2H06A

Crystal structure of human phosphoribosyl pyrophosphate synthetase 1
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
311
structure length
305
Chain Sequence
b'NIKIFSGSSHQDLSQKIADRLGLELGKVVTKKFSNQETCVEIGESVRGEDVYIVQSGCGEINDNLMELLIMINACKIASASRVTAVIPCFPYARQDKKDKSRAPISAKLVANMLSVAGADHIITMDLHASQIQGFFDIPVDNLYAEPAVLKWIRENISEWRNCTIVSPDAGGAKRVTSIADRLNVDFALIHKERDRMVLVGDVKDRVAILVDDMADTCGTICHAADKLLSAGATRVYAILTHGIFSGPAISRINNACFEAVVVTNTIPQEDKMKHCSKIQVIDISMILAEAIRRTHNGESVSYLF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ribose-phosphate pyrophosphokinase I
molecule tags Transferase
source organism Homo sapiens
publication title Crystal structure of human phosphoribosylpyrophosphate synthetase 1 reveals a novel allosteric site
pubmed doi rcsb
total genus 93
structure length 305
sequence length 311
chains with identical sequence B
ec nomenclature ec 2.7.6.1: Ribose-phosphate diphosphokinase.
pdb deposition date 2006-05-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13793 Pribosyltran_N N-terminal domain of ribose phosphate pyrophosphokinase
A PF14572 Pribosyl_synth Phosphoribosyl synthetase-associated domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2020 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2h06A01
3.40.50.2020 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2h06A02
1V9SA 3GEPA 1UPUA 1XTVA 1DKUA 1QK3A 1A96A 4TWBA 4RADA 3G6WA 1BD4A 1O57A 3LRTA 4JITA 4QRIA 4LZOA 2XBUA 4S2UA 1XTTA 1Z7GA 2DY0A 1A3CA 3QW4B 1YFZA 4LZAA 1FSGA 1G2PA 3EFHA 1XTUA 5IAOA 3DMPA 3H83A 5BSKA 4RHTA 2GEBA 1ZN9A 4P84A 3LPNA 1A95A 1ECGA 1U9YA 1ZN7A 1UFRA 4P80A 2HCRA 4KN6A 1XZ8A 3MJDA 1I14A 2VFAA 4P82A 1UPFA 1G9SA 4P83A 4LYGA 1CJBA 5E38A 1P17A 1ECFA 1BD3A 1QCCA 2FXVA 1XZNA 4X45A 1I5EA 1NULA 1VSTA 1ECBA 1P19A 3GGCA 1AO0A 4RHXA 2E55A 1QK4A 4P86A 4P81A 3M3HA 1DKRA 4FYMA 5JV5A 1OREA 1DBRA 3NAGA 1QB7A 1LH0A 4WN3A 2JBHA 4M0KA 4RACA 2JKYA 4ZFNA 4M0UA 2AEEA 1NONA 4LZNA 4LYYA 5KAPA 4QYIA 1A98A 2P1ZA 2PRYA 3OZGA 4X44A 1STOA 3GGJA 1IBSA 4RV4A 5JSQA 1W30A 3OZFA 2C4KA 4QYIB 3DAHA 1DQPA 5IPFA 4F8EA 1ZN8A 1P4AA 1MZVA 1JLSA 4MB6A 4RAQA 1D6NA 1TC2A 4JLSA 5BQOA 2PS1A 3S5JA 5ESXA 5ESWA 3HVUA 1VCHA 4IJQA 4RAOA 1OROA 1WD5A 2IGBA 1ECJA 1DQNA 1L1RA 1P18A 1QK5A 2JKZA 3ACBA 3O7MA 4PFQA 3OHPA 4RHYA 1O5OA 1U9ZA 5EUCA 2EHJA 2H07A 2WNSA 3ACDA 4OHCA 1HGXA 5KAMA 5BQPA 1HMPA 2PRZA 5HIAA 1G9TA 1L1QA 1VDMA 1I13A 1TC1A 1A4XA 2YZKA 1OPRA 3MBIA 4RQAA 1I0IA 4RABA 1QB8A 3DEZA 4PAWA 1J7JA 4RHUA 1PZMA 4M0PA 1I0LA 5HKLA 4P3KA 1A97A 2JI4A 4WMLA 1GPH1 1BZYA 3N2LA 4RQBA 5BRNA 1G2QA 1ECCA 4RANA 4Z1OA 2H06A 5K51A 1GRVA 1JLRA 1R3UA 2H08A 3ACCA 3KB8A 1QCDA 1Y0BA
chains in the Genus database with same CATH superfamily
1TUBB 4X7MA 3AIKA 2VXYA 3OQJA 5IKEA 5LWHA 2LE0A 3VVLA 3EZFA 1NLYA 2YQ4A 3MWLA 1T2AA 3G6WA 1VOTA 5H9VA 2WKRA 3INTA 3KG2A 3HDQA 3O75A 5GJVC 1URPA 3SEZA 1X0XA 4OIMA 3DL0A 4NBKA 1W6RA 4PNPA 4U1RA 4EHIA 3HR4A 3OA2A 4K46A 3DCJA 4QHSA 1JMKC 1CUBA 1ODFA 2Q4BA 4NZYA 4O4HF 5CX1B 2FWRA 4WLVA 3JCZA 1JJBA 1LU9A 2KW5A 3BG5A 5FWXA 5GP1A 3KOUA 5AXBA 1N36B 2AXEA 1L6IA 4K6FA 2WDPA 2RHGB 4G0WA 5I8ZA 1IQ0A 2DRIA 3I28A 3VTFA 3T5TA 1GU0A 3KR2A 3A2NA 2V8OA 2K7FA 3QPCA 1K92A 3ENKA 5E38A 2GA8A 1AH2A 3ZVLA 4D8YA 4TYNA 4IH1A 4HBGA 4WZZA 3K9BA 2Z8XA 4YQEA 5B6PA 5DWQA 5DIFA 4RCYA 4KVGA 4YONB 3SJZA 2FJPA 3BIJA 1EAMA 1JDBC 2Q4DA 1CZLA 3Q3CA 1AUOA 1GUZA 2BGMA 3MBKA 4JN6B 4RGBA 2YIJA 3ZOKA 1ZG3A 2QMYA 4R0MA 1X7YB 3E2PA 1IHPA 3HFGA 2EHDA 3CB4A 3DMHA 5LP6C 2JKYA 2WWGA 3OPMA 4Z8XA 3KXIA 4EMUA 2PE5A 3WTCA 4EQ6A 1LBEA 1BX3A 2C9CA 3B1FA 1LLFA 1MIOA 4WACA 3LCVB 4NPAA 1L5OA 1H3NA 1SXJC 3LVRE 5EESA 4C06A 4DV1B 4Q05A 2WOOA 2CHQA 1XTKA 1E62A 2X5NA 1AXEA 4Y9SA 1Q7GA 3V1UA 4EABA 5JCXA 1AGYA 5K20A 3DBRB 5CPFA 3TFOA 5IJ0A 3NBZC 1WVIA 4QVGA 3ORRA 3J81k 1NVKA 2I1LA 4MUFA 2WW8A 2ZIEA 1R8YA 2WY2D 4JD5A 3BRSA 4WJZA 4W7IA 3O03A 5IS2A 2WJYA 2AS0A 5KYYB 1ZD1A 5D2CA 1OTHA 2H2WA 2GJKA 3EYAA 3WNZA 4TQ9A 3GIWA 5CDHA 4QOFA 1U2QA 5JE8A 2I54A 3BCSA 4RPHA 2LIPA 5CFMA 2FSUA 1X7ZB 3OQIB 3DKRA 2NYVA 5GZ3A 1PX2A 1ELOA 1X92A 4MW6A 1IZ8A 1E5DA 1GQOA 1RE0A 2WU8A 2FLKA 5LFAA 2M98A 3DD5A 4NL4H 3AK4A 4OP2A 1OMOA 1YQEA 4IYRA 4D4GA 1NI5A 1ZK4A 3MD0A 3NOVA 4BX3A 2XB6A 2XTZA 3TR0A 5HE9A 2PH1A 2E5LB 3KWFA 1L4HA 3AP1A 1OSNA 1UMDB 3GNSA 2H29A 3Q7TA 4PIVA 2BFCB 3N5CA 3I8OA 1C4WA 4RGVA 4DA7A 1EUQA 4NPHA 2HTFA 5TVGA 2Q2VA 3VDXA 2Q6LA 3PGA1 4KXVA 3VC7A 1MG5A 2FLVA 4DRXB 3N2ZB 4E2ZA 4B80A 3PFBA 1UJNA 2RGCA 2X86A 3KZNA 1F0NA 2RKWA 3KNZA 1M6NA 4LOLA 3ST7A 1PLJA 2AXNA 2ZBRA 3R20A 4IIYA 3S6JA 4UEKA 4ARSA 4K03A 2DFNA 1UPCA 3CUUA 4YRPA 2I5PO 4JEIA 4QFCA 5DH9A 5FYDA 3N0RA 3C2QA 4TT8A 2REQA 3UMSA 3RG2A 2PFGA 5ECWA 4LHZA 4M55A 4YUVA 5SICE 4MS4A 1Y89A 3DEYX 1PJ3A 2HK6A 1SCNE 3UWOA 4BQEA 2ZDQA 3VHXA 8MHTA 3K4PA 4K9MA 1KEZA 1IJKA 1D8AA 5CXUA 5TNXA 1UJ6A 4FT2A 1EVLA 2GH1A 4CBVA 3IKLA 4I9NA 1GZ6A 3O94A 4XGIA 1H2HA 1T2NA 5LCXA 1M2KA 2QTZA 4LXUA 3FYUC 1AUPA 4G0PA 4TMZA 1MRZA 3L18A 4I4TB 4L9AA 4KXUA 3ORSA 3KTAB 5K6TA 4YT5A 5DBEX 1NBMA 2QTWB 5ES4B 1SOUA 1HDZA 3A4YA 3LBFA 4IWNA 3TK1A 3TR6A 4U39A 4C30A 3TLJA 3D6FA 3NUZA 1ATZA 1RKBA 1GILA 4FT4A 2ZRGA 3Q4GA 1MEOA 1LNQA 4TRJA 4FR0A 4AZTA 2PFSA 4DABA 1N34B 2ZYIA 2IT1A 4C78A 3PI6A 4Q82A 1VA5A 4AG6A 1V4NA 4AAYA 2PYZA 3INNA 2R6CA 5C51B 2RHLA 3ZG6A 1XJWA 4KO1S 1FFDA 1N5MA 3I2JA 4PANA 2N9UA 3KCNA 1ONNA 3SYMA 4F06A 1KU0A 3ETEA 3LGAA 3CUYA 3PXAA 5AK0A 1U81A 3A1WA 3TI7A 4QDXA 5A4IS 1UBFA 2H7XA 3EXIA 3T34A 3GF4A 4F4FA 1YQGA 3B48A 4IUDS 3D3EA 3GFRA 1C8KA 1NX6A 2YJNA 4JKIA 2XZLA 1QAQA 2ZBEA 3MYYA 1F8FA 2RK4A 4BDSA 5K0NA 4QGSA 3U9TA 2O0KA 2GCGA 1JHUA 1HT0A 3RSLA 4PBSA 3EXG2 3SC2A 1WEHA 1ESCA 5BY2A 5HZMA 4OJTA 3WQHA 1M66A 1NP7A 3HVUA 1U3FA 3ZHXA 4EHAA 3LK6A 1S2MA 2H1FA 5DMXA 2XQKA 5D7NA 5CNMA 3EDRA 2OPHA 3HCPA 3HCWA 1AIPA 4XD2A 3ROEA 2A1IA 3ISVA 3QH4A 2XV1A 3B7GA 1J97A 4HN2A 4ND6A 5LXTF 3RYTC 4CG2A 5CDGA 2HHHB 1YQQA 3KHKA 5KVAA 3DFZA 3AF1A 4ACAA 1KEWA 1ZM7A 4B5LA 3WADA 2HJSA 4RS3A 2YWFA 4KWCA 3H3FA 2WVJA 3SF8B 1SQFA 3H42B 4CM8A 1HLFA 3GLIE 4K6MA 2IW3A 1KEEA 3LLUA 3MMXA 3U3KA 3LYAA 4TZ0A 2PN1A 4WNAA 3TI9A 3QXSA 2X8JB 4I5IA 4TTQA 4LXYA 1J1ZA 4C3VA 2VDQB 4AMVA 2BGRA 2ZR9A 2WK1A 3F6RA 2G67A 4PXAA 4CF7A 3ZDCA 3MB8A 1TW3A 4RSMA 2RCNA 4NCNA 5HKOA 5ELXA 2E7ZA 1EE9A 2P40A 2WT8A 4M76B 3RC9A 3SYLA 3RU9A 2AG8A 2C8VA 4JL6A 5A0TA 3VR6D 4RX1A 2NU9A 4PVDA 1P5JA 3EVNA 2WC1A 3MINB 3RWBA 3UJ3X 4ENVA 3ZWWA 3HXMA 4PO1A 3GP3A 3IT1A 2IZOA 2UVPA 6ADHA 4U2DA 3U5TA 3P2KA 1XTTA 2HA6A 1R6BX 1H2WA 1NLZA 2XCLA 2ZJZA 3U3MA 4NCJA 4S04A 2JJ8A 1YL6A 1PR0A 2FN7A 2NACA 3G9TA 3WB9A 1SQ0A 1WOMA 2HA0A 4DBLE 2I3BA 1GUFA 4NYMQ 4CQNA 2GCEA 2QG4A 1J06A 3U26A 2DWCA 5DK6A 1BKYA 4C04A 2EEPA 2V5UA 3ZIDA 4I55B 2P91A 1WCIA 2I2AA 4UMFA 3WQSB 5L6LB 2WVGA 4C0SA 3PJEA 1YRQA 4N5MA 4C14A 3Q9LA 3CLUC 1TJ3A 3GQBB 3B8HA 3D0RA 1BW9B 2YV5A 1YR6A 1EB9A 2FR0A 3K9WA 4ZI7F 5DK4A 3GY0A 2I2FA 521PA 1Z0JA 3HKEB 3PPVA 5C34B 4S12A 2G83A 4RKWA 5CTAA 4ZI3A 2D62A 1YONA 2WUEA 2BR4A 2QENA 2Y0CA 4MR8A 5EHNA 2A33A 4CIWA 2WTEA 3NP7A 5LQRA 4Z4GA 4BE9A 5AM4A 3HDGA 4B7CA 2FRDC 2JVIA 1P0FA 8ATCA 3HK2A 1Q14A 2QTTA 2WV7A 2A2ZA 5TB5A 4FYYA 4J0GA 1D0IA 3NAMA 2GMWA 5B30A 4MPRA 1FDSA 2BFDB 1XBTA 4ZKEA 1QO0A 3U3ZA 2REOA 4QTTB 4XD7A 1ZK3A 2BT4A 4OLJA 3GWGA 1FTYA 3HEBA 4G63A 1P75A 5DHPA 4QG7A 4RMJA 1ZA2A 3T4UA 3GRUA 1S01A 3TIFA 2AL7A 2AW5A 2BHRA 3OX1A 1NI4A 3AB7A 1HR0B 1DQNA 1MORA 3NVAA 2QW8A 3HEAA 3F49S 3QFFA 1OXKB 1KYIA 3EARA 2BMVA 4XXHA 4YWJA 7REQA 2PO7A 3OF5A 4PG5A 1Y3AA 2ZRIA 1VJTA 1PX0A 4B6JA 1OASA 4DDWA 1EIZA 3GJSA 1GM5A 1AX9A 2FZWA 2CE7A 3ITEA 5KSPA 4XQGA 1THZA 5HIAA 1LLCA 1JJ7A 4DMRA 3PFCA 3VZQA 3K9FC 3WICA 3FI9A 1B6RA 4Y1RB 3WLNA 1ZJYA 4IUCS 2GD0A 4IZHA 5JS6A 1UBTS 3SS8A 3QX9A 2Y3IA 3VDNB 3O9ZA 2C2YA 1HA3A 3I6YA 3QU4A 1QHGA 1DRJA 4L9WA 3BWVA 2ETXA 4R2KA 3TLMA 3UG6A 4B6SA 1FS6A 2X6TA 1REQA 3FY4A 1A97A 1KQ3A 1W48A 1N1EA 2FEXA 3T06B 2OHXA 1SXQA 3V8VA 2P6PA 3UA4A 1M1NB 3P9PA 3MC1A 4MVYA 5IVPA 5F76A 3D8SA 2BFBA 5KC9A 4ROSA 1ZICA 3D5EA 2VDWA 4EB6A 3ACCA 4O25A 4IDGA 2YCBA 4TROA 4ESOA 1U0BB 5CVJA 1ISHA 1I3MA 2H1IA 1GQFA 4ZQFA 2FEMA 4TLMB 1ZX1A 1PEAA 4AZ3A 5I01A 1FBTA 3NKLA 4K3UA 1P5HA 3LPAA 4GMXA 4UCFA 5KWSA 3MUOA 4TM8A 4RTPA 3EX7C 2C20A 4MICA 1YRBA 4V39A 3P45A 4H15A 3L4BC 1RVDA 5HZGA 5GIPE 5JG7A 1A3CA 1JHAA 2YMPA 4XEHA 1JYSA 3AZOA 3I53A 3A0RB 2G76A 4CL2A 1KAGA 1XTUA 3IAAA 3QE0A 1MJGA 4ITUA 1M6YA 2ISSD 1XA0A 1THMA 3FIUA 3X1KA 5AVTA 3N8HA 1T13A 4RETA 1ZD3A 1K08A 5BNWA 1ZI9A 2JHFA 3IUMA 3NHYA 5LP6A 2ZJOA 3ZE0B 3S1SA 1X38A 1L8AA 2FZVA 2HRBA 3FG9A 3PCTA 5TS2A 2NUAB 2EF0A 1C0EA 2VJOA 3S70A 4O2AA 2R4UA 1P1HA 2P3QA 4D8VA 1X7HA 1UDWA 1XZNA 4N5HX 4Q9NA 3W6OA 4DCGA 4YT4A 2BFBB 3OZEA 3K70D 1U5BA 4X7PA 2ZANA 1UBOS 5JS8A 1XQ6A 1VSQA 1N2CA 4XEUA 4EH1A 1KDPA 1RAIA 1U3VA 2F17A 4AMYA 5DYWA 1BMDA 1S7CA 2WSLA 1H94A 2CJYA 3AILA 3BTSA 4G25A 3TKYA 3VR6A 3K9GA 4ZCPA 1QB7A 2D2XA 1QIGA 2V96A 2NVUB 1DFGA 2R62A 3RFCA 1DCKA 5AKZA 4BNLA 2B5WA 4MVJI 4OJYA 3H1TA 2QEQA 4QTUB 4XSHA 2H4JA 5CVCA 5HJ7A 3EPKA 4INZA 4HGQA 4LZJA 3OQHA 2VJLA 1TADA 3LGSA 1XNGA 1HRDA 1W30A 3T94A 3TUZC 1PVDA 1Z2PX 2Y93A 2JFVA 3HLKA 1Y4DE 1YOBA 3I4CA 1CUSA 3VI4B 1EXNA 2QR5A 4OMFG 2GEJA 5JEDA 3TL2A 3KEGA 2B92A 2XYRA 1LFDB 3H13A 1I7SB 2OV3A 4JJIA 2YHIA 5HFJA 4DR4B 5FOSA 3U3XA 5KCZA 1ACJA 2W4QA 4CMJA 2LVBA 3E3NA 4OK5A 2IELA 1N9GB 1TF2A 3LW8A 4JXZA 2XZOA 1V7CA 3R4CA 1ISGA 4K9DA 2UZ0A 3OOJA 5EYPB 3LQ2A 3V7NA 2AZMA 3LT2A 3C98A 3OJOA 4I1VA 4AS3A 1E3WA 5EJ7A 4KJXA 1L5KA 2WKSA 2VJAA 1DKOA 3THYA 3MMZA 1HEUA 5LU8A 3GLGA 1DMRA 2I7CA 1FF9A 3ONNA 4WOBA 1Z0IA 3R7NA 5HS6A 1Q92A 4Q66C 3MWKA 3NTUA 2H1OA 4EGAA 1TLTA 3NJ4A 3QVVA 2XB2A 3EEBA 4ZCMA 5IBRA 3VR2A 3ZD9A 4EG4A 2GCIA 3H2IA 4C5CA 3RS5A 5EY5B 5K6AA 2OXIA 3SC4A 1UPBA 4DV3B 1YQTA 3VI3B 4CMAA 3RYFB 3GT3A 5F3RA 2Y1OA 3H2BA 4YJFB 5JZMA 3RVRA 1JEOA 2QTGA 4M53A 3GRAA 3TSWA 4AD8A 2OCDA 2DVMA 3BB4A 3L8YA 4WN9A 4LGCA 2WV9A 3NZEA 4HI0E 3OIGA 3QP9A 4P9NA 3CN7A 2YVLA 3SM3A 3GMDA 5F2NA 3VVMA 2WSSA 1U0NA 4MTCA 4IDEA 3FYUA 1Q57A 1I33A 2E2WA 2VPTA 4GI3A 1QIDA 4GYJA 4HDSA 4G5FA 4UDYX 5FTMA 1G7RA 3WBJA 4P0PB 3ZJUA 3JARA 3ZHYA 4IO0A 4PRZA 3R3JA 3LK7A 3WOHA 2F3UA 5FKJA 3U62A 1OLUB 2XBLA 4D44A 1QU2A 1DIAA 5BSMA 5K0CA 3SHVA 3AEKB 3WXMA 4H6WA 5BW6B 3EFHA 4WKBA 1BE8A 2HIGA 2JK1A 4OXNA 4KRFA 3HN6A 4LK2A 3NUQA 4LV5B 2F3RA 3OAAA 2CY0A 1Y8ZA 1FOEB 4UXJA 1PJBA 1PNRA 1J2UA 2DCUA 2I55A 3CF2A 3K6SA 2J3MA 2C7PA 3L6RA 5LZ7A 4RD6A 4N1AA 5KX5F 2BM0A 4H18A 1I2AA 1U4NA 5TV2A 3TEFA 2HPVA 3ZBQA 4EYKA 2C2HA 3T52A 5F5NA 4YUYA 5FJJA 2YICA 3O1LA 1MMFB 3KB2A 3L0OA 5LWQA 4YJGA 4XTCS 4E7OA 3EZYA 3TOSA 5LZ9A 2XXBA 3E81A 4B8WA 3HZZA 3P0HA 3PC3A 3JATB 4P86A 4QT0A 4FYPA 4Y2JA 2Q50A 5AQ1A 1E2HA 1RI3A 4YY3B 1TKCA 1Y3DE 3A1VA 1JSCA 2OHVA 4L8FA 3OQVA 4UXIA 4W5OA 3KD2A 4RTMA 3BT7A 5BMVA 3TSAA 5AT1A 1WZIA 5ALWA 1E2MA 3OPNA 1Q7BA 1WHTB 2WSIA 3H2KA 3LS2A 1V11B 1WDMA 2EKQA 4ZP1A 4Z9YA 4WV3A 3GJZA 4J6FA 4ZOAA 2JFGA 1TFRA 4GZMA 3R0JA 3HZHA 5GOTA 3RVMA 4J0HA 3A8TA 3R6LA 4IIUA 4D8XA 4QELA 4HF7A 3I61A 3EQ2A 3VZBA 3ZCXA 3OEYA 1HKUA 4A5OA 3EZXA 2IOFK 4INJA 4EZBA 5HP4A 1TK9A 2B5VA 2YV2A 4LEIA 1YTUA 5JXJA 4NBSA 4LFAB 1G0NA 3BD8A 3MMSA 4MP3A 3W3AA 1M2HA 2C59A 1FQOA 3KQUA 1HO3A 4CTOA 4EKGA 1C3VA 3WLSA 3WZLA 3HKCB 1DWOA 1JKMA 1L5RA 3IPLA 4JBGA 1BDBA 4DJTA 1PGQA 1QZ3A 3AM5A 4O3FA 1ILWA 1HDIA 4WGFA 1N0UA 5JPCA 2WIFA 4PBRA 4RXUA 4DYHA 5JD5A 3RAGA 2PX2A 1EX7A 1U4SA 4KVFA 4OBXA 3RTBA 1M3SA 1BCRA 3U4HA 1R16A 5JAOA 1AK9A 1HE1C 4BLQA 1BU5A 4TMKA 1FJGB 1G3QA 2G77B 3OZUA 2ZYTX 4UHKA 4UOEA 1VG8A 3M9XA 4RD4A 2IDMA 5L40A 1G98A 3VHRA 2GARA 4XQEA 1Q12A 3STWA 2XJ9A 3NNNA 4Q7LA 1PQ4A 1WMEA 2ZE8A 3C7AA 4QBGB 1N77A 1XZJA 1XQWA 1L4EA 4N3BA 4PAGA 3MSXA 5K4GA 4QQFA 5JCZA 2ZI7A 3E84A 2WWXA 5JJ5A 4FN5A 4U2BA 2PBLA 1G8YA 1NUSA 1GN8A 5KU1A 3ZLJA 1EK1A 4G0XA 4KXMA 4MV6A 3SVTA 4NNJA 4UPVA 2JGEA 2IC5A 2RH5A 2G5TA 4U7DA 5A7GA 1U2GA 4PTZA 4GMHA 3L6OO 2V7XA 4EJSA 2O50A 3KSAC 2ZKIA 3PXDA 2H08A 3T3GA 4AYXA 1H69A 2Q2OA 2XE7A 5IYZA 1BCSA 4RJTA 5K8TA 3A6HA 1N6KA 4GECA 2F1JA 1SU8A 2A59A 3EHDA 4TMTA 1FP6A 2ZUWA 4HLUC 3MLBA 3OZTA 2VHYA 1X8KA 2H85A 1WJGA 1SXIA 4I1RA 4I5GA 3RRFA 5JBIA 4CDNA 2FR8A 1SIBE 1Z82A 4YUAA 1QYRA 4D9GA 3WK5A 4R98A 2VPPA 1GL9B 5HIIA 3K96A 3W5SA 5BW8A 2B1IA 2WTNA 3P0FA 1GFIA 5CEFA 3WWZA 2GDJA 3COWA 2P30A 2J0VA 2ZXFA 3QNWA 1SXJA 3MS4A 4MA4A 4NYMR 3ZU3A 2UXCB 2OGZA 2WSBA 1SC6A 3RIYA 1JU4A 2X3UA 4OHFA 2J85A 2YZMA 2PMCA 4JQZA 1Y5NA 4LRXA 5B3JA 5IDVA 2ECQA 4GKAA 3ANTA 5AUOB 5JOQA 5ALHA 5LOVF 3BJEA 5CDUA 3ABIA 3F46A 1S7GA 1Z38A 3BERA 2NM0A 2CUNA 1E8NA 1SPBS 2E55A 5IM5A 3U09A 2P5YA 3OCXA 4HWOA 5EZ6B 2V9CA 1LCIA 2V9PA 1LW6E 4WXRA 5EJGA 4FGWA 4BFCA 5K3OA 4IX1A 5BMOA 4R1QA 2ZRBA 3BXOA 3DWEX 1QKKA 5CNIA 3TTSA 3L7OA 5HEKA 1T6XA 2UYHA 3D6MA 1GYRA 4G5OA 2JJ2D 3RYHB 4BGVA 1XQXA 2ZIVB 4HMPA 4AKSA 4EVRA 4XPZA 2Z08A 2UZAA 3UMFA 1WOYA 2FWNA 2QN1A 1XRLA 2H7VA 2ZKLA 2YC2C 5DOZA 1KP3A 3CO0S 1SZCA 1F17A 1G8AA 1Q3KA 1FEZA 4HXFB 3TLBA 2LDBA 4F56A 2OAP1 4BWFB 3DT9A 1T5SA 4WK2B 1YS9A 3S2UA 4JJ4A 1LI7A 4UMEA 1BS2A 1CY7A 1K7SN 2MJLA 3UTDA 1VHQA 4FGUA 5EJMA 1GAEO 2JAPA 2H7YA 4JLVA 4AUMA 3RH0A 1SHUX 1JQAA 3VGJA 3CKLA 3FOAA 4N40A 2EJCA 2OV6A 3KJIA 1G21A 2CUKA 4BBZA 2EHJA 5EZQA 4YAUA 5K05A 1XGKA 2WNSA 2IITA 1BKSB 4MGZR 4TRNA 3QPAA 2Z9DA 4OQLA 3UMVA 3QVMA 3GFGA 3NEAA 4EBBA 2NX2A 3OP1A 4HYEA 4XM1A 3RC8A 3AEKA 1G5IA 3L43A 4KWIA 1AM4D 1Z5VA 2Y1CA 3FW1A 2DUWA 3R7DA 2O8CA 3DP9A 3E5MA 5CMLA 3GIDA 5K0GA 1HETA 1KGDA 3FJYA 1ISSA 1BS9A 4I8IA 3DDWA 7YASA 3HH8A 3DOCA 3MJ4A 3VR3D 1G0OA 2F7SA 1SCJA 5REQA 3KRTA 1E32A 5BN4B 3L46A 4OKIA 1UBRS 5CG2A 1D2NA 1GPMA 1D2MA 3EIQA 3Q9SA 3W8DA 3OIDA 4FWTA 3GYBA 4L74A 1FSSA 1T5TA 3IESA 4XVHA 4C2AA 4CLDA 1XZBA 3ETNA 2BEJA 2NXEA 2W8BA 5IK2A 5AVWA 4WCFB 3I6BA 5E3HA 1ZEMA 2ZI9A 3QPBA 4C20A 3CN9A 3CSSA 1OX6A 2TYSB 2HU8A 3ASZA 4JGIA 4IIFA 2I3DA 4NS1A 5JAZA 5EKDA 1LSSA 4W5RA 2WJPA 1THTA 5JCJD 4U6QA 1QP0A 5CG1A 4H16A 3PGJA 2V6GA 2DG2A 4R2JA 2F8LA 2M6RA 4D96A 4EW2A 5AESA 3LPNA 2C7BA 3B3AA 3AF4A 3C8HA 3RFUA 4EW3A 1E2EA 2Q1YA 4EB8A 1GGJA 3BDAA 1T1SA 1L3CA 5HDQA 4KDCA 4YMGA 2W11A 5EYPA 4BMPB 4RA6B 3DOHA 2JLUA 1Z15A 3KOWA 4QGHA 4R2HA 4GZ6A 4MV3A 3WYGA 5A0VA 3BHMA 1W5EA 4IQFA 5LYJB 1Y6QA 3RK0A 1M6HA 1X15A 4HOYA 3BXHA 1C4KA 1VZ2A 2R7AA 1RCFA 2E48A 4TXMA 4XFDA 1WRBA 2YJ5A 3RHTA 2RHRA 4FX5A 5BVHA 3C45A 4QUDA 3HO6A 1E7YA 3WHIA 2IBSA 1RJFA 3HM2A 3NAGA 2GF9A 4WXPA 3UW3A 3VU9A 5ALVA 2G17A 4Q3NA 3O38A 1YNSA 4E94A 1B8PA 1WZEA 3TD2A 3Q1KA 4FCTA 3H0CA 4I50F 1O58A 4O29A 1G3IA 2UZ3A 3G2KA 1HXHA 3I9JA 4TV8B 2QVGA 3B6EA 2ZYWX 4NSNA 5EZYF 1JSZA 1UT6A 2WG1A 3TS1A 2QMQA 1R6AA 3OQOA 4NAHA 1UWLA 1JA9A 2QBYB 1P3JA 1TCAA 1X7XB 3BGIA 2A1UB 4E2YA 4FLFA 1S3IA 1XEXB 4C0XA 1UMDA 2YMLA 4L8VA 2C2KA 2ZRHA 2QTNA 4MQFB 1UP4A 2EG9A 3E35A 3H2SA 3KFVA 4R8MA 1P39A 4NKRA 2JBWA 4M38A 3T3EA 3OJ0A 1XROA 3W90A 3IP1A 2AG0A 1F48A 2JJMA 2ZCUA 2ZTHA 5B3AA 4CIBA 3VPBA 2PUJA 2PKWA 3NYRA 3GLTA 4A0FA 1L7RA 3B9RA 1ZD9A 5KPJA 1SKYB 1TJPB 2L42A 4QNMA 3WB2A 4E31A 1IBMB 1LRLA 4P7GA 1X9IA 2BMFA 4BC0A 5KO2A 4J7CA 3HSKA 4DXAA 4FHZA 1JQBA 2CXXA 4F85A 2I4IA 2H07A 2WZQA 2R48A 1NGSA 4CMKA 3RV3A 1Q83A 3BH6A 1TOAA 1F5NA 3UNXA 1G19A 4XX0A 4X7RA 3T5GA 5IF3A 4ARZB 3PHIA 3D3KA 3ZHVA 3KDAA 5G0UA 3ZCSA 4O3MA 1KQGA 2G72A 3T7JA 3PNBA 2QN9A 1T5OA 4F5DA 3H8JA 2Y4OA 1ONPA 3KALA 5FYQA 2FU5C 4PLVA 2Y27A 4JSRA 4G5SA 1Q91A 4P8RA 4PSUA 5IJ0B 2O8NA 2WPNA 1AQIA 2WD7A 3P71T 5ADVA 2RJ3A 2EP8A 4KKXB 1W0JD 3C4QA 5F52A 4Q4CA 1YJXA 1Y1QA 4CV1A 4DSNA 5E3JA 4PC1A 4QDTA 1GLNA 5B2EA 1ECCA 5B7GA 5GY7A 2QZZA 3DNMA 4Y2RA 4GYKA 2J0QA 5H3HA 4FQ7A 2ZVPX 1GO2A 4NK5A 2W43A 5JH7A 4OQZA 1GITA 1B16A 3QNUA 4EA7A 4G36A 1G8JA 2XMGA 3F6PA 3GEPA 1K7CA 1DKUA 3OIUA 5HJ2A 3TTTA 4RSRA 3KPYA 1JIKA 2IH2A 1T5IA 1UFVA 5BSHA 5EPOA 3C6ZA 5IC4A 2NQ2C 2CYCA 2BEVB 2FUKA 3JYNA 2P3SA 5H4HA 2DFDA 3GLUA 3NIDB 3SJBA 3T9AA 1V2GA 2HD4A 2CVFA 2NG1A 1P8JA 1KU6A 4WNIA 5SY6A 2D4HA 4C0LA 3ZDRA 4YXFA 2AW3A 4N76A 4R05A 4W5WA 4DNOA 4PAQA 4KH1A 1PL0A 3B70A 3T4EA 3ZV4A 1NBMD 5ALOA 3PXBA 3RSQA 1D1QA 2GXAA 2XDQA 1TLFA 1X7GA 3EWIA 2ZRCA 3T3HA 2XPCA 2JLBA 2C82A 2X0EA 1KIMA 5C31A 4YRDA 5L3RA 1YA8A 3B3FA 3MSCA 4HH3C 4I7EA 1H0RA 1LI5A 4DMCA 4TZTA 5FBQB 1A76A 1IOLA 4Z7OB 1KNXA 3NVDA 5JAMA 1X2EA 3RC3A 4GPD1 1I5OA 1TO1E 1Y1KE 2XYVA 3H6KA 3RDPA 3VRHA 3GI1A 4UNNA 5KTKA 2OT3B 3AEQB 3F74A 3JQ8B 3OD1A 3B89A 4IO1A 3WNQA 4OSOA 1VTKA 3F6SA 4H7IA 3D59A 4HQLA 1KDVA 3RRMA 2BEVA 1UP6A 4B44A 4KQJA 2AC7A 2GPBA 4Y8VA 3ZN2A 1P4GA 4BMZA 3BA6A 1ST2A 2J9GA 1JQLB 4XPIB 5ICCA 2I34A 1GGFA 3PJRA 3JR7A 1EJ6A 2N42A 2DFKB 4KAXA 5IC6A 3OLYA 2Z5VA 1C29B 1RRKA 3HVKA 5E6SB 3ZEIA 5MGBA 1C1DB 4OSEA 4GXNA 3Q3GE 1DLIA 1G20E 3KR9A 3T7CA 3C85A 3U1VA 1QPBA 4O4JB 1DXYA 2AQ8A 3DB2A 4PZAA 5I8WA 1E2BA 2A5LA 3LDAA 1T1EA 1O03A 2ID7A 4LRYA 1K66A 2QTRA 2GZRA 4BB9A 3LOUA 2P2GA 3GCDA 2RI6A 3I04A 2F9MA 3R0QA 2DPGA 5AOBA 1T8UA 1D2HA 1E9BA 1T9CA 2GLTA 3EDCA 5JXIA 5C8VA 2FPMA 2PGXA 2I67A 1FFAA 1TO2E 3DYVA 3S2IA 4D3SA 2VK4A 4WFIA 1M7BA 2PGAA 1L5QA 1P62B 4XKJA 4YMSA 4D3DA 3OTOB 3P52A 3GDWA 3VPFA 1RWVA 3IPRA 4XVUA 2HLDA 1JR2A 1E7RA 2QJRA 1NAHA 1JHDA 2DLDA 4NBVA 1FK8A 5CA0B 1FXWA 2ZE5A 2ANBA 4WCFC 2ATEA 5BUZA 4FYKA 3W2FA 5FOVA 3QUCA 4LF6B 5DRTA 3FPHA 4KMRA 1SKAA 2ZZMA 4Q7MB 1QAMA 1E18A 5AMXA 1P7VA 3ONEA 1SOMA 2COKA 1NYQA 2HBZA 4WCDA 1JEYB 2V0CA 2O2IA 4HUQA 1R10A 3HB1A 1V2HE 1UODA 1ZRSA 3U7JA 4YEDA 3VU1A 3E7FA 4Q4AA 1HDEA 1QRUA 4G4JA 1FFCA 2Q27A 1YJ5A 3KJFA 1DRVA 3H84A 3TMYA 4BGEA 3EQZA 4YRSA 3DLTA 5DCUA 3WGMA 5IUNC 1B3BA 2B3TA 3H4TA 4FGZA 1KXJA 1LKZA 4GOMD 1CJVC 1OVGA 2K7ZA 3JAKA 3PC6A 5L4LA 4JR2A 2XLBA 4K1XA 1F9AA 2YMMA 4QZVA 5IT5A 5LXTA 1LJUA 4MGHA 5HKAA 2JJ1D 4FYXA 4NU8X 1O9GA 4C0QC 4OHBA 1SCUB 4OHKA 2CC2A 2QRZA 1BD4A 2XNCA 4BJ1A 2HWXA 2LDXA 3JYOA 1YQXA 2VWQA 3ZQ4A 4F1JA 1HNZB 4JI7B 1HE8B 1PT8A 4FILA 1MFPA 3WLHA 2HSWA 1WABA 2Y66A 3WGHA 1G6OA 3GLIB 2RGAA 1ZNXA 3FB1A 3N6VA 1I6LA 1LA2A 1D04A 3UHPA 1I2ZA 4BEVA 4BIMA 1XCLA 1JX6A 2GPAA 2PVSA 1WDLA 4MR9A 1OXTA 1U4OA 2GPTA 2XUQA 2O7NA 3DYIA 3HGMA 3KVOA 4HDCA 1WS6A 1Z8DA 5IBQA 3SG0A 2OFXA 1ECLA 2DQSA 1XMSA 3F67A 4NYIR 4X6LA 1KRHA 1JG2A 4OTZA 4BAUA 1MABA 2CFCA 4QU9A 2QD5A 3KM0A 3RT7A 1EVZA 4ND1A 4R1LA 4BO0A 4B40A 3SJCA 5SZHB 1KDYA 1GCIA 2AR9A 1M2NA 1SVIA 1QLJA 2JF0A 2VAXA 3FCSB 4GMKA 1ZCFA 4P4SB 1TQHA 2UKDA 2ONCA 4B3JA 3FPCA 3THYB 4NWIA 5DF1A 4NHEA 2VJMB 3TUIC 5CFLA 4C4SA 2EATA 1KJWA 2OILA 2XA2A 2RONA 1LSJA 3N7TA 1TTQB 1ZSVA 5IULC 2ZUEA 1EGQA 3M2TA 1WXWA 5TC4A 4DWWA 3THWA 3DWIA 4MUXA 2JLRA 3WLAA 4ASUA 4FDLA 1QHYA 8ABPA 1GZ4A 5KAPA 4EG1A 3PQ2A 2CBZA 2AK2A 4V1CB 3NJ8A 1UXKA 3Q7RA 3MWEA 4RHEA 3H2HA 5GGXA 3U37A 3HYNA 3ZBPA 2VCYA 1I36A 3QFRA 4O4HA 2Q28A 3LVFO 4GG1A 1CG6A 2FMHA 4GPEA 3AEUA 1O3YA 2GN0A 3B6IA 3I3SR 4KUGA 1JW9B 3N28A 4M1YA 1DQPA 3VV2A 5JWRA 4D97A 3ABZA 3ZW9A 2QORA 3MIIA 5F5XA 1MN6A 5EOVA 5E7JA 1KHHA 4ZEOA 4HT3B 3FKQA 4GXQA 4KNVA 4MMZB 3VO1A 4DRZA 4DUGA 1OWLA 5KNDA 3OLVA 1PR9A 2QRNA 3CWCA 3EA0A 1NMXA 4A8JB 2D8AA 3CMCO 3N2KA 1I7PA 3P9RA 4PZPA 5KJFA 4X6XA 3WSWA 5LQNA 1L0BA 2G5CA 1YQWA 2PKXA 3CG4A 3A3NA 4C3OB 4WBNA 2QRVA 2WM8A 2AKAB 1VPEA 2D1TA 4Z9XA 2FW9A 3QVJA 4MWOA 4IIXA 1OLXA 4ZVUA 1P31A 5ALQA 2X9GA 3CZPA 1BSVA 3EDOA 2GJ9A 3WLTA 2DKNA 4JROA 1SUFA 5TPWB 1G21B 1QGZA 2W2VA 1ZM4A 3L82B 4NK4A 2RHWA 5CB4B 1NJ5A 3D3NA 2O48X 1I4DD 2G7ZA 2R751 3OU6A 4LYJA 4NBRA 5J5AA 4KMSA 4CR7A 3HR7A 4UARA 2I80A 3SSMA 4KPUB 4C76A 2DWUA 1DO2A 1JA1A 2VSYA 5FWAA 1R6UA 3NTXA 3G49A 1JJAA 3L7YA 3E7DA 1QG6A 5HCIA 3VZCA 1QIIA 4EG6A 2DYKA 5C2JB 3LY5A 1AG9A 1JPNA 1UANA 4D0SA 3CTPA 3WE7A 3GELA 3K4QA 4YLGA 1LTQA 4H3VA 4DIUA 4YV1A 4C2UA 3M1YA 5FOTA 4ML3A 2XGSA 4GO1A 4JXJA 5AW4A 1H4SA 1K5PA 2O3UA 1QCCA 1Y4UA 2TS1A 4QHYA 4C7MA 2MR6A 1QK3A 3L01A 4WN9B 3CUVA 3KT6A 4I2NA 1RYZA 3CURA 4C5AA 3RVNA 4JT9A 2NQ8A 1L7NA 4BV2A 4DQXA 4WZAE 1A9XB 4HPWA 2B8WA 2XF8A 3TX2A 1Y5MA 1YRAA 2K2QB 4DQ0A 4HQOA 4MVCA 4JQSA 2ZIZA 3PRYA 1L5MA 3AUSA 3O1IC 3WNVA 4B6EA 4L2IB 4F4HA 4ZT3A 3EQ9A 3P19A 4YRZA 4ZHSA 2O19A 2P0AA 4BFUA 3R3YA 5DT2A 4M1MA 2KLBA 2F8TA 3BK7A 2WD9A 4INPA 1TJ4A 4N4AA 4BX9A 4IHQA 2JGFA 3QX3A 5DXJA 3O74A 2B69A 2R8RA 3A4LA 4UKDA 3IBGA 3HXPA 3QU9A 1I1HA 1TKBA 5KVQA 2AYYA 2FZEA 2G9VA 5ARDA 2HYIC 1XP8A 3F98A 3CONA 1RJGA 4QOSA 2QJTA 3Q7EA 2WWHA 2WILA 3EG9B 3I5MA 1XSEA 2VJKA 2ZBDA 4XUDA 2R1UA 2OORA 1PTKA 3FFXA 4GYWA 2RFLA 3AUFA 3PLNA 1V71A 3NTOA 4H7PA 4AJ4A 1YL7A 5A5DA 3K1JA 2EP5A 1BJRE 1RLOA 4OBBA 3SHWA 2JLVA 1R7RA 2RGDA 2PL3A 1MVOA 4PZUA 5DBGA 1VBKA 4QPNA 5BYJA 3UK0A 1PJZA 2F1RA 3DTNA 3QXJA 2RBKA 2Q8NA 3SX2A 3ITDA 4PCAA 3TG8A 1SVLA 1K97A 2BHNA 4CI9A 4MKHA 1O87A 4KYVA 4TMWA 4PR0A 4Y2YA 3PYLA 4I46A 3EHEA 2PT6A 2H1VA 1XTPA 2JRLA 3D6NB 1BE6A 5HBGA 4WCVA 1PFKA 4YP0A 2D5AA 2C98A 1JDSA 1ECPA 1XN1A 1ZL0A 3DBVO 3DMFA 4DSTA 1L1EA 1K6MA 2R6ZA 5I7WA 3ND5A 4C22A 1N2CB 4ARZA 3EAGA 1JR4A 3JQFA 5K5EA 5EXXA 2OKGA 4QJ4A 4BUCA 1FNBA 4HNUA 1VA4A 1WPXA 1RWXA 5CFQA 4INOA 1J0EA 1TK2A 3LH5A 3E1KA 3FFAA 4KBYA 3DW1X 2ZZKA 4IP0A 4RO0A 5AK6A 3VJMA 3Q41A 3KHUA 3ICWA 1EFVB 3N3BC 5C1IA 5L3QB 4PFJA 3DBLA 2IY9A 3A9SA 4FOSA 2LR0A 1CJUC 2FA9A 1MQSA 4P3PA 1SVKA 1LPMA 1V8DA 4X94A 4XOIA 1WCIB 1IVNA 5CVUA 1PK8A 2AA3A 1WP4A 2W6OA 3DE1X 3K1AA 1ZP6A 2IY7A 3KL4A 3MJSA 2OZLB 2IFTA 5CT9A 3KHSA 5IWCA 2FP3A 1UQUA 4JAVC 2NO1A 2HN9A 3LZ6A 3ZHOA 4E1BA 5LZ8A 4MQ6A 4P2BA 2X9VA 4X1KB 1Z5GA 1KOFA 1FUUA 1ZXLA 3SMQA 1RQRA 3BSFA 3G0BA 2CXPA 2FN4A 4G2TA 2VSQA 1H93A 1F5SA 1Z73A 1YDEA 2AIRA 3AEQA 2JCXA 4RQUA 4UBNA 3SU8A 2WIDA 3W2IA 2I91A 2APJA 3D6AA 3I9MA 1P44A 2DPXA 3GJ5A 3FR7A 2NTVA 3TEJA 2G6BA 2LCFA 1IB0A 1QTRA 1QHSA 1JQDA 1V11A 4JITA 2AFHA 4KK3A 1EXMA 3M83A 4KXWA 4D5GA 5KEIA 1GT6A 4XIGS 3QSYA 4NZNA 3I73A 1EFCA 2HC9A 1GDHA 2N46A 3PQ4A 3D1JA 4ND7A 5CM9C 5DYTA 3WDMA 4OAOA 3ROQA 4JX9A 4HQKA 4JB0A 1FQJA 2YNMA 1WDKA 5ERYA 3IEVA 2ZBUA 5TPZD 1ZM9A 1DWPA 3O0DA 4Q3AA 4UHDA 5H68A 5JXHA 1XQYA 2FI1A 2JFUA 1J5PA 2P2LA 1AB6A 5KKNB 1H6CA 2QLNA 3I1YA 4O4LF 3DTVD 2FETA 1GZ5A 3NYWA 4W8OA 2RK6A 1FUIA 3RNLA 1IRIA 1AVTA 1KZHA 3ENNA 4OK6A 1ADFA 3OJEA 3LAWA 4J3JA 4OQFA 1GA6A 4JI5B 4F3KA 1Z7WA 4K86A 2O3RA 1UBKS 3GBVA 4BPRA 2V58A 2G7MC 2QY6A 1CUHA 3AJAA 2GOYA 3DDSA 3LCMA 2RGEA 4KE7A 2G4LA 5G53C 4DCNA 3SZLA 4DLWA 1KDZA 2XCSB 2R6HA 1O94A 2GNOA 3JYLA 3IEIA 3ADDA 4AJ1A 2MT9A 1QFSA 4O2LA 3W7AA 5A7FA 4J0DA 2AEEA 1RADA 2Q6KA 3IT2A 4WY8A 1LX7A 1QPZA 3GLHA 1IN5A 1M0TA 1CRLA 1X1TA 2NZ2A 1EFKA 1SB9A 3BFVA 3KVYA 2BJHA 5EMKA 4OA8A 2Q21A 1ZR4A 3EJWA 3AW9A 4Q00A 3AMVA 3KUCA 1KVSA 4NOKA 4B7UA 4DJJA 4EFMA 4HN4B 5EUMA 8AT1A 1FA9A 4ZMBA 5BN4A 3LRPA 3N7UA 4NCXA 4DDVA 3SC6A 2VJMA 1WUIS 3UGJA 3GJQA 2H57A 4DIOA 2CFTA 4UOZA 5IKMA 3U40A 4B79A 3PFGA 2R47A 2VK2A 1A71A 1C9JA 3HFJA 5CAEA 4M3NA 1NIJA 4QGFA 5DLDA 3IDZA 1GNTA 3IBTA 4QQKA 1PEYA 1RPJA 3M4JA 4GX2A 5DTJA 5HK8A 4P1ZA 3HB4X 3I39X 2NXCA 5EQFA 1GP2A 4MVJH 3ESBA 4K8RB 3R7AA 3C6MA 1X1DA 1CXZA 2WWWA 3OCCA 2HY7A 4O0LA 2BP7A 3WMGA 1I2MA 2UYQA 4TT3A 3DO8A 3NXSA 2HCFA 5G3YA 5FWXB 4L8WB 1NAIA 2ZK7A 2YX1A 1YB2A 2AK3A 5C1PA 1PWEA 1XQVA 4HWRA 1QR6A 5EQJB 2BZ1A 4JLOA 3STXA 4EP1A 4GLLA 3WBBA 4G26A 1NMEA 1E2PA 3N58A 4NXMB 1E94E 3L4EA 1SWVA 4HS9A 4GX5A 2MIIA 4IUYA 3SYRA 4QXRA 1J7JA 4X95A 3H8WA 1N75A 4DCOA 2W90A 1H2BA 2OV4A 1FW6A 3G2MA 3OX4A 4OLHA 4MUYA 1F7UA 2CUTA 3BULA 5KCMA 3TEMA 1QO7A 4QXAA 4CRWB 1X39A 3KJGA 2AD1A 4CMHA 2GN8A 2IQIA 2W4IA 1I3KA 1XZHA 3NIFB 2XMBA 3SIXA 4YAEA 1YS6A 4LZZA 2E89A 5FBWB 2EJTA 2PSSA 4NS4A 1XJ5A 5LD2C 3EMVA 1AK1A 4X97A 2R79A 1XT6A 4H1TA 3ZI0A 4JT2A 4F3NA 4ZEVA 2BN4A 4PM4A 4ZCRA 3UJ7A 1QVWA 3FKSD 1R12A 2HCTA 3GA0A 1L9KA 4QLOA 4RPJA 4UNSA 4JCOA 1OI7A 5E8RA 4AN1A 4F60A 3I52A 5HOQA 1ZH4A 1SQGA 3ZCTA 5LYJF 2FQXA 3X44A 3B6KA 1Z26A 1LS1A 4DA8A 3AJRA 5KZMB 4DV2B 3T0GA 1LDMA 2PRJA 3ED1A 5EUQB 4ZC8A 2G4CA 1HEIA 2YMQA 4JCCA 5D3MB 3HDTA 3PHCA 4RKYA 1RHUA 4ZZ3A 5MDHA 1TM3E 1YR2A 4Q1CA 2X77A 4TPKA 2XNHA 1WVGA 1RM3A 1YD7A 3AQ4A 3FAZA 4FQ8A 4QYSA 4D3XA 4W5JA 1XD8A 4ZYZA 2ZM5A 3ZY3A 2VA8A 4LSWA 2FUG6 3CX3A 4EPWA 1GT91 1LWOA 4WZBE 2BBOA 2HSEA 2E4WA 3I9V6 4JUCA 4GZ5A 3V5NA 4W1QA 4JKYA 3GLFA 4G1BA 1FVXA 2VT7A 2IP2A 4LWPA 3SX0A 5CNKA 3WBKA 4R2LA 5BR4A 3W2HA 3JARB 3QKWA 3TGWA 4ZZ1A 3HYCA 3I09A 2O59A 1WMDA 5AI0A 3OTWA 4D92A 4US0R 3K9LA 1JHZA 1E1QD 1EWVA 3N0WA 4GHWA 3F3MA 3LL7A 2FPPB 2VHWA 1OXUA 1R27A 2Y2VA 1SHKA 2YBDA 1QVVA 1R8QA 3FH0A 3OEHD 4ZV7A 3SCZA 1LLQA 2OD2A 4FU0A 1S6YA 4M0EA 4NE9A 4U2CA 5E6UA 2R5WA 5J59A 5BNZA 4CZ2A 3P97A 4BZZA 5B64A 3WHPA 2Q3LA 4V1CA 3FHTA 4B73A 2C7QA 2BCGY 1LVHA 2PZ8A 2QE6A 2ZAOA 3N1UA 5FF9A 2A35A 1OX5A 3F1KA 2ZR8A 1PLKA 1R8SA 2VQ3A 2W2PA 1DIOB 1HL7A 4WY5A 1CUVA 5DASA 1SMKA 4QYMA 3U80A 2GEKA 3ROKA 4EMBA 1ZY2A 1KPIA 2EG5A 2ODBA 5L7TA 5IT0A 2PMBA 1LV7A 1O6FA 3DFUA 4G5GA 4MS1A 1KVQA 3HUFA 1IPHA 1Y6FA 3TSOA 4MVJP 1SCIA 1F0YA 1SPXA 2IKQA 2Q1TA 4KDRA 1FFBA 4BO4A 1MP0A 4AP5A 4BCDA 5H82A 3JYPA 2LNDA 2ADMA 3N2IA 4MWGA 4PSDA 2JH8A 3RT1A 3D3JA 3S4YA 1DKNA 2FPXA 4BQOA 1EAYA 4RIIA 2WFLA 4KQ2A 5EN4A 3IL2A 3KUUA 2JGRA 2BGUA 2CLHB 2Q0QA 3PGVA 1AKEA 4IJUA 3V7UA 4J8PA 1JI3A 5JVDF 3CRMA 2H54A 3SSOA 4XB1A 4DV5B 5GOZA 2IXBA 2X8WA 3AHDA 1XXHE 2ZWVA 3M4NA 4XSVA 3VNAA 1W4BA 4FS3A 1V4VA 5EE1A 3IB3A 4XCQA 2DHRA 1YE5A 2FWIA 3QTTA 3X2SA 3RRBA 2YBEA 2XGJA 1JNXX 1R00A 4UVEA 4EGJA 4WI1A 5B6IA 4W1SA 2O2JA 5LZ4A 2VHTA 4E32A 3CCFA 5DJ5A 4BKMA 5KYUA 1TA9A 4YP9A 4XLTA 4I66A 3PR3A 3R44A 4LVNA 2I6GA 2CF6A 5ENDA 4CJXA 4NJOA 2BGTA 3BYZA 1GNLA 1JRLA 3I72A 4MDEA 3TLXA 1MT0A 2XCUA 3RG8A 2EYQA 2VJPA 3JQBA 2CVHA 3EEFA 4JUBA 2VWHA 2HB6A 3I5AA 4A6PA 1DAMA 3S2FA 4F2GA 3LBAA 3VPAA 3Q72A 1A8QA 3L5OA 3DFKA 4WVLA 2I8CA 4MCAA 3U0VA 2H4FA 8LDHA 1QIEA 1XAJA 4W7SA 1P4SA 2O57A 4K5QA 1CY8A 1BW9A 2B4YA 5L8VA 1UKBA 5KC8A 5LU9A 3H1FA 5IBPA 2FH5B 3MINA 1MRSA 4H1VA 3BIXA 4IDHA 5CNJA 4QQNA 5G0VA 3H4MA 3A25A 2PV7A 3RIEA 3WJ2A 1CJKC 1JZSA 1DTSA 2QPAA 2NO7A 3IQIX 3OQMA 3IT3A 1N6HA 1KJNA 3SR0A 2C4MA 3WXBA 5ISMA 2J5QA 3QVOA 4ZVMA 4HGRA 1RS0A 2BGJA 4JMLA 4ZN6A 3T9BA 4ARVA 3BOSA 4GDMA 4AQYB 2B9EA 3TZHA 3SAJA 2Z9CA 4MIYA 4MROA 2JLCA 3Q7PA 4HDMB 1LBSA 4GVXA 4TM7A 1OLSA 4QARA 3EMKA 2F3TA 2XEDA 3G13A 1USIA 5SZKB 1ZRHA 4IH4A 2VXCA 4G01B 2KMLA 3V8PA 1EFUA 4I50A 3CCBA 2YJ4A 1X42A 2V5VA 4Y2XA 3F7OA 3QGMA 4OGLA 1GSOA 2ZPUA 4ZAZA 2GPYA 3PFFA 2D00A 2JC3A 5CH8A 3HKEA 3E18A 3VPHA 3HNPA 4IBOA 3AU9A 1UEIA 3A9TA 4RKFA 3GJ0A 2RKOA 4DG8A 1ORTA 4JX8A 4WXMA 4Q6BA 3L6DA 1G5QA 1ENOA 1F4PA 1XMXA 4JQYA 2IRWA 3GVHA 4GS5A 1MJHA 4J0EA 2C9YA 4UHFA 1XMJA 2ACWA 1U0OC 4XGQA 3WISA 3AVYA 2DXIA 3J81A 4Y1RA 2XOEA 3OE7D 1OBVA 4MO9A 4ZAFA 1W25A 3EFBA 3BRWA 3ZDAA 2X4GA 3L07A 1LBIA 4X1YA 2PCLA 2Z09A 5HM8A 3GP5A 3HVIA 4S1PA 5EIEA 2IBMA 3R8CA 5K09A 5K45A 5E1OA 1SCDA 4OK3A 4BTEA 1YI1A 4M46A 2V7VA 4MW7A 2R87A 5AI6A 3DG9A 4YAJA 5IT4A 2PH3A 2VK8A 3MBIA 4ALKA 5LQAA 2HV9A 5K8JB 4FM9A 3U81A 4MRRA 4ZTUB 1UEXC 2ZOSA 3MHPA 3EXFA 3NATA 2B4TO 3WY9A 3RJ9A 3T4PA 3K6KA 2B37A 1UM9A 2JKVA 3PQ7A 1RJ9A 1FYVA 4CG1A 5F9HA 1JHMA 3BFKA 1ZOIA 2VTDA 3ZZUA 1P9WA 3FETA 2I7VA 3PWKA 5FWDA 1AN0A 1IJBA 1L7DA 4LNUB 3GUCA 1YBVA 3OKFA 4DF3A 2XUAA 3PD0A 1UJ2A 1VC2A 2W6JD 3M81A 4UCXA 2ZIGA 3NM5A 3OOYA 1VBMA 3CZ9A 3A14A 4DE5A 2PNJA 1KYQA 3WQRA 1F8XA 3QG1A 1MGPA 5DYIA 3NTRA 4BQQA 3T1YB 1JUDA 3WK4A 4IRUB 2QVXX 1PS0A 3IKMB 5FOQA 4U7HA 1V3UA 2VDPB 4OFWA 4CDGA 2IYPA 1QHNA 4UD2A 5CFNA 2L17A 3F5FA 4DANA 1VB5A 2BM8A 4JVSB 1HQYE 3O5AA 1J7KA 2WIAA 4RESA 5TY0A 1O6CA 3TRDA 4BFVA 1VMAA 3WNCA 1MG0A 1LEHA 1ES9A 1S3GA 2V7WA 1QQAA 1KMIY 1IU9A 1IDOA 5HS4A 1SBQA 5K4HA 5KNBA 2FZGA 1H8HA 3IKTA 1N1MA 3MJRA 1P8AA 4HNQA 4AJJA 4ETNA 4EGFA 3ES9A 4YBRA 5ALXA 4JB8A 2Q8QA 4TXLA 4BUZA 3KTFA 5KSYA 1QO9A 2BY4A 4JJ6A 3RC2A 2NLOA 2VZLA 3MGBA 4ND8B 4GYYA 4FKBA 4LSZA 3AG6A 3CLHA 1U5CA 4HAWA 4RKQA 4YDSA 2B20A 1K3UB 5LNK1 1CUDA 3TNJA 3E48A 2QJWA 3PC8A 3GPBA 4F7WA 3NCTA 1XMVA 1YUBA 4KYUA 1NW5A 1Z4OA 4ZVSA 5KYVA 2HRDA 1EFDN 4IH9A 1VKHA 1NOJA 3PPIA 2UZ1B 1SKUA 2R6DA 1LRJA 1PG0A 4IWYA 3GCZA 1VLJA 4JLKA 4KFCA 3QUSA 4A36A 2PBZA 1J8MF 5G1PA 1R37A 5MHTA 5KDLA 2H4XA 1HZJA 1G17A 4M0FA 1E7WA 2IVZA 3E9ZA 5KQSA 3TJRA 1Z6TA 3CZRA 5KTRA 1JEDA 4B85A 3U6BA 4GKJB 3UF0A 1NVDA 3OLZA 1PSWA 1TZCA 2D7JA 4F45A 3QBDA 2XE4A 3DV0A 3SOZA 2GB4A 3H5RA 5ICGA 2FPRA 1PN3A 5B57C 1QE5A 2FJUA 3Q8MA 2NZYA 4P3NA 5HF9A 1FRQA 2BD0A 2ERYA 2BGIA 3F8SA 4ALMA 5KWIA 3QELA 1VPTA 1K6JA 2EW2A 3WLJA 3WLQA 4GLBA 4ZA2A 3AFNA 2E1RA 2O7QA 1RLTA 3HXKA 2P3OA 3B82A 3JYHA 4R8VA 2ECFA 2WA1A 1LQUA 4CN8A 2OXFA 1AZLA 1JDBB 2P67A 2YJTD 5AJTA 5C1BA 4Q1DA 4TXHA 3RS9A 1ZJZA 3F5SA 3MAJA 1PJ2A 3TIVA 2C1EA 2C8LA 1I1OA 3G02A 4L27A 5BVHB 1JJFA 3PWSA 3HDHA 4UBMA 1KKUA 3BRQA 2C00A 3EAQA 3FA2A 3RARA 3K0SA 2J09A 3OJXA 1HMPA 1T36B 1YRLA 3UAOA 2UUBB 2YQZA 2D0DA 5AM1A 3DO5A 1KK1A 1SZDA 4V0SA 4TL9A 1G3UA 2ZTSA 2CXUA 2OO3A 3CE9A 2XCIA 3CLRC 4GICA 2Q1WA 1ZZEA 4K81B 1ZGHA 2Q5HA 4E03A 1GHTA 3FD8A 3H9UA 4Z1MD 5KDDA 4PSAA 2CVPA 4MZXA 1CF2O 3JZFA 1OU0A 3R75A 4KTVE 2CJWB 1JIQA 3WRXA 3LC0A 2PUEA 5FDFA 1GUBA 1Y8CA 2DPHA 1WU8A 5G02A 2W83A 4FSXA 4IL5A 3W5DA 3CLKA 4PX2A 1O95C 1ISPA 1N9GA 2H06A 2DTXA 4R3NA 5E4YA 3HCRA 2VJNA 2CV1A 1CHDA 3C7TA 3CZCA 2X7HA 4OOFA 5I7VA 1AHPA 4RPIA 1KY3A 1OR8A 2CD9A 5JZ9A 4KTTE 3SMVA 1ML3A 2MMGA 3UPTA 2QD1A 1ZI6A 4KAAA 4D5EA 3DZ8A 3ROFA 5HKKA 1O97D 2PA0A 3BMQA 4NR0A 4ER7A 1L4LA 5ICSA 3LUBA 3QLVA 2BDEA 4O59O 4OHXA 3PS9A 2NYRA 4A2CA 4PONA 1U2PA 1MX9A 4R0VA 3K0CC 1EDOA 4ITRC 2QD2A 3IAS6 2ID4A 1Z56C 1T1GA 2XTAA 3L05A 3WQQA 3ZCQA 5KYWB 2Q4RA 4XR9A 2F2TA 1N2ZA 1ZUD1 2QU8A 4L0QA 3OEED 4AQDA 3JQGB 1XX6A 1WMBA 5TQVA 1V8BA 3EUEA 4P54A 3GLGE 3VNQA 5CVDA 4WL0A 3OM9A 5I51A 5IUKC 3AL0C 3EA4A 1KQPA 2IHVA 3FZGA 3WMFA 1Y98A 2XD9A 4BLTA 5A06A 4R83A 4RPLA 4ZIRB 2IYLD 1NVBA 4KUHA 1POWA 2WLSA 1WZNA 3BQMB 1XQ1A 2Q5FA 4Y1FA 2VAWA 3WWPA 4QU0A 1QGDA 4CMIA 4Y0NA 1B15A 2HWKA 3IX7A 4PGGA 3ZWYA 3HO1A 3SLKA 4OMCA 2VDWB 4EB6B 2EJUA 3ZLBA 1E9RA 1A2QA 4POAA 3CEMA 1UC5B 4DLRA 4BNKA 2WM9B 1XFAA 5FTKA 4BFSA 2I4MA 2X4LA 1IWOA 4BWVA 4PYJA 5EC8A 2G8NA 1YCDA 4CMCA 4QOIA 1CDEA 2H59A 5ETJA 2ZPTX 3U17A 1RWOA 3FSGA 3LUJA 3ZHSA 3GP8A 4QRHA 1VJCA 2B1JA 3I2YX 5BMVF 4U7WA 3SVLA 1MXHA 1W46A 2QN6A 3S5UA 4P92A 5B3LA 1GSAA 2OESA 2Y0PA 3DHEA 4YFVA 2Q1XA 4PAMA 2IX9A 5AKKA 3E4DA 2IZ5A 2JCSA 3R5KA 3ZY2A 4YXWD 1FUKA 3T9FA 1DTEA 1YRWA 2RAVA 2XUIA 5ER6A 5K9ZA 1RXWA 1KEVA 4KXYA 1XAIA 4YMIA 4JLSA 1EWKA 9LDBA 2GO1A 3TQSA 4AZSA 4EB3A 4ZCSA 1XD9A 4CPDA 3R5SA 2VLBA 4I81A 4GAEA 3VR2D 4BLPA 5ALDA 5EFOA 3DCIA 3HCAA 3D6JA 1EFLA 2QLTA 3V8MA 4I9FA 1ZNQO 3SR4A 5IFLA 2HSJA 4EFKA 4FZ3A 3WDSA 4OAPA 1PT9A 2R6JA 2HO5A 1KP9A 3BCUA 3HB9A 5DDIP 5P21A 1DP4A 1RCTE 3C3YA 4TKMA 3THWB 1F38A 1HM5A 1S1CA 1JKFA 1PD0A 1A4XA 1MB4A 3DMYA 5T4EA 1K0UA 3EXHC 3OFNA 4AZ0A 3TDMA 3DUFB 5K7SA 3NDJA 3HC7A 3V2GA 1JECA 3BK1A 1ZMRA 2YXDA 3SDSA 1OH5A 1MO5A 2WJGA 3IBCA 2OXEA 2NVOA 2JIZD 5ALMA 4PGHA 3NGLA 4PNHA 1UJCA 2H2AA 4YRAA 5B3JC 4BLWA 1AT1A 4POOA 1U8TA 3V3KA 2C83A 2V6IA 3DLAA 4XIJA 5JARA 1IY9A 2IBTA 1Z8FA 2QTLA 3JZMA 5DX0A 5TJ9A 1SHZA 1SD5A 3AYZB 4MQLA 4B7ZA 4IMRA 1G5PA 4TTVA 5IJ9A 2YXNA 2HREA 1AKUA 1QCDA 4ZQHA 5DXAA 3K70B 2Z5GA 4EQ6B 5MN6A 2DQ4A 2ZSEA 4LJRA 2BFMA 4H7EA 1RWBA 2JFWA 3L0YA 4YRIA 1NM5C 3E9RA 4TKZA 1BJKA 1CP3A 4Z1MA 4IGKA 1KVUA 1J09A 1MB9A 3U7RA 4GMDA 4CL8A 1RI4A 1KKMA 3MEQA 2J5KA 3O83A 3WLOA 5I47A 1X80B 4KU4A 3TCNA 2H1CA 5CA0A 2QMHA 5IAOA 4L85A 1FP7A 2NXJA 3BH0A 5CYGA 1ZYUA 4JR1A 1P6QA 3PE4A 1NQWA 1US8B 1M2OA 2H2GA 2GYWA 2N0SA 3A37A 3EYWA 4I5DA 5IEBA 3ZS9A 4CETA 4N49A 1Z17A 2NXNA 3L84A 1RBYA 4D45A 1NKTA 5HZHA 4A3SA 5EMHA 5G2OA 5GINE 3G68A 3BWXA 4X84A 5ENZA 3UWDA 1G20B 2F3QA 1Z5WA 3WYCA 1C8BA 2MSKA 4KAFA 1FZQA 1GJRA 4HFMA 4NJMB 4EUEA 4IGEA 2LXNA 5EJAA 2OBNA 3W7BA 1WBDA 3TPCA 4I55A 4E2FA 4UASA 1N3BA 2OLKA 4D80A 4ZQCB 3QVGB 4YP5A 2IF2A 2DLNA 1VQ1A 4DUPA 2OK7A 3B3QA 3O2JA 4R2XA 3CNQS 1E3EA 1QV7A 1W5TA 2XI4A 4RBNA 3GH1A 3JX9A 4MRAA 4QYIA 4DLPA 2AOTB 1ZJ5A 1HRKA 2JFNA 2BEWB 3CRVA 1EUYA 1Z22A 2C61A 5F4ZA 2JATA 1KY5A 2C92A 1T24A 4N01A 4IKEA 5E4JA 1BEEA 3TLCA 1ZVKA 1F12A 1A4RA 1NXQA 1LW7A 1WD7A 2VCHA 4GQBA 1VECA 3BSYA 5TX7A 4R9UC 2HPAA 1WHTA 3OJFA 2K87A 2XCQA 2ZR0A 5BWMA 2ORED 4YJ3A 3AVTA 2NVWA 1ECJA 2YN0A 2V7UA 3KYCB 4GMGA 1X7DA 2H4ZA 3RUPA 4E2XA 1OCEA 3NGMA 4AG3A 4OUDB 4KFRA 5EP3A 2ZSHA 1G8SA 1PL7A 5I9NA 2CSUA 4CQMA 2ASVA 3HLYA 4IFTA 4EYEA 5BV7A 3TINA 2DQZA 1PQWA 4G3XA 4DSAA 3DFIA 3WLIA 2BZSA 4DJFC 4KFSA 1AGXA 2BF4A 4JA0A 4YACA 2YZ2A 3KYCA 2Z56A 2ZUVA 5DGTA 1ZISA 5BT8A 5LOVB 1E2DA 1FMCA 2I4NA 1C8VB 1OAOA 3IQZA 3M6UA 4TQGA 4BVBA 4ZVNA 3IRVA 3IVAA 3RS7A 1TK3A 2D4AA 2EL7A 4DJDC 1LF0A 3AI2A 4DR1B 2VHEA 1LNZA 3LX5A 2WR8A 2AN3A 2O8FB 5CT4A 3MFQA 4Q4LA 5CHEA 4ZI5A 2D6FA 5DV9A 2C2ZA 4XDGA 3F5QA 1NJ1A 1RKVA 4I99A 2DY1A 4U3JA 4EGSA 4RH0A 1DEHA 1F1JA 1RD4A 2DT5A 4JP8A 4IQ8A 5MGNA 4UBOA 3UA3A 3NNSA 5KPDA 3WV5A 1JLRA 2CMHA 1M76A 2I76A 5EG5A 1TYCA 1Y63A 2ROQA 5KWVA 2IHUA 3KR0A 4AZ3B 4QYWA 1M34A 4D8WA 1GVHA 3FPAA 3ILHA 4DADA 1F6BA 1PEDA 1KEUA 1M2JA 1EVYA 3D9QX 1R5BA 4HQ6A 3NAQA 4JASB 4KL8S 4UEQA 4ZD6A 2ZRMA 2PJDA 4NE7A 4QQRA 3MWFA 2W93A 1LVGA 3KFLA 1RKUA 1WUTA 2OP0A 2ZEJA 1CR4A 3F4BA 5K3BA 4ESEA 5L3QA 3F9RA 3CMMA 3PC8C 3UB2A 2R44A 4W5NA 4R6XA 5DGIA 4FGKA 1XZCA 3ODPA 4QKQA 3NRCA 2QN7A 4S2EA 1H6DA 4ARAA 1YZGA 3HI4A 4L3VA 3PNMA 2C77A 1YJBA 4WDQA 1IN1A 5HMMA 1Y82A 2FEPA 1G21E 2XXAA 4MAFA 3TM5A 4E5MA 4NMXB 4HDRB 3MFYA 3VQTA 1HE4A 1R0CA 1P7PA 5IWAB 5IMBA 2F9LA 5AW1A 1KMMA 4QSHA 1A8UA 2PNFA 3OHSX 3UT5B 4DR3B 1JG4A 3GPCA 3DZDA 1CLUA 3QUBA 4CEHA 2BCEA 3RCBA 4UHJA 3LF2A 3U7QA 4CF6A 2FY8A 4LRQA 3WV4A 3HHPA 2FG7C 2OCLA 3W1WA 2IHYA 5HCNA 2ZSDA 2EXXA 3FPJA 3QLTA 4BNJA 1OFTA 4ZYTA 1Q1AA 3DHWC 1RQ7A 1N5JA 5H70A 5DNEA 2QWXA 1AC5A 3EJ6A 4YCBA 4DLZA 1X7XA 2P9HA 3OPYA 4MYTA 4EO7A 2C94A 2QX4A 4EWLA 5DM70 2WU3A 4D9HA 3D5TA 3EISA 4TXNA 1FLVA 1N8KA 4FYWA 3ID6C 5CYFA 3RUFA 2B6NA 3E9MA 3CSUA 1YOVB 3MT0A 4I0WB 3SM9A 3UOGA 1CUCA 1GQQA 1S89A 2PQMA 3ZZNA 4DILA 2XA9A 5E6RB 5CDFE 3IVMA 5I3CA 2QRKA 4YNBA 4OHPA 3NGXA 1GQYA 3TGLA 3HBMA 3PNYA 4J75A 4JOCA 1XZLA 3EFOA 1P29A 5DCLA 5FFNA 2RGXA 1BWRA 2I1QA 5DSXA 3SHQA 3CE6A 4Q4HB 1H6BA 1U2ZA 3ADKA 3IQDB 1TAHA 3OQIA 5CVTA 3UMYA 1G1MA 3G0OA 1NNUA 1O9BA 3F7TA 3FCOA 4M1ZA 3HSYA 5FNVF 5LKAA 1ZHOA 1QIJA 2Z3VA 2G63A 3O47A 3KX2A 1OH7A 3EWAA 7GPBA 1TECE 4G0VA 2HLDD 3AVVA 3LX4A 1Z45A 4XX1A 4B6PA 2I3GA 2J46A 5ALUA 4O4JF 1SVUA 2OB1A 1NJ8A 4AU1A 1P1JA 4BVGA 2P2NA 2VATA 1J56A 3HCBA 4IGIA 4MUBA 2XVZA 1RPNA 2ZIXB 3COJA 4KITB 4XJSA 2JANA 4KP7A 4JP1A 1T9DA 5FWNA 5L95A 2WF7A 2NUAA 4NV0A 5TS3A 1J2YA 3KKOA 4Q3BA 4D8UA 4QUAA 1F8GA 2O4UX 1I0ZA 3Q5DA 2SKCA 3JS5A 4IOLA 1ADCA 4MV8A 3OKCA 1P45A 1RXVA 1TAUA 3CKKA 1W4AA 2P4QA 1BN6A 1DJLA 2BBTA 1SC3A 2GFIA 3L7AA 3QXCA 4R2MA 1EKXA 5CW2A 3I0MA 2YZ7A 2ZBPA 4UE6A 3JV7A 1YB7A 3H9JA 1MAWA 3X43A 1LK0A 4FNGA 3V2UA 2A5YB 2QNRA 2QRHA 3P2YA 1OV4A 1YF3A 2BSXA 3A7EA 1MJ5A 4FMCB 4ZRDA 4CLOB 1JFVA 4RV9A 1P1RA 1YK0A 2I6TA 1FL9A 1ZGJA 2C5BA 3P2IA 5K8LA 4ZGBA 3U7EB 3T4XA 5DRYA 1MEJA 2GILA 4LTMA 1UXIA 3JRNA 1LBTA 1L4MA 1RLUA 1RM5A 2Z43A 3QKRA 1NBEA 5H81A 1CB7A 1JWLA 3K72B 4KRXA 5JRZA 2VNIA 4AJ9A 2IYVA 1TZBA 1LY1A 3E61A 4YQFA 4EA9A 1H3FA 1OXMA 4M4SA 2AN1A 3I76A 1KOGA 1VSUA 5IN5A 5BWBA 3CX8A 1Z6ZA 2NXWA 1M2FA 3BORA 1KRWA 1W4ZA 4UNPA 3MJDA 2RD2A 4K0RA 4WASA 2J0EA 1CD5A 4D9CA 1L7EA 4HFJA 4ER3A 4Z4EA 1QHFA 1FTGA 3OO1A 1LD3A 1YS1X 1BAPA 5EQDA 2SHKA 1BH6A 3GCXA 5GM2A 5A9RA 4RMIA 3I5UA 2HJ9A 1W0KA 2WMNB 4RZ2A 4CEJA 1VSTA 2O2DA 2XVYA 3GBSA 2UXBB 1OXBB 2IZ1A 5HRAA 3GG2A 1WSWA 1WP9A 2E3JA 1H8EA 3DKIA 3OKPA 2ZRDA 3L1VA 3ZDFA 4W5TA 1FFWA 1S3SA 5BSUA 4MWDA 1OKKA 5HJEA 1VKRA 3AVUA 3T5BA 2J0UB 4ZZIA 1ZXBA 1SC1A 4KE8A 2D59A 4ALLA 4ZEMA 1NVXQ 1Z28A 2GHQA 3TQRA 4EVSA 4DZZA 4RTQA 2QE7D 1VE6A 3GJ7A 2GEUA 4CIDA 5JU6A 2VYND 5TJHA 3TZ6A 3O8QA 1DUIA 1NPYA 4JJEA 2FEAA 4LX0A 3PUYA 1TD9A 3D3QA 2W2NA 4L78A 3C3MA 1C0LA 4RZ3A 4J1TC 4BHTA 4MYUA 1LLDA 3JQ9A 1EDZA 3H97A 3IAS1 1BRTA 2WF6A 1VFNA 1B0ZA 4Y67A 3EPRA 1GSIA 3CLSD 4PIMA 3VPCA 4EX7A 3IPAA 2Q9UA 1QQ7A 4W6QA 4KRYA 4DMKA 2XVXA 3H18A 1F3OA 4M7OA 5FUBA 4CIAA 3AY7A 4J29A 2O0JA 1V37A 5AHXA 1YVRA 3EAFA 5HRCA 1M8PA 3BE8A 3DONA 3HU1A 3NT4A 1VI6A 4JBIA 1EZ1A 4MKXA 2DETA 2OCBA 2B30A 2HHAA 2B7BA 4C6RA 1AO3A 3MGKA 2PH5A 4ZVVA 5JJIA 1H1TA 3DTVB 3ICPA 4C88A 1JIJA 3JQAA 1ZUIA 3G5MA 4FK8A 2NAFA 2NT3A 1GV0A 4AZVA 4MDHA 5G1NA 4YA6A 3VFDA 2YOHA 4DT1A 2IHZA 1BWSA 1Z4IA 1XTZA 3HJCA 1PEKE 2IEIA 4YJ3B 1EVKA 3A4VA 1X8LA 1MH9A 2ZUUA 2Q2QA 3QG5A 3NRJA 1RHJA 5ALGA 3SS7X 4YPOA 4N41A 1GEGA 2JS7A 4EPYA 2FF7A 1S1MA 4LSMA 2QSUA 4B3FX 5FH9A 2Z8YA 4G4SO 5ALJA 3VJKA 4R40A 2P4EA 3ZVKA 1D9ZA 3QA9A 1IY0A 2IDJA 1I0IA 3TLGA 3EF3A 3LPLA 1E3MA 3EWSA 5JUWA 2VP3A 4IMIB 5KNLA 3CX6A 5HYVA 3VDMA 3VYUB 3TOCA 3I5YA 4G1FA 1YULA 4FFMA 1RWPA 1NUTA 1C7FA 1ULUA 4G9GA 4NMLA 3JQBC 4PLZA 4C7OB 4JNKA 2W48A 4D4IA 2Q4OA 3EA5A 4JYZA 2X58A 621PA 4JGGA 1ULAA 3AR9A 2ZSUA 3W0LB 1AKWA 5FFFA 4Q4HA 3VR4H 2ZWMA 3KD3A 4MUIA 1OI2A 5IJXA 4DCCA 4MDFA 4HLDA 4QTXA 1UJ5A 3MCAA 4RSGA 2YUIA 4RLHA 1P0MA 1V96A 3PDIB 4AMZA 3V7FA 2D1FA 2Y0DA 3PHLA 4FUTA 3KQPA 5K0ZA 2WD8A 1X7WB 2DBRA 4BV3A 1P9LA 4Y9RA 2VDVE 3K15A 4IF4A 5FHRA 2IIVA 2GR9A 5CH3A 4FBLA 4BYMA 4D0GA 2VT6A 4FZ5A 2H2FA 5HUJA 3RAJA 1ODIA 1EESA 3ZIAA 3OECA 2B61A 3OA0A 1JE1A 3W5CA 2QDXA 2EWMA 2VRBA 4YO7A 2AOUA 2Q62A 2OYRA 1JDTA 1SWWA 3F1LA 3HY3A 4YDHB 4Q7EA 3R0XA 4J76A 3SS9X 1DG9A 4E51A 1BCSB 2QZJA 3DKPA 1DDOA 3T3MB 2KQUA 1ZLXA 3EBPA 4LRUA 3W9UA 2RH9B 2OCIA 1JEQB 1M34E 1D03A 2XZPA 3DS8A 3E3MA 3ZTTA 1U28A 2PCJA 1LPPA 2FV8A 3U61B 2RB5A 3KB6A 4KX5A 1X94A 2AJLI 4MRPA 3ZZ0A 4FEAA 4PYIA 1CVIA 1P81A 4ETMA 2G9RA 1XD2B 1U0SY 2G1KA 2J5XA 3RIXA 1T6YA 2C95A 2H0AA 2HCJB 1EUZA 2NV6A 2QRPA 1XZEA 2YC4C 3EXEA 3EZ7A 4HB3A 1CFZA 3SGLA 3WLEA 3D8RA 2QY9A 3SQNA 1NHGA 3B2QA 3ZY5A 1P0QA 2Z8YM 4K2AA 2G5GX 3IT0A 3RVJA 3WGJA 3JYQA 3L40A 1XJCA 1EFRD 2EL9A 4JB2A 4A0SA 3X1YA 1W35A 3T5CA 3B1XA 2GJSA 2EZTA 3KZCA 4P08A 3V42A 3LYLA 4FOTA 4CFYA 4X66B 2OAGA 1W2WB 1XWIA 2NNWB 4M60A 3EC1A 1ZUHA 3QJYA 3HBFA 5CX4A 2PX0A 1DG1G 1UPXA 3CO5A 5H7XA 1PJTA 4HGZA 4ZDWA 5CBPA 4DR6B 2OMKA 2OCKA 4LKRA 2CLCX 3Q15C 3ENZA 3CRNA 1CR1A 3DT8A 3WO1A 4M49A 1V3TA 3H1BA 3QVGA 2VUSA 4AJPA 2XIQA 2FW6A 2WQZA 4TGLA 2QW0X 2SCUA 1OBCA 3V46A 4AWAA 4MS1B 1Z6AA 4Z9FA 2PZLA 1KFJB 1C7ZA 3P9XA 3QMPA 1RPTA 4JBLA 5F3WB 4EFNA 3U4CA 4BVFA 3M3DA 1L5NA 1BMFD 4N8DA 1KQOA 2YHUA 2C03A 3OLCX 4EL5A 4RAOA 4WESB 1E1KA 5DVZA 3AHGA 5EIHA 2GRUA 2H31A 2I3ZA 3GPDG 3GD7A 3QPVA 4KC0A 1D2RA 3T7RA 4MA5A 3IULA 3KSBC 1OWNA 1AGRA 1VLHA 4G1EB 1XXHB 2Q41A 4JL5A 4KGVA 1BMTA 4TN5A 1SM4A 3OFKA 1BE1A 4YAOA 2AR7A 3PD7A 3J7TA 4AIIA 4YMUA 1GY8A 1IBRA 4WW0A 1QC5B 4ZALA 5TPWA 4LJ6A 2E21A 3DDOA 3P7MA 4ZI7B 5L4SA 3ZE7A 1IK6A 2OD7A 2C04A 3UH0A 2YWXA 2Z4SA 4JODA 1PL6A 4BGUA 1WLYA 3K20A 5KDOA 1XCPA 3NO4A 4P5DA 4UUQA 4HNSA 2GPNA 1AKQA 3CWZA 1SUCA 2W2MA 4KQKA 3VKUA 2OBLA 4Q48A 3F47A 2EU8A 4GOKA 1BX0A 1R9NA 3JD4A 2WYHA 4LE2A 4G1UC 2BMJA 3E23A 3H87A 4RW0A 3UXHA 4E46A 5JY6A 3LX6A 3RF7A 4M9QA 2BRUA 2G40A 2J4FA 2H4WA 1GPH1 1TF5A 3K9CA 4M22A 4ZICA 8ADHA 3WIDA 1YQ9A 5B7QA 1F9EA 1WSBA 1TTPB 3JQ7A 1FX0A 4XJVA 1B93A 2YZGA 4WOPA 4AJ2A 3PWZA 4WERA 3ROPA 4N5IX 2OZKA 2WP0A 3GNLA 3Q1LA 4HX2A 5CDSA 4YCCA 4PCUA 1N2BA 3ZDZB 1XCMA 1XV5A 3PZBA 1C81A 3LDFA 1B6SA 3IA2A 3LJKA 3QBTA 2WUWE 2G82A 2PVPA 2VPWA 4PS1A 4Y18A 4C0BA 2YRXA 3JASA 2QQFA 2ZYGA 3LNCA 3FCYA 4KLAA 1HTTA 2EDAA 2W2LA 5CLJA 1VCNA 3OJLA 4MPJA 3SD7A 1GIAA 1MVLA 3R3ZA 4R5MA 2H8GA 4EAAA 1P4HA 4GSKA 5G4KA 3EXAA 3HU5A 3E3LA 1Z5UA 3DOIA 4M7WA 4UVDA 2JNWA 1AS2A 1QGYA 3KAPA 5GJBA 2EQBA 3V1MA 1XCGB 4PINA 4QGAA 3PB3A 1UXJA 2O6LA 2V4UA 2PK3A 4ZCTA 4WLFA 1RPZA 3LC1O 1XTQA 4B4WA 2QV0A 3B52X 4MUHA 5KNCD 5G4KB 3V9PA 1ADBA 1VIMA 4ZVLA 4DMGA 3ADCA 1SXHA 2RAUA 3FHCB 4A8PA 5D1HA 3QNMA 2W4MA 3KSUA 5IH3A 2W6ZA 3PKIA 2ODWA 4NF2A 3DC2A 3EVGA 3R1IA 4RDIA 3MAGA 3OE4A 1XWFA 3KUDA 4I3FA 4WN3A 5AKHA 5CCBA 1N6RA 1CK4A 4UBJA 5K8CA 1JN0A 2I1VB 3LM8A 1Y1LA 1YZ3A 2IXEA 4E15A 3S8EA 1L8LA 3NFRA 4KYIB 4U2FA 4EAQA 3DD1A 1XVUA 2OHHA 1IHOA 2QP4A 4RD0A 3A6PC 3DZKA 5J63A 5T3UA 4EBFA 4BV8A 2V97A 3RFFA 1J25A 1E0KA 5E0OA 1MEEA 2IODA 3L8EA 3L02A 4XDYA 1JLLA 4RQTA 2CXHA 3LWDA 4MI6A 3VTAA 2NGRA 3TJZA 3P9KA 4DAOA 5DBIA 3OQ1A 3DL2A 3GXBA 3OQNA 4JC8A 1CZOA 1TTHA 3EF1A 3HZOA 2FPSA 3A27A 4J1TA 8GPBA 4OF4A 1XVIA 1S8AA 1SAYA 4DDUA 3R9XB 2EYUA 4XGKA 5D5PA 4CT5A 1DADA 2FSVA 2WEKA 4XDZA 3DMTC 1NF2A 5FAXA 3K30A 4ND5A 4O1MA 2R6FA 4CQJA 3LUKA 1SBCA 2WB4A 1P2SA 1UBSB 4F8JA 5EHZA 2HQBA 2QTCA 2ZM6B 1UC4B 1JYFA 1W1UA 2I6SA 3I12A 1N32B 2Z1NA 1R6DA 4W1RA 3ZI7A 3KJZA 2PTHA 4WIAA 3UATA 1SBIA 3L7DA 3D0OA 2PDAA 1EP3B 4R7GA 3R7FA 1N8SA 2X5XA 4L08A 1YR9A 4A1FA 5DZSA 1M0WA 1OA1A 4WXYB 5M04A 3UJBA 2XE8A 3A2LA 4LBZA 3KSDO 4KW7A 2HZ7A 2IV2X 1R0YA 4DLUA 2E4XA 3SN6A 3UGQA 2G0AA 2ZUCA 4P3XA 1E0SA 1K68A 1N5OX 2COEA 4Q24A 4FLEA 1E79D 1D4OA 1K8RA 1ZQ1A 2I99A 4IOKA 1BVYF 4I4NA 2X1LA 5JC8A 5CAEB 3MJTA 1Z0FA 3ND8A 1II9A 2CBXA 4KO3S 1TPZA 5CH5A 3G88A 1OI3A 4ZYYA 3RC7A 4IFEA 5D3ZA 4QUHA 4RVOA 1Z06A 4L5BA 4N8SA 4NLLA 2B1QA 4J07A 4YRRA 3MLAA 1YMUA 3NWJA 4UVIA 3V8EA 3FOFC 5ECDA 3SC3A 1MFZA 4OGKA 5JFTA 3NWPA 2D2IA 4B8YA 2ZI4A 5FPTA 4GPBA 2GRAA 3WI7A 2XB4A 4MR7A 3PFKA 3D7SA 4LMPA 2FPKA 3R3VA 1LPNA 4RD2A 1PT5A 2YDXA 3QU5A 4EHKA 1HT3A 5L6MB 2FW8A 1KO7A 2GHRA 3B1VA 2VUIB 3ZI4A 4TMXA 3Q3VA 4MVJE 3WLLA 1GTL1 4C03A 1W5SA 2OVBA 3ZCPA 5CD9A 3IODA 4F8YA 1AZTA 2WUGA 3SEAA 2AFHB 1W85A 2ARKA 2C5FA 2D3TA 4B31A 1UPFA 2HMAA 4M88A 1Y7TA 2UVQA 5JSYA 1Y6GA 4L8GA 1CF4A 1AMOA 5SYNA 2V45A 3VR0A 1TXGA 1U28C 1WXEA 2IEBA 2QN8A 2X42A 3DH0A 4HQFA 4KVZA 1SURA 4MQMA 1Q0RA 1YWGO 4R1PA 1KFBB 2XH8A 2RBGA 3OZSA 1PT7A 1H2FA 2CXRA 3MT9A 4PQGA 3HUTA 3D1VA 4DB2A 4YP1A 2Q3DA 4Z3DA 3PNKA 5A2GA 2BFDA 1TGYA 5EMLA 4L76A 4H7DA 4MB0A 4YT8A 4F1KA 3G8BA 4R9RA 4ZI7A 1XKQA 3H9BA 1I6MA 4R1TA 3OHMA 3TAUA 3WWCA 3L2OB 4K6GA 4YMVA