2H03A

Structural studies of protein tyrosine phosphatase beta catalytic domain in complex with inhibitors
Total Genus 101
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
101
sequence length
288
structure length
288
Chain Sequence
KTSCPIKINQFEGHFMKLQADSNYLLSKEYEELKDVGRNQSCDIALLPENRGKNRYNNILPYDATRVKLSGGSDYINASYIPGNNFRREYIVTQGPLPGTKDDFWKMVWEQNVHNIVMVTQCVEKGRVKCDHYWPADQDSLYYGDLILQMLSESVLPEWTIREFKICGEEQLDAHRLIRHFHYTVWPDHGVPETTQSLIQFVRTVRDYINRSPGAGPTVVHCSAGVGRTGTFIALDRILQQLDSKDSVDIYGAVHDLRLHRVHMVQTECQYVYLHQCVRDVLRARKLR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Design and synthesis of potent, non-peptidic inhibitors of HPTPbeta.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords Protein tyrosine phosphatase, receptor type, B,
total genus 101
structure length 288
sequence length 288
ec nomenclature ec 3.1.3.48: Protein-tyrosine-phosphatase.
pdb deposition date 2006-05-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00102 Y_phosphatase Protein-tyrosine phosphatase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.190.10 Alpha Beta Alpha-Beta Complex Protein-Tyrosine Phosphatase; Chain A Protein tyrosine phosphatase superfamily 2h03A00
3V0DA 1X24A 2QBSA 4PVGA 1WRMA 2PSZA 2F71A 3QCJA 3PS5A 4BPCA 1WAXA 5K22A 2B49A 2A8BA 1LYVA 5IBSA 4GE6A 4WOHA 2VEUA 3B7OA 4R0TA 2B3OA 1XBOA 4GE5A 2CM2A 4GWFA 1Q6SA 4R0SA 4AZ1A 3F41A 3O3LA 2ZMMA 2H04A 1XXPA 1Q1MA 5KA8A 3QCKA 1Q6MA 3AWFA 2SHPA 2QCTA 2F6TA 3S3EA 2P6XA 4OHEA 3F9AA 5KABA 5BX1A 3F81A 2BV5A 1PA9A 4GS0A 2CNIA 1QZ0A 2MBCA 4QBWA 3CM3A 2Y96A 2BIJA 5KA4A 1OEVA 2I5XA 1NO6A 4GFUA 4OHIA 1M3GA 2Y2FA 2VEYA 3QCFA 2GP0A 1KAVA 2A3KA 4H34A 4NWFA 3EMUA 2RF6A 4H1OA 4RKKA 4JNBA 4WU2A 3AWGA 2CNFA 4JBCA 3F9BA 3QCEA 3RGQA 3D42A 2HCMA 3EZZA 2QBRA 3S3KA 3EAXA 2I6JA 1FPRA 2NT7A 1Q6NA 1T48A 2QEPA 3BRHA 1YPTA 3QCNA 2CMBA 2I3RA 2PI7A 4KYQA 2WGPA 1PH0A 4JMKA 3QCCA 3V0GA 2H4GA 5K23A 2CJZA 1T49A 4PYHA 2PT0A 2I3UA 2F6FA 1OEUA 1ZC0A 2CNEA 2BZLA 1XRIA 2G59A 1RXDA 5K25A 3AWEA 2AHSA 1YGRA 3QCHA 4QAHA 3H2XA 2M3VA 3D1QA 1JF7A 2CM3A 2CM7A 1AAXA 4I8NA 2C7SA 4QUMA 3O4TA 4R30A 4MBBA 2H4VA 1U26A 3LJ8A 3S3HA 4JMJA 4QBEA 1GWZA 2YDUA 4HJQA 3EU0A 1BZHA 2B4OA 1JLNA 1XXVA 1YWFA 4D3QA 2HB1A 1G7GA 2NLKA 2AZRA 1PYNA 2QCJA 1VHRA 2NT2A 2NTAA 1L8GA 2FH7A 4ERCA 1LARA 1PTVA 3A5KA 4D3RA 1Q6PA 1R6HA 2F70A 2F6VA 2GWOA 1PTTA 4NYHA 1OHDA 2CM8A 2C46A 4RH9A 4ICZA 2I6OA 1XM2A 2IMGA 4ZN5A 1FPZA 2QDCA 2F6WA 5K24A 3SMEA 4OHDA 3S4OA 5KA9A 1YGUA 1C85A 4WU3A 2NZ6A 1J4XA 1G1FA 1Q6TA 5KA1A 4KI9A 3S4EA 2B4PA 2F46A 3V0HA 2FJMA 2J16B 2BGDA 1LQFA 1G1GA 4OHLA 3ZM0A 5KA0A 4Y14A 1MKPA 2CNGA 2CMCA 2VEXA 2QDPA 5HDEA 1NNYA 1YFOA 3RZ2A 2ESBA 4GE2A 3RO1A 1A5YA 5MMZB 1YZ4A 2OC3A 1D5RA 2I6IA 5K9VA 3QCBA 1PTUA 3CWEA 1NZ7A 4B04A 2VEVA 1SUGA 3MMJA 4HRFA 1G7FA 2Q47A 4BJOA 4OHHA 4Z6BA 3I36A 2I42A 5KA2A 2CFVA 2B4SA 5LXQB 1OETA 2H4KA 3O4SA 1BZCA 1OESA 2E0TA 1ZZWA 5J8RA 1U25A 1NL9A 1C83A 3O4UA 2I4GA 3GXGA 3N0AA 1C87A 3I80A 1OHEA 4YR8B 2PBNA 4RH5A 4KYRA 5AWXA 1G4WR 3S3FA 2OZ5A 4RI5A 5BZXA 4DGPA 2BGEA 3BLTA 3BM8A 2F6YA 3SR9A 5KAAA 4HJPA 2I75A 2HNPA 2I4EA 3QCGA 4RHGA 2HNQA 3QKQA 3EB1A 1EEOA 1PTYA 1ONYA 3ZM3A 1L8KA 5BZZA 4TVVA 4J51A 2P4DA 4YAAA 2I4HA 5EHRA 5KACA 2Q05A 3GXHA 4WTYA 2OOQA 5GTJA 2I6MA 3V0EA 1P15A 1WCHA 3QCLA 4NX8A 1I57A 2QBPA 4QUNA 3QKPA 3D1OA 4S0GA 4DGXA 5K9WA 3D44A 3ZV2A 2PQ5A 2QDMA 1OHCA 3M4UA 2CMAA 2I1YA 1YN9A 2HXPA 4Y2EA 1QXKA 2J16A 4GFVA 2B07A 3F99A 2HC1A 1C88A 5I6VA 1PA1A 3D1HA 3OMHA 1U24A 5KA3A 4QAPA 1ZCLA 2H03A 3I7ZA 3A5JA 2HY3A 1YTSA 3RGOA 4GRZA 3V0JA 3ZM1A 4ZRTA 4IKCA 1FQ1A 3O5XA 3QCIA 1BZJA 1YTNA 3ZM2A 5IBMA 3QCDA 3MOZA 1I9SA 1G4US 2QBQA 1V3AA 5M43A 3BLUA 2GJTA 4D3PA 1OEMX 2JJDA 5KADA 4ZI4A 5BUGA 3MOWA 1EENA 2FJNA 4NNDA 1KAKA 2G6ZA 2CNHA 1NWEA 1GFYA 2R0BA 4GRYA 2I6PA 2HC2A 1ONZA 2F6ZA 2PA5A 5KA7A 2ZN7A 1YTWA 3D9CA 1C84A 2DXPA 1Q6JA 2OUDA 2H02A 1G1HA 1ECVA 3ZMQA 2VEWA 4NWGA 3V0FA 3OLRA 3ZMPA 1I9TA 1RPMA 3U96A 1ZCKA 3NMEA 1PXHA 4RDDA 3QCMA 2B4UA 4RI4A 2J17A 2NV5A 2HVLA 1T4JA 1OEOX 5EHPA 1C86A 3V0IA 1NWLA
chains in the Genus database with same CATH superfamily
3V0DA 1X24A 2QBSA 4PVGA 1WRMA 2PSZA 2F71A 3QCJA 3PS5A 4BPCA 1WAXA 5K22A 2B49A 1GQQA 2A8BA 1LYVA 4BUBA 5IBSA 4GE6A 4ZIYA 4WOHA 2VEUA 3B7OA 4R0TA 2B3OA 1XBOA 4GE5A 2CM2A 3MVNA 4GWFA 1Q6SA 4R0SA 4AZ1A 3F41A 3O3LA 2ZMMA 2Y66A 2H04A 1XXPA 1Q1MA 5KA8A 3QCKA 1Q6MA 3AWFA 2SHPA 2QCTA 2F6TA 3S3EA 2P6XA 4OHEA 3F9AA 5KABA 5BX1A 3F81A 2BV5A 1PA9A 4GS0A 2CNIA 1QZ0A 2MBCA 4QBWA 3CM3A 2Y96A 2BIJA 5KA4A 1OEVA 2I5XA 2XPCA 1NO6A 4GFUA 4OHIA 1M3GA 2Y2FA 2VEYA 3QCFA 2GP0A 1KAVA 2GC6A 2A3KA 4H34A 4NWFA 3EMUA 3ZL8A 2VTEA 2RF6A 4H1OA 4RKKA 4JNBA 4WU2A 3AWGA 2CNFA 4JBCA 3F9BA 3QCEA 3RGQA 3D42A 2HCMA 3EZZA 4C13A 2QBRA 3S3KA 3EAXA 2WJPA 2I6JA 1FPRA 4CVLA 2NT7A 1Q6NA 1T48A 2QEPA 3BRHA 1YPTA 3QCNA 2CMBA 2I3RA 2PI7A 4KYQA 2WGPA 1PH0A 4JMKA 3QCCA 3V0GA 2H4GA 5K23A 2AM2A 2CJZA 1T49A 4PYHA 2PT0A 2I3UA 2F6FA 1OEUA 1ZC0A 2CNEA 2BZLA 1XRIA 2VORA 2G59A 1RXDA 5K25A 3AWEA 2AHSA 1YGRA 3QCHA 4QAHA 3H2XA 2M3VA 3D1QA 1JF7A 2CM3A 2CM7A 1AAXA 4I8NA 2C7SA 4QUMA 3O4TA 1J6UA 4R30A 4MBBA 2H4VA 1U26A 1UAGA 3LJ8A 3S3HA 4JMJA 4QBEA 1GWZA 2YDUA 4HJQA 2Y1OA 3EU0A 1BZHA 1W7KA 2B4OA 1JLNA 1XXVA 1YWFA 4D3QA 2HB1A 1G7GA 2NLKA 2AZRA 1PYNA 2QCJA 1VHRA 2NT2A 2NTAA 1L8GA 2FH7A 4ERCA 1LARA 1PTVA 3A5KA 4D3RA 2AM1A 3ZM5A 1Q6PA 1R6HA 2F70A 2F6VA 2GWOA 2F00A 1PTTA 1OHDA 4NYHA 1E0DA 2CM8A 2C46A 4RH9A 4ICZA 2Y68A 2I6OA 1XM2A 2IMGA 4ZN5A 1FPZA 2QDCA 2F6WA 2Y67A 5K24A 3SMEA 4OHDA 3S4OA 5KA9A 1YGUA 1C85A 4WU3A 2NZ6A 1J4XA 1G1FA 1Q6TA 5KA1A 4KI9A 1JBWA 3S4EA 4CVKA 2B4PA 2F46A 3V0HA 2FJMA 2J16B 2JFGA 2BGDA 1LQFA 1G1GA 4OHLA 3ZM0A 5KA0A 2VOSA 4Y14A 1MKPA 2CNGA 2CMCA 2VEXA 2QDPA 5HDEA 1NNYA 1YFOA 4QF5A 3RZ2A 2GCAA 2ESBA 4GE2A 3UAGA 3RO1A 4CVMA 1A5YA 5MMZB 2UUOA 1YZ4A 2OC3A 3QCZA 1D5RA 2I6IA 5K9VA 3QCBA 1PTUA 2X5OA 1NZ7A 3CWEA 4B04A 2VEVA 1SUGA 3MMJA 4HRFA 1G7FA 2Q47A 4BJOA 2WTZA 2JFFA 4OHHA 4Z6BA 3I36A 2I42A 5KA2A 2CFVA 2B4SA 5LXQB 1OETA 3HN7A 2H4KA 3O4SA 1BZCA 1GQYA 1OESA 2E0TA 1ZZWA 5J8RA 1U25A 1NL9A 1C83A 3O4UA 2I4GA 4HV4A 3GXGA 3N0AA 1C87A 3I80A 1OHEA 4YR8B 2PBNA 4RH5A 4KYRA 5AWXA 1G4WR 3S3FA 2OZ5A 4RI5A 3ZM6A 5BZXA 4DGPA 2BGEA 3BLTA 3BM8A 1JBVA 2F6YA 3SR9A 5KAAA 4HJPA 2I75A 2HNPA 2I4EA 3QCGA 4RHGA 2HNQA 1FGSA 3QKQA 3EB1A 1EEOA 1PTYA 1ONYA 3ZM3A 1L8KA 2UUPA 5BZZA 4TVVA 4J51A 2P4DA 2GCBA 4YAAA 2I4HA 5EHRA 5KACA 2Q05A 3GXHA 4WTYA 2OOQA 5GTJA 2I6MA 3V0EA 1P15A 1WCHA 3QCLA 4NX8A 2VTDA 1I57A 2QBPA 4QUNA 3QKPA 3D1OA 4S0GA 4DGXA 5K9WA 3D44A 3ZV2A 2PQ5A 2QDMA 1OHCA 3M4UA 2CMAA 2I1YA 1YN9A 2HXPA 4Y2EA 1QXKA 2J16A 2UAGA 4GFVA 2B07A 3F99A 3NRSA 2HC1A 1C88A 5I6VA 1PA1A 3D1HA 3OMHA 1U24A 1O5ZA 1P31A 5KA3A 5A5EA 4QDIA 4QAPA 1ZCLA 2H03A 1P3DA 3I7ZA 3A5JA 4UAGA 2HY3A 1YTSA 3RGOA 4GRZA 3V0JA 3ZM1A 4ZRTA 2GC5A 4IKCA 1FQ1A 3O5XA 3QCIA 4C12A 1BZJA 1YTNA 3ZM2A 5IBMA 3QCDA 3MOZA 1I9SA 1G4US 2QBQA 1V3AA 3PYZA 5M43A 3BLUA 2GJTA 4D3PA 1OEMX 5A5FA 3N2AA 2JJDA 5KADA 4ZI4A 2XJAA 5BUGA 3MOWA 2JFHA 1EENA 1EEHA 2FJNA 4NNDA 1KAKA 2G6ZA 4BUCA 2CNHA 1NWEA 1GFYA 2R0BA 4GRYA 2I6PA 2HC2A 1ONZA 2F6ZA 1E8CA 2PA5A 5KA7A 2ZN7A 1YTWA 3D9CA 1C84A 2DXPA 1GG4A 1Q6JA 2OUDA 2H02A 1G1HA 1ECVA 3ZMQA 2VEWA 4NWGA 3V0FA 3OLRA 3ZMPA 1I9TA 1RPMA 3U96A 1ZCKA 3NMEA 1PXHA 4RDDA 3QCMA 2B4UA 4RI4A 2J17A 2NV5A 2HVLA 1T4JA 3LK7A 1OEOX 1W78A 5EHPA 1C86A 3V0IA 1NWLA
chains in the Genus database with same CATH topology
3V0DA 1X24A 2QBSA 4PVGA 1WRMA 2PSZA 2F71A 3QCJA 3PS5A 4BPCA 1WAXA 5K22A 2B49A 2A8BA 1LYVA 5IBSA 4GE6A 4WOHA 2VEUA 3B7OA 4R0TA 2B3OA 1XBOA 4GE5A 2CM2A 4GWFA 1Q6SA 4R0SA 4AZ1A 3F41A 3O3LA 2ZMMA 2H04A 1XXPA 1Q1MA 5KA8A 3QCKA 1Q6MA 3AWFA 2SHPA 2QCTA 2F6TA 3S3EA 2P6XA 4OHEA 3F9AA 5KABA 5BX1A 3F81A 2BV5A 1PA9A 4GS0A 2CNIA 1QZ0A 2MBCA 4QBWA 3CM3A 2Y96A 2BIJA 5KA4A 1OEVA 2I5XA 1NO6A 4GFUA 4OHIA 1M3GA 2Y2FA 2VEYA 3QCFA 2GP0A 1KAVA 2A3KA 4H34A 4NWFA 3EMUA 2RF6A 4H1OA 4RKKA 4JNBA 4WU2A 3AWGA 2CNFA 4JBCA 3F9BA 3QCEA 3RGQA 3D42A 2HCMA 3EZZA 2QBRA 3S3KA 3EAXA 2I6JA 1FPRA 2NT7A 1Q6NA 1T48A 2QEPA 3BRHA 1YPTA 3QCNA 2CMBA 2I3RA 2PI7A 4KYQA 2WGPA 1PH0A 4JMKA 3QCCA 3V0GA 2H4GA 5K23A 2CJZA 1T49A 4PYHA 2PT0A 2I3UA 2F6FA 1OEUA 1ZC0A 2CNEA 2BZLA 1XRIA 2G59A 1RXDA 5K25A 3AWEA 2AHSA 1YGRA 3QCHA 4QAHA 3H2XA 2M3VA 3D1QA 1JF7A 2CM3A 2CM7A 1AAXA 4I8NA 2C7SA 4QUMA 3O4TA 4R30A 4MBBA 2H4VA 1U26A 3LJ8A 3S3HA 4JMJA 4QBEA 1GWZA 2YDUA 4HJQA 3EU0A 1BZHA 2B4OA 1JLNA 1XXVA 1YWFA 4D3QA 2HB1A 1G7GA 2NLKA 2AZRA 1PYNA 2QCJA 1VHRA 2NT2A 2NTAA 1L8GA 2FH7A 4ERCA 1LARA 1PTVA 3A5KA 4D3RA 1Q6PA 1R6HA 2F70A 2F6VA 2GWOA 1PTTA 4NYHA 1OHDA 2CM8A 2C46A 4RH9A 4ICZA 2I6OA 1XM2A 2IMGA 4ZN5A 1FPZA 2QDCA 2F6WA 5K24A 3SMEA 4OHDA 3S4OA 5KA9A 1YGUA 1C85A 4WU3A 2NZ6A 1J4XA 1G1FA 1Q6TA 5KA1A 4KI9A 3S4EA 2B4PA 2F46A 3V0HA 2FJMA 2J16B 2BGDA 1LQFA 1G1GA 4OHLA 3ZM0A 5KA0A 4Y14A 1MKPA 2CNGA 2CMCA 2VEXA 2QDPA 5HDEA 1NNYA 1YFOA 3RZ2A 2ESBA 4GE2A 3RO1A 1A5YA 5MMZB 1YZ4A 2OC3A 1D5RA 2I6IA 5K9VA 3QCBA 1PTUA 3CWEA 1NZ7A 4B04A 2VEVA 1SUGA 3MMJA 4HRFA 1G7FA 2Q47A 4BJOA 4OHHA 4Z6BA 3I36A 2I42A 5KA2A 2CFVA 2B4SA 5LXQB 1OETA 2H4KA 3O4SA 1BZCA 1OESA 2E0TA 1ZZWA 5J8RA 1U25A 1NL9A 1C83A 3O4UA 2I4GA 3GXGA 3N0AA 1C87A 3I80A 1OHEA 4YR8B 2PBNA 4RH5A 4KYRA 5AWXA 1G4WR 3S3FA 2OZ5A 4RI5A 5BZXA 4DGPA 2BGEA 3BLTA 3BM8A 2F6YA 3SR9A 5KAAA 4HJPA 2I75A 2HNPA 2I4EA 3QCGA 4RHGA 2HNQA 3QKQA 3EB1A 1EEOA 1PTYA 1ONYA 3ZM3A 1L8KA 5BZZA 4TVVA 4J51A 2P4DA 4YAAA 2I4HA 5EHRA 5KACA 2Q05A 3GXHA 4WTYA 2OOQA 5GTJA 2I6MA 3V0EA 1P15A 1WCHA 3QCLA 4NX8A 1I57A 2QBPA 4QUNA 3QKPA 3D1OA 4S0GA 4DGXA 5K9WA 3D44A 3ZV2A 2PQ5A 2QDMA 1OHCA 3M4UA 2CMAA 2I1YA 1YN9A 2HXPA 4Y2EA 1QXKA 2J16A 4GFVA 2B07A 3F99A 2HC1A 1C88A 5I6VA 1PA1A 3D1HA 3OMHA 1U24A 5KA3A 4QAPA 1ZCLA 2H03A 3I7ZA 3A5JA 2HY3A 1YTSA 3RGOA 4GRZA 3V0JA 3ZM1A 4ZRTA 4IKCA 1FQ1A 3O5XA 3QCIA 1BZJA 1YTNA 3ZM2A 5IBMA 3QCDA 3MOZA 1I9SA 1G4US 2QBQA 1V3AA 5M43A 3BLUA 2GJTA 4D3PA 1OEMX 2JJDA 5KADA 4ZI4A 5BUGA 3MOWA 1EENA 2FJNA 4NNDA 1KAKA 2G6ZA 2CNHA 1NWEA 1GFYA 2R0BA 4GRYA 2I6PA 2HC2A 1ONZA 2F6ZA 2PA5A 5KA7A 2ZN7A 1YTWA 3D9CA 1C84A 2DXPA 1Q6JA 2OUDA 2H02A 1G1HA 1ECVA 3ZMQA 2VEWA 4NWGA 3V0FA 3OLRA 3ZMPA 1I9TA 1RPMA 3U96A 1ZCKA 3NMEA 1PXHA 4RDDA 3QCMA 2B4UA 4RI4A 2J17A 2NV5A 2HVLA 1T4JA 1OEOX 5EHPA 1C86A 3V0IA 1NWLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3V0D A;  1X24 A;  2QBS A;  4PVG A;  1WRM A;  2PSZ A;  2F71 A;  3QCJ A;  3PS5 A;  4BPC A;  1WAX A;  5K22 A;  2B49 A;  2A8B A;  1LYV A;  5IBS A;  4GE6 A;  4WOH A;  2VEU A;  3B7O A;  4R0T A;  2B3O A;  1XBO A;  4GE5 A;  2CM2 A;  4GWF A;  1Q6S A;  4R0S A;  4AZ1 A;  3F41 A;  3O3L A;  2ZMM A;  2H04 A;  1XXP A;  1Q1M A;  5KA8 A;  3QCK A;  1Q6M A;  3AWF A;  2SHP A;  2QCT A;  2F6T A;  3S3E A;  2P6X A;  4OHE A;  3F9A A;  5KAB A;  5BX1 A;  3F81 A;  2BV5 A;  1PA9 A;  4GS0 A;  2CNI A;  1QZ0 A;  2MBC A;  4QBW A;  3CM3 A;  2Y96 A;  2BIJ A;  5KA4 A;  1OEV A;  2I5X A;  1NO6 A;  4GFU A;  4OHI A;  1M3G A;  2Y2F A;  2VEY A;  3QCF A;  2GP0 A;  1KAV A;  2A3K A;  4H34 A;  4NWF A;  3EMU A;  2RF6 A;  4H1O A;  4RKK A;  4JNB A;  4WU2 A;  3AWG A;  2CNF A;  4JBC A;  3F9B A;  3QCE A;  3RGQ A;  3D42 A;  2HCM A;  3EZZ A;  2QBR A;  3S3K A;  3EAX A;  2I6J A;  1FPR A;  2NT7 A;  1Q6N A;  1T48 A;  2QEP A;  3BRH A;  1YPT A;  3QCN A;  2CMB A;  2I3R A;  2PI7 A;  4KYQ A;  2WGP A;  1PH0 A;  4JMK A;  3QCC A;  3V0G A;  2H4G A;  5K23 A;  2CJZ A;  1T49 A;  4PYH A;  2PT0 A;  2I3U A;  2F6F A;  1OEU A;  1ZC0 A;  2CNE A;  2BZL A;  1XRI A;  2G59 A;  1RXD A;  5K25 A;  3AWE A;  2AHS A;  1YGR A;  3QCH A;  4QAH A;  3H2X A;  2M3V A;  3D1Q A;  1JF7 A;  2CM3 A;  2CM7 A;  1AAX A;  4I8N A;  2C7S A;  4QUM A;  3O4T A;  4R30 A;  4MBB A;  2H4V A;  1U26 A;  3LJ8 A;  3S3H A;  4JMJ A;  4QBE A;  1GWZ A;  2YDU A;  4HJQ A;  3EU0 A;  1BZH A;  2B4O A;  1JLN A;  1XXV A;  1YWF A;  4D3Q A;  2HB1 A;  1G7G A;  2NLK A;  2AZR A;  1PYN A;  2QCJ A;  1VHR A;  2NT2 A;  2NTA A;  1L8G A;  2FH7 A;  4ERC A;  1LAR A;  1PTV A;  3A5K A;  4D3R A;  1Q6P A;  1R6H A;  2F70 A;  2F6V A;  2GWO A;  1PTT A;  4NYH A;  1OHD A;  2CM8 A;  2C46 A;  4RH9 A;  4ICZ A;  2I6O A;  1XM2 A;  2IMG A;  4ZN5 A;  1FPZ A;  2QDC A;  2F6W A;  5K24 A;  3SME A;  4OHD A;  3S4O A;  5KA9 A;  1YGU A;  1C85 A;  4WU3 A;  2NZ6 A;  1J4X A;  1G1F A;  1Q6T A;  5KA1 A;  4KI9 A;  3S4E A;  2B4P A;  2F46 A;  3V0H A;  2FJM A;  2J16 B;  2BGD A;  1LQF A;  1G1G A;  4OHL A;  3ZM0 A;  5KA0 A;  4Y14 A;  1MKP A;  2CNG A;  2CMC A;  2VEX A;  2QDP A;  5HDE A;  1NNY A;  1YFO A;  3RZ2 A;  2ESB A;  4GE2 A;  3RO1 A;  1A5Y A;  5MMZ B;  1YZ4 A;  2OC3 A;  1D5R A;  2I6I A;  5K9V A;  3QCB A;  1PTU A;  3CWE A;  1NZ7 A;  4B04 A;  2VEV A;  1SUG A;  3MMJ A;  4HRF A;  1G7F A;  2Q47 A;  4BJO A;  4OHH A;  4Z6B A;  3I36 A;  2I42 A;  5KA2 A;  2CFV A;  2B4S A;  5LXQ B;  1OET A;  2H4K A;  3O4S A;  1BZC A;  1OES A;  2E0T A;  1ZZW A;  5J8R A;  1U25 A;  1NL9 A;  1C83 A;  3O4U A;  2I4G A;  3GXG A;  3N0A A;  1C87 A;  3I80 A;  1OHE A;  4YR8 B;  2PBN A;  4RH5 A;  4KYR A;  5AWX A;  1G4W R;  3S3F A;  2OZ5 A;  4RI5 A;  5BZX A;  4DGP A;  2BGE A;  3BLT A;  3BM8 A;  2F6Y A;  3SR9 A;  5KAA A;  4HJP A;  2I75 A;  2HNP A;  2I4E A;  3QCG A;  4RHG A;  2HNQ A;  3QKQ A;  3EB1 A;  1EEO A;  1PTY A;  1ONY A;  3ZM3 A;  1L8K A;  5BZZ A;  4TVV A;  4J51 A;  2P4D A;  4YAA A;  2I4H A;  5EHR A;  5KAC A;  2Q05 A;  3GXH A;  4WTY A;  2OOQ A;  5GTJ A;  2I6M A;  3V0E A;  1P15 A;  1WCH A;  3QCL A;  4NX8 A;  1I57 A;  2QBP A;  4QUN A;  3QKP A;  3D1O A;  4S0G A;  4DGX A;  5K9W A;  3D44 A;  3ZV2 A;  2PQ5 A;  2QDM A;  1OHC A;  3M4U A;  2CMA A;  2I1Y A;  1YN9 A;  2HXP A;  4Y2E A;  1QXK A;  2J16 A;  4GFV A;  2B07 A;  3F99 A;  2HC1 A;  1C88 A;  5I6V A;  1PA1 A;  3D1H A;  3OMH A;  1U24 A;  5KA3 A;  4QAP A;  1ZCL A;  2H03 A;  3I7Z A;  3A5J A;  2HY3 A;  1YTS A;  3RGO A;  4GRZ A;  3V0J A;  3ZM1 A;  4ZRT A;  4IKC A;  1FQ1 A;  3O5X A;  3QCI A;  1BZJ A;  1YTN A;  3ZM2 A;  5IBM A;  3QCD A;  3MOZ A;  1I9S A;  1G4U S;  2QBQ A;  1V3A A;  5M43 A;  3BLU A;  2GJT A;  4D3P A;  1OEM X;  2JJD A;  5KAD A;  4ZI4 A;  5BUG A;  3MOW A;  1EEN A;  2FJN A;  4NND A;  1KAK A;  2G6Z A;  2CNH A;  1NWE A;  1GFY A;  2R0B A;  4GRY A;  2I6P A;  2HC2 A;  1ONZ A;  2F6Z A;  2PA5 A;  5KA7 A;  2ZN7 A;  1YTW A;  3D9C A;  1C84 A;  2DXP A;  1Q6J A;  2OUD A;  2H02 A;  1G1H A;  1ECV A;  3ZMQ A;  2VEW A;  4NWG A;  3V0F A;  3OLR A;  3ZMP A;  1I9T A;  1RPM A;  3U96 A;  1ZCK A;  3NME A;  1PXH A;  4RDD A;  3QCM A;  2B4U A;  4RI4 A;  2J17 A;  2NV5 A;  2HVL A;  1T4J A;  1OEO X;  5EHP A;  1C86 A;  3V0I A;  1NWL A; 
#chains in the Genus database with same CATH topology
 3V0D A;  1X24 A;  2QBS A;  4PVG A;  1WRM A;  2PSZ A;  2F71 A;  3QCJ A;  3PS5 A;  4BPC A;  1WAX A;  5K22 A;  2B49 A;  1GQQ A;  2A8B A;  1LYV A;  4BUB A;  5IBS A;  4GE6 A;  4ZIY A;  4WOH A;  2VEU A;  3B7O A;  4R0T A;  2B3O A;  1XBO A;  4GE5 A;  2CM2 A;  3MVN A;  4GWF A;  1Q6S A;  4R0S A;  4AZ1 A;  3F41 A;  3O3L A;  2ZMM A;  2Y66 A;  2H04 A;  1XXP A;  1Q1M A;  5KA8 A;  3QCK A;  1Q6M A;  3AWF A;  2SHP A;  2QCT A;  2F6T A;  3S3E A;  2P6X A;  4OHE A;  3F9A A;  5KAB A;  5BX1 A;  3F81 A;  2BV5 A;  1PA9 A;  4GS0 A;  2CNI A;  1QZ0 A;  2MBC A;  4QBW A;  3CM3 A;  2Y96 A;  2BIJ A;  5KA4 A;  1OEV A;  2I5X A;  2XPC A;  1NO6 A;  4GFU A;  4OHI A;  1M3G A;  2Y2F A;  2VEY A;  3QCF A;  2GP0 A;  1KAV A;  2GC6 A;  2A3K A;  4H34 A;  4NWF A;  3EMU A;  3ZL8 A;  2VTE A;  2RF6 A;  4H1O A;  4RKK A;  4JNB A;  4WU2 A;  3AWG A;  2CNF A;  4JBC A;  3F9B A;  3QCE A;  3RGQ A;  3D42 A;  2HCM A;  3EZZ A;  4C13 A;  2QBR A;  3S3K A;  3EAX A;  2WJP A;  2I6J A;  1FPR A;  4CVL A;  2NT7 A;  1Q6N A;  1T48 A;  2QEP A;  3BRH A;  1YPT A;  3QCN A;  2CMB A;  2I3R A;  2PI7 A;  4KYQ A;  2WGP A;  1PH0 A;  4JMK A;  3QCC A;  3V0G A;  2H4G A;  5K23 A;  2AM2 A;  2CJZ A;  1T49 A;  4PYH A;  2PT0 A;  2I3U A;  2F6F A;  1OEU A;  1ZC0 A;  2CNE A;  2BZL A;  1XRI A;  2VOR A;  2G59 A;  1RXD A;  5K25 A;  3AWE A;  2AHS A;  1YGR A;  3QCH A;  4QAH A;  3H2X A;  2M3V A;  3D1Q A;  1JF7 A;  2CM3 A;  2CM7 A;  1AAX A;  4I8N A;  2C7S A;  4QUM A;  3O4T A;  1J6U A;  4R30 A;  4MBB A;  2H4V A;  1U26 A;  1UAG A;  3LJ8 A;  3S3H A;  4JMJ A;  4QBE A;  1GWZ A;  2YDU A;  4HJQ A;  2Y1O A;  3EU0 A;  1BZH A;  1W7K A;  2B4O A;  1JLN A;  1XXV A;  1YWF A;  4D3Q A;  2HB1 A;  1G7G A;  2NLK A;  2AZR A;  1PYN A;  2QCJ A;  1VHR A;  2NT2 A;  2NTA A;  1L8G A;  2FH7 A;  4ERC A;  1LAR A;  1PTV A;  3A5K A;  4D3R A;  2AM1 A;  3ZM5 A;  1Q6P A;  1R6H A;  2F70 A;  2F6V A;  2GWO A;  2F00 A;  1PTT A;  1OHD A;  4NYH A;  1E0D A;  2CM8 A;  2C46 A;  4RH9 A;  4ICZ A;  2Y68 A;  2I6O A;  1XM2 A;  2IMG A;  4ZN5 A;  1FPZ A;  2QDC A;  2F6W A;  2Y67 A;  5K24 A;  3SME A;  4OHD A;  3S4O A;  5KA9 A;  1YGU A;  1C85 A;  4WU3 A;  2NZ6 A;  1J4X A;  1G1F A;  1Q6T A;  5KA1 A;  4KI9 A;  1JBW A;  3S4E A;  4CVK A;  2B4P A;  2F46 A;  3V0H A;  2FJM A;  2J16 B;  2JFG A;  2BGD A;  1LQF A;  1G1G A;  4OHL A;  3ZM0 A;  5KA0 A;  2VOS A;  4Y14 A;  1MKP A;  2CNG A;  2CMC A;  2VEX A;  2QDP A;  5HDE A;  1NNY A;  1YFO A;  4QF5 A;  3RZ2 A;  2GCA A;  2ESB A;  4GE2 A;  3UAG A;  3RO1 A;  4CVM A;  1A5Y A;  5MMZ B;  2UUO A;  1YZ4 A;  2OC3 A;  3QCZ A;  1D5R A;  2I6I A;  5K9V A;  3QCB A;  1PTU A;  2X5O A;  1NZ7 A;  3CWE A;  4B04 A;  2VEV A;  1SUG A;  3MMJ A;  4HRF A;  1G7F A;  2Q47 A;  4BJO A;  2WTZ A;  2JFF A;  4OHH A;  4Z6B A;  3I36 A;  2I42 A;  5KA2 A;  2CFV A;  2B4S A;  5LXQ B;  1OET A;  3HN7 A;  2H4K A;  3O4S A;  1BZC A;  1GQY A;  1OES A;  2E0T A;  1ZZW A;  5J8R A;  1U25 A;  1NL9 A;  1C83 A;  3O4U A;  2I4G A;  4HV4 A;  3GXG A;  3N0A A;  1C87 A;  3I80 A;  1OHE A;  4YR8 B;  2PBN A;  4RH5 A;  4KYR A;  5AWX A;  1G4W R;  3S3F A;  2OZ5 A;  4RI5 A;  3ZM6 A;  5BZX A;  4DGP A;  2BGE A;  3BLT A;  3BM8 A;  1JBV A;  2F6Y A;  3SR9 A;  5KAA A;  4HJP A;  2I75 A;  2HNP A;  2I4E A;  3QCG A;  4RHG A;  2HNQ A;  1FGS A;  3QKQ A;  3EB1 A;  1EEO A;  1PTY A;  1ONY A;  3ZM3 A;  1L8K A;  2UUP A;  5BZZ A;  4TVV A;  4J51 A;  2P4D A;  2GCB A;  4YAA A;  2I4H A;  5EHR A;  5KAC A;  2Q05 A;  3GXH A;  4WTY A;  2OOQ A;  5GTJ A;  2I6M A;  3V0E A;  1P15 A;  1WCH A;  3QCL A;  4NX8 A;  2VTD A;  1I57 A;  2QBP A;  4QUN A;  3QKP A;  3D1O A;  4S0G A;  4DGX A;  5K9W A;  3D44 A;  3ZV2 A;  2PQ5 A;  2QDM A;  1OHC A;  3M4U A;  2CMA A;  2I1Y A;  1YN9 A;  2HXP A;  4Y2E A;  1QXK A;  2J16 A;  2UAG A;  4GFV A;  2B07 A;  3F99 A;  3NRS A;  2HC1 A;  1C88 A;  5I6V A;  1PA1 A;  3D1H A;  3OMH A;  1U24 A;  1O5Z A;  1P31 A;  5KA3 A;  5A5E A;  4QDI A;  4QAP A;  1ZCL A;  2H03 A;  1P3D A;  3I7Z A;  3A5J A;  4UAG A;  2HY3 A;  1YTS A;  3RGO A;  4GRZ A;  3V0J A;  3ZM1 A;  4ZRT A;  2GC5 A;  4IKC A;  1FQ1 A;  3O5X A;  3QCI A;  4C12 A;  1BZJ A;  1YTN A;  3ZM2 A;  5IBM A;  3QCD A;  3MOZ A;  1I9S A;  1G4U S;  2QBQ A;  1V3A A;  3PYZ A;  5M43 A;  3BLU A;  2GJT A;  4D3P A;  1OEM X;  5A5F A;  3N2A A;  2JJD A;  5KAD A;  4ZI4 A;  2XJA A;  5BUG A;  3MOW A;  2JFH A;  1EEN A;  1EEH A;  2FJN A;  4NND A;  1KAK A;  2G6Z A;  4BUC A;  2CNH A;  1NWE A;  1GFY A;  2R0B A;  4GRY A;  2I6P A;  2HC2 A;  1ONZ A;  2F6Z A;  1E8C A;  2PA5 A;  5KA7 A;  2ZN7 A;  1YTW A;  3D9C A;  1C84 A;  2DXP A;  1GG4 A;  1Q6J A;  2OUD A;  2H02 A;  1G1H A;  1ECV A;  3ZMQ A;  2VEW A;  4NWG A;  3V0F A;  3OLR A;  3ZMP A;  1I9T A;  1RPM A;  3U96 A;  1ZCK A;  3NME A;  1PXH A;  4RDD A;  3QCM A;  2B4U A;  4RI4 A;  2J17 A;  2NV5 A;  2HVL A;  1T4J A;  3LK7 A;  1OEO X;  1W78 A;  5EHP A;  1C86 A;  3V0I A;  1NWL A; 
#chains in the Genus database with same CATH homology
 3V0D A;  1X24 A;  2QBS A;  4PVG A;  1WRM A;  2PSZ A;  2F71 A;  3QCJ A;  3PS5 A;  4BPC A;  1WAX A;  5K22 A;  2B49 A;  2A8B A;  1LYV A;  5IBS A;  4GE6 A;  4WOH A;  2VEU A;  3B7O A;  4R0T A;  2B3O A;  1XBO A;  4GE5 A;  2CM2 A;  4GWF A;  1Q6S A;  4R0S A;  4AZ1 A;  3F41 A;  3O3L A;  2ZMM A;  2H04 A;  1XXP A;  1Q1M A;  5KA8 A;  3QCK A;  1Q6M A;  3AWF A;  2SHP A;  2QCT A;  2F6T A;  3S3E A;  2P6X A;  4OHE A;  3F9A A;  5KAB A;  5BX1 A;  3F81 A;  2BV5 A;  1PA9 A;  4GS0 A;  2CNI A;  1QZ0 A;  2MBC A;  4QBW A;  3CM3 A;  2Y96 A;  2BIJ A;  5KA4 A;  1OEV A;  2I5X A;  1NO6 A;  4GFU A;  4OHI A;  1M3G A;  2Y2F A;  2VEY A;  3QCF A;  2GP0 A;  1KAV A;  2A3K A;  4H34 A;  4NWF A;  3EMU A;  2RF6 A;  4H1O A;  4RKK A;  4JNB A;  4WU2 A;  3AWG A;  2CNF A;  4JBC A;  3F9B A;  3QCE A;  3RGQ A;  3D42 A;  2HCM A;  3EZZ A;  2QBR A;  3S3K A;  3EAX A;  2I6J A;  1FPR A;  2NT7 A;  1Q6N A;  1T48 A;  2QEP A;  3BRH A;  1YPT A;  3QCN A;  2CMB A;  2I3R A;  2PI7 A;  4KYQ A;  2WGP A;  1PH0 A;  4JMK A;  3QCC A;  3V0G A;  2H4G A;  5K23 A;  2CJZ A;  1T49 A;  4PYH A;  2PT0 A;  2I3U A;  2F6F A;  1OEU A;  1ZC0 A;  2CNE A;  2BZL A;  1XRI A;  2G59 A;  1RXD A;  5K25 A;  3AWE A;  2AHS A;  1YGR A;  3QCH A;  4QAH A;  3H2X A;  2M3V A;  3D1Q A;  1JF7 A;  2CM3 A;  2CM7 A;  1AAX A;  4I8N A;  2C7S A;  4QUM A;  3O4T A;  4R30 A;  4MBB A;  2H4V A;  1U26 A;  3LJ8 A;  3S3H A;  4JMJ A;  4QBE A;  1GWZ A;  2YDU A;  4HJQ A;  3EU0 A;  1BZH A;  2B4O A;  1JLN A;  1XXV A;  1YWF A;  4D3Q A;  2HB1 A;  1G7G A;  2NLK A;  2AZR A;  1PYN A;  2QCJ A;  1VHR A;  2NT2 A;  2NTA A;  1L8G A;  2FH7 A;  4ERC A;  1LAR A;  1PTV A;  3A5K A;  4D3R A;  1Q6P A;  1R6H A;  2F70 A;  2F6V A;  2GWO A;  1PTT A;  4NYH A;  1OHD A;  2CM8 A;  2C46 A;  4RH9 A;  4ICZ A;  2I6O A;  1XM2 A;  2IMG A;  4ZN5 A;  1FPZ A;  2QDC A;  2F6W A;  5K24 A;  3SME A;  4OHD A;  3S4O A;  5KA9 A;  1YGU A;  1C85 A;  4WU3 A;  2NZ6 A;  1J4X A;  1G1F A;  1Q6T A;  5KA1 A;  4KI9 A;  3S4E A;  2B4P A;  2F46 A;  3V0H A;  2FJM A;  2J16 B;  2BGD A;  1LQF A;  1G1G A;  4OHL A;  3ZM0 A;  5KA0 A;  4Y14 A;  1MKP A;  2CNG A;  2CMC A;  2VEX A;  2QDP A;  5HDE A;  1NNY A;  1YFO A;  3RZ2 A;  2ESB A;  4GE2 A;  3RO1 A;  1A5Y A;  5MMZ B;  1YZ4 A;  2OC3 A;  1D5R A;  2I6I A;  5K9V A;  3QCB A;  1PTU A;  3CWE A;  1NZ7 A;  4B04 A;  2VEV A;  1SUG A;  3MMJ A;  4HRF A;  1G7F A;  2Q47 A;  4BJO A;  4OHH A;  4Z6B A;  3I36 A;  2I42 A;  5KA2 A;  2CFV A;  2B4S A;  5LXQ B;  1OET A;  2H4K A;  3O4S A;  1BZC A;  1OES A;  2E0T A;  1ZZW A;  5J8R A;  1U25 A;  1NL9 A;  1C83 A;  3O4U A;  2I4G A;  3GXG A;  3N0A A;  1C87 A;  3I80 A;  1OHE A;  4YR8 B;  2PBN A;  4RH5 A;  4KYR A;  5AWX A;  1G4W R;  3S3F A;  2OZ5 A;  4RI5 A;  5BZX A;  4DGP A;  2BGE A;  3BLT A;  3BM8 A;  2F6Y A;  3SR9 A;  5KAA A;  4HJP A;  2I75 A;  2HNP A;  2I4E A;  3QCG A;  4RHG A;  2HNQ A;  3QKQ A;  3EB1 A;  1EEO A;  1PTY A;  1ONY A;  3ZM3 A;  1L8K A;  5BZZ A;  4TVV A;  4J51 A;  2P4D A;  4YAA A;  2I4H A;  5EHR A;  5KAC A;  2Q05 A;  3GXH A;  4WTY A;  2OOQ A;  5GTJ A;  2I6M A;  3V0E A;  1P15 A;  1WCH A;  3QCL A;  4NX8 A;  1I57 A;  2QBP A;  4QUN A;  3QKP A;  3D1O A;  4S0G A;  4DGX A;  5K9W A;  3D44 A;  3ZV2 A;  2PQ5 A;  2QDM A;  1OHC A;  3M4U A;  2CMA A;  2I1Y A;  1YN9 A;  2HXP A;  4Y2E A;  1QXK A;  2J16 A;  4GFV A;  2B07 A;  3F99 A;  2HC1 A;  1C88 A;  5I6V A;  1PA1 A;  3D1H A;  3OMH A;  1U24 A;  5KA3 A;  4QAP A;  1ZCL A;  2H03 A;  3I7Z A;  3A5J A;  2HY3 A;  1YTS A;  3RGO A;  4GRZ A;  3V0J A;  3ZM1 A;  4ZRT A;  4IKC A;  1FQ1 A;  3O5X A;  3QCI A;  1BZJ A;  1YTN A;  3ZM2 A;  5IBM A;  3QCD A;  3MOZ A;  1I9S A;  1G4U S;  2QBQ A;  1V3A A;  5M43 A;  3BLU A;  2GJT A;  4D3P A;  1OEM X;  2JJD A;  5KAD A;  4ZI4 A;  5BUG A;  3MOW A;  1EEN A;  2FJN A;  4NND A;  1KAK A;  2G6Z A;  2CNH A;  1NWE A;  1GFY A;  2R0B A;  4GRY A;  2I6P A;  2HC2 A;  1ONZ A;  2F6Z A;  2PA5 A;  5KA7 A;  2ZN7 A;  1YTW A;  3D9C A;  1C84 A;  2DXP A;  1Q6J A;  2OUD A;  2H02 A;  1G1H A;  1ECV A;  3ZMQ A;  2VEW A;  4NWG A;  3V0F A;  3OLR A;  3ZMP A;  1I9T A;  1RPM A;  3U96 A;  1ZCK A;  3NME A;  1PXH A;  4RDD A;  3QCM A;  2B4U A;  4RI4 A;  2J17 A;  2NV5 A;  2HVL A;  1T4J A;  1OEO X;  5EHP A;  1C86 A;  3V0I A;  1NWL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...