 2CX3A 3Q18A 5D96A 4IP6A 2B3SA 3QAWA 1PN9A 1U3AA 3G7YA 2TRXA 3EVIA 3FW2A 4ZBAA 2P5QA 1TRWA 3MDKA 2R5GA 3EURA 1WE0A 1GH2A 4GSTA 4PQHA 2JADA 5J3RA 4K7IA 2OE1A 4NXIA 2M72A 4TW5A 3KJYA 4OWYA 5HR1A 3H79A 3D0ZA 4YKGA 1GTAA 2FWGA 1DUGA 2VLTA 2YNXA 4MJBA 2R0CA 2WDUA 4KUNA 1VF4A 1XW6A 1WOUA 5IMFA 4F9ZA 5DJLA 3VPTA 3L4NA 2MMAA 4CDOA 2GT6A 2X4AA 1X5CA 4PTSA 2LRCA 2KLXA 4LL4B 5ID2B 3ZIJA 5J9CA 1I9DA 5ECMB 4YH2A 3UOMA 3DIEA 3ZITA 2VIMA 4K7OA 4MNNA 4O5RA 1U88A 2IFQB 4GTUA 1A2LA 3VFIA 1X5DA 2QA2A 5J4UA 2FHEA 2O8VB 4I6XA 1TRSA 3FMWA 3GYKA 2FCHA 3TJJA 1OYJA 3A2XA 1ZCPA 2AYTA 11GSA 4K5RA 2FA4A 2NPBA 4PNFA 5DCGA 1AC1A 1F3AA 3Q74A 3WYWA 1YEXA 1PL1A 2FD3A 5IMDA 4O5QA 1YF0A 5CO3A 1PKZA 3APSA 2LTKA 4EKZA 2OBIA 1GTBA 4MJAA 3W8SA 2L59A 1A0FA 5DQYA 2VLUA 1GUMA 9GSSA 2BJXA 1T1VA 4EL1A 1GSYA 4BL7A 2RM6A 1CQHA 1XVQA 3J7Yb 3GKKA 3EWLA 5G30A 3FZAA 3IXRA 3MYDA 2D2ZA 2HRFA 3NIVA 1J08A 1YF1A 1GP1A 1SD9A 1O6JA 1OE8A 5DQSA 2O7KA 1Q4JA 3H4KA 1QK8A 4L5OA 4MABA 3LFLA 3MNGA 5D8IA 2NVLA 2VL3A 2IMIA 2VOCA 1AUCA 4HJ2A 5D73A 3E0UA 4XS1A 5CP1A 1XXUA 5DJMA 3FR6A 4PNGA 4ACSA 1XOAA 2YWNA 2CV4A 6GSSA 2PPTA 5INYA 5KN1A 2WZ9A 5CNWA 4AJ8A 2LNTA 2F8FA 1G7EA 3EC3A 1URMA 4NPBA 3TKQA 2XPEA 1BAYA 1FG4A 2MYGA 3O76A 3WGXA 2OJLA 3FYGA 3APQA 1XVWA 4I2TA 2LUSA 4OD7A 2VLVA 3IC4A 5COHA 3BD2A 5DALB 5ELAA 1YKAA 2LRNA 3DVWA 5L71A 3H8QA 1X9MB 2PUKC 1SL1B 4LA1A 4KSMA 3CTGA 3CBUA 3EU3A 4LL1B 5ECRB 4MK3A 2N5BA 3VI5A 3GUSA 3TKPA 5H5RA 5ABRA 4Z2RA 2PMTA 3APOA 1KTEA 1A2MA 1MDKA 1R4WA 1XCCA 3PPUA 3KZQA 3QR6A 5IMZA 1MEKA 1MD3A 1XW5A 3UBKA 8GSSA 3GIXA 5IMVA 2RUEA 2AHEA 4N10A 3U5RE 4O32A 2JSYA 2NDOA 3TKSA 2IFQA 1V2AA 1WWJA 3GX0A 2B1KA 2J23A 2V6OA 5B8AA 1A8YA 2JZSA 1JFUA 2RIIA 3GA4A 4PGTA 1ACVA 1OKTA 2LJKA 3GN3A 1SK2A 3F4TA 3ME8A 4IGJA 3QDNA 2VCWA 4FYCA 3NOFA 4PUFC 3L78A 3DGQA 1FOHA 5KEJA 3G7JA 1FVJA 5H5SA 3FK8A 2XBIA 2CAQA 5HFKA 4HOJA 3ZMKA 3Q19A 4MF7A 4YAVA 5HFGA 1A0RP 3FR9A 3A3TA 2H0HA 2X8GA 4IN0A 1S3AA 2L5LA 3IRAA 1EGOA 3IHGA 1LU4A 5G31A 1M99A 1UC7A 1EGRA 4TKYA 4G19A 3HVSA 4KCAA 1O8WA 4K0GA 2YV7A 4GF0A 6GSYA 4ID0A 2GQMA 5IO2A 4DSRA 2H75A 2DC5A 1B9XC 5GSTA 1AQWA 2HT9A 4XRDA 2E2MA 4IJ3A 1K0AA 4I2UA 3OR5A 3ZFBA 19GSA 3CSJA 7GSSA 2LS5A 2IMEA 1NHOA 2IMKA 3QAGA 3PR8A 1X9SB 5IIZA 3P90A 3DKSA 4KB3A 2GLRA 4MPFA 5HR2A 4TXVA 1K0MA 2DJ2A 2H6XA 4TR0A 1V58A 1BJXA 1XZOA 2IN3A 5C04A 2MZCA 2R37A 5JWQB 4BIKA 4DVCA 1QXHA 1PQNA 1PRXA 3F3RA 3W8JA 3DYRA 3HJMA 1VRSD 2L57A 4WEYA 1ERVA 1QFNA 1WP0A 4XS4B 4ZB8A 3PH9A 4K8MA 1THXA 1R5AA 3IV4A 2I4AA 4K9ZA 4V1Ag 3A5IA 1ABAA 1ST9A 1K0OA 3KP8A 2X49A 1GRXA 5CRHA 3ZREA 4CW9A 5F06A 2GZYA 1M2AA 5DALA 5ECPB 3RHBA 3M8NA 3DMLA 2VM1A 2EC4A 4KGIA 3H1NA 17GSA 3KGKA 2ZNMA 1WPIA 1V57A 2DLXA 3CSHA 4TRXA 3I9V2 3I69A 4ZB9A 1TP9A 5DBQA 2PVOC 4KCEA 2QKEA 4L0UA 1O8XA 2DSAA 2KOKA 1GLPA 3VWXA 1AIUA 3KIJA 5J41A 1GWCA 3ZRDA 4EUYA 1UVZA 1OC3A 5ECOB 3LWAA 3GV1A 1O85A 2N5FA 4HZ4A 2DMMA 1TI1A 2WS2A 4Q5FA 3UVHA 4EO3A 3BJ5A 1PKWA 3R2QA 4IS0A 1YY7A 2LJRA 1QUWA 2GGTA 4MMMA 4K5SA 1YEPA 1ZYNA 3IPZA 3QPMA 2GTUA 2DJKA 4OFNA 4MP4A 2ZCTA 1ERUA 3WGDA 4MA9A 1NM3A 5AISA 1FOVA 2FLSA 1N8JA 3GH6A 2VO4A 5IPHA 1YKCA 3FEUA 5G5FA 2B5EA 3V1WA 3RBTA 1M2DA 5A4UA 1FW1A 4KE3A 5D93A 2ON7A 3DD3A 1QQ2A 3QD9A 5ECKB 2F51A 4XCSA 3FY7A 3S9FA 1FB6A 2WJUA 2YN1A 2L6CA 1Z3EA 2H0GA 4O7HA 3UMAA 3C7MA 3TRXA 3F63A 3F4SA 3TKRA 2YZUA 4K2DA 14GSA 2JZTA 1M3JA 1C72A 3IDVA 4J56E 3ZVJA 4MZWA 2R0GA 3QMXA 1EWXA 3GTUA 5EPFA 1ZZYA 4XIHA 5KOXA 1XPVA 4MF5A 5ECQB 1ERWA 1PFOA 2VCXA 2FGXA 1T00A 3TJFA 1EV4A 3R3EA 4XTSA 1PMTA 4H86A 2VL2A 3LXTA 4JE1A 2E7PA 5CREA 5ENUA 4EDYA 3IE3A 2P31A 5ECNB 2CVBA 1OC8A 4XS4A 3FRCA 3HJOA 2PN8A 1R5PA 1J9BA 5LD0A 1PA3A 1THOA 1G0TA 4ECJA 1BQ7A 2LKUA 4OFMA 4WF5A 1F6MC 1M2BA 2F9SA 2TRCP 1SYRA 3CRTA 2L4CA 3LW9A 2YANA 3W6GA 5J9BA 2QSIA 4BWQA 2EIRA 2EIOA 2A4VA 2HYXA 1ZMAA 1OC9B 4IQ1A 1SJZA 1TXXA 2X8HA 2QGVA 2H19A 4EIPA 2C0FA 4GRFA 3HHVA 1GNEA 3GFKA 2RUFA 4WR5A 3E3EA 3E9JB 5GAPD 5E4WA 4JEDA 5F05A 2HE3A 1K3YA 1M3IA 5GAND 2OBKA 5JWRB 4X43A 1M9BA 3ZLPA 1O7UA 3RDWA 4ECBA 2H1DA 4L5LA 4EF0A 3GNJA 4GLTA 1SJ6A 3EPTA 1T4YA 1TOFA 2PERA 4WR4A 3A2VA 5JCWA 2L4QA 1ML6A 1U3IA 3GH9A 4A5PA 1JZWA 1MDJA 1ILOA 3QFAC 3HVXA 4RI7A 1X0RA 4O5UA 3TJGA 1HNCA 3P2AA 4CY6A 2GQKA 1WMJA 3IC8A 2GVPA 2C4JA 5G5EA 3TGZA 4EIQA 2C0EA 4Q5NA 4KDYA 3UARA 5JWOB 2H74A 3GKXA 2HZEA 1B4PA 4IJIA 4FO5A 1ZOFA 2C0DA 2H71A 2LSTA 4POKA 4F03A 1UN2A 3CTFA 5C00A 1RK4A 2PGTA 5HR0A 1JZRA 3DVXA 4ZILA 1G7OA 2HRKA 2VD0A 4LMWA 3D5JA 2YOIA 1OKDA 2PVQA 3AY8A 1O81A 1GUKA 4NMUA 2R6KA 2O89A 2Z9SA 2JL4A 3LG6A 3RAZA 1ZL9A 4QQ7A 1A8LA 2C8UA 4ZIJA 1SU9A 2MMNA 1W4VA 3HXSA 3LYKA 2E2GA 2H1GA 3SWLA 3CSIA 5F07A 5IQYA 4IQAA 1SKWB 1JLVA 1Z7PA 3C1RA 4ML1A 1VF1A 1GL8A 2B7JA 5LNKe 3IK7A 1XW9A 2H30A 3VI7A 2A2RA 1G6YA 1GSEA 3NZNA 3WGEA 3IA1A 4XRAA 2I3YA 1NW2A 4OMVA 1AW9A 2YWIA 3HVNA 3FZ5A 1V9WA 4IELA 5AN1A 2GSRA 1NSWA 2YCDA 4HU7A 5GSSA 4EE0A 2XBQA 4J2FA 2MBSA 2X99A 4HI7A 4V2LA 4HU9A 3CQFA 3F3QA 3TB2A 2VM2A 2V2GA 3F8UA 3ME7A 3US3A 4NWYA 2DJ3A 2QC7A 4TXOB 5D9XA 3ZTLA 2M46A 2JU5A 3GURA 1HNAA 4CHSA 1USBA 1XBSA 3TJKA 2PBJA 4FYBA 3WT2A 4DSSB 2GDRA 3P7XA 3D6IA 1TK8B 4MF6A 1J0FA 2GZPA 3MWHA 1OC9A 2V6KA 2A4HA 3TRQA 2YV9A 2DMLA 3GKMA 2VL9A 4ULXA 1K0NA 4GCIA 1AXDA 1HNBA 4MPGA 5IM9A 3QCPA 1BG5A 2WRTA 2KP2A 1U87A 3VPQA 2LQQA 4USSA 2HRAA 2VCTA 1JHBA 2IWTA 3CYNA 4IVFA 4POLA 1PD21 5FWGA 4BWSA 3KTBA 2A2SA 5EL8A 2AJQB 5B8BA 3IR4A 3KH7A 3M9KA 3VLNA 2DBCA 3GTUB 4NV5A 2FWHA 1EOHA 2XHFA 4MH2A 1B48A 1HYUA 2OE0A 5KOWA 2ES7A 3CXGA 4ZL7A 4WBRD 3ERFA 2YP6A 4X4JA 4AJ6A 2R0PA 12GSA 1B4QA 2IJYA 4TR1B 2R2JA 1TRUA 1FO5A 2IMDA 1TI3A 3F4RA 1EEMA 4Q5RA 3BBYA 4TR4A 2E0QA 2DIZA 2VCVA 4OCEA 3HYPA 3ERWA 5ECHB 4BPYA 2C1YA 2N5AA 4BA7A 2MMZA 1ZGNA 4WKWA 1IYHA 1XIYA 5H5QA 3C1SA 3ISOA 4NV2A 1E2YA 3C73A 2B1LA 3KP9A 4K1FA 1SJIA 5IMCA 2B5YA 1KEBA 1SYXA 4POMA 4NHZA 2VUPA 2XC2A 1A2JA 2KUCA 1K0CA 1M0UA 1TK5B 3U6VA 1JZOA 4X1UA 1NHYA 3KMOA 1GSDA 2H66A 4XS6A 1F3BA 3A2WA 2CQ9A 3SBCA 3IBHA 4ZL8A 2I1UA 2VCZA 4AF2A 3TDGA 1XG8A 1TU7A 2DJ0A 2V41A 4JBBA
chains in the Genus database with same CATH topology
4GSNA 1Q98A 2CT6A 2VAFA 3EE2A 4IP1A 2H73A 1DSBA 4N11A 4JRRA 2P5RA 3JCML 1ON4A 3HDCA 1VF2A 1F9MA 4G9HA 1ERTA 1PN0A 3M9JA 4TXOA 1PX6A 2RM5A 4YAPA 1ZYQB 1YJ6A 1PGTA 4ISDA 3ZL5A 2JSZA 1XWCA 2H6YA 2OACA 3BCIA 3GMFA 1F37A 5KN0A 4KA0A 4K0NA 5HFIA 4DSSA 3L9UA 3M3MA 5FT3A 5IPGA 5IOXA 1SL2B 2HSHA 3LORA 1PL2A 2V32A 4V2NA 1Y25A 2HZEB 2LJAA 4AGSA 5J5NA 1GSQA 2IIYA 1BYEA 16GSA 3GX8A 4HDEA 1XWKA 1K0BA 2IMFA 2C0GA 3DEXA 2HXKA 3LEFA 4OFTA 1MTCA 1PX7A 2ON5A 2DKHA 3A5WA 1KBNA 3QOUA 2VCQA 4G10A 4ECCA 2HSYA 3BOAA 4K2XA 1HD2A 3IOSA 2OA7A 3RHCA 3HCZA 4TOPA 3KEBA 1AAZA 5HQPA 5A4VA 2ALBA 3M0FA 4RQXA 2J9HA 4AJ7A 3HJPA 2GQLA 2BMXA 5KN3A 5ECIB 1WJKA 4E8HA 1AQVA 4KH7A 5DAKB 1XWAA 4MZCA 3D4MA 2OKAA 3G9BA 2PWJA 3C71A 3LQ7A 2RLIA 2CVKA 3N5OA 4MH3A 4TR1A 1I5GA 1LBKA 2H1AA 4ECIA 2B6MA 1A24A 4HJMA 4RUVA 2G0FA 1B9YC 3UL3A 3ZZXA 1UA5A 2PU9C 1Z9HA 4G0KA 3TKSE 3FHKA 3IAM2 1KNGA 1YQ1A 3LGCA 5ECLB 1YDKA 2R4VA 4IW9A 4N0VA 3UVTA 3VWVA 4ZBBA 3TJBA 3VWUA 3CMIA 4KSOA 4ILFA 3FR3A 3KTLA 4ZB6A 2K8SA 4EDZA 3ERGA 3F6FA 4HQSA 3F0IA 3D4TA 3HY2A 2DKIA 5CYYA 3HZ4A 2B5XA 4OO4A 1N2AA 4WETA 4Z7XA 4MJCA 1GNWA 1OE7A 1CQGA 4KF9A 3ZFLA 5ELGA 2F8AA 4OCFA 4ZL9A 4RI6A 1MDIA 5KN2A 1IYIA 2M80A 5IO0A 4QL7A 3TKSC 2ZUPA 4HS1A 4HUAA 1JLWA 3MIXA 2WFCA 3HZ8A 2WGRA 1T7PB 4F0BA 4O92A 1S3DA 2FWEA 3ZMLA 4YKFA 2YWMA 1EEJA 5DCHA 2GZZA 3H93A 4GQCA 4LMVA 4ZBDA 3PINA 1F2EA 3UJ1A 2H8LA 3EINA 3KXOA 2LNSA 3J7Yk 3WT1A 5D9VA 1XWGA 2HNLA 2NTOA 3ZIVA 4BVXB 1LJRA 1YZXA 1FB0A 2XPDA 4HZ2A 4WF4A 3LJRA 4YQUA 3TCOA 1EOGA 1HQOA 1SL0B 3WD6A 1GTIA 4FH8A 4HQZA 1R7HA 2IL3A 5HR3A 2F3MA 2EIQA 2JACA 5CRGA 1Z6NA 3IHQA 5D9WA 5EY6A 1SK0A 5LCZA 3TOUA 1X9WB 3ZVJD 2HZFA 2B7KA 4IKHA 2YZHA 5AGYA 3GL5A 1K3LA 3GKNA 1T4ZA 1H4OA 3HA9A 4PQ1A 4BVYA 4KDUA 2DJ1A 2K18A 3HKRA 1E6BA 4K7NA 3D22A 4MCUA 2LQOA 1WRYA 3TRPA 1FHEA 5G1LA 1Z7RA 2WCIA 2IPAA 1XOBA 2CA8A 1DE1A 1W89A 4HEA2 5DAKA 2AB6A 2H1BA 3RPNA 3GHAA 1FVKA 3EYTA 5A4WA 6GSTA 2H6ZA 1T3BA 1TK0B 1GTUA 1BEDA 2WB9A 1SD8A 4PXOA 5B6NA 2P0GA 3L9SA 3N9JA 4F0CA 5CAXA 3VWWA 4F82A 5AIXA 2HFDA 6GSWA 2LEGA 1EP7A 1GUHA 5E59A 1H75A 4XHMA 1MD4A 3LSZA 4D73B 2H01A 2C3NA 2WULA 5B6MA 2X8CA 2C3QA 2HRNA 1TDIA 1EP8A 4N0ZA 1RQMA 4PX1A 4TN8A 2HSMA 1S3CA 5ID2A 4GQFA 4J57E 3FKFA 4IBPA 1XFLA 4QL9A 3UBLA 1AQXA 1XWBA 1TJDA 2CVDA 4JU5A 3UEMA 4L0WA 2YJ7A 4FIWA 1GLQA 4OO5A 3L9VA 4ML6A 1SK1A 4KAEA 4V2MA 5JCUA 1QMVA 2YWOA 3O3TA 3QFBC 1A23A 2H76A 5IMAA 6GSXA 1OVNA 3DWVA 4Q5QA 5DVBA 3FZ9A 2H0IA 2FA8A 1Y6EA 4JR4A 1SKSB 4GWRA 3O6TA 3CRUA 2H70A 5B7CA 3GSSA 4WBJA 4EC0A 2GT5A 5GZZB 1V40A 3KM6A 4F2IA 5DDLA 4G2EA 22GSA 5EVOA 2VD1A 3GSTA 1G6WA 3FZ4A 4P3YB 3MSZA 2GSSA 3TUEA 1QGVA 3BCKA 2I81A 1O73A 2AAWA 2L5OA 2R3XA 4KDXA 4K6XA 4WXTA 4JZQA 5ECSA 3KH9A 3F6DA 18GSA 4G0LA 4V1Ap 4BVXA 1M9AA 2AUVA 2K6VA 5BMUA 2LV3A 5BRTA 3LXZA 2GSTA 4EXJA 1WIKA 1TKDB 4MDCA 1GSUA 4GXZA 4RQRA 1U6TA 3UAPA 2CX4A 1FAAA 1Z6MA 1VF3A 3GRXA 1EZKA 1TW9A 4I8BA 3Q6OA 1DE2A 1K0DA 1K3OA 2FUG2 4N30A 4NHWA 1GULA 4FYUA 3UIWA 3DRNA 2CAIA 2OADA 4ZXGA 2V1MA 2FY6A 3ZYWA 5F8BA 2OE3A 5IOWA 2G2QA 1GSFA 1M7TA 3GL3A 2MBTA 10GSA 2X64A 4DEJA 2VL2C 2NBSA 2BTOT 2HLSA 2L6DA 5CRDA 1GSSA 3IAS2 4L8EA 1ZYEA 2QA1A 2GSQA 5F0GA 4PQIA 4KNDA 3C8EA 5D9TA 5CRWA 2AV4A 4LLRA 5G1KA 1BX9A 3KMNA 4PURA 4G0IA 1B8XA 1V98A 1X5EA 3M1GA 2LRTA 1R26A 4D73A 5A5KA 6GSUA 2MMOA 3VURA 4MLYA 4PUAA 2TIRA 4YQVA 2FNOA 3HVVA 2DIYA 2CZ3A 2GS3A 4FQUA 3F9UA 1SENA 3L0HA 2KP1A 2REMA 4TVEA 2CZ2A 1JZDA 2DJJA 5FHIA 1Z5YE 1RW1A 3EMXA 4BL7B 1OAZA 3G7IA 2H72A 1VGLA 3D21A 2K8VA 1TTZA 3RPPA 3I43A 4NAXA 1SKRB 13GSA 1PSQA 1DBYA 4X0XA 3MAKA 3PGTA 3VK9A 4CY8A 3I6AA 5G2ZA 4MJEA 2O85A 4GSSA 3K8NA 1ZYPA 2YPMA 4MZBA 2C3TA 5AIVA 4DSQA 3TOTA 3LYPA 3P8WA 2KHPA 2YJHA 1TU8A 3IK9A 1TRVA 2A2PA 20GSA 3EU4A 3ED3A 4POBA 4Z2TA 4I5QA 1T8EB 2K9FA 3KCMA 4EVMA 2FWFA 4KX4A 4IHUA 2C80A 4JR6A 4Z2UA 3QAVA 4BVYB 6GSVA 4I97A 2I9HA 3HD5A 4E8EA 4ICYA 3KD0A 4KW6A 1EV9A 4YQMA 2HI7A 3EMPA 5JCGA 3DXBA 2UZ8A 2JZRA 2O87A 4TR3A 2CX3A 3Q18A 5D96A 4IP6A 2B3SA 3QAWA 1PN9A 1U3AA 3G7YA 2TRXA 3EVIA 3FW2A 4ZBAA 2P5QA 1TRWA 3MDKA 2R5GA 3EURA 1WE0A 1GH2A 4GSTA 4PQHA 2JADA 5J3RA 4K7IA 2OE1A 4NXIA 2M72A 4TW5A 3KJYA 4OWYA 5HR1A 3H79A 3D0ZA 4YKGA 1GTAA 2FWGA 1DUGA 2VLTA 2YNXA 4MJBA 2R0CA 2WDUA 4KUNA 1VF4A 1XW6A 1WOUA 5IMFA 4F9ZA 5DJLA 3VPTA 3L4NA 2MMAA 4CDOA 2GT6A 2X4AA 1X5CA 4PTSA 2LRCA 2KLXA 4LL4B 5ID2B 3ZIJA 5J9CA 1I9DA 5ECMB 4YH2A 3UOMA 3DIEA 3ZITA 2VIMA 4K7OA 4MNNA 4O5RA 1U88A 2IFQB 4GTUA 1A2LA 3VFIA 1X5DA 2QA2A 5J4UA 2FHEA 2O8VB 4I6XA 1TRSA 3FMWA 3GYKA 2FCHA 3TJJA 1OYJA 3A2XA 1ZCPA 2AYTA 11GSA 4K5RA 2FA4A 2NPBA 4PNFA 5DCGA 1AC1A 1F3AA 3Q74A 3WYWA 1YEXA 1PL1A 2FD3A 5IMDA 4O5QA 1YF0A 5CO3A 1PKZA 3APSA 2LTKA 4EKZA 2OBIA 1GTBA 4MJAA 3W8SA 2L59A 1A0FA 5DQYA 2VLUA 1GUMA 9GSSA 2BJXA 1T1VA 4EL1A 1GSYA 4BL7A 2RM6A 1CQHA 1XVQA 3J7Yb 3GKKA 3EWLA 5G30A 3FZAA 3IXRA 3MYDA 2D2ZA 2HRFA 3NIVA 1J08A 1YF1A 1GP1A 1SD9A 1O6JA 1OE8A 5DQSA 2O7KA 1Q4JA 3H4KA 1QK8A 4L5OA 4MABA 3LFLA 3MNGA 5D8IA 2NVLA 2VL3A 2IMIA 2VOCA 1AUCA 5D73A 4HJ2A 3E0UA 4XS1A 5CP1A 1XXUA 5DJMA 3FR6A 4PNGA 4ACSA 1XOAA 2YWNA 2CV4A 6GSSA 2PPTA 5INYA 5KN1A 2WZ9A 5CNWA 4AJ8A 2LNTA 2F8FA 1G7EA 3EC3A 1URMA 4NPBA 3TKQA 2XPEA 1BAYA 1FG4A 2MYGA 3O76A 3WGXA 2OJLA 3FYGA 3APQA 1XVWA 4I2TA 2LUSA 4OD7A 2VLVA 3IC4A 5COHA 3BD2A 5DALB 5ELAA 1YKAA 2LRNA 3DVWA 5L71A 3H8QA 1X9MB 2PUKC 1SL1B 4LA1A 4KSMA 3CTGA 3CBUA 3EU3A 4LL1B 5ECRB 4MK3A 2N5BA 3VI5A 3GUSA 3TKPA 5H5RA 5ABRA 4Z2RA 2PMTA 3APOA 1KTEA 1A2MA 1MDKA 1R4WA 1XCCA 3PPUA 3KZQA 3QR6A 5IMZA 1MEKA 1MD3A 1XW5A 3UBKA 8GSSA 3GIXA 5IMVA 2RUEA 2AHEA 4N10A 3U5RE 4O32A 2JSYA 2NDOA 3TKSA 2IFQA 1V2AA 1WWJA 3GX0A 2B1KA 2J23A 2V6OA 5B8AA 1A8YA 2JZSA 1JFUA 2RIIA 3GA4A 4PGTA 1ACVA 1OKTA 2LJKA 3GN3A 1SK2A 3F4TA 3ME8A 4IGJA 3QDNA 2VCWA 4FYCA 3NOFA 4PUFC 3L78A 3DGQA 1FOHA 5KEJA 3G7JA 1FVJA 5H5SA 3FK8A 2XBIA 2CAQA 5HFKA 4HOJA 3ZMKA 3Q19A 4MF7A 4YAVA 5HFGA 1A0RP 3FR9A 3A3TA 2H0HA 2X8GA 4IN0A 1S3AA 2L5LA 3IRAA 1EGOA 3IHGA 1LU4A 5G31A 1M99A 1UC7A 1EGRA 4TKYA 4G19A 3HVSA 4KCAA 1O8WA 4K0GA 2YV7A 4GF0A 6GSYA 4ID0A 2GQMA 5IO2A 4DSRA 2H75A 2DC5A 1B9XC 5GSTA 1AQWA 2HT9A 4XRDA 2E2MA 4IJ3A 1K0AA 4I2UA 3OR5A 3ZFBA 19GSA 3CSJA 7GSSA 2LS5A 2IMEA 1NHOA 2IMKA 3QAGA 3PR8A 1X9SB 5IIZA 3P90A 3DKSA 4KB3A 2GLRA 4MPFA 5HR2A 4TXVA 1K0MA 2DJ2A 2H6XA 4TR0A 1V58A 1BJXA 1XZOA 2IN3A 5C04A 2MZCA 2R37A 5JWQB 4DVCA 1QXHA 1PQNA 1PRXA 3F3RA 3W8JA 3DYRA 3HJMA 1VRSD 2L57A 4WEYA 1ERVA 1QFNA 1WP0A 4XS4B 4ZB8A 3PH9A 4K8MA 1THXA 1R5AA 3IV4A 2I4AA 4K9ZA 4V1Ag 3A5IA 1ABAA 1ST9A 1K0OA 3KP8A 2X49A 1GRXA 5CRHA 3ZREA 4CW9A 5F06A 2GZYA 1M2AA 5DALA 5ECPB 3RHBA 3M8NA 3DMLA 2VM1A 2EC4A 4KGIA 3H1NA 17GSA 3KGKA 2ZNMA 1WPIA 1V57A 2DLXA 3CSHA 4TRXA 3I9V2 3I69A 4ZB9A 1TP9A 5DBQA 2PVOC 4KCEA 2QKEA 4L0UA 1O8XA 2DSAA 2KOKA 1GLPA 3VWXA 1AIUA 3KIJA 5J41A 1GWCA 3ZRDA 4EUYA 1UVZA 1OC3A 5ECOB 3LWAA 3GV1A 1O85A 2N5FA 4HZ4A 2DMMA 1TI1A 2WS2A 4Q5FA 3UVHA 4EO3A 3BJ5A 1PKWA 3R2QA 4IS0A 1YY7A 2LJRA 1QUWA 2GGTA 4MMMA 4K5SA 1YEPA 1ZYNA 3IPZA 3QPMA 2GTUA 2DJKA 4OFNA 4MP4A 2ZCTA 1ERUA 3WGDA 4MA9A 1NM3A 5AISA 1FOVA 2FLSA 1N8JA 3GH6A 2VO4A 5IPHA 1YKCA 3FEUA 5G5FA 2B5EA 3V1WA 3RBTA 1M2DA 5A4UA 1FW1A 4KE3A 5D93A 2ON7A 3DD3A 1QQ2A 3QD9A 5ECKB 2F51A 4XCSA 3FY7A 3S9FA 1FB6A 2WJUA 2YN1A 2L6CA 1Z3EA 2H0GA 4O7HA 3UMAA 3C7MA 3TRXA 3F63A 3F4SA 3TKRA 2YZUA 4K2DA 14GSA 2JZTA 1C72A 3IDVA 4J56E 3ZVJA 4MZWA 2R0GA 3QMXA 1EWXA 3GTUA 5EPFA 1ZZYA 4XIHA 5KOXA 1XPVA 4MF5A 5ECQB 1ERWA 2VCXA 2FGXA 1T00A 3TJFA 1EV4A 3R3EA 4XTSA 1PMTA 4H86A 2VL2A 3LXTA 4JE1A 2E7PA 5CREA 5ENUA 4EDYA 3IE3A 2P31A 5ECNB 2CVBA 1OC8A 4XS4A 3FRCA 3HJOA 2PN8A 1R5PA 1J9BA 5LD0A 1PA3A 1THOA 1G0TA 4ECJA 1BQ7A 2LKUA 4OFMA 4WF5A 1F6MC 1M2BA 2F9SA 2TRCP 1SYRA 3CRTA 2L4CA 3LW9A 2YANA 3W6GA 5J9BA 2QSIA 4BWQA 2EIRA 2EIOA 2A4VA 2HYXA 1ZMAA 1OC9B 4IQ1A 1SJZA 1TXXA 2X8HA 2QGVA 2H19A 4EIPA 2C0FA 4GRFA 3HHVA 1GNEA 3GFKA 2RUFA 4WR5A 3E3EA 3E9JB 5GAPD 5E4WA 4JEDA 5F05A 2HE3A 1K3YA 5GAND 2OBKA 5JWRB 4X43A 1M9BA 3ZLPA 1O7UA 3RDWA 4ECBA 2H1DA 4L5LA 4EF0A 3GNJA 4GLTA 1SJ6A 3EPTA 1T4YA 1TOFA 2PERA 4WR4A 3A2VA 5JCWA 2L4QA 1ML6A 1U3IA 3GH9A 4A5PA 1JZWA 1MDJA 1ILOA 3QFAC 3HVXA 4RI7A 1X0RA 4O5UA 3TJGA 1HNCA 3P2AA 4CY6A 2GQKA 1WMJA 3IC8A 2GVPA 2C4JA 5G5EA 3TGZA 4EIQA 2C0EA 4Q5NA 4KDYA 3UARA 5JWOB 2H74A 3GKXA 2HZEA 1B4PA 4IJIA 4FO5A 1ZOFA 2C0DA 2H71A 2LSTA 4POKA 4F03A 1UN2A 3CTFA 5C00A 1RK4A 2PGTA 5HR0A 1JZRA 3DVXA 4ZILA 1G7OA 2HRKA 2VD0A 4LMWA 3D5JA 2YOIA 1OKDA 2PVQA 3AY8A 1O81A 1GUKA 4NMUA 2R6KA 2O89A 2Z9SA 2JL4A 3LG6A 3RAZA 1ZL9A 4QQ7A 1A8LA 2C8UA 4ZIJA 1SU9A 2MMNA 1W4VA 3HXSA 3LYKA 2E2GA 2H1GA 3SWLA 3CSIA 5F07A 5IQYA 4IQAA 1SKWB 1JLVA 1Z7PA 3C1RA 4ML1A 1VF1A 1GL8A 2B7JA 5LNKe 3IK7A 1XW9A 2H30A 3VI7A 2A2RA 1G6YA 1GSEA 3NZNA 3WGEA 3IA1A 4XRAA 2I3YA 1NW2A 4OMVA 1AW9A 2YWIA 3FZ5A 1V9WA 4IELA 5AN1A 2GSRA 1NSWA 2YCDA 4HU7A 5GSSA 4EE0A 2XBQA 4J2FA 2MBSA 2X99A 4HI7A 4V2LA 4HU9A 3F3QA 3TB2A 2VM2A 2V2GA 3F8UA 3ME7A 3US3A 4NWYA 2DJ3A 2QC7A 4TXOB 5D9XA 3ZTLA 2M46A 2JU5A 3GURA 1HNAA 4CHSA 1USBA 1XBSA 3TJKA 2PBJA 4FYBA 3WT2A 4DSSB 2GDRA 3P7XA 3D6IA 1TK8B 4MF6A 1J0FA 2GZPA 3MWHA 1OC9A 2V6KA 2A4HA 3TRQA 2YV9A 2DMLA 3GKMA 2VL9A 4ULXA 1K0NA 4GCIA 1AXDA 1HNBA 4MPGA 5IM9A 3QCPA 1BG5A 2WRTA 2KP2A 1U87A 3VPQA 2LQQA 4USSA 2HRAA 2VCTA 1JHBA 2IWTA 3CYNA 4IVFA 4POLA 1PD21 5FWGA 4BWSA 3KTBA 2A2SA 5EL8A 2AJQB 5B8BA 3IR4A 3KH7A 3M9KA 3VLNA 2DBCA 3GTUB 4NV5A 2FWHA 1EOHA 2XHFA 4MH2A 1B48A 1HYUA 2OE0A 5KOWA 2ES7A 3CXGA 4ZL7A 4WBRD 3ERFA 2YP6A 4X4JA 4AJ6A 2R0PA 12GSA 1B4QA 2IJYA 4TR1B 2R2JA 1TRUA 1FO5A 2IMDA 1TI3A 3F4RA 1EEMA 4Q5RA 3BBYA 4TR4A 2E0QA 2DIZA 2VCVA 4OCEA 3HYPA 3ERWA 5ECHB 4BPYA 2C1YA 2N5AA 4BA7A 2MMZA 1ZGNA 4WKWA 1IYHA 1XIYA 5H5QA 3C1SA 3ISOA 4NV2A 1E2YA 3C73A 2B1LA 3KP9A 4K1FA 1SJIA 5IMCA 2B5YA 1KEBA 1SYXA 4POMA 4NHZA 2VUPA 2XC2A 1A2JA 2KUCA 1K0CA 1M0UA 1TK5B 3U6VA 1JZOA 4X1UA 1NHYA 3KMOA 1GSDA 2H66A 4XS6A 1F3BA 3A2WA 2CQ9A 3SBCA 3IBHA 4ZL8A 2I1UA 2VCZA 4AF2A 3TDGA 1TU7A 2DJ0A 2V41A 4JBBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4GSN A;  1Q98 A;  2CT6 A;  2VAF A;  3EE2 A;  4IP1 A;  2H73 A;  1DSB A;  4N11 A;  4JRR A;  2P5R A;  3JCM L;  1ON4 A;  3HDC A;  1VF2 A;  1F9M A;  4G9H A;  1ERT A;  3M9J A;  4TXO A;  1PX6 A;  2RM5 A;  4YAP A;  1ZYQ B;  1YJ6 A;  1PGT A;  4ISD A;  3ZL5 A;  2JSZ A;  1XWC A;  2H6Y A;  2OAC A;  3BCI A;  3GMF A;  1F37 A;  5KN0 A;  4KA0 A;  4K0N A;  5HFI A;  4DSS A;  3L9U A;  3M3M A;  5FT3 A;  5IPG A;  5IOX A;  1SL2 B;  2HSH A;  3LOR A;  1PL2 A;  2V32 A;  4V2N A;  1Y25 A;  2HZE B;  2LJA A;  4AGS A;  5J5N A;  1GSQ A;  2IIY A;  1BYE A;  16GS A;  3GX8 A;  4HDE A;  1XWK A;  1K0B A;  2IMF A;  2C0G A;  3DEX A;  2HXK A;  3LEF A;  4OFT A;  1MTC A;  1PX7 A;  2ON5 A;  3A5W A;  1KBN A;  3QOU A;  2VCQ A;  4G10 A;  4ECC A;  2HSY A;  3BOA A;  1HD2 A;  3IOS A;  2OA7 A;  3RHC A;  3HCZ A;  4TOP A;  3KEB A;  1AAZ A;  5HQP A;  5A4V A;  2ALB A;  3M0F A;  4RQX A;  2J9H A;  4AJ7 A;  3HJP A;  2GQL A;  2BMX A;  5KN3 A;  5ECI B;  1WJK A;  4E8H A;  1AQV A;  4KH7 A;  5DAK B;  1XWA A;  4MZC A;  3D4M A;  2OKA A;  3G9B A;  2PWJ A;  3C71 A;  3LQ7 A;  2RLI A;  2CVK A;  3N5O A;  4MH3 A;  4TR1 A;  1I5G A;  1LBK A;  2H1A A;  4ECI A;  2B6M A;  1A24 A;  4HJM A;  4RUV A;  2G0F A;  1B9Y C;  3UL3 A;  3ZZX A;  1UA5 A;  2PU9 C;  1Z9H A;  3TKS E;  3FHK A;  3IAM 2;  1KNG A;  1YQ1 A;  3LGC A;  5ECL B;  1YDK A;  2R4V A;  4IW9 A;  4N0V A;  3UVT A;  3VWV A;  4ZBB A;  3TJB A;  3VWU A;  3CMI A;  4KSO A;  4ILF A;  3FR3 A;  3KTL A;  4ZB6 A;  2K8S A;  4EDZ A;  3ERG A;  3F6F A;  4HQS A;  3F0I A;  3D4T A;  3HY2 A;  5CYY A;  3HZ4 A;  2B5X A;  4OO4 A;  1N2A A;  4WET A;  4Z7X A;  4MJC A;  1GNW A;  1OE7 A;  1CQG A;  3ZFL A;  5ELG A;  2F8A A;  4OCF A;  4ZL9 A;  4RI6 A;  1MDI A;  5KN2 A;  1IYI A;  2M80 A;  5IO0 A;  4QL7 A;  3TKS C;  2ZUP A;  4HS1 A;  4HUA A;  1JLW A;  2WFC A;  3HZ8 A;  2WGR A;  1T7P B;  4F0B A;  4O92 A;  1S3D A;  2FWE A;  3ZML A;  2YWM A;  1EEJ A;  5DCH A;  2GZZ A;  3H93 A;  4GQC A;  4LMV A;  4ZBD A;  3PIN A;  1F2E A;  3UJ1 A;  2H8L A;  3EIN A;  3KXO A;  2LNS A;  3J7Y k;  3WT1 A;  5D9V A;  1XWG A;  2HNL A;  2NTO A;  3ZIV A;  1LJR A;  1YZX A;  1FB0 A;  2XPD A;  4HZ2 A;  4WF4 A;  3LJR A;  4YQU A;  3TCO A;  1EOG A;  1HQO A;  1SL0 B;  3WD6 A;  1GTI A;  4FH8 A;  4HQZ A;  1R7H A;  2IL3 A;  5HR3 A;  2F3M A;  2EIQ A;  2JAC A;  5CRG A;  1Z6N A;  3IHQ A;  5D9W A;  5EY6 A;  1SK0 A;  5LCZ A;  3TOU A;  1X9W B;  3ZVJ D;  2HZF A;  2B7K A;  4IKH A;  2YZH A;  5AGY A;  3GL5 A;  1K3L A;  3GKN A;  1T4Z A;  1H4O A;  3HA9 A;  4PQ1 A;  4BVY A;  4KDU A;  2DJ1 A;  2K18 A;  3HKR A;  1E6B A;  4K7N A;  3D22 A;  4MCU A;  2LQO A;  1WRY A;  3TRP A;  1FHE A;  5G1L A;  1Z7R A;  2WCI A;  2IPA A;  1XOB A;  2CA8 A;  1DE1 A;  1W89 A;  4HEA 2;  5DAK A;  2AB6 A;  2H1B A;  3RPN A;  3GHA A;  1FVK A;  3EYT A;  5A4W A;  6GST A;  2H6Z A;  1T3B A;  1TK0 B;  1GTU A;  1BED A;  2WB9 A;  1SD8 A;  4PXO A;  5B6N A;  2P0G A;  3L9S A;  3N9J A;  4F0C A;  5CAX A;  3VWW A;  4F82 A;  5AIX A;  2HFD A;  6GSW A;  2LEG A;  1EP7 A;  1GUH A;  5E59 A;  1H75 A;  4XHM A;  1MD4 A;  3LSZ A;  4D73 B;  2H01 A;  2C3N A;  2WUL A;  5B6M A;  2X8C A;  2C3Q A;  2HRN A;  1TDI A;  1EP8 A;  4N0Z A;  1RQM A;  4PX1 A;  4TN8 A;  1S3C A;  5ID2 A;  4GQF A;  4J57 E;  3FKF A;  4IBP A;  1XFL A;  4QL9 A;  3UBL A;  1AQX A;  1XWB A;  1TJD A;  2CVD A;  4JU5 A;  3UEM A;  4L0W A;  2YJ7 A;  4FIW A;  1GLQ A;  4OO5 A;  3L9V A;  4ML6 A;  1SK1 A;  4KAE A;  4V2M A;  5JCU A;  1QMV A;  2YWO A;  3O3T A;  3QFB C;  1A23 A;  2H76 A;  5IMA A;  6GSX A;  1OVN A;  3DWV A;  4Q5Q A;  5DVB A;  3FZ9 A;  2H0I A;  2FA8 A;  1Y6E A;  4JR4 A;  1SKS B;  4GWR A;  3O6T A;  3CRU A;  2H70 A;  5B7C A;  3GSS A;  4WBJ A;  4EC0 A;  2GT5 A;  5GZZ B;  1V40 A;  3KM6 A;  4F2I A;  5DDL A;  4G2E A;  22GS A;  5EVO A;  2VD1 A;  3GST A;  1G6W A;  3FZ4 A;  4P3Y B;  3MSZ A;  2GSS A;  3TUE A;  1QGV A;  3BCK A;  2I81 A;  1O73 A;  2AAW A;  2L5O A;  2R3X A;  4KDX A;  4K6X A;  4WXT A;  4JZQ A;  5ECS A;  3KH9 A;  3F6D A;  18GS A;  4V1A p;  4BVX A;  1M9A A;  2AUV A;  2K6V A;  2LV3 A;  3LXZ A;  2GST A;  4EXJ A;  1WIK A;  1TKD B;  4MDC A;  1GSU A;  4GXZ A;  4RQR A;  1U6T A;  3UAP A;  2CX4 A;  1FAA A;  1Z6M A;  1VF3 A;  3GRX A;  1EZK A;  1TW9 A;  4I8B A;  3Q6O A;  1DE2 A;  1K0D A;  1K3O A;  2FUG 2;  4N30 A;  4NHW A;  1GUL A;  4FYU A;  3UIW A;  3DRN A;  2CAI A;  2OAD A;  4ZXG A;  2V1M A;  2FY6 A;  3ZYW A;  5F8B A;  2OE3 A;  5IOW A;  2G2Q A;  1GSF A;  1M7T A;  3GL3 A;  2MBT A;  10GS A;  2X64 A;  4DEJ A;  2VL2 C;  2NBS A;  2BTO T;  2HLS A;  2L6D A;  5CRD A;  1GSS A;  3IAS 2;  4L8E A;  1ZYE A;  2GSQ A;  5F0G A;  4PQI A;  4KND A;  3C8E A;  5D9T A;  5CRW A;  2AV4 A;  4LLR A;  5G1K A;  1BX9 A;  3KMN A;  4PUR A;  1B8X A;  1V98 A;  1X5E A;  3M1G A;  2LRT A;  1R26 A;  4D73 A;  5A5K A;  6GSU A;  2MMO A;  3VUR A;  4MLY A;  4PUA A;  2TIR A;  4YQV A;  2FNO A;  3HVV A;  2DIY A;  2CZ3 A;  2GS3 A;  3F9U A;  1SEN A;  3L0H A;  2KP1 A;  2REM A;  4TVE A;  2CZ2 A;  1JZD A;  2DJJ A;  5FHI A;  1Z5Y E;  1RW1 A;  3EMX A;  1OAZ A;  3G7I A;  2H72 A;  1VGL A;  3D21 A;  2K8V A;  1TTZ A;  3RPP A;  3I43 A;  4NAX A;  1SKR B;  13GS A;  1PSQ A;  1DBY A;  4X0X A;  3MAK A;  3PGT A;  3VK9 A;  3I6A A;  5G2Z A;  4MJE A;  2O85 A;  4GSS A;  3K8N A;  2YPM A;  4MZB A;  2C3T A;  5AIV A;  4DSQ A;  3TOT A;  3LYP A;  3P8W A;  2KHP A;  2YJH A;  1TU8 A;  3IK9 A;  1TRV A;  20GS A;  3EU4 A;  3ED3 A;  4POB A;  4I5Q A;  1T8E B;  2K9F A;  3KCM A;  4EVM A;  2FWF A;  4KX4 A;  4IHU A;  2C80 A;  4JR6 A;  3QAV A;  6GSV A;  4I97 A;  2I9H A;  3HD5 A;  4E8E A;  3KD0 A;  4KW6 A;  1EV9 A;  4YQM A;  2HI7 A;  3EMP A;  5JCG A;  3DXB A;  2JZR A;  2O87 A;  4TR3 A;  2CX3 A;  3Q18 A;  5D96 A;  4IP6 A;  2B3S A;  3QAW A;  1PN9 A;  1U3A A;  3G7Y A;  2TRX A;  3EVI A;  3FW2 A;  4ZBA A;  2P5Q A;  1TRW A;  3MDK A;  2R5G A;  3EUR A;  1WE0 A;  1GH2 A;  4GST A;  4PQH A;  2JAD A;  5J3R A;  4K7I A;  2OE1 A;  4NXI A;  2M72 A;  4TW5 A;  3KJY A;  4OWY A;  5HR1 A;  3H79 A;  3D0Z A;  1GTA A;  2FWG A;  1DUG A;  2VLT A;  2YNX A;  4MJB A;  2WDU A;  4KUN A;  1VF4 A;  1XW6 A;  1WOU A;  5IMF A;  4F9Z A;  5DJL A;  3VPT A;  3L4N A;  2MMA A;  4CDO A;  2GT6 A;  1X5C A;  2LRC A;  2KLX A;  4LL4 B;  5ID2 B;  3ZIJ A;  5J9C A;  1I9D A;  5ECM B;  4YH2 A;  3UOM A;  3DIE A;  3ZIT A;  2VIM A;  4K7O A;  4O5R A;  1U88 A;  2IFQ B;  4GTU A;  1A2L A;  3VFI A;  1X5D A;  5J4U A;  2FHE A;  2O8V B;  4I6X A;  1TRS A;  3GYK A;  2FCH A;  3TJJ A;  1OYJ A;  3A2X A;  1ZCP A;  2AYT A;  11GS A;  2FA4 A;  2NPB A;  4PNF A;  5DCG A;  1AC1 A;  1F3A A;  3Q74 A;  3WYW A;  1YEX A;  1PL1 A;  2FD3 A;  5IMD A;  1YF0 A;  5CO3 A;  1PKZ A;  3APS A;  2LTK A;  4EKZ A;  2OBI A;  1GTB A;  4MJA A;  3W8S A;  2L59 A;  1A0F A;  5DQY A;  2VLU A;  1GUM A;  9GSS A;  2BJX A;  1T1V A;  4EL1 A;  1GSY A;  4BL7 A;  2RM6 A;  1CQH A;  1XVQ A;  3J7Y b;  3GKK A;  3EWL A;  5G30 A;  3FZA A;  3IXR A;  2D2Z A;  2HRF A;  3NIV A;  1J08 A;  1YF1 A;  1GP1 A;  1SD9 A;  1O6J A;  1OE8 A;  5DQS A;  2O7K A;  1Q4J A;  3H4K A;  1QK8 A;  4L5O A;  4MAB A;  3LFL A;  3MNG A;  5D8I A;  2NVL A;  2VL3 A;  2IMI A;  2VOC A;  1AUC A;  5D73 A;  4HJ2 A;  3E0U A;  4XS1 A;  5CP1 A;  1XXU A;  5DJM A;  3FR6 A;  4PNG A;  4ACS A;  1XOA A;  2YWN A;  2CV4 A;  6GSS A;  2PPT A;  5INY A;  5KN1 A;  2WZ9 A;  5CNW A;  4AJ8 A;  2LNT A;  2F8F A;  1G7E A;  3EC3 A;  1URM A;  4NPB A;  3TKQ A;  2XPE A;  1BAY A;  1FG4 A;  2MYG A;  3O76 A;  3WGX A;  2OJL A;  3FYG A;  3APQ A;  1XVW A;  4I2T A;  2LUS A;  4OD7 A;  2VLV A;  3IC4 A;  5COH A;  3BD2 A;  5DAL B;  5ELA A;  1YKA A;  2LRN A;  3DVW A;  5L71 A;  3H8Q A;  1X9M B;  2PUK C;  1SL1 B;  4LA1 A;  4KSM A;  3CTG A;  3CBU A;  3EU3 A;  4LL1 B;  5ECR B;  4MK3 A;  2N5B A;  3VI5 A;  3GUS A;  3TKP A;  5H5R A;  5ABR A;  2PMT A;  3APO A;  1KTE A;  1A2M A;  1MDK A;  1R4W A;  1XCC A;  3KZQ A;  3QR6 A;  5IMZ A;  1MEK A;  1MD3 A;  1XW5 A;  3UBK A;  8GSS A;  3GIX A;  5IMV A;  2RUE A;  2AHE A;  4N10 A;  3U5R E;  4O32 A;  2JSY A;  2NDO A;  3TKS A;  2IFQ A;  1V2A A;  1WWJ A;  3GX0 A;  2B1K A;  2J23 A;  2V6O A;  5B8A A;  1A8Y A;  2JZS A;  1JFU A;  2RII A;  3GA4 A;  4PGT A;  1ACV A;  1OKT A;  2LJK A;  3GN3 A;  1SK2 A;  3F4T A;  3ME8 A;  4IGJ A;  3QDN A;  2VCW A;  4FYC A;  3NOF A;  4PUF C;  3L78 A;  3DGQ A;  5KEJ A;  3G7J A;  1FVJ A;  5H5S A;  3FK8 A;  2XBI A;  2CAQ A;  5HFK A;  4HOJ A;  3ZMK A;  3Q19 A;  4MF7 A;  4YAV A;  5HFG A;  1A0R P;  3FR9 A;  3A3T A;  2H0H A;  2X8G A;  4IN0 A;  1S3A A;  2L5L A;  3IRA A;  1EGO A;  1LU4 A;  5G31 A;  1M99 A;  1UC7 A;  1EGR A;  4TKY A;  4G19 A;  3HVS A;  4KCA A;  1O8W A;  4K0G A;  2YV7 A;  4GF0 A;  6GSY A;  4ID0 A;  2GQM A;  5IO2 A;  4DSR A;  2H75 A;  2DC5 A;  1B9X C;  5GST A;  1AQW A;  2HT9 A;  4XRD A;  2E2M A;  4IJ3 A;  1K0A A;  4I2U A;  3OR5 A;  3ZFB A;  19GS A;  3CSJ A;  7GSS A;  2LS5 A;  2IME A;  1NHO A;  2IMK A;  3QAG A;  3PR8 A;  1X9S B;  5IIZ A;  3P90 A;  3DKS A;  4KB3 A;  2GLR A;  4MPF A;  5HR2 A;  4TXV A;  1K0M A;  2DJ2 A;  2H6X A;  4TR0 A;  1V58 A;  1BJX A;  1XZO A;  2IN3 A;  5C04 A;  2MZC A;  2R37 A;  5JWQ B;  4DVC A;  1QXH A;  1PQN A;  1PRX A;  3F3R A;  3W8J A;  3DYR A;  3HJM A;  1VRS D;  2L57 A;  4WEY A;  1ERV A;  1QFN A;  1WP0 A;  4XS4 B;  4ZB8 A;  3PH9 A;  4K8M A;  1THX A;  1R5A A;  3IV4 A;  2I4A A;  4K9Z A;  4V1A g;  1ABA A;  1ST9 A;  1K0O A;  3KP8 A;  1GRX A;  5CRH A;  3ZRE A;  4CW9 A;  5F06 A;  2GZY A;  1M2A A;  5DAL A;  5ECP B;  3RHB A;  3M8N A;  3DML A;  2VM1 A;  2EC4 A;  4KGI A;  3H1N A;  17GS A;  3KGK A;  2ZNM A;  1WPI A;  1V57 A;  2DLX A;  3CSH A;  4TRX A;  3I9V 2;  3I69 A;  4ZB9 A;  1TP9 A;  5DBQ A;  2PVO C;  4KCE A;  2QKE A;  4L0U A;  1O8X A;  2DSA A;  2KOK A;  1GLP A;  3VWX A;  1AIU A;  3KIJ A;  5J41 A;  1GWC A;  3ZRD A;  4EUY A;  1UVZ A;  1OC3 A;  5ECO B;  3LWA A;  3GV1 A;  1O85 A;  2N5F A;  4HZ4 A;  2DMM A;  1TI1 A;  2WS2 A;  4Q5F A;  3UVH A;  4EO3 A;  3BJ5 A;  1PKW A;  3R2Q A;  4IS0 A;  1YY7 A;  2LJR A;  1QUW A;  2GGT A;  4MMM A;  1YEP A;  3QPM A;  3IPZ A;  2GTU A;  2DJK A;  4OFN A;  4MP4 A;  2ZCT A;  1ERU A;  3WGD A;  4MA9 A;  1NM3 A;  5AIS A;  1FOV A;  2FLS A;  1N8J A;  3GH6 A;  2VO4 A;  5IPH A;  1YKC A;  3FEU A;  5G5F A;  2B5E A;  3V1W A;  3RBT A;  1M2D A;  5A4U A;  1FW1 A;  4KE3 A;  5D93 A;  2ON7 A;  3DD3 A;  1QQ2 A;  3QD9 A;  5ECK B;  2F51 A;  4XCS A;  3FY7 A;  3S9F A;  1FB6 A;  2WJU A;  2YN1 A;  2L6C A;  1Z3E A;  2H0G A;  4O7H A;  3UMA A;  3C7M A;  3TRX A;  3F63 A;  3F4S A;  3TKR A;  2YZU A;  4K2D A;  14GS A;  2JZT A;  1C72 A;  3IDV A;  4J56 E;  3ZVJ A;  4MZW A;  3QMX A;  1EWX A;  3GTU A;  5EPF A;  1ZZY A;  4XIH A;  1XPV A;  4MF5 A;  5ECQ B;  1ERW A;  2VCX A;  2FGX A;  1T00 A;  3TJF A;  1EV4 A;  4XTS A;  1PMT A;  4H86 A;  2VL2 A;  3LXT A;  4JE1 A;  2E7P A;  5ENU A;  5CRE A;  4EDY A;  3IE3 A;  2P31 A;  5ECN B;  2CVB A;  1OC8 A;  4XS4 A;  3FRC A;  3HJO A;  2PN8 A;  1R5P A;  1J9B A;  5LD0 A;  1PA3 A;  1THO A;  1G0T A;  4ECJ A;  1BQ7 A;  2LKU A;  4OFM A;  4WF5 A;  1F6M C;  1M2B A;  2F9S A;  2TRC P;  1SYR A;  3CRT A;  2L4C A;  2YAN A;  3W6G A;  5J9B A;  2QSI A;  4BWQ A;  2EIR A;  2EIO A;  2A4V A;  2HYX A;  1ZMA A;  1OC9 B;  4IQ1 A;  1SJZ A;  1TXX A;  2X8H A;  2QGV A;  2H19 A;  2C0F A;  4GRF A;  3HHV A;  1GNE A;  3GFK A;  2RUF A;  4WR5 A;  3E3E A;  3E9J B;  5GAP D;  5E4W A;  4JED A;  5F05 A;  2HE3 A;  1K3Y A;  5GAN D;  2OBK A;  5JWR B;  4X43 A;  1M9B A;  3ZLP A;  1O7U A;  3RDW A;  4ECB A;  2H1D A;  4L5L A;  4EF0 A;  3GNJ A;  4GLT A;  1SJ6 A;  1T4Y A;  1TOF A;  2PER A;  4WR4 A;  3A2V A;  5JCW A;  2L4Q A;  1ML6 A;  1U3I A;  3GH9 A;  1JZW A;  1MDJ A;  1ILO A;  3QFA C;  3HVX A;  4RI7 A;  1X0R A;  3TJG A;  1HNC A;  3P2A A;  2GQK A;  1WMJ A;  2GVP A;  2C4J A;  5G5E A;  3TGZ A;  2C0E A;  4Q5N A;  4KDY A;  3UAR A;  5JWO B;  2H74 A;  3GKX A;  2HZE A;  1B4P A;  4IJI A;  4FO5 A;  1ZOF A;  2C0D A;  2H71 A;  2LST A;  4POK A;  4F03 A;  1UN2 A;  3CTF A;  5C00 A;  1RK4 A;  2PGT A;  5HR0 A;  1JZR A;  3DVX A;  4ZIL A;  1G7O A;  2VD0 A;  4LMW A;  3D5J A;  2YOI A;  1OKD A;  2PVQ A;  3AY8 A;  1O81 A;  1GUK A;  4NMU A;  2R6K A;  2O89 A;  2Z9S A;  2JL4 A;  3LG6 A;  3RAZ A;  1ZL9 A;  4QQ7 A;  1A8L A;  2C8U A;  4ZIJ A;  1SU9 A;  2MMN A;  1W4V A;  3HXS A;  3LYK A;  2E2G A;  2H1G A;  3SWL A;  3CSI A;  5F07 A;  5IQY A;  4IQA A;  1SKW B;  1JLV A;  1Z7P A;  3C1R A;  4ML1 A;  1VF1 A;  1GL8 A;  2B7J A;  5LNK e;  3IK7 A;  1XW9 A;  2H30 A;  3VI7 A;  2A2R A;  1G6Y A;  1GSE A;  3NZN A;  3WGE A;  3IA1 A;  4XRA A;  2I3Y A;  1NW2 A;  4OMV A;  1AW9 A;  2YWI A;  3FZ5 A;  1V9W A;  4IEL A;  5AN1 A;  2GSR A;  1NSW A;  2YCD A;  4HU7 A;  5GSS A;  4EE0 A;  2XBQ A;  4J2F A;  2MBS A;  2X99 A;  4HI7 A;  4V2L A;  4HU9 A;  3F3Q A;  3TB2 A;  2VM2 A;  2V2G A;  3F8U A;  3ME7 A;  3US3 A;  4NWY A;  2DJ3 A;  2QC7 A;  4TXO B;  5D9X A;  3ZTL A;  2M46 A;  2JU5 A;  3GUR A;  1HNA A;  4CHS A;  1USB A;  1XBS A;  3TJK A;  2PBJ A;  4FYB A;  3WT2 A;  4DSS B;  2GDR A;  3P7X A;  3D6I A;  1TK8 B;  4MF6 A;  1J0F A;  2GZP A;  3MWH A;  1OC9 A;  2V6K A;  3TRQ A;  2YV9 A;  2DML A;  3GKM A;  2VL9 A;  4ULX A;  1K0N A;  4GCI A;  1AXD A;  1HNB A;  4MPG A;  5IM9 A;  3QCP A;  1BG5 A;  2WRT A;  2KP2 A;  1U87 A;  3VPQ A;  2LQQ A;  2VCT A;  1JHB A;  2IWT A;  3CYN A;  4IVF A;  4POL A;  1PD2 1;  5FWG A;  4BWS A;  3KTB A;  2A2S A;  5EL8 A;  2AJQ B;  5B8B A;  3IR4 A;  3KH7 A;  3M9K A;  3VLN A;  2DBC A;  3GTU B;  4NV5 A;  2FWH A;  1EOH A;  2XHF A;  4MH2 A;  1B48 A;  1HYU A;  2OE0 A;  2ES7 A;  3CXG A;  4ZL7 A;  4WBR D;  3ERF A;  2YP6 A;  4AJ6 A;  12GS A;  1B4Q A;  2IJY A;  4TR1 B;  2R2J A;  1TRU A;  1FO5 A;  2IMD A;  1TI3 A;  3F4R A;  1EEM A;  4Q5R A;  3BBY A;  4TR4 A;  2E0Q A;  2DIZ A;  2VCV A;  4OCE A;  3HYP A;  3ERW A;  5ECH B;  4BPY A;  2C1Y A;  2N5A A;  4BA7 A;  2MMZ A;  1ZGN A;  4WKW A;  1IYH A;  1XIY A;  5H5Q A;  3C1S A;  3ISO A;  4NV2 A;  1E2Y A;  3C73 A;  2B1L A;  3KP9 A;  4K1F A;  1SJI A;  5IMC A;  2B5Y A;  1KEB A;  1SYX A;  4POM A;  4NHZ A;  2VUP A;  2XC2 A;  1A2J A;  2KUC A;  1K0C A;  1M0U A;  1TK5 B;  3U6V A;  1JZO A;  4X1U A;  1NHY A;  3KMO A;  1GSD A;  2H66 A;  4XS6 A;  1F3B A;  3A2W A;  2CQ9 A;  3SBC A;  3IBH A;  4ZL8 A;  2I1U A;  2VCZ A;  4AF2 A;  3TDG A;  1TU7 A;  2DJ0 A;  2V41 A;  4JBB A; 
#chains in the Genus database with same CATH topology
 4GSN A;  1Q98 A;  2CT6 A;  2VAF A;  3EE2 A;  4IP1 A;  2H73 A;  1DSB A;  4N11 A;  4JRR A;  2P5R A;  3JCM L;  1ON4 A;  3HDC A;  1VF2 A;  1F9M A;  4G9H A;  1ERT A;  1PN0 A;  3M9J A;  4TXO A;  1PX6 A;  2RM5 A;  4YAP A;  1ZYQ B;  1YJ6 A;  1PGT A;  4ISD A;  3ZL5 A;  2JSZ A;  1XWC A;  2H6Y A;  2OAC A;  3BCI A;  3GMF A;  1F37 A;  5KN0 A;  4KA0 A;  4K0N A;  5HFI A;  4DSS A;  3L9U A;  3M3M A;  5FT3 A;  5IPG A;  5IOX A;  1SL2 B;  2HSH A;  3LOR A;  1PL2 A;  2V32 A;  4V2N A;  1Y25 A;  2HZE B;  2LJA A;  4AGS A;  5J5N A;  1GSQ A;  2IIY A;  1BYE A;  16GS A;  3GX8 A;  4HDE A;  1XWK A;  1K0B A;  2IMF A;  2C0G A;  3DEX A;  2HXK A;  3LEF A;  4OFT A;  1MTC A;  1PX7 A;  2ON5 A;  2DKH A;  3A5W A;  1KBN A;  3QOU A;  2VCQ A;  4G10 A;  4ECC A;  2HSY A;  3BOA A;  4K2X A;  1HD2 A;  3IOS A;  2OA7 A;  3RHC A;  3HCZ A;  4TOP A;  3KEB A;  1AAZ A;  5HQP A;  5A4V A;  2ALB A;  3M0F A;  4RQX A;  2J9H A;  4AJ7 A;  3HJP A;  2GQL A;  2BMX A;  5KN3 A;  5ECI B;  1WJK A;  4E8H A;  1AQV A;  4KH7 A;  5DAK B;  1XWA A;  4MZC A;  3D4M A;  2OKA A;  3G9B A;  2PWJ A;  3C71 A;  3LQ7 A;  2RLI A;  2CVK A;  3N5O A;  4MH3 A;  4TR1 A;  1I5G A;  1LBK A;  2H1A A;  4ECI A;  2B6M A;  1A24 A;  4HJM A;  4RUV A;  2G0F A;  1B9Y C;  3UL3 A;  3ZZX A;  1UA5 A;  2PU9 C;  1Z9H A;  4G0K A;  3TKS E;  3FHK A;  3IAM 2;  1KNG A;  1YQ1 A;  3LGC A;  5ECL B;  1YDK A;  2R4V A;  4IW9 A;  4N0V A;  3UVT A;  3VWV A;  4ZBB A;  3TJB A;  3VWU A;  3CMI A;  4KSO A;  4ILF A;  4HSC X;  3FR3 A;  3KTL A;  4ZB6 A;  2K8S A;  4EDZ A;  3ERG A;  3F6F A;  4HQS A;  3F0I A;  3D4T A;  3HY2 A;  2DKI A;  5CYY A;  3HZ4 A;  2B5X A;  4OO4 A;  1N2A A;  4WET A;  4Z7X A;  4MJC A;  1GNW A;  1OE7 A;  1CQG A;  4KF9 A;  3ZFL A;  5ELG A;  2F8A A;  4OCF A;  4ZL9 A;  4RI6 A;  1MDI A;  5KN2 A;  1IYI A;  2M80 A;  5IO0 A;  4QL7 A;  3TKS C;  2ZUP A;  4HS1 A;  4HUA A;  1JLW A;  3MIX A;  2WFC A;  3HZ8 A;  2WGR A;  1T7P B;  4F0B A;  4O92 A;  1S3D A;  2FWE A;  3ZML A;  4YKF A;  2YWM A;  1EEJ A;  5DCH A;  2GZZ A;  3H93 A;  4GQC A;  4LMV A;  4ZBD A;  3PIN A;  1F2E A;  3UJ1 A;  2H8L A;  3EIN A;  3KXO A;  2LNS A;  3J7Y k;  3WT1 A;  5D9V A;  1XWG A;  2HNL A;  2NTO A;  3ZIV A;  4BVX B;  1LJR A;  1YZX A;  1FB0 A;  2XPD A;  4HZ2 A;  4WF4 A;  3LJR A;  4YQU A;  3TCO A;  1EOG A;  1HQO A;  1SL0 B;  3WD6 A;  1GTI A;  4FH8 A;  4HQZ A;  1R7H A;  2IL3 A;  5HR3 A;  2F3M A;  2EIQ A;  2JAC A;  5CRG A;  1Z6N A;  3IHQ A;  5D9W A;  5EY6 A;  1SK0 A;  5LCZ A;  3TOU A;  1X9W B;  3ZVJ D;  2HZF A;  2B7K A;  4IKH A;  2YZH A;  5AGY A;  3GL5 A;  1K3L A;  3GKN A;  1T4Z A;  1H4O A;  3HA9 A;  4PQ1 A;  4BVY A;  4KDU A;  2DJ1 A;  2K18 A;  3HKR A;  1E6B A;  4K7N A;  3D22 A;  4MCU A;  2LQO A;  1WRY A;  3TRP A;  1FHE A;  5G1L A;  1Z7R A;  2WCI A;  2IPA A;  1XOB A;  2CA8 A;  1DE1 A;  1W89 A;  4HEA 2;  5DAK A;  2AB6 A;  2H1B A;  3RPN A;  3GHA A;  1FVK A;  3EYT A;  5A4W A;  6GST A;  2H6Z A;  1T3B A;  1TK0 B;  1GTU A;  1BED A;  2WB9 A;  1SD8 A;  4PXO A;  5B6N A;  2P0G A;  3L9S A;  3N9J A;  4F0C A;  5CAX A;  3VWW A;  4F82 A;  5AIX A;  2HFD A;  6GSW A;  2LEG A;  1EP7 A;  1GUH A;  5E59 A;  1H75 A;  4XHM A;  1MD4 A;  3LSZ A;  4D73 B;  2H01 A;  2C3N A;  2WUL A;  5B6M A;  2X8C A;  2C3Q A;  2HRN A;  1TDI A;  1EP8 A;  4N0Z A;  1RQM A;  4PX1 A;  4TN8 A;  2HSM A;  1S3C A;  5ID2 A;  4GQF A;  4J57 E;  3FKF A;  4IBP A;  1XFL A;  4QL9 A;  3UBL A;  1AQX A;  1XWB A;  1TJD A;  2CVD A;  4JU5 A;  3UEM A;  4L0W A;  2YJ7 A;  4FIW A;  4OO5 A;  1GLQ A;  3L9V A;  4ML6 A;  1SK1 A;  4KAE A;  4V2M A;  5JCU A;  1QMV A;  2YWO A;  3O3T A;  3QFB C;  1A23 A;  2H76 A;  5IMA A;  6GSX A;  1OVN A;  3DWV A;  4Q5Q A;  5DVB A;  3FZ9 A;  2H0I A;  2FA8 A;  1Y6E A;  4JR4 A;  1SKS B;  4GWR A;  3O6T A;  3CRU A;  2H70 A;  5B7C A;  3GSS A;  4WBJ A;  4EC0 A;  2GT5 A;  5GZZ B;  1V40 A;  3KM6 A;  4F2I A;  5DDL A;  4G2E A;  22GS A;  5EVO A;  2VD1 A;  3GST A;  1G6W A;  3FZ4 A;  4P3Y B;  3MSZ A;  2GSS A;  3TUE A;  1QGV A;  3BCK A;  2I81 A;  1O73 A;  2AAW A;  2L5O A;  2R3X A;  4KDX A;  4K6X A;  4WXT A;  4JZQ A;  5ECS A;  3KH9 A;  3F6D A;  18GS A;  4G0L A;  4V1A p;  4BVX A;  1M9A A;  2AUV A;  2K6V A;  5BMU A;  2LV3 A;  5BRT A;  3LXZ A;  2GST A;  4EXJ A;  1WIK A;  1TKD B;  4MDC A;  1GSU A;  4GXZ A;  4RQR A;  1U6T A;  3UAP A;  2CX4 A;  1FAA A;  1Z6M A;  1VF3 A;  3GRX A;  1EZK A;  1TW9 A;  4I8B A;  3Q6O A;  1DE2 A;  1K0D A;  1K3O A;  2FUG 2;  4N30 A;  4NHW A;  1GUL A;  4FYU A;  3UIW A;  3DRN A;  2CAI A;  2OAD A;  4ZXG A;  2V1M A;  2FY6 A;  3ZYW A;  5F8B A;  2OE3 A;  5IOW A;  2G2Q A;  1GSF A;  1M7T A;  3GL3 A;  2MBT A;  10GS A;  2X64 A;  4DEJ A;  2VL2 C;  2NBS A;  2BTO T;  2HLS A;  2L6D A;  5CRD A;  1GSS A;  3IAS 2;  4L8E A;  1ZYE A;  2QA1 A;  2GSQ A;  5F0G A;  4PQI A;  4KND A;  3C8E A;  5D9T A;  5CRW A;  2AV4 A;  4LLR A;  5G1K A;  1BX9 A;  3KMN A;  4PUR A;  4G0I A;  1B8X A;  1V98 A;  1X5E A;  3M1G A;  2LRT A;  1R26 A;  4D73 A;  5A5K A;  6GSU A;  1S3R A;  2MMO A;  3VUR A;  4MLY A;  4PUA A;  2TIR A;  4YQV A;  2FNO A;  3HVV A;  2DIY A;  2CZ3 A;  2GS3 A;  4FQU A;  3F9U A;  1SEN A;  3L0H A;  2KP1 A;  2REM A;  4TVE A;  2CZ2 A;  1JZD A;  2DJJ A;  5FHI A;  1Z5Y E;  1RW1 A;  3EMX A;  4BL7 B;  1OAZ A;  3G7I A;  2H72 A;  1VGL A;  3D21 A;  2K8V A;  1TTZ A;  3RPP A;  3I43 A;  4NAX A;  1SKR B;  13GS A;  1PSQ A;  1DBY A;  4X0X A;  3MAK A;  3PGT A;  3VK9 A;  4CY8 A;  3I6A A;  5G2Z A;  4MJE A;  2O85 A;  4GSS A;  3K8N A;  1ZYP A;  2YPM A;  4MZB A;  2C3T A;  5AIV A;  4DSQ A;  3TOT A;  3LYP A;  3P8W A;  2KHP A;  2YJH A;  1TU8 A;  3IK9 A;  1TRV A;  2A2P A;  20GS A;  3EU4 A;  3ED3 A;  4POB A;  4Z2T A;  4I5Q A;  1T8E B;  2K9F A;  3KCM A;  4EVM A;  2FWF A;  4KX4 A;  4IHU A;  2C80 A;  4JR6 A;  4Z2U A;  3QAV A;  4BVY B;  6GSV A;  4I97 A;  2I9H A;  3HD5 A;  4E8E A;  4ICY A;  3KD0 A;  4KW6 A;  1EV9 A;  4YQM A;  2HI7 A;  3EMP A;  5JCG A;  3DXB A;  2UZ8 A;  2JZR A;  2O87 A;  4TR3 A;  2CX3 A;  3Q18 A;  5D96 A;  4IP6 A;  2B3S A;  3QAW A;  1PN9 A;  1U3A A;  3G7Y A;  2TRX A;  3EVI A;  3FW2 A;  4ZBA A;  2P5Q A;  1TRW A;  3MDK A;  2R5G A;  3EUR A;  1WE0 A;  1GH2 A;  4GST A;  4PQH A;  2JAD A;  5J3R A;  4K7I A;  2OE1 A;  4NXI A;  2M72 A;  4TW5 A;  3KJY A;  4OWY A;  5HR1 A;  3H79 A;  3D0Z A;  4YKG A;  1GTA A;  2FWG A;  1DUG A;  2VLT A;  2YNX A;  4MJB A;  2R0C A;  2WDU A;  4KUN A;  1VF4 A;  1XW6 A;  1WOU A;  5IMF A;  4F9Z A;  5DJL A;  3VPT A;  3L4N A;  2MMA A;  4CDO A;  2GT6 A;  2X4A A;  1X5C A;  4PTS A;  2LRC A;  2KLX A;  4LL4 B;  5ID2 B;  3ZIJ A;  5J9C A;  1I9D A;  5ECM B;  4YH2 A;  3UOM A;  3DIE A;  3ZIT A;  2VIM A;  4K7O A;  4MNN A;  4O5R A;  1U88 A;  2IFQ B;  4GTU A;  1A2L A;  3VFI A;  1X5D A;  2QA2 A;  5J4U A;  2FHE A;  2O8V B;  4I6X A;  1TRS A;  3FMW A;  3GYK A;  2FCH A;  3TJJ A;  1OYJ A;  3A2X A;  1ZCP A;  2AYT A;  11GS A;  4K5R A;  2FA4 A;  2NPB A;  4PNF A;  5DCG A;  1AC1 A;  1F3A A;  3Q74 A;  3WYW A;  1YEX A;  1PL1 A;  2FD3 A;  5IMD A;  4O5Q A;  1YF0 A;  5CO3 A;  1PKZ A;  3APS A;  2LTK A;  4EKZ A;  2OBI A;  1GTB A;  4MJA A;  3W8S A;  2L59 A;  1A0F A;  5DQY A;  2VLU A;  1GUM A;  9GSS A;  2BJX A;  1T1V A;  4EL1 A;  1GSY A;  4BL7 A;  2RM6 A;  1CQH A;  1XVQ A;  3J7Y b;  3GKK A;  3EWL A;  5G30 A;  3FZA A;  3IXR A;  3MYD A;  2D2Z A;  2HRF A;  3NIV A;  1J08 A;  1YF1 A;  1GP1 A;  1SD9 A;  1O6J A;  1OE8 A;  5DQS A;  2O7K A;  1Q4J A;  3H4K A;  1QK8 A;  4L5O A;  4MAB A;  3LFL A;  3MNG A;  5D8I A;  2NVL A;  2VL3 A;  2IMI A;  2VOC A;  1AUC A;  4HJ2 A;  5D73 A;  3E0U A;  4XS1 A;  5CP1 A;  1XXU A;  5DJM A;  3FR6 A;  4PNG A;  4ACS A;  1XOA A;  2YWN A;  2CV4 A;  6GSS A;  2PPT A;  5INY A;  5KN1 A;  2WZ9 A;  5CNW A;  4AJ8 A;  2LNT A;  2F8F A;  1G7E A;  3EC3 A;  1URM A;  4NPB A;  3TKQ A;  2XPE A;  1BAY A;  1FG4 A;  2MYG A;  3O76 A;  3WGX A;  2OJL A;  3FYG A;  3APQ A;  1XVW A;  4I2T A;  2LUS A;  4OD7 A;  2VLV A;  3IC4 A;  5COH A;  3BD2 A;  5DAL B;  5ELA A;  1YKA A;  2LRN A;  3DVW A;  5L71 A;  3H8Q A;  1X9M B;  2PUK C;  1SL1 B;  4LA1 A;  4KSM A;  3CTG A;  3CBU A;  3EU3 A;  4LL1 B;  5ECR B;  4MK3 A;  2N5B A;  3VI5 A;  3GUS A;  3TKP A;  5H5R A;  5ABR A;  4Z2R A;  2PMT A;  3APO A;  1KTE A;  1A2M A;  1MDK A;  1R4W A;  1XCC A;  3PPU A;  3KZQ A;  3QR6 A;  5IMZ A;  1MEK A;  1MD3 A;  1XW5 A;  3UBK A;  8GSS A;  3GIX A;  5IMV A;  2RUE A;  2AHE A;  4N10 A;  3U5R E;  4O32 A;  2JSY A;  2NDO A;  3TKS A;  2IFQ A;  1V2A A;  1WWJ A;  3GX0 A;  2B1K A;  2J23 A;  2V6O A;  5B8A A;  1A8Y A;  2JZS A;  1JFU A;  2RII A;  3GA4 A;  4PGT A;  1ACV A;  1OKT A;  2LJK A;  3GN3 A;  1SK2 A;  3F4T A;  3ME8 A;  4IGJ A;  3QDN A;  2VCW A;  4FYC A;  3NOF A;  4PUF C;  3L78 A;  3DGQ A;  1FOH A;  5KEJ A;  3G7J A;  1FVJ A;  5H5S A;  3FK8 A;  2XBI A;  2CAQ A;  5HFK A;  4HOJ A;  3ZMK A;  3Q19 A;  4MF7 A;  4YAV A;  5HFG A;  1A0R P;  3FR9 A;  3A3T A;  2H0H A;  2X8G A;  4IN0 A;  1S3A A;  2L5L A;  3IRA A;  1EGO A;  3IHG A;  1LU4 A;  5G31 A;  1M99 A;  1UC7 A;  1EGR A;  4TKY A;  4G19 A;  3HVS A;  4KCA A;  1O8W A;  4K0G A;  2YV7 A;  4GF0 A;  6GSY A;  4ID0 A;  2GQM A;  5IO2 A;  4DSR A;  2H75 A;  2DC5 A;  1B9X C;  5GST A;  1AQW A;  2HT9 A;  4XRD A;  2E2M A;  4IJ3 A;  1K0A A;  4I2U A;  3OR5 A;  3ZFB A;  19GS A;  3CSJ A;  7GSS A;  2LS5 A;  2IME A;  1NHO A;  2IMK A;  3QAG A;  3PR8 A;  1X9S B;  5IIZ A;  3P90 A;  3DKS A;  4KB3 A;  2GLR A;  4MPF A;  5HR2 A;  4TXV A;  1K0M A;  2DJ2 A;  2H6X A;  4TR0 A;  1V58 A;  1BJX A;  1XZO A;  2IN3 A;  5C04 A;  2MZC A;  2R37 A;  5JWQ B;  4BIK A;  4DVC A;  1QXH A;  1PQN A;  1PRX A;  3F3R A;  3W8J A;  3DYR A;  3HJM A;  1VRS D;  2L57 A;  4WEY A;  1ERV A;  1QFN A;  1WP0 A;  4XS4 B;  4ZB8 A;  3PH9 A;  4K8M A;  1THX A;  1R5A A;  3IV4 A;  2I4A A;  4K9Z A;  4V1A g;  3A5I A;  1ABA A;  1ST9 A;  1K0O A;  3KP8 A;  2X49 A;  1GRX A;  5CRH A;  3ZRE A;  4CW9 A;  5F06 A;  2GZY A;  1M2A A;  5DAL A;  5ECP B;  3RHB A;  3M8N A;  3DML A;  2VM1 A;  2EC4 A;  4KGI A;  3H1N A;  17GS A;  3KGK A;  2ZNM A;  1WPI A;  1V57 A;  2DLX A;  3CSH A;  4TRX A;  3I9V 2;  3I69 A;  4ZB9 A;  1TP9 A;  5DBQ A;  2PVO C;  4KCE A;  2QKE A;  4L0U A;  1O8X A;  2DSA A;  2KOK A;  1GLP A;  3VWX A;  1AIU A;  3KIJ A;  5J41 A;  1GWC A;  3ZRD A;  4EUY A;  1UVZ A;  1OC3 A;  5ECO B;  3LWA A;  3GV1 A;  1O85 A;  2N5F A;  4HZ4 A;  2DMM A;  1TI1 A;  2WS2 A;  4Q5F A;  3UVH A;  4EO3 A;  3BJ5 A;  1PKW A;  3R2Q A;  4IS0 A;  1YY7 A;  2LJR A;  1QUW A;  2GGT A;  4MMM A;  4K5S A;  1YEP A;  1ZYN A;  3IPZ A;  3QPM A;  2GTU A;  2DJK A;  4OFN A;  4MP4 A;  2ZCT A;  1ERU A;  3WGD A;  4MA9 A;  1NM3 A;  5AIS A;  1FOV A;  2FLS A;  1N8J A;  3GH6 A;  2VO4 A;  5IPH A;  1YKC A;  3FEU A;  5G5F A;  2B5E A;  3V1W A;  3RBT A;  1M2D A;  5A4U A;  1FW1 A;  4KE3 A;  5D93 A;  2ON7 A;  3DD3 A;  1QQ2 A;  3QD9 A;  5ECK B;  2F51 A;  4XCS A;  3FY7 A;  3S9F A;  1FB6 A;  2WJU A;  2YN1 A;  2L6C A;  1Z3E A;  2H0G A;  4O7H A;  3UMA A;  3C7M A;  3TRX A;  3F63 A;  3F4S A;  3TKR A;  2YZU A;  4K2D A;  14GS A;  2JZT A;  1M3J A;  1C72 A;  3IDV A;  4J56 E;  3ZVJ A;  4MZW A;  2R0G A;  3QMX A;  1EWX A;  3GTU A;  5EPF A;  1ZZY A;  4XIH A;  5KOX A;  1XPV A;  4MF5 A;  5ECQ B;  1ERW A;  1PFO A;  2VCX A;  2FGX A;  1T00 A;  3TJF A;  1EV4 A;  3R3E A;  4XTS A;  1PMT A;  4H86 A;  2VL2 A;  3LXT A;  4JE1 A;  2E7P A;  5CRE A;  5ENU A;  4EDY A;  3IE3 A;  2P31 A;  5ECN B;  2CVB A;  1OC8 A;  4XS4 A;  3FRC A;  3HJO A;  2PN8 A;  1R5P A;  1J9B A;  5LD0 A;  1PA3 A;  1THO A;  1G0T A;  4ECJ A;  1BQ7 A;  2LKU A;  4OFM A;  4WF5 A;  1F6M C;  1M2B A;  2F9S A;  2TRC P;  1SYR A;  3CRT A;  2L4C A;  3LW9 A;  2YAN A;  3W6G A;  5J9B A;  2QSI A;  4BWQ A;  2EIR A;  2EIO A;  2A4V A;  2HYX A;  1ZMA A;  1OC9 B;  4IQ1 A;  1SJZ A;  1TXX A;  2X8H A;  2QGV A;  2H19 A;  4EIP A;  2C0F A;  4GRF A;  3HHV A;  1GNE A;  3GFK A;  2RUF A;  4WR5 A;  3E3E A;  3E9J B;  5GAP D;  5E4W A;  4JED A;  5F05 A;  2HE3 A;  1K3Y A;  1M3I A;  5GAN D;  2OBK A;  5JWR B;  4X43 A;  1M9B A;  3ZLP A;  1O7U A;  3RDW A;  4ECB A;  2H1D A;  4L5L A;  4EF0 A;  3GNJ A;  4GLT A;  1SJ6 A;  3EPT A;  1T4Y A;  1TOF A;  2PER A;  4WR4 A;  3A2V A;  5JCW A;  2L4Q A;  1ML6 A;  1U3I A;  3GH9 A;  4A5P A;  1JZW A;  1MDJ A;  1ILO A;  3QFA C;  3HVX A;  4RI7 A;  1X0R A;  4O5U A;  3TJG A;  1HNC A;  3P2A A;  4CY6 A;  2GQK A;  1WMJ A;  3IC8 A;  2GVP A;  2C4J A;  5G5E A;  3TGZ A;  4EIQ A;  2C0E A;  4Q5N A;  4KDY A;  3UAR A;  5JWO B;  2H74 A;  3GKX A;  2HZE A;  1B4P A;  4IJI A;  4FO5 A;  1ZOF A;  2C0D A;  2H71 A;  2LST A;  4POK A;  4F03 A;  1UN2 A;  3CTF A;  5C00 A;  1RK4 A;  2PGT A;  5HR0 A;  1JZR A;  3DVX A;  4ZIL A;  1G7O A;  2HRK A;  2VD0 A;  4LMW A;  3D5J A;  2YOI A;  1OKD A;  2PVQ A;  3AY8 A;  1O81 A;  1GUK A;  4NMU A;  2R6K A;  2O89 A;  2Z9S A;  2JL4 A;  3LG6 A;  3RAZ A;  1ZL9 A;  4QQ7 A;  1A8L A;  2C8U A;  4ZIJ A;  1SU9 A;  2MMN A;  1W4V A;  3HXS A;  3LYK A;  2E2G A;  2H1G A;  3SWL A;  3CSI A;  5F07 A;  5IQY A;  4IQA A;  1SKW B;  1JLV A;  1Z7P A;  3C1R A;  4ML1 A;  1VF1 A;  1GL8 A;  2B7J A;  5LNK e;  3IK7 A;  1XW9 A;  2H30 A;  3VI7 A;  2A2R A;  1G6Y A;  1GSE A;  3NZN A;  3WGE A;  3IA1 A;  4XRA A;  2I3Y A;  1NW2 A;  4OMV A;  1AW9 A;  2YWI A;  3HVN A;  3FZ5 A;  1V9W A;  4IEL A;  5AN1 A;  2GSR A;  1NSW A;  2YCD A;  4HU7 A;  5GSS A;  4EE0 A;  2XBQ A;  4J2F A;  2MBS A;  2X99 A;  4HI7 A;  4V2L A;  4HU9 A;  3CQF A;  3F3Q A;  3TB2 A;  2VM2 A;  2V2G A;  3F8U A;  3ME7 A;  3US3 A;  4NWY A;  2DJ3 A;  2QC7 A;  4TXO B;  5D9X A;  3ZTL A;  2M46 A;  2JU5 A;  3GUR A;  1HNA A;  4CHS A;  1USB A;  1XBS A;  3TJK A;  2PBJ A;  4FYB A;  3WT2 A;  4DSS B;  2GDR A;  3P7X A;  3D6I A;  1TK8 B;  4MF6 A;  1J0F A;  2GZP A;  3MWH A;  1OC9 A;  2V6K A;  2A4H A;  3TRQ A;  2YV9 A;  2DML A;  3GKM A;  2VL9 A;  4ULX A;  1K0N A;  4GCI A;  1AXD A;  1HNB A;  4MPG A;  5IM9 A;  3QCP A;  1BG5 A;  2WRT A;  2KP2 A;  1U87 A;  3VPQ A;  2LQQ A;  4USS A;  2HRA A;  2VCT A;  1JHB A;  2IWT A;  3CYN A;  4IVF A;  4POL A;  1PD2 1;  5FWG A;  4BWS A;  3KTB A;  2A2S A;  5EL8 A;  2AJQ B;  5B8B A;  3IR4 A;  3KH7 A;  3M9K A;  3VLN A;  2DBC A;  3GTU B;  4NV5 A;  2FWH A;  1EOH A;  2XHF A;  4MH2 A;  1B48 A;  1HYU A;  2OE0 A;  5KOW A;  2ES7 A;  3CXG A;  4ZL7 A;  4WBR D;  3ERF A;  2YP6 A;  4X4J A;  4AJ6 A;  2R0P A;  12GS A;  1B4Q A;  2IJY A;  4TR1 B;  2R2J A;  1TRU A;  1FO5 A;  2IMD A;  1TI3 A;  3F4R A;  1EEM A;  4Q5R A;  3BBY A;  4TR4 A;  2E0Q A;  2DIZ A;  2VCV A;  4OCE A;  3HYP A;  3ERW A;  5ECH B;  4BPY A;  2C1Y A;  2N5A A;  4BA7 A;  2MMZ A;  1ZGN A;  4WKW A;  1IYH A;  1XIY A;  5H5Q A;  3C1S A;  3ISO A;  4NV2 A;  1E2Y A;  3C73 A;  2B1L A;  3KP9 A;  4K1F A;  1SJI A;  5IMC A;  2B5Y A;  1KEB A;  1SYX A;  4POM A;  4NHZ A;  2VUP A;  2XC2 A;  1A2J A;  2KUC A;  1K0C A;  1M0U A;  1TK5 B;  3U6V A;  1JZO A;  4X1U A;  1NHY A;  3KMO A;  1GSD A;  2H66 A;  4XS6 A;  1F3B A;  3A2W A;  2CQ9 A;  3SBC A;  3IBH A;  4ZL8 A;  2I1U A;  2VCZ A;  4AF2 A;  3TDG A;  1XG8 A;  1TU7 A;  2DJ0 A;  2V41 A;  4JBB A; 
#chains in the Genus database with same CATH homology
 4GSN A;  1Q98 A;  2CT6 A;  2VAF A;  3EE2 A;  4IP1 A;  2H73 A;  1DSB A;  4N11 A;  4JRR A;  2P5R A;  3JCM L;  1ON4 A;  3HDC A;  1VF2 A;  1F9M A;  4G9H A;  1ERT A;  1PN0 A;  3M9J A;  4TXO A;  1PX6 A;  2RM5 A;  4YAP A;  1ZYQ B;  1YJ6 A;  1PGT A;  4ISD A;  3ZL5 A;  2JSZ A;  1XWC A;  2H6Y A;  2OAC A;  3BCI A;  3GMF A;  1F37 A;  5KN0 A;  4KA0 A;  4K0N A;  5HFI A;  4DSS A;  3L9U A;  3M3M A;  5FT3 A;  5IPG A;  5IOX A;  1SL2 B;  2HSH A;  3LOR A;  1PL2 A;  2V32 A;  4V2N A;  1Y25 A;  2HZE B;  2LJA A;  4AGS A;  5J5N A;  1GSQ A;  2IIY A;  1BYE A;  16GS A;  3GX8 A;  4HDE A;  1XWK A;  1K0B A;  2IMF A;  2C0G A;  3DEX A;  2HXK A;  3LEF A;  4OFT A;  1MTC A;  1PX7 A;  2ON5 A;  2DKH A;  3A5W A;  1KBN A;  3QOU A;  2VCQ A;  4G10 A;  4ECC A;  2HSY A;  3BOA A;  4K2X A;  1HD2 A;  3IOS A;  2OA7 A;  3RHC A;  3HCZ A;  4TOP A;  3KEB A;  1AAZ A;  5HQP A;  5A4V A;  2ALB A;  3M0F A;  4RQX A;  2J9H A;  4AJ7 A;  3HJP A;  2GQL A;  2BMX A;  5KN3 A;  5ECI B;  1WJK A;  4E8H A;  1AQV A;  4KH7 A;  5DAK B;  1XWA A;  4MZC A;  3D4M A;  2OKA A;  3G9B A;  2PWJ A;  3C71 A;  3LQ7 A;  2RLI A;  2CVK A;  3N5O A;  4MH3 A;  4TR1 A;  1I5G A;  1LBK A;  2H1A A;  4ECI A;  2B6M A;  1A24 A;  4HJM A;  4RUV A;  2G0F A;  1B9Y C;  3UL3 A;  3ZZX A;  1UA5 A;  2PU9 C;  1Z9H A;  4G0K A;  3TKS E;  3FHK A;  3IAM 2;  1KNG A;  1YQ1 A;  3LGC A;  5ECL B;  1YDK A;  2R4V A;  4IW9 A;  4N0V A;  3UVT A;  3VWV A;  4ZBB A;  3TJB A;  3VWU A;  3CMI A;  4KSO A;  4ILF A;  3FR3 A;  3KTL A;  4ZB6 A;  2K8S A;  4EDZ A;  3ERG A;  3F6F A;  4HQS A;  3F0I A;  3D4T A;  3HY2 A;  2DKI A;  5CYY A;  3HZ4 A;  2B5X A;  4OO4 A;  1N2A A;  4WET A;  4Z7X A;  4MJC A;  1GNW A;  1OE7 A;  1CQG A;  4KF9 A;  3ZFL A;  5ELG A;  2F8A A;  4OCF A;  4ZL9 A;  4RI6 A;  1MDI A;  5KN2 A;  1IYI A;  2M80 A;  5IO0 A;  4QL7 A;  3TKS C;  2ZUP A;  4HS1 A;  4HUA A;  1JLW A;  3MIX A;  2WFC A;  3HZ8 A;  2WGR A;  1T7P B;  4F0B A;  4O92 A;  1S3D A;  2FWE A;  3ZML A;  4YKF A;  2YWM A;  1EEJ A;  5DCH A;  2GZZ A;  3H93 A;  4GQC A;  4LMV A;  4ZBD A;  3PIN A;  1F2E A;  3UJ1 A;  2H8L A;  3EIN A;  3KXO A;  2LNS A;  3J7Y k;  3WT1 A;  5D9V A;  1XWG A;  2HNL A;  2NTO A;  3ZIV A;  4BVX B;  1LJR A;  1YZX A;  1FB0 A;  2XPD A;  4HZ2 A;  4WF4 A;  3LJR A;  4YQU A;  3TCO A;  1EOG A;  1HQO A;  1SL0 B;  3WD6 A;  1GTI A;  4FH8 A;  4HQZ A;  1R7H A;  2IL3 A;  5HR3 A;  2F3M A;  2EIQ A;  2JAC A;  5CRG A;  1Z6N A;  3IHQ A;  5D9W A;  5EY6 A;  1SK0 A;  5LCZ A;  3TOU A;  1X9W B;  3ZVJ D;  2HZF A;  2B7K A;  4IKH A;  2YZH A;  5AGY A;  3GL5 A;  1K3L A;  3GKN A;  1T4Z A;  1H4O A;  3HA9 A;  4PQ1 A;  4BVY A;  4KDU A;  2DJ1 A;  2K18 A;  3HKR A;  1E6B A;  4K7N A;  3D22 A;  4MCU A;  2LQO A;  1WRY A;  3TRP A;  1FHE A;  5G1L A;  1Z7R A;  2WCI A;  2IPA A;  1XOB A;  2CA8 A;  1DE1 A;  1W89 A;  4HEA 2;  5DAK A;  2AB6 A;  2H1B A;  3RPN A;  3GHA A;  1FVK A;  3EYT A;  5A4W A;  6GST A;  2H6Z A;  1T3B A;  1TK0 B;  1GTU A;  1BED A;  2WB9 A;  1SD8 A;  4PXO A;  5B6N A;  2P0G A;  3L9S A;  3N9J A;  4F0C A;  5CAX A;  3VWW A;  4F82 A;  5AIX A;  2HFD A;  6GSW A;  2LEG A;  1EP7 A;  1GUH A;  5E59 A;  1H75 A;  4XHM A;  1MD4 A;  3LSZ A;  4D73 B;  2H01 A;  2C3N A;  2WUL A;  5B6M A;  2X8C A;  2C3Q A;  2HRN A;  1TDI A;  1EP8 A;  4N0Z A;  1RQM A;  4PX1 A;  4TN8 A;  2HSM A;  1S3C A;  5ID2 A;  4GQF A;  4J57 E;  3FKF A;  4IBP A;  1XFL A;  4QL9 A;  3UBL A;  1AQX A;  1XWB A;  1TJD A;  2CVD A;  4JU5 A;  3UEM A;  4L0W A;  2YJ7 A;  4FIW A;  1GLQ A;  4OO5 A;  3L9V A;  4ML6 A;  1SK1 A;  4KAE A;  4V2M A;  5JCU A;  1QMV A;  2YWO A;  3O3T A;  3QFB C;  1A23 A;  2H76 A;  5IMA A;  6GSX A;  1OVN A;  3DWV A;  4Q5Q A;  5DVB A;  3FZ9 A;  2H0I A;  2FA8 A;  1Y6E A;  4JR4 A;  1SKS B;  4GWR A;  3O6T A;  3CRU A;  2H70 A;  5B7C A;  3GSS A;  4WBJ A;  4EC0 A;  2GT5 A;  5GZZ B;  1V40 A;  3KM6 A;  4F2I A;  5DDL A;  4G2E A;  22GS A;  5EVO A;  2VD1 A;  3GST A;  1G6W A;  3FZ4 A;  4P3Y B;  3MSZ A;  2GSS A;  3TUE A;  1QGV A;  3BCK A;  2I81 A;  1O73 A;  2AAW A;  2L5O A;  2R3X A;  4KDX A;  4K6X A;  4WXT A;  4JZQ A;  5ECS A;  3KH9 A;  3F6D A;  18GS A;  4G0L A;  4V1A p;  4BVX A;  1M9A A;  2AUV A;  2K6V A;  5BMU A;  2LV3 A;  5BRT A;  3LXZ A;  2GST A;  4EXJ A;  1WIK A;  1TKD B;  4MDC A;  1GSU A;  4GXZ A;  4RQR A;  1U6T A;  3UAP A;  2CX4 A;  1FAA A;  1Z6M A;  1VF3 A;  3GRX A;  1EZK A;  1TW9 A;  4I8B A;  3Q6O A;  1DE2 A;  1K0D A;  1K3O A;  2FUG 2;  4N30 A;  4NHW A;  1GUL A;  4FYU A;  3UIW A;  3DRN A;  2CAI A;  2OAD A;  4ZXG A;  2V1M A;  2FY6 A;  3ZYW A;  5F8B A;  2OE3 A;  5IOW A;  2G2Q A;  1GSF A;  1M7T A;  3GL3 A;  2MBT A;  10GS A;  2X64 A;  4DEJ A;  2VL2 C;  2NBS A;  2BTO T;  2HLS A;  2L6D A;  5CRD A;  1GSS A;  3IAS 2;  4L8E A;  1ZYE A;  2QA1 A;  2GSQ A;  5F0G A;  4PQI A;  4KND A;  3C8E A;  5D9T A;  5CRW A;  2AV4 A;  4LLR A;  5G1K A;  1BX9 A;  3KMN A;  4PUR A;  4G0I A;  1B8X A;  1V98 A;  1X5E A;  3M1G A;  2LRT A;  1R26 A;  4D73 A;  5A5K A;  6GSU A;  2MMO A;  3VUR A;  4MLY A;  4PUA A;  2TIR A;  4YQV A;  2FNO A;  3HVV A;  2DIY A;  2CZ3 A;  2GS3 A;  4FQU A;  3F9U A;  1SEN A;  3L0H A;  2KP1 A;  2REM A;  4TVE A;  2CZ2 A;  1JZD A;  2DJJ A;  5FHI A;  1Z5Y E;  1RW1 A;  3EMX A;  4BL7 B;  1OAZ A;  3G7I A;  2H72 A;  1VGL A;  3D21 A;  2K8V A;  1TTZ A;  3RPP A;  3I43 A;  4NAX A;  1SKR B;  13GS A;  1PSQ A;  1DBY A;  4X0X A;  3MAK A;  3PGT A;  3VK9 A;  4CY8 A;  3I6A A;  5G2Z A;  4MJE A;  2O85 A;  4GSS A;  3K8N A;  1ZYP A;  2YPM A;  4MZB A;  2C3T A;  5AIV A;  4DSQ A;  3TOT A;  3LYP A;  3P8W A;  2KHP A;  2YJH A;  1TU8 A;  3IK9 A;  1TRV A;  2A2P A;  20GS A;  3EU4 A;  3ED3 A;  4POB A;  4Z2T A;  4I5Q A;  1T8E B;  2K9F A;  3KCM A;  4EVM A;  2FWF A;  4KX4 A;  4IHU A;  2C80 A;  4JR6 A;  4Z2U A;  3QAV A;  4BVY B;  6GSV A;  4I97 A;  2I9H A;  3HD5 A;  4E8E A;  4ICY A;  3KD0 A;  4KW6 A;  1EV9 A;  4YQM A;  2HI7 A;  3EMP A;  5JCG A;  3DXB A;  2UZ8 A;  2JZR A;  2O87 A;  4TR3 A;  2CX3 A;  3Q18 A;  5D96 A;  4IP6 A;  2B3S A;  3QAW A;  1PN9 A;  1U3A A;  3G7Y A;  2TRX A;  3EVI A;  3FW2 A;  4ZBA A;  2P5Q A;  1TRW A;  3MDK A;  2R5G A;  3EUR A;  1WE0 A;  1GH2 A;  4GST A;  4PQH A;  2JAD A;  5J3R A;  4K7I A;  2OE1 A;  4NXI A;  2M72 A;  4TW5 A;  3KJY A;  4OWY A;  5HR1 A;  3H79 A;  3D0Z A;  4YKG A;  1GTA A;  2FWG A;  1DUG A;  2VLT A;  2YNX A;  4MJB A;  2R0C A;  2WDU A;  4KUN A;  1VF4 A;  1XW6 A;  1WOU A;  5IMF A;  4F9Z A;  5DJL A;  3VPT A;  3L4N A;  2MMA A;  4CDO A;  2GT6 A;  2X4A A;  1X5C A;  4PTS A;  2LRC A;  2KLX A;  4LL4 B;  5ID2 B;  3ZIJ A;  5J9C A;  1I9D A;  5ECM B;  4YH2 A;  3UOM A;  3DIE A;  3ZIT A;  2VIM A;  4K7O A;  4MNN A;  4O5R A;  1U88 A;  2IFQ B;  4GTU A;  1A2L A;  3VFI A;  1X5D A;  2QA2 A;  5J4U A;  2FHE A;  2O8V B;  4I6X A;  1TRS A;  3FMW A;  3GYK A;  2FCH A;  3TJJ A;  1OYJ A;  3A2X A;  1ZCP A;  2AYT A;  11GS A;  4K5R A;  2FA4 A;  2NPB A;  4PNF A;  5DCG A;  1AC1 A;  1F3A A;  3Q74 A;  3WYW A;  1YEX A;  1PL1 A;  2FD3 A;  5IMD A;  4O5Q A;  1YF0 A;  5CO3 A;  1PKZ A;  3APS A;  2LTK A;  4EKZ A;  2OBI A;  1GTB A;  4MJA A;  3W8S A;  2L59 A;  1A0F A;  5DQY A;  2VLU A;  1GUM A;  9GSS A;  2BJX A;  1T1V A;  4EL1 A;  1GSY A;  4BL7 A;  2RM6 A;  1CQH A;  1XVQ A;  3J7Y b;  3GKK A;  3EWL A;  5G30 A;  3FZA A;  3IXR A;  3MYD A;  2D2Z A;  2HRF A;  3NIV A;  1J08 A;  1YF1 A;  1GP1 A;  1SD9 A;  1O6J A;  1OE8 A;  5DQS A;  2O7K A;  1Q4J A;  3H4K A;  1QK8 A;  4L5O A;  4MAB A;  3LFL A;  3MNG A;  5D8I A;  2NVL A;  2VL3 A;  2IMI A;  2VOC A;  1AUC A;  5D73 A;  4HJ2 A;  3E0U A;  4XS1 A;  5CP1 A;  1XXU A;  5DJM A;  3FR6 A;  4PNG A;  4ACS A;  1XOA A;  2YWN A;  2CV4 A;  6GSS A;  2PPT A;  5INY A;  5KN1 A;  2WZ9 A;  5CNW A;  4AJ8 A;  2LNT A;  2F8F A;  1G7E A;  3EC3 A;  1URM A;  4NPB A;  3TKQ A;  2XPE A;  1BAY A;  1FG4 A;  2MYG A;  3O76 A;  3WGX A;  2OJL A;  3FYG A;  3APQ A;  1XVW A;  4I2T A;  2LUS A;  4OD7 A;  2VLV A;  3IC4 A;  5COH A;  3BD2 A;  5DAL B;  5ELA A;  1YKA A;  2LRN A;  3DVW A;  5L71 A;  3H8Q A;  1X9M B;  2PUK C;  1SL1 B;  4LA1 A;  4KSM A;  3CTG A;  3CBU A;  3EU3 A;  4LL1 B;  5ECR B;  4MK3 A;  2N5B A;  3VI5 A;  3GUS A;  3TKP A;  5H5R A;  5ABR A;  4Z2R A;  2PMT A;  3APO A;  1KTE A;  1A2M A;  1MDK A;  1R4W A;  1XCC A;  3PPU A;  3KZQ A;  3QR6 A;  5IMZ A;  1MEK A;  1MD3 A;  1XW5 A;  3UBK A;  8GSS A;  3GIX A;  5IMV A;  2RUE A;  2AHE A;  4N10 A;  3U5R E;  4O32 A;  2JSY A;  2NDO A;  3TKS A;  2IFQ A;  1V2A A;  1WWJ A;  3GX0 A;  2B1K A;  2J23 A;  2V6O A;  5B8A A;  1A8Y A;  2JZS A;  1JFU A;  2RII A;  3GA4 A;  4PGT A;  1ACV A;  1OKT A;  2LJK A;  3GN3 A;  1SK2 A;  3F4T A;  3ME8 A;  4IGJ A;  3QDN A;  2VCW A;  4FYC A;  3NOF A;  4PUF C;  3L78 A;  3DGQ A;  1FOH A;  5KEJ A;  3G7J A;  1FVJ A;  5H5S A;  3FK8 A;  2XBI A;  2CAQ A;  5HFK A;  4HOJ A;  3ZMK A;  3Q19 A;  4MF7 A;  4YAV A;  5HFG A;  1A0R P;  3FR9 A;  3A3T A;  2H0H A;  2X8G A;  4IN0 A;  1S3A A;  2L5L A;  3IRA A;  1EGO A;  3IHG A;  1LU4 A;  5G31 A;  1M99 A;  1UC7 A;  1EGR A;  4TKY A;  4G19 A;  3HVS A;  4KCA A;  1O8W A;  4K0G A;  2YV7 A;  4GF0 A;  6GSY A;  4ID0 A;  2GQM A;  5IO2 A;  4DSR A;  2H75 A;  2DC5 A;  1B9X C;  5GST A;  1AQW A;  2HT9 A;  4XRD A;  2E2M A;  4IJ3 A;  1K0A A;  4I2U A;  3OR5 A;  3ZFB A;  19GS A;  3CSJ A;  7GSS A;  2LS5 A;  2IME A;  1NHO A;  2IMK A;  3QAG A;  3PR8 A;  1X9S B;  5IIZ A;  3P90 A;  3DKS A;  4KB3 A;  2GLR A;  4MPF A;  5HR2 A;  4TXV A;  1K0M A;  2DJ2 A;  2H6X A;  4TR0 A;  1V58 A;  1BJX A;  1XZO A;  2IN3 A;  5C04 A;  2MZC A;  2R37 A;  5JWQ B;  4DVC A;  1QXH A;  1PQN A;  1PRX A;  3F3R A;  3W8J A;  3DYR A;  3HJM A;  1VRS D;  2L57 A;  4WEY A;  1ERV A;  1QFN A;  1WP0 A;  4XS4 B;  4ZB8 A;  3PH9 A;  4K8M A;  1THX A;  1R5A A;  3IV4 A;  2I4A A;  4K9Z A;  4V1A g;  3A5I A;  1ABA A;  1ST9 A;  1K0O A;  3KP8 A;  2X49 A;  1GRX A;  5CRH A;  3ZRE A;  4CW9 A;  5F06 A;  2GZY A;  1M2A A;  5DAL A;  5ECP B;  3RHB A;  3M8N A;  3DML A;  2VM1 A;  2EC4 A;  4KGI A;  3H1N A;  17GS A;  3KGK A;  2ZNM A;  1WPI A;  1V57 A;  2DLX A;  3CSH A;  4TRX A;  3I9V 2;  3I69 A;  4ZB9 A;  1TP9 A;  5DBQ A;  2PVO C;  4KCE A;  2QKE A;  4L0U A;  1O8X A;  2DSA A;  2KOK A;  1GLP A;  3VWX A;  1AIU A;  3KIJ A;  5J41 A;  1GWC A;  3ZRD A;  4EUY A;  1UVZ A;  1OC3 A;  5ECO B;  3LWA A;  3GV1 A;  1O85 A;  2N5F A;  4HZ4 A;  2DMM A;  1TI1 A;  2WS2 A;  4Q5F A;  3UVH A;  4EO3 A;  3BJ5 A;  1PKW A;  3R2Q A;  4IS0 A;  1YY7 A;  2LJR A;  1QUW A;  2GGT A;  4MMM A;  4K5S A;  1YEP A;  1ZYN A;  3IPZ A;  3QPM A;  2GTU A;  2DJK A;  4OFN A;  4MP4 A;  2ZCT A;  1ERU A;  3WGD A;  4MA9 A;  1NM3 A;  5AIS A;  1FOV A;  2FLS A;  1N8J A;  3GH6 A;  2VO4 A;  5IPH A;  1YKC A;  3FEU A;  5G5F A;  2B5E A;  3V1W A;  3RBT A;  1M2D A;  5A4U A;  1FW1 A;  4KE3 A;  5D93 A;  2ON7 A;  3DD3 A;  1QQ2 A;  3QD9 A;  5ECK B;  2F51 A;  4XCS A;  3FY7 A;  3S9F A;  1FB6 A;  2WJU A;  2YN1 A;  2L6C A;  1Z3E A;  2H0G A;  4O7H A;  3UMA A;  3C7M A;  3TRX A;  3F63 A;  3F4S A;  3TKR A;  2YZU A;  4K2D A;  14GS A;  2JZT A;  1C72 A;  3IDV A;  4J56 E;  3ZVJ A;  4MZW A;  2R0G A;  3QMX A;  1EWX A;  3GTU A;  5EPF A;  1ZZY A;  4XIH A;  5KOX A;  1XPV A;  4MF5 A;  5ECQ B;  1ERW A;  2VCX A;  2FGX A;  1T00 A;  3TJF A;  1EV4 A;  3R3E A;  4XTS A;  1PMT A;  4H86 A;  2VL2 A;  3LXT A;  4JE1 A;  2E7P A;  5CRE A;  5ENU A;  4EDY A;  3IE3 A;  2P31 A;  5ECN B;  2CVB A;  1OC8 A;  4XS4 A;  3FRC A;  3HJO A;  2PN8 A;  1R5P A;  1J9B A;  5LD0 A;  1PA3 A;  1THO A;  1G0T A;  4ECJ A;  1BQ7 A;  2LKU A;  4OFM A;  4WF5 A;  1F6M C;  1M2B A;  2F9S A;  2TRC P;  1SYR A;  3CRT A;  2L4C A;  3LW9 A;  2YAN A;  3W6G A;  5J9B A;  2QSI A;  4BWQ A;  2EIR A;  2EIO A;  2A4V A;  2HYX A;  1ZMA A;  1OC9 B;  4IQ1 A;  1SJZ A;  1TXX A;  2X8H A;  2QGV A;  2H19 A;  4EIP A;  2C0F A;  4GRF A;  3HHV A;  1GNE A;  3GFK A;  2RUF A;  4WR5 A;  3E3E A;  3E9J B;  5GAP D;  5E4W A;  4JED A;  5F05 A;  2HE3 A;  1K3Y A;  5GAN D;  2OBK A;  5JWR B;  4X43 A;  1M9B A;  3ZLP A;  1O7U A;  3RDW A;  4ECB A;  2H1D A;  4L5L A;  4EF0 A;  3GNJ A;  4GLT A;  1SJ6 A;  3EPT A;  1T4Y A;  1TOF A;  2PER A;  4WR4 A;  3A2V A;  5JCW A;  2L4Q A;  1ML6 A;  1U3I A;  3GH9 A;  4A5P A;  1JZW A;  1MDJ A;  1ILO A;  3QFA C;  3HVX A;  4RI7 A;  1X0R A;  4O5U A;  3TJG A;  1HNC A;  3P2A A;  4CY6 A;  2GQK A;  1WMJ A;  3IC8 A;  2GVP A;  2C4J A;  5G5E A;  3TGZ A;  4EIQ A;  2C0E A;  4Q5N A;  4KDY A;  3UAR A;  5JWO B;  2H74 A;  3GKX A;  2HZE A;  1B4P A;  4IJI A;  4FO5 A;  1ZOF A;  2C0D A;  2H71 A;  2LST A;  4POK A;  4F03 A;  1UN2 A;  3CTF A;  5C00 A;  1RK4 A;  2PGT A;  5HR0 A;  1JZR A;  3DVX A;  4ZIL A;  1G7O A;  2HRK A;  2VD0 A;  4LMW A;  3D5J A;  2YOI A;  1OKD A;  2PVQ A;  3AY8 A;  1O81 A;  1GUK A;  4NMU A;  2R6K A;  2O89 A;  2Z9S A;  2JL4 A;  3LG6 A;  3RAZ A;  1ZL9 A;  4QQ7 A;  1A8L A;  2C8U A;  4ZIJ A;  1SU9 A;  2MMN A;  1W4V A;  3HXS A;  3LYK A;  2E2G A;  2H1G A;  3SWL A;  3CSI A;  5F07 A;  5IQY A;  4IQA A;  1SKW B;  1JLV A;  1Z7P A;  3C1R A;  4ML1 A;  1VF1 A;  1GL8 A;  2B7J A;  5LNK e;  3IK7 A;  1XW9 A;  2H30 A;  3VI7 A;  2A2R A;  1G6Y A;  1GSE A;  3NZN A;  3WGE A;  3IA1 A;  4XRA A;  2I3Y A;  1NW2 A;  4OMV A;  1AW9 A;  2YWI A;  3FZ5 A;  1V9W A;  4IEL A;  5AN1 A;  2GSR A;  1NSW A;  2YCD A;  4HU7 A;  5GSS A;  4EE0 A;  2XBQ A;  4J2F A;  2MBS A;  2X99 A;  4HI7 A;  4V2L A;  4HU9 A;  3F3Q A;  3TB2 A;  2VM2 A;  2V2G A;  3F8U A;  3ME7 A;  3US3 A;  4NWY A;  2DJ3 A;  2QC7 A;  4TXO B;  5D9X A;  3ZTL A;  2M46 A;  2JU5 A;  3GUR A;  1HNA A;  4CHS A;  1USB A;  1XBS A;  3TJK A;  2PBJ A;  4FYB A;  3WT2 A;  4DSS B;  2GDR A;  3P7X A;  3D6I A;  1TK8 B;  4MF6 A;  1J0F A;  2GZP A;  3MWH A;  1OC9 A;  2V6K A;  2A4H A;  3TRQ A;  2YV9 A;  2DML A;  3GKM A;  2VL9 A;  4ULX A;  1K0N A;  4GCI A;  1AXD A;  1HNB A;  4MPG A;  5IM9 A;  3QCP A;  1BG5 A;  2WRT A;  2KP2 A;  1U87 A;  3VPQ A;  2LQQ A;  4USS A;  2HRA A;  2VCT A;  1JHB A;  2IWT A;  3CYN A;  4IVF A;  4POL A;  1PD2 1;  5FWG A;  4BWS A;  3KTB A;  2A2S A;  5EL8 A;  2AJQ B;  5B8B A;  3IR4 A;  3KH7 A;  3M9K A;  3VLN A;  2DBC A;  3GTU B;  4NV5 A;  2FWH A;  1EOH A;  2XHF A;  4MH2 A;  1B48 A;  1HYU A;  2OE0 A;  5KOW A;  2ES7 A;  3CXG A;  4ZL7 A;  4WBR D;  3ERF A;  2YP6 A;  4X4J A;  4AJ6 A;  2R0P A;  12GS A;  1B4Q A;  2IJY A;  4TR1 B;  2R2J A;  1TRU A;  1FO5 A;  2IMD A;  1TI3 A;  3F4R A;  1EEM A;  4Q5R A;  3BBY A;  4TR4 A;  2E0Q A;  2DIZ A;  2VCV A;  4OCE A;  3HYP A;  3ERW A;  5ECH B;  4BPY A;  2C1Y A;  2N5A A;  4BA7 A;  2MMZ A;  1ZGN A;  4WKW A;  1IYH A;  1XIY A;  5H5Q A;  3C1S A;  3ISO A;  4NV2 A;  1E2Y A;  3C73 A;  2B1L A;  3KP9 A;  4K1F A;  1SJI A;  5IMC A;  2B5Y A;  1KEB A;  1SYX A;  4POM A;  4NHZ A;  2VUP A;  2XC2 A;  1A2J A;  2KUC A;  1K0C A;  1M0U A;  1TK5 B;  3U6V A;  1JZO A;  4X1U A;  1NHY A;  3KMO A;  1GSD A;  2H66 A;  4XS6 A;  1F3B A;  3A2W A;  2CQ9 A;  3SBC A;  3IBH A;  4ZL8 A;  2I1U A;  2VCZ A;  4AF2 A;  3TDG A;  1TU7 A;  2DJ0 A;  2V41 A;  4JBB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...