2H0GA

Crystal structure of dsbg t200m mutant
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
229
structure length
229
Chain Sequence
ELPAPVKAIEKQGITIIKTFDAPGGMKGYLGKYQDMGVTIYLTPDGKHAISGYMYNEKGENLSNTLIEKEIYAPAGREMWQRMEQSHWLLDGKKDAPVIVYVFADPFCPYCKQFWQQARPWVDSGKVQLRTLLVGVIKPESPATAAAILASKDPAKTWQQYEASGGKLKLNVPANVSTEQMKVLSDNEKLMDDLGANVMPAIYYMSKENTLQQAVGLPDQKTLNIIMGN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Thiol:disulfide interchange protein dsbG
publication title Short-circuiting divergent evolution: laboratory evolution of one disulfide isomerase to resemble another
rcsb
source organism Escherichia coli
molecule tags Isomerase
total genus 64
structure length 229
sequence length 229
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-05-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13098 Thioredoxin_2 Thioredoxin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.70 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Disulphide bond isomerase, DsbC/G, N-terminal 2h0gA01
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 2h0gA02
2AYTA 3UARA 3KCMA 4OMVA 4AJ8A 1Q4JA 2K6VA 3GA4A 3RPPA 4IGJA 1SK0A 3W8SA 4P3YB 13GSA 4ZL8A 3G9BA 4XIHA 11GSA 3FKFA 3HCZA 3TJJA 3IR4A 1J9BA 1PX6A 1MDIA 3TOTA 4IN0A 1H4OA 4GTUA 4AJ6A 4MCUA 4KSOA 5CREA 5CAXA 1PN9A 2PBJA 1GSYA 6GSWA 2H6ZA 1BAYA 2YPMA 3EU4A 5KN0A 1G0TA 22GSA 2GS3A 2EC4A 2LUSA 4IJ3A 3I43A 4OFMA 1OE7A 1GL8A 3FK8A 1EP7A 3VPQA 1SU9A 4JE1A 3MNGA 2O85A 3IDVA 2H74A 2X8CA 4TR4A 3TCOA 1O81A 1JFUA 1A8YA 4MDCA 3D4TA 3GL5A 4J56E 3HVVA 4KB3A 1WWJA 2K18A 4GWRA 2LQQA 4TR0A 3GSSA 4MJCA 1HNCA 2OBIA 3IA1A 1U3IA 5B6MA 1F37A 4POBA 2MMNA 2MMAA 3D5JA 4NWYA 4KE3A 3US3A 1EOGA 5IPGA 2R2JA 2O8VB 4GLTA 4GSSA 2GZYA 1R26A 1QQ2A 2B5YA 1TI3A 3QAGA 3APQA 2K8VA 5CRDA 1VF3A 2H01A 5H5SA 3ED3A 4LL1B 5F07A 4MZWA 5GZZB 1O6JA 1ON4A 4IBPA 2OADA 2H0HA 4IQ1A 2JZRA 5F0GA 4V2LA 2NBSA 3HVXA 6GSYA 2YJHA 2FWEA 1ABAA 1GWCA 3GKMA 3KMOA 1XVWA 3G7IA 1YZXA 4DSQA 5G1LA 2FWGA 3WGDA 1XW5A 3F3QA 2M72A 1T1VA 1K0OA 2CZ3A 4PUFC 1YKAA 4K0GA 3DD3A 4YH2A 2DJJA 2QKEA 4XS4B 1V2AA 5ABRA 2H75A 1GUKA 5DVBA 3GX8A 1K0NA 3TKSC 1N8JA 4ECIA 3ME8A 1PKWA 2N5AA 4KDXA 4D73A 3P7XA 3IHQA 3EYTA 1OC3A 2R3XA 1QGVA 3P8WA 5KN1A 2A2RA 2F3MA 4OD7A 4I2TA 5JCUA 2QC7A 2L59A 4ULXA 3A3TA 2H70A 4NPBA 5JWQB 2GQLA 4XRDA 3HJOA 3QD9A 5D73A 2CX4A 4ML1A 5ECRB 2FLSA 4XTSA 5ELAA 1MTCA 3GNJA 1Z6NA 2H1DA 2A2SA 1OYJA 1WP0A 1XWBA 4IELA 1R5AA 1TK8B 2O7KA 3UVTA 1URMA 5A4VA 1MDJA 2L5LA 3ZTLA 5INYA 3FR9A 3V1WA 2WS2A 4NAXA 5AISA 1EOHA 4IP6A 2H73A 3TKRA 1M9BA 3M8NA 3GN3A 2CQ9A 1XWGA 3BCKA 1GSQA 2FNOA 3ZRDA 3L0HA 1A2JA 4YAPA 9GSSA 4K6XA 6GSUA 5DBQA 4K9ZA 1DE1A 3O3TA 2WCIA 3F0IA 2PVQA 4WR4A 1GNEA 4TR3A 4F0BA 1B4PA 3KIJA 1VRSD 4ZILA 1SD9A 2CT6A 4X1UA 2KUCA 3H4KA 2YANA 2VUPA 2YCDA 2F8AA 5DCHA 2JZSA 2IFQA 1SJIA 3UBKA 1GNWA 1KTEA 2N5BA 3KP9A 4GSTA 4F82A 5ECKB 2H1GA 3Q18A 1W4VA 5DQSA 1X5DA 2JU5A 1EWXA 4NHZA 4MA9A 3RHBA 2HFDA 5HFKA 3UMAA 3ZIVA 2LTKA 2NTOA 5G5EA 5B8AA 2LKUA 1SJZA 1Z6MA 1FB0A 1RK4A 3KTLA 4H86A 4OFTA 2C3TA 2VCWA 2CVBA 3HZ8A 3KTBA 1TRVA 5ECMB 2PN8A 2GVPA 1YEPA 1A2MA 2C1YA 2AHEA 4YQVA 3IPZA 2X99A 3TUEA 2LJAA 3EE2A 3Q6OA 5ID2B 5ECSA 2WRTA 3L4NA 4V2NA 4EE0A 4IKHA 3FR3A 1TJDA 1VGLA 2VLUA 3KP8A 5IMCA 1K0DA 1K3OA 2R37A 18GSA 1EEMA 1PL1A 1UN2A 1WJKA 2DJKA 5D96A 3LYPA 2QGVA 5IMAA 4TR1A 2C0EA 3HZ4A 1MD4A 2DC5A 3J7Yb 4K7NA 2NVLA 2G0FA 3M0FA 4FYCA 4O92A 3O6TA 3ERGA 5EVOA 1AXDA 1LU4A 3EINA 4YQUA 4F0CA 2XPEA 5HFGA 3DGQA 2B5EA 5IMVA 1OKDA 3EURA 3CTFA 2R6KA 1WRYA 1AQVA 3GMFA 3VLNA 1KEBA 3BCIA 2RIIA 2E2MA 3TJBA 3GX0A 4HZ4A 3UAPA 1A23A 4MLYA 2KP2A 4QL9A 2WDUA 1K0BA 1ZZYA 5CYYA 1ZYEA 5HR0A 1XXUA 2YWNA 1HNAA 2YOIA 2PU9C 3ZFBA 4EXJA 3HJMA 1QXHA 1TU7A 3H93A 4TRXA 4TXOB 2IL3A 2XBQA 1K0MA 1OC8A 4GXZA 2HRNA 2FCHA 5ECPB 1GTBA 1AQWA 1THXA 4G2EA 2TIRA 2YNXA 1HNBA 2R5GA 4TW5A 1QK8A 1YY7A 3CSHA 3LXZA 3EU3A 1XWAA 3P90A 1T3BA 4PQHA 1HQOA 4RI7A 2F8FA 2KLXA 3HD5A 5JCWA 4XS4A 4KX4A 1UC7A 3HYPA 4BL7A 1DUGA 3L9UA 5D9WA 4MF7A 1O85A 3TRPA 4BA7A 5ECOB 1ERTA 5G1KA 1AC1A 1LBKA 1IYHA 3KZQA 4JRRA 1GSDA 3DIEA 1TU8A 1FB6A 3CMIA 1K0CA 3IOSA 2HE3A 3GKXA 3KJYA 5DALA 3SBCA 3NZNA 3KMNA 5IO2A 4PURA 2GQKA 3IK7A 4KA0A 2FA4A 4FIWA 1ERWA 5COHA 5DAKA 1X9SB 3F3RA 1RW1A 2CVKA 4HEA2 4N11A 4NV5A 1USBA 3G7JA 1YF0A 3EMPA 1JHBA 2RLIA 1NW2A 4HU7A 5HFIA 3VI5A 1A24A 3LFLA 1GLQA 4RQRA 5FHIA 2VIMA 4I6XA 1TTZA 2L5OA 4KAEA 2X8GA 4IS0A 3C71A 1HD2A 2GSSA 4J57E 3F4TA 1PSQA 2H30A 4L0UA 2D2ZA 5J4UA 4E8EA 4N10A 3FZ9A 3LORA 3GKKA 4BWSA 1BG5A 5HR2A 3QPMA 2VL3A 3N5OA 2CV4A 5IMZA 1WPIA 3MSZA 1GSEA 4IP1A 5KN3A 3LJRA 3LEFA 3M9JA 3GH9A 4N30A 2LV3A 3EC3A 5F8BA 2OKAA 1OE8A 2HSHA 3FYGA 4JZQA 4V2MA 4JR4A 3TJFA 1G6WA 3APOA 1TOFA 4KUNA 2PPTA 5D9VA 1OC9B 2YWIA 2YWOA 1YKCA 1J0FA 4PGTA 1ML6A 3DEXA 2X64A 3FRCA 5JWRB 3DMLA 1EV4A 2HNLA 4CDOA 1EEJA 3RBTA 2I4AA 4MH3A 5G5FA 4NXIA 1OVNA 3VWUA 1Z7RA 3FHKA 3MAKA 6GSSA 3BBYA 4IVFA 4ZBBA 5ID2A 1PL2A 4ZXGA 1GUHA 4F2IA 4DSRA 2K8SA 1XOAA 4RI6A 2DJ3A 1GP1A 1W89A 4MJBA 3ZMLA 4KH7A 1SENA 3ZREA 2IMDA 4XRAA 2IN3A 1PD21 2NDOA 5D9XA 2H71A 1TDIA 5D9TA 1M2BA 2L6DA 3W6GA 4KCEA 4ZB8A 1O73A 5J9BA 2CX3A 5LNKe 5B8BA 4OCEA 2LS5A 3PGTA 4LA1A 1HYUA 2H0GA 2HZEB 5JCGA 3QAVA 5C04A 1B9YC 4DVCA 2DIZA 1BX9A 3W8JA 3C1SA 2XPDA 2X8HA 3QMXA 4ML6A 3VI7A 5CRWA 3CYNA 3GIXA 4I8BA 2B7KA 3C73A 4JR6A 3HXSA 2LRCA 2MYGA 4MF5A 3J7Yk 3A2VA 5D8IA 1MEKA 3U6VA 1WE0A 2QSIA 1ZOFA 3QCPA 1ZL9A 4FO5A 1GTAA 3F4SA 3A5WA 4F03A 4IHUA 4V1Ap 4O5RA 3EWLA 3M3MA 20GSA 2IMIA 3KGKA 4DSSB 5IOWA 4TXVA 5HQPA 1YDKA 5IM9A 4HS1A 3GTUA 4MJEA 4L8EA 4PQ1A 1XVQA 3M1GA 5J9CA 3TOUA 1T4ZA 2HZFA 1VF4A 4Q5QA 5IO0A 4K8MA 5C00A 1FAAA 5DQYA 1QMVA 3C8EA 2KP1A 3WGEA 4TOPA 2VM2A 2GZPA 1SKWB 2RUEA 2JSZA 3SWLA 2H66A 4L0WA 1MD3A 1XBSA 10GSA 1TRUA 4O32A 2VLTA 3VPTA 2JSYA 2OA7A 2VL2C 4NHWA 3MWHA 1JLVA 4HJ2A 17GSA 1BEDA 3FY7A 4EVMA 2L4CA 4MABA 2KOKA 5G2ZA 4ECCA 1Z9HA 1SKRB 3CSIA 2DJ1A 4WF4A 3A2XA 2I9HA 2JL4A 3G7YA 3TKQA 4WETA 5KN2A 5LCZA 3TKSA 1XW6A 2IWTA 1UVZA 1ZYQB 2A4VA 3CRUA 2M80A 4O7HA 4QQ7A 2AV4A 2IYJA 1YEXA 2B6MA 1AUCA 3E0UA 3ZLPA 2C3QA 2IPAA 3GSTA 3QAWA 1R7HA 2OACA 2GSRA 1MDKA 2XC2A 3HJPA 3UJ1A 3NOFA 3BOAA 1Q98A 3UOMA 4IJIA 2WZ9A 4PUAA 4K2DA 5DJMA 3RPNA 5J41A 4HI7A 3H8QA 2WJUA 1ZGNA 4ZBDA 2RUFA 3GFKA 3WD6A 2V32A 5FT3A 1OKTA 4KGIA 1EZKA 2GSQA 2HYXA 1A2LA 3Q19A 1SK1A 3TRQA 2KHPA 2RM6A 3E3EA 1EGRA 4F9ZA 2LRNA 2P0GA 2EIRA 2YN1A 4L5OA 5IOXA 3DWVA 2DMMA 4KCAA 2EIOA 2ON7A 1Y6EA 3RDWA 3FR6A 4WBRD 4HDEA 1F2EA 4LLRA 1OC9A 3ERWA 5G31A 3ME7A 4X0XA 3UBLA 1IYIA 3DRNA 2AUVA 5B6NA 3I69A 5ECIB 3TJGA 3LXTA 4PQIA 2REMA 5CRHA 3WYWA 4ZB6A 1GTIA 4JEDA 2HRFA 2PGTA 2YZHA 4LMWA 2EIQA 2OJLA 2VO4A 3RHCA 3KH9A 3GKNA 3WGXA 2PWJA 5EY6A 3LYKA 1OAZA 2RM5A 2V6KA 2V1MA 3CTGA 3D4MA 2H19A 4GF0A 2J23A 2FD3A 2DMLA 2F9SA 1SD8A 1YF1A 1KNGA 4D73B 4ZL9A 2DSAA 2I1UA 1H75A 4MP4A 2LEGA 3GV1A 4HU9A 1XWKA 3UEMA 3D6IA 3D21A 2YZUA 4ACSA 2HLSA 1E2YA 2IMEA 1K3LA 1E6BA 2OE0A 4HJMA 5GAPD 2O89A 1A8LA 4IW9A 4K1FA 1XFLA 2ZCTA 3GRXA 2VD1A 2TRCP 4MMMA 2VOCA 4RUVA 2HZEA 2HSYA 3TDGA 3ZZXA 5JWOB 5IIZA 3AY8A 5CP1A 4HUAA 3FW2A 3CBUA 2ZUPA 4GQCA 1M2DA 2H72A 3IBHA 3VWWA 2CA8A 5J5NA 4ZBAA 3HY2A 7GSSA 1V9WA 1M7TA 3MDKA 1U87A 4MZBA 1T7PB 4G19A 1FG4A 3HDCA 4POLA 1XCCA 2MBTA 1GH2A 2GTUA 3GYKA 4Q5RA 4I97A 1O8WA 4BVYA 1O7UA 4OWYA 3VURA 2C0GA 3DXBA 2Z9SA 2VCVA 1PMTA 5E4WA 1SJ6A 4BPYA 1K0AA 4PXOA 3R2QA 4KDUA 3IXRA 1FW1A 4WR5A 2GZZA 4FYUA 4NMUA 1B8XA 1B9XC 4WKWA 3TGZA 2C8UA 3D22A 1KBNA 3HA9A 3ZMKA 2P5RA 2C3NA 3K8NA 3LGCA 5F06A 3WT2A 2H1AA 2DJ2A 2XHFA 2IFQB 2H8LA 1TP9A 4EL1A 4QL7A 3KD0A 1N2AA 3IK9A 3UL3A 3VFIA 3FEUA 1TW9A 3TJKA 2ES7A 3ZVJA 3IE3A 1A0FA 4GRFA 1GSSA 1RQMA 4K7IA 4OFNA 4K7OA 4KNDA 3L9SA 2IMFA 2IY2A 2H0IA 1TK0B 4HOJA 4I5QA 2FUG2 3H1NA 5H5RA 1C72A 3TKPA 2L6CA 1VF1A 6GSXA 1WOUA 2WB9A 3F6DA 1T8EB 2B3SA 3ZFLA 2VCTA 1Y25A 3CRTA 3LG6A 1V58A 2CAQA 3VWVA 2VCQA 1G7OA 1XWCA 2V6OA 1F3BA 4EKZA 4TR1B 4TVEA 5CO3A 4N0VA 4ECBA 12GSA 1EP8A 3ERFA 1WIKA 2B7JA 3CXGA 1PA3A 5E59A 5HR3A 3N9JA 1J08A 2JACA 1VF2A 2J9HA 4HQZA 4WBJA 1T00A 2LJRA 1NHOA 4G10A 4X43A 1SYXA 5ECHB 1S3CA 1X0RA 2MZCA 3IV4A 1AQXA 1YJ6A 2CZ2A 4CHSA 4NV2A 2E2GA 4TKYA 3UVHA 4K0NA 5CRGA 1T4YA 5GSTA 1PKZA 2E7PA 5AIVA 3C1RA 1U6TA 2LQOA 6GSTA 2GT6A 2YJ7A 5H5QA 3KXOA 3TRXA 2B1KA 4POKA 3M9KA 1GSFA 1FVJA 4OO5A 1V98A 1G7EA 3U5RE 2C0DA 8GSSA 3ZYWA 1DBYA 3IAS2 3TKSE 1WMJA 3F6FA 1FVKA 4EUYA 1XZOA 1BQ7A 3P2AA 5EPFA 3F9UA 1X5EA 3L78A 2HXKA 2VAFA 4EDYA 2R4VA 5GSSA 1EGOA 1GLPA 4JU5A 2V41A 2ZNMA 2E0QA 2H6XA 5ELGA 4WF5A 2DIYA 3IRAA 2MMOA 3DVWA 3I6AA 2BTOT 2DLXA 4XCSA 3ZITA 19GSA 2FHEA 1NHYA 4XS6A 2G2QA 3QOUA 4FH8A 5EL8A 4TXOA 1O8XA 2DBCA 2NPBA 4OCFA 1AIUA 1ST9A 1ZCPA 1THOA 2F51A 2IMKA 3IC4A 1SL1B 3PH9A 5DALB 2HI7A 3IAM2 5L71A 3Q74A 4G9HA 2TRXA 2YP6A 5A5KA 1V57A 1R5PA 4E8HA 3KM6A 2FGXA 4PX1A 2MBSA 5DAKB 3F63A 2I81A 1A0RP 4ISDA 4MH2A 4ILFA 1UA5A 4MPFA 2B5XA 5A4WA 1ERVA 5FWGA 2H1BA 4ZIJA 5CNWA 4MPGA 2OE3A 2WGRA 2GDRA 2H6YA 3RAZA 1JLWA 3CSJA 3F4RA 2P5QA 4HZ2A 4POMA 4LMVA 4V1Ag 2YV7A 1TK5B 2B1LA 2YWMA 4JBBA 1ERUA 3OR5A 4Q5NA 3ISOA 2OE1A 4MF6A 1TKDB 3GURA 4IQAA 5LD0A 2LSTA 3C7MA 2N5FA 1I5GA 5AGYA 1XIYA 1PRXA 1PQNA 3APSA 4GQFA 1B4QA 1AW9A 1TRWA 1B48A 5ENUA 1CQGA 4FYBA 2CAIA 2JZTA 4Z7XA 3ZVJD 1AAZA 2MMZA 1Z7PA 1CQHA 2GLRA 1NSWA 1FO5A 6GSVA 4KW6A 5ECLB 1LJRA 2VCXA 1X5CA 2OBKA 5B7CA 2C80A 4EF0A 4WXTA 4MK3A 2LNSA 2FY6A 5F05A 1NM3A 4KSMA 2VD0A 3EMXA 3DVXA 5AN1A 3PINA 2WFCA 1GULA 5IQYA 2BMXA 1U88A 1YQ1A 16GSA 1TI1A 3JCML 1I9DA 1JZRA 5D93A 4MZCA 2HT9A 1Z3EA 1DE2A 3GHAA 4EDZA 2PERA 4GSNA 3LWAA 4L5LA 4YAVA 1JZDA 3DKSA 4EO3A 5IPHA 1M9AA 4RQXA 2PMTA 2C0FA 4ECJA 5HR1A 1M0UA 5AIXA 4BVXA 3QDNA 5IMDA 2ALBA 3BD2A 4MJAA 5DCGA 3I9V2 4J2FA 3GL3A 1SYRA 3LSZA 1S3AA 1F6MC 4YQMA 2PUKC 2V2GA 3F8UA 1GTUA 1QFNA 1M99A 4HQSA 4KDYA 2VL2A 3HVSA 2GGTA 1X9WB 2GQMA 2DJ0A 1M2AA 1V40A 2P31A 3E9JB 1TRSA 4Q5FA 3S9FA 2IIYA 1ACVA 3FZAA 1BYEA 4CW9A 4ZL7A 3QFBC 5DJLA 1PX7A 1S3DA 3H79A 4WEYA 5IMFA 3BJ5A 1SL0B 2AAWA 1DSBA 4ID0A 1GUMA 2WULA 2AB6A 1XW9A 1ZMAA 4PNGA 2XBIA 2LRTA 5KEJA 5ECNB 3PR8A 1EV9A 3HKRA 3LQ7A 3ZL5A 4I2UA 4GCIA 2L4QA 3VK9A 1GRXA 1QUWA 2GSTA 3GH6A 2PVOC 4PNFA 3A2WA 1XPVA 3VWXA 3L9VA 3QFAC 1X9MB 3FZ5A 5J3RA 2C4JA 4ZB9A 3KH7A 2IJYA 1JZWA 3TB2A 2FWFA 2GT5A 5DDLA 3GTUB 1PGTA 4N0ZA 1JZOA 3UIWA 5GAND 5ECQB 1XOBA 1SL2B 3D0ZA 2H76A 4AF2A 1G6YA 2YV9A 3HHVA 2BJXA 2L57A 2LJKA 2FWHA 3NIVA 1FOVA 3KEBA 1R4WA 1F9MA 2CVDA 1K3YA 1BJXA 4XS1A 2O87A 3QR6A 2JADA 2K9FA 2LNTA 4OO4A 3ZIJA 1ILOA 4XHMA 1U3AA 3DYRA 2M46A 4DSSA 2ON5A 2VCZA 3GUSA 2FA8A 2AJQB 4DEJA 1FHEA 1Z5YE 4AJ7A 3O76A 2I3YA 4BWQA 2VLVA 5A4UA 3WT1A 1SKSB 2VM1A 4TN8A 1SK2A 4AGSA 3FZ4A 4LL4B 5G30A 4EC0A 1F3AA 1TXXA 14GSA 1GSUA 3EVIA 2VL9A
chains in the Genus database with same CATH superfamily
3OWSA 2AYTA 3K7CA 4CY8A 1VQM3 3KCMA 3UARA 4OMVA 4AJ8A 1Q4JA 2K6VA 3GA4A 1IQXA 2BT3A 3RPPA 4IGJA 1SK0A 3W8SA 4P3YB 13GSA 3AMOB 1VQN3 1T2IA 3NXJA 3HOHA 4FMAA 4ZL8A 3NV0A 3G9BA 4XIHA 1FGTA 4HM2B 11GSA 3FKFA 3HCZA 3TJJA 3IR4A 1J9BA 1PX6A 1MDIA 3TOTA 2GBXB 4IN0A 1JB5A 1LNHA 3VGNA 1H4OA 4GTUA 4AJ6A 4MCUA 4KSOA 5CREA 1I3IA 5CAXA 1PN9A 1Q7Y4 2PBJA 1GSYA 6GSWA 5IG4A 2H6ZA 1BAYA 2YPMA 3GSPA 3EU4A 1PN0A 5KN0A 1G0TA 2RSXA 22GSA 2GS3A 2EC4A 3FKAA 2LUSA 4IJ3A 3I43A 4OFMA 1OE7A 1GL8A 1OHPA 2GSPA 3FK8A 1HU9A 1EP7A 1TU5A 3IC8A 3VPQA 1JKGB 3MSOA 1SU9A 3MNGA 4JE1A 3CPW2 4RZMA 1IDPA 2O85A 2K0MA 3IDVA 2H74A 2X8CA 1E3RA 1EKMA 4TR4A 3TCOA 2BIRA 1N8QA 1BIRA 1O81A 1JFUA 1A8YA 2KAAA 4MDCA 3D4TA 3CPOA 1IVXA 3GL5A 1T5YA 4J56E 3HVVA 2RCDA 4ZM8A 4KB3A 3D79A 1WWJA 2K18A 4GWRA 2LQQA 4TR0A 3GSSA 2SBLA 4MJCA 1HNCA 2OQEA 2OBIA 1BSEA 3IA1A 1U3IA 1NO3A 5B6MA 1F37A 4POBA 2MMNA 4XDVA 1BSBA 2MMAA 5JPUA 1JBSA 3D5JA 4NWYA 2LQVA 4KE3A 1UGHI 4L7KA 3US3A 4R4KA 1EOGA 5IPGA 3FG3A 3ZG5A 2R2JA 2WO0A 2O8VB 3HX8A 4GLTA 3GZYB 4GSSA 2GZYA 1R26A 1QQ2A 3EN1B 3FG1A 1Q824 1TI3A 2B5YA 3QAGA 3APQA 2XH9A 1VQ63 8RNTA 2K8VA 2W6JH 3IJEB 3QRDA 5CRDA 3JUOA 1VF3A 3JUQA 1B3SA 2H01A 3NM7A 5BXQA 5H5SA 3ED3A 1NWWA 4LL1B 3R3EA 5F07A 4MZWA 5GZZB 1O6JA 1ON4A 1W6GA 4IBPA 4GSPA 2OADA 2H0HA 2W56B 4IQ1A 4STDA 2JZRA 2DKHA 4V2LA 5F0GA 1K734 2NBSA 3HVXA 6GSYA 2BO9B 2YJHA 1SPUA 3NX0A 2FWEA 8CHOA 1ABAA 1KC84 1GWCA 3GKMA 4BL2A 3NBJA 1TUHA 3KMOA 1XVWA 1GY5A 3G7IA 1YZXA 4DSQA 5G1LA 2FWGA 3WGDA 3DGYA 1XW5A 3LOYA 3F3QA 2M72A 1T1VA 4KVHA 1K0OA 2CZ3A 4PUFC 1YKAA 1HZ1A 2BMOB 3BNDA 4K0GA 3LTAA 1Q814 3DD3A 4EV2A 4YH2A 2DJJA 2QKEA 4XS4B 1V2AA 1N5PA 5ABRA 2H75A 1GUKA 5DVBA 3GX8A 2XF3A 1JBRA 1K0NA 3TKSC 3SYUA 1N8JA 4ECIA 3ME8A 1PKWA 3CCL3 2N5AA 4KDXA 4D73A 3P7XA 3IHQA 3EYTA 1UCIA 1OC3A 2R3XA 1QGVA 3P8WA 1JN5A 1BNRA 2A2RA 1YGEA 2F3MA 4OD7A 5KN1A 4I2TA 3B4PA 5JCUA 2QC7A 2L59A 4ULXA 1GS3A 3A3TA 2H70A 1VZZA 4NPBA 1A2KA 5JWQB 4LSOA 1FGMA 3CME3 1BGSA 2E2UA 2GQLA 3HVNA 4XRDA 3NHXA 4BVYB 3LXUX 3HJOA 3QD9A 4CCVA 5D73A 1B2SA 1MGWA 2CX4A 1BNEA 4ML1A 5ECRB 2FLSA 1DETA 4XTSA 5ELAA 1MTCA 2XR8B 3GNJA 5M18A 1Z6NA 2XGLA 2H1DA 2A2SA 1OYJA 4G1MB 1BUJA 1NNVA 1WP0A 1XWBA 4IELA 1LOYA 1R4YA 1R5AA 3MIXA 4WYKA 7RNTA 2CFDA 1TK8B 2O7KA 3UVTA 1X1UA 2IUKA 1URMA 5A4VA 1MDJA 2L5LA 3ZTLA 5INYA 3FR9A 3V1WA 2WS2A 4NAXA 5AISA 1EOHA 4IP6A 2H73A 3TKRA 1M9BA 3M8NA 5AIGA 3GN3A 2CQ9A 1XWGA 3WOFB 3BCKA 1GSQA 3KIIA 1I70A 2FNOA 1GSPA 3ZRDA 3L0HA 1QJGA 3D9RA 1OHOA 1A2JA 5KP3A 4YAPA 9GSSA 4K6XA 6GSUA 5I97A 4YKGA 1QVG2 5DBQA 5AYSC 4K9ZA 4J8TA 1I2GA 1DE1A 3G6E3 1BAOA 3O3TA 2WCIA 3F0IA 2PVQA 4WR4A 1GNEA 3EF8A 4TR3A 3MHEA 4F0BA 1B4PA 3KIJA 1VRSD 4ZILA 1SD9A 2CT6A 5EEOA 4X1UA 2KUCA 3H4KA 2YANA 2VUPA 1IK3A 3FLJA 2YCDA 3GZBA 2F8AA 5IG0A 2D42A 3G0KA 5DCHA 2JZSA 2IFQA 3FCSB 1SJIA 5EQLA 1Q864 3M8CA 3UBKA 1GNWA 1KTEA 1W00A 2N5BA 3KP9A 4GSTA 4F82A 5ECKB 2H1GA 3Q18A 3NUVA 1G02A 1RRLA 1W4VA 3SXXA 5DQSA 1X5DA 2JU5A 1EWXA 4NHZA 4MA9A 3RHBA 3J7Yd 2HFDA 5HFKA 3UMAA 3ZIVA 4MMYB 2LTKA 2NTOA 5G5EA 5B8AA 3FZWA 2LKUA 3NQYA 1M1K4 1SJZA 1DMNA 1Z6MA 1FB0A 1M3IA 2W04A 1IV7A 3AMOA 1RK4A 2W9QA 3KTLA 4H86A 4OFTA 2C3TA 2VCWA 5TGNA 2Q07A 1M904 2CVBA 1RGGA 3NBBA 3HZ8A 3KTBA 3EQQB 2HMJB 3OV4A 1YIJ3 1TRVA 2PN8A 5ECMB 2GVPA 1YEPA 1A2MA 3WOEB 2C1YA 2CX0A 2AHEA 2P05A 3IPZA 4YQVA 1IYYA 2X99A 3ROBA 3TUEA 2LJAA 4KFDA 3EE2A 3Q6OA 5ID2B 5HOHA 5ECSA 2WRTA 3L4NA 1FUWA 1OPYA 4V2NA 4EE0A 9RNTA 3FR3A 1TJDA 1VGLA 2VLUA 3KP8A 4IKHA 2W2CA 5IMCA 1K0DA 1ZGXA 1K3OA 2R37A 18GSA 2KCDA 1EEMA 1PL1A 1UN2A 1WJKA 1MOLA 3S28A 2DJKA 3X3XA 5D96A 3LYPA 1OUNA 1UUGB 4X2HA 1PYLA 4XM4A 2QGVA 5IMAA 3CCJ3 4TR1A 2HMLB 1E3VA 2C0EA 3HZ4A 1MD4A 2DC5A 3J7Yb 3K0ZA 2OOVC 2NVLA 4K7NA 2G0FA 3M0FA 1A67A 4FYCA 4O92A 3EJVA 3S27A 5IG5A 2GEXA 3O6TA 3PYJA 3ERGA 5EVOA 4BL3A 3B7CA 1AXDA 3RGAA 1LU4A 3EINA 2BU4A 4YQUA 4F0CA 2B24B 2XPEA 5HFGA 3DGQA 1RGFA 2CX1A 2B5EA 5IMVA 1OKDA 3RNTA 4GHOA 3EURA 1IQYA 1EUIC 2R6KA 3CTFA 1WRYA 1CYUA 1AQVA 3GMFA 3VLNA 1KEBA 2STDA 3BCIA 2RIIA 2AADA 2E2MA 3TJBA 3GX0A 2KRTA 1ZYNA 4MNNA 5CF2A 2Z7AA 4HZ4A 1SJWA 3UAPA 1A23A 1YJN3 4MLYA 4R80A 2KP2A 2YX9A 4QL9A 2WDUA 1K0BA 5BRTA 1BRHA 1ZZYA 1BRJA 5CYYA 1ZYEA 4G0KA 5HR0A 1ASKA 1XXUA 2JDIH 2YWNA 1HNAA 5CLKA 2YOIA 2PU9C 3ZFBA 4EXJA 3HIIA 1UCJA 3HJMA 1QXHA 1SARA 4KFEA 1TU7A 3ECFA 3H93A 1RGEA 3PZWA 4TRXA 1IVVA 1W7CA 4TXOB 2IL3A 2XBQA 1K0MA 1OC8A 4GXZA 2HRNA 2FCHA 7GSPA 2W56A 5ECPB 1BRNL 1GTBA 1UUVB 1AQWA 1THXA 1SIIA 1VQ93 4G2EA 2TIRA 5KOXA 1A2PA 1UCKA 2YNXA 1HNBA 1RN1A 4Z2RA 1DE3A 2R5GA 1I2EA 1KSIA 4TW5A 4U13A 2J8XB 1QK8A 1YY7A 3DM8A 3CSHA 4EIPA 3LXZA 3EU3A 1NB3I 3FG4A 1XWAA 3P90A 1T3BA 1ROVA 4PQHA 1HQOA 1FW7A 4H61A 4RI7A 3X40A 3WA3A 2F8FA 1CQSA 1O7GB 2KLXA 3HD5A 5JCWA 4XS4A 1HYFA 4KX4A 1UC7A 4K1VA 3HYPA 1QAKA 1TFOA 4BL7A 1DUGA 3L9UA 5D9WA 4MF7A 1YNVX 1JB4A 1O85A 3TRPA 4BA7A 5ECOB 1WNHA 1ERTA 5G1KA 1AC1A 1LBKA 3D4AA 2FNQA 3KCHA 3SEDA 3FSDA 1IYHA 3KZQA 4JRRA 1GSDA 5RNTA 3DIEA 1TU8A 1RSNA 5AIFA 1FB6A 3CMIA 1K0CA 3IOSA 2HE3A 4G0LA 3GKXA 3KJYA 2UGIA 5DALA 3SBCA 3NBRA 3NZNA 3KMNA 5IO2A 4PURA 1RNTA 2GQKA 2OQEC 3IK7A 4KA0A 4EYCA 2FA4A 3AHSA 2RFRA 4FIWA 1ERWA 1C7HA 1QALA 1ULJB 5COHA 5DAKA 1X9SB 1LOWA 3F3RA 4BTWA 1RW1A 2CVKA 2QEX3 4HEA2 4N11A 4NV5A 2CKFB 1USBA 3G7JA 1YF0A 2F5MA 1W6YA 3EMPA 1JHBA 2RLIA 2X49A 1LVNA 1NW2A 4HU7A 5HFIA 3VI5A 1A24A 3LFLA 1IQ8A 1GLQA 3LT9A 2A15A 4RQRA 5FHIA 4KFFA 2VIMA 2CFGA 1BRGA 4I6XA 3EX9A 1WMOA 3DXOA 1TTZA 2L5OA 4ICYA 4KAEA 2X8GA 4IS0A 3C71A 1HD2A 2GSSA 4WHAA 3BIRA 3LZAA 1PSQA 4AEQA 2H30A 3F4TA 4J57E 4L0UA 1FGRA 1M3JA 2D2ZA 5J4UA 2IUJA 4E8EA 4N10A 3AHWA 3FZ9A 2BMQB 3LORA 3GKKA 4BWSA 3A5EA 1OACA 1BG5A 4G0IA 3KZTA 5HR2A 3QPMA 2VL3A 3N5OA 2CV4A 5IMZA 1WPIA 3MSZA 1GSEA 1U8CB 4WWUC 4IP1A 5KN3A 4H3UA 1V74A 3GAXA 3LJRA 3LEFA 3M9JA 3GH9A 4N30A 2XRXB 2LV3A 3EC3A 5HGRA 2OKAA 5F8BA 1OE8A 2HSHA 3FYGA 4JZQA 4V2MA 5KP4A 4XDWA 4JR4A 1EA2A 3U1WA 3TJFA 1T2HA 3LH4A 1G6WA 1XG8A 2C4BA 3ZFZA 3APOA 3GZRA 4BVXB 2Z76A 2KXGA 4IIAA 1TOFA 5D83A 1GOVA 4KUNA 2PPTA 5D9VA 2W9PA 1FOHA 3DZLA 1OC9B 1YGWA 2HMMB 3UL6A 2YWIA 4LGQA 2YWOA 1YKCA 1FA3A 1J0FA 3JUNA 4PGTA 1ML6A 3DEXA 2X64A 3FRCA 5JWRB 3DMLA 1EV4A 2HNLA 1IV9A 4CDOA 1EEJA 2INXA 2ZHXB 1O7NB 3RBTA 2I4AA 4MH3A 1UCLA 3CCQ3 4J9AA 5G5FA 5IF6A 4NXIA 1OVNA 3VWUA 1QVF2 1Z7RA 3F7XA 3FHKA 1RGAA 3JUPA 3F14A 1B21A 3MAKA 6GSSA 3BBYA 1CEWI 1WMPA 2P09A 2GXFA 4IVFA 4ZBBA 5ID2A 2KF5A 3URPA 1QAFA 4BTYA 4MMXB 4HJLB 4HM6B 1PL2A 4ZXGA 1GUHA 1O7HB 4F2IA 4DSRA 4FMBA 2K8SA 1XOAA 4RI6A 3T8UA 2DJ3A 3KKGA 3RDEA 3ZG0A 1GP1A 2RNTA 3F9SA 5IENA 3D5GA 1W89A 4MJBA 4CY6A 3ZMLA 4X2OA 4KH7A 1B27A 1SENA 3ZREA 4O02B 3HK4A 4CPKA 2IMDA 4Q53A 4XRAA 3EBYA 2IN3A 1PD21 2NDOA 1I3FA 3Q90A 2UUGC 1W01A 1M1XB 5D9XA 2H71A 1TDIA 5D9TA 1M2BA 2L6DA 3W6GA 4CJNA 4KCEA 2MF7A 1O73A 4ZB8A 2HSMA 1JRQA 5J9BA 2HRAA 4FCZA 3DGLA 2CX3A 1S5AA 5LNKe 2QIYA 1I2FA 5B8BA 4OCEA 2LS5A 2CFWA 2CFLA 3PGTA 4K90B 4LA1A 1HYUA 2H0GA 1OCVA 2HZEB 4K5RA 5JCGA 1DMMA 1WQLB 4OUQA 3QAVA 2WGOA 5C04A 1B9YC 4R9KA 4DVCA 1BNFA 2DIZA 1N9JA 1I0VA 3S29A 1BX9A 3W8JA 3C1SA 2XPDA 2X8HA 4FMDA 3QMXA 4ML6A 3VI7A 1OH0A 1BNIA 5CRWA 3CYNA 3GIXA 5EVHA 4I8BA 2YFJB 2B7KA 3C73A 4JR6A 3HXSA 2LRCA 2MYGA 1BANA 1AVKA 3EC9A 5BMUA 4MF5A 4PEJA 4HVNA 4O3VA 3J7Yk 3A2VA 5D8IA 1O7WB 2I9WA 1MEKA 3U6VA 1WE0A 2QSIA 4HZ9B 1ZOFA 3QCPA 2FGTA 4KT3B 1S723 1ZL9A 1K28A 4FO5A 1GTAA 3A76A 4BU4A 3FH1A 3F4SA 3A5WA 5ELUA 4F03A 1FUTA 4IHUA 1BOXA 3NQZA 2R0PA 1RCKA 4V1Ap 4O5RA 5JPPA 3EWLA 3M3MA 1R4CA 4AKYA 20GSA 3EBTA 2IMIA 4TX4A 3SVAA 3KGKA 4DSSB 5IOWA 3CCU3 2WGQA 4TXVA 5HQPA 2XFSA 1YDKA 1AVLA 1GY7A 4Z2UA 6GSPA 5IM9A 4HS1A 3GWRA 1S3RA 3GTUA 1D6ZA 1Q40B 4MJEA 4L8EA 4PQ1A 1XVQA 1MWTA 5JBSA 3M1GA 3PCRA 5J9CA 3TOUA 1T4ZA 3KFQC 2HZFA 1VF4A 4N6NB 4Q5QA 5IO0A 4K8MA 5C00A 1FAAA 1GYBA 5DQYA 1QMVA 2ML5A 3C8EA 1OGXA 2KP1A 1NJI4 3CC43 3WGEA 1IT7A 4TOPA 2VM2A 2GZPA 1SKWB 3MG1A 2RUEA 2JSZA 4HM1B 3SWLA 2H66A 4L0WA 3UB1A 4MMZB 1MD3A 1VQ53 4J5KA 1XBSA 4MJDA 10GSA 1TRUA 4O32A 3NV0B 2VLTA 3VPTA 3EPTA 4EC6A 2JSYA 2OA7A 2VL2C 3N9HA 4NHWA 3WHOA 3MWHA 2XFTA 1JLVA 4HJ2A 17GSA 1BEDA 3FY7A 4EVMA 2L4CA 4O2HA 4MABA 2KOKA 5G2ZA 2R41A 4ECCA 1GD3A 1Z9HA 2GEYA 1SKRB 3CSIA 2DJ1A 2XGNA 4WF4A 1BU4A 3A2XA 2BNGA 2W0QA 2I9HA 2JL4A 3G7YA 3TKQA 4WETA 1RCLA 5KN2A 3LT8A 3KN4A 5LCZA 1LQGC 3TKSA 1BNSA 4XBXA 1XW6A 2KF4A 2IWTA 1ISKA 1UVZA 1ZYQB 3SLUA 3Q2PA 4N6LA 4FR9A 2A4VA 1BNGA 3CRUA 3CCS3 2M80A 4O7HA 1RHLA 1D6YA 1TIJA 4QQ7A 2AV4A 2IYJA 1YEXA 1MWSA 2B6MA 1AUCA 1E97A 3E0UA 3ZLPA 2C3QA 2IPAA 3GSTA 4LMIA 3MWZA 3CCE3 3QAWA 1R7HA 1IVUA 2SARA 2OACA 2F98A 2GSRA 2YFIB 1VQ83 2F99A 1MDKA 3F40A 2XC2A 2O9UX 3HJPA 3UJ1A 3NOFA 3BOAA 1Q98A 4AKZA 1RDSA 3UOMA 5G2GA 2R4IA 4IJIA 2WZ9A 4PUAA 4K2DA 1Q7HA 1TRPA 5DJMA 3RPNA 5J41A 4HI7A 3H8QA 4FMCA 2WJUA 1ZGNA 1UGIA 4ZBDA 3BNBA 3EE1A 4EV5A 1VQP3 2RUFA 3GFKA 1RGLA 1VQL3 3WD6A 2V32A 5FT3A 1OKTA 3V92A 4KGIA 1EZKA 2GSQA 4R1KA 2HYXA 1RMSA 3HI7A 1IT8A 1A2LA 3Q19A 1SK1A 3TRQA 2KHPA 2RM6A 3E3EA 1EGRA 1JKGA 1B2XA 4F9ZA 2LRNA 2P0GA 2EIRA 2YN1A 1AR0A 4L5OA 5IOXA 3DWVA 2DMMA 4KCAA 2EIOA 1DVDA 1Y6EA 2ON7A 1HKXA 3RDWA 1ROAA 3FR6A 4WBRD 4HDEA 1F2EA 4LLRA 3HZPA 1OC9A 3ERWA 3A5IA 5G31A 2Z77A 2HRKA 5IEPA 4EIQA 3ME7A 3SOYA 4X0XA 6RNTA 3UBLA 1IYIA 2Y74A 5IEOA 3DRNA 3G8ZA 3QK9A 2AUVA 5B6NA 3I69A 5ECIB 5M1AA 4QWTA 4LEHA 3TJGA 4JRFA 3LXTA 4PQIA 1MWUA 2REMA 5CRHA 3WYWA 4ZB6A 1GTIA 4JEDA 2HRFA 2PGTA 2YZHA 3K5TA 2ZDJA 4LMWA 2EIQA 2OJLA 6STDA 2VO4A 1L5GB 3RHCA 3Q1CA 2CWTA 3D5IA 3KH9A 3GKNA 3WGXA 2HMKB 2XEPA 2B1XB 2IMJA 2PWJA 3LYKA 5EY6A 1OAZA 1TTOA 2RM5A 2V6KA 1WMNA 1X1WA 2V1MA 3CTGA 3D4MA 2H19A 1UDII 4GF0A 1BRSA 1NU3A 2J23A 2FD3A 2AAEA 2DMLA 5CF1A 1SD8A 2F9SA 2HMNB 4O8SA 2CHCA 2D1WA 1YF1A 1KNGA 4D73B 4ZL9A 1YHQ3 2DSAA 2I1UA 1H75A 4MP4A 2LEGA 3UJMA 5BVBA 1Q42A 3HIGA 3OWUA 3GV1A 4HU9A 1XWKA 3S67A 3UEMA 1BSCA 3D6IA 1WTHA 3D21A 2YZUA 4ACSA 2HLSA 1E2YA 3OX9A 2IMEA 2CG1A 5M19A 1K3LA 3DH2A 1E6BA 2OE0A 4HJMA 1STDA 5GAPD 2O89A 3DGNA 1A8LA 4IW9A 3WA2X 4K1FA 1XFLA 4L8PA 3H3HA 3EB8A 2ZCTA 3GRXA 2KF6A 1GMQA 2VD1A 2ZA4A 2TRCP 4HM7B 4MMMA 3G4S3 3AGOA 3MKIA 2YFLB 2VOCA 4RUVA 2QA1A 1K9M4 1JB2A 2K54A 1BSDA 2HZEA 3L0RA 3TDGA 2HSYA 3ZZXA 5JWOB 5IIZA 2R0GA 3AY8A 5CP1A 3X41A 1AQZA 3K9MC 4HUAA 3FW2A 3CBUA 2ZUPA 4HM5B 4GQCA 1M2DA 2H72A 3IBHA 3VWWA 4J5GA 2CA8A 3CC23 5J5NA 4ZBAA 3HY2A 7GSSA 2BHMA 3CC73 1V9WA 1LNIA 3BNEA 1FUSA 4N6TA 1M7TA 1U87A 3MDKA 4MZBA 1T7PB 1YIT3 4G19A 1FG4A 3V99A 3MG2A 3HDCA 4POLA 3OW22 2OOVA 5D81A 1XCCA 2MBTA 1GH2A 2GTUA 3GYKA 1TFKA 4Q5RA 3GZXB 4I97A 1SIHA 1O8WA 3DGMA 3OWYA 5FGOA 4BVYA 1O7UA 4OWYA 3VURA 2P0MA 2C0GA 5KOWA 3DXBA 2Z9SA 2VCVA 3MYDA 1PMTA 4XBYA 5E4WA 1SJ6A 4BPYA 1K0AA 3DUKA 2F4YA 1STFI 1W2ZA 2GU1A 3EN8A 3IXRA 3R2QA 2OCTA 4KDUA 4PXOA 1FW1A 4NHFA 2GZZA 4WR5A 1LQMB 1KWIA 4FYUA 4NMUA 3KSPA 1A2VA 1B8XA 4R9LA 1B9XC 3BLZA 4WKWA 3TGZA 2C8UA 3D22A 1KBNA 1W2B2 3HA9A 3ZMKA 2P5RA 2C3NA 3K8NA 3LGCA 5F06A 2WOHA 3WT2A 2H1AA 3CCR3 3GRDA 2DJ2A 3MYTA 2XHFA 4LYLB 2IFQB 2H8LA 1TP9A 4EL1A 4QL7A 3KD0A 1N2AA 3PS8A 3IK9A 3UL3A 2CFKA 3VFIA 3FEUA 1TW9A 2F56A 3TJKA 2A2PA 3IMAB 2ES7A 3ZVJA 3G16A 1W02A 2CWVA 4A5PA 3IE3A 1A0FA 4GRFA 3FF2A 1ZO2A 2R0CA 1GSSA 1TP6A 1RQMA 4K7IA 4OFNA 4N6UA 1YVBI 3E99A 4K7OA 2KF3A 4KNDA 3I553 3L9SA 2IMFA 2QA43 5CXOA 2CC3A 2IY2A 1CH0A 4Z2TA 2H0IA 1TK0B 2E2TA 1Y4KA 4HOJA 2CK3H 2BMRB 3JVCA 4I5QA 2FUG2 1BUQA 3H1NA 5H5RA 5AYRB 1C72A 2XSOB 3TKPA 2L6CA 1VF1A 6GSXA 1WOUA 2WB9A 3V98A 3F6DA 1T8EB 2B3SA 1FGOA 3ZFLA 2VCTA 1Y25A 3CRTA 3LG6A 1V58A 2CAQA 3VWVA 2VCQA 1RTUA 3IHGA 1G7OA 1XWCA 1RGCA 2CW9A 2E2VA 2IA7A 2V6OA 3N8BA 1KQS2 2OTJ3 1F3BA 1BRKA 3BNCA 4EKZA 2W03A 4TR1B 4HYZA 4TVEA 3PGBA 3T8NA 5CO3A 5GSPA 4N0VA 4ECBA 3X42A 12GSA 1EP8A 3ERFA 1U5OA 1WIKA 2B7JA 4HBRA 3AGNA 3CXGA 1PA3A 5E59A 2CWUA 5AEWB 1PU4A 5HR3A 3U97A 3CQFA 3N9JA 2HOHA 2FXTA 1J08A 2V1LA 2JACA 5DREA 1VF2A 4BTXA 2J9HA 4HQZA 4WBJA 5ELJA 3I0YA 1T00A 1G96A 2F86B 1NHOA 2LJRA 4G10A 4X43A 1SYXA 3ER7A 1MNLA 2ML6A 5ECHB 1S3CA 1X0RA 1W5ZA 1W6CA 2MZCA 5IG3A 3IV4A 3F8XA 1AQXA 1YJ6A 2CZ2A 4CHSA 4NV2A 2E2GA 4TKYA 3UVHA 4K0NA 4LZIA 4DKIA 5CRGA 3PXMA 1T4YA 5GSTA 3CXC2 4WFOA 1PKZA 2E7PA 3S5CA 1GOUA 5AIVA 3C1RA 1U6TA 2LQOA 6GSTA 2GT6A 1YJW3 2YJ7A 5H5QA 3KXOA 2A4HA 1PFPA 3TRXA 2B1KA 4POKA 3CCV3 2PNCA 4CDLA 3M9KA 1GSFA 1FVJA 4IPBA 4OO5A 3I563 1V98A 1G7EA 3U5RE 4EW5A 3CD63 2ZL8A 2C0DA 3WDGB 4MEIA 8GSSA 1FZUA 5AIIA 3ZYWA 1DBYA 4FQUA 1K8A4 3IAS2 3TKSE 1WMJA 3F6FA 1FVKA 4L8OA 2GU3A 1VQK3 4EUYA 1JJ22 4K1UA 1XZOA 2OWPA 1BQ7A 1GMRA 3P2AA 5EPFA 2HMOB 3F9UA 1X5EA 3L78A 2HXKA 2VAFA 4EDYA 2R4VA 5GSSA 1RN7A 1EGOA 1GLPA 4JU5A 4BIKA 2Z6BA 2V41A 2ZNMA 4XB5A 3WR2A 2E0QA 2H6XA 5ELGA 4WF5A 1RNBA 1YJ93 2DIYA 3IRAA 5DRVA 2MMOA 3DVWA 3I6AA 2BTOT 2DLXA 4XCSA 3ZITA 19GSA 4BL7B 2FHEA 1TRQA 1NHYA 1Q9EA 1IVWA 4XS6A 2G2QA 3QOUA 4FH8A 5EL8A 4TXOA 2CG0A 1RRHA 1O8XA 4PTSA 1MWRA 4OVMA 2DBCA 2NPBA 4OCFA 1AIUA 1ST9A 3O8YA 2K3DA 2M7OA 1ZCPA 1THOA 2F51A 2IMKA 3IC4A 5CK6A 3N54B 1SL1B 5FW5A 4EBGA 1FGQA 1N8R4 1KD14 2PZVA 1DMQA 4HM8B 3PH9A 5DALB 1VQ43 2HI7A 3IAM2 1OF5B 5L71A 3Q74A 1ZYPA 4G9HA 1NDOB 3JUMA 2TRXA 2YP6A 5A5KA 4FCJA 1V57A 1R5PA 4IT7A 4E8HA 3VF1A 3KM6A 2FGXA 4PX1A 2MBSA 3NM2A 5AEUB 3F63A 5DAKB 2I81A 3LTBA 1A0RP 4K2XA 1LOVA 4ISDA 3WMDA 4MH2A 4ILFA 3KE7A 2C10A 1UA5A 1B2ZA 1ERVA 2B5XA 1B2MA 2H1BA 4MPFA 5FWGA 4YKFA 4ZIJA 5CNWA 4MPGA 1NB5I 2JQ5A 2OE3A 2WGRA 2GDRA 2H6YA 3RAZA 1UI8A 1SQWA 1JLWA 2DKIA 3CSJA 3F4RA 3OXAA 2P5QA 3UL5A 4HZ2A 4POMA 4K61A 1BVIA 4LMVA 2MC8A 3MPHA 1EQKA 4V1Ag 2YV7A 1TK5B 3LTCA 2B1LA 2YWMA 3CCM3 4JBBA 1ERUA 1I0XA 3OR5A 1RLSA 1O7MB 4Q5NA 3SX1A 3ISOA 2OE1A 4MF6A 1TKDB 3CMA3 3GURA 1N9EA 1JNQA 4IQAA 2LSTA 5LD0A 3C7MA 2N5FA 1VQQA 1I5GA 5AGYA 3CNXA 1XIYA 1PRXA 1PQNA 3APSA 3RGRA 4GQFA 3F7SA 1B4QA 1AW9A 1TRWA 4KZ1A 1B48A 5ENUA 1CQGA 4FYBA 2CAIA 2UX0A 4HAAA 2JZTA 5BU4A 7STDA 1B20A 4N3VA 4Z7XA 3ZVJD 1AAZA 2C11A 2MMZA 1Z7PA 1CQHA 2GLRA 4N6V0 1NSWA 1JBTA 1VQ73 1FO5A 1BRIA 3VSYA 6GSVA 4KW6A 5IERA 1W4NA 5ECLB 2GBWB 1LJRA 2VCXA 1X5CA 4RNYA 2OTL3 1A90A 2OBKA 1B2UA 1RGHA 3UNLA 5B7CA 2RBIA 5AIHA 4GB5A 2C80A 4EF0A 2WOFA 2QGUA 4WXTA 4MK3A 2LNSA 2FY6A 1LOXA 5F05A 1NM3A 4KSMA 2VD0A 3EMXA 3DVXA 2XSHB 1I8VA 5AN1A 3PINA 2WFCA 5BIRA 2LYXA 1GULA 5IQYA 3G713 2BMXA 1U88A 1YQ1A 4O5UA 16GSA 1TI1A 1GOYA 3JCML 1I9DA 1JZRA 3BU4A 1YI23 3ALAA 4O5QA 2Y73A 1MGRA 5D93A 1CYVA 1OHSA 4MZCA 1ULIB 1PY3A 1BSAA 2HT9A 1Z3EA 4HSCX 1DE2A 3GHAA 1UI7A 4EDZA 2PERA 4GSNA 3LWAA 2O3OA 4L5LA 1JZDA 1RN4A 2CH9A 3DKSA 4YAVA 4EO3A 5IPHA 1M9AA 4RQXA 2PMTA 2C0FA 3KSED 4ECJA 5HR1A 1RJOA 1M0UA 5AIXA 4BVXA 2P0XA 3QDNA 4XBTA 3WODG 5IMDA 4N6MA 2RGQA 2ALBA 3BD2A 4MJAA 1GMPA 1JV2B 1D6UA 2F5WA 5DCGA 1ZS7A 3I9V2 4J2FA 3GL3A 1SYRA 3LSZA 3D3LA 1S3AA 3EHCA 2L4VA 3IPTA 3F8HA 3X3ZA 1F6MC 4YQMA 2PUKC 2V2GA 3F8UA 1GTUA 1RKYA 1PFOA 4HM0B 1QFNA 1M99A 1AY7A 1BNJA 1VQO3 4HQSA 3T0UA 2VL2A 4KDYA 3HVSA 2GGTA 4HZBB 1AV4A 1X9WB 2GQMA 2DJ0A 1M2AA 1V40A 2P31A 1GD4A 3E9JB 2L1SA 3LYGA 1TRSA 4Q5FA 3K63A 5IW9A 4HOHA 3H51A 3MG3A 4NREA 3S9FA 3X3YA 2IIYA 3DGOA 1ACVA 1J2BA 1QMAA 2CIUA 1YVSA 3FZAA 4RNTA 1BYEA 4CW9A 4ZL7A 3QFBC 5DJLA 1Z1SA 1GY6A 3FGYA 1PX7A 1S3DA 3H79A 4WEYA 5IMFA 3BJ5A 1SL0B 2AAWA 5STDA 1DSBA 1X1XA 4ID0A 1JN5B 4WP5A 1GUMA 1O7PB 4X4JA 2WULA 2AB6A 1XW9A 1ZMAA 4PNGA 2XBIA 4N6OB 2LRTA 5KEJA 1N5HA 5ECNB 3PR8A 1EV9A 3Q3FA 3HKRA 3LQ7A 3ZL5A 1EG9B 4OK0A 4I2UA 3BB9A 4FCMA 2UZ8A 2L4QA 4GCIA 3VK9A 1C54A 3LTDA 1GRXA 1QUWA 2GSTA 3GH6A 1FYSA 2PVOC 3CNMA 4PNFA 4JF8A 3A2WA 1XPVA 3VWXA 3L9VA 3QFAC 3PCSA 4USSA 1X9MB 4WYKB 3FZ5A 5J3RA 1K41A 2C4JA 3STDA 4ZB9A 3KH7A 3FMWA 1UUWB 2IJYA 1JZWA 3TB2A 3B4OA 2FWFA 2GT5A 5DDLA 3GTUB 5A0OB 1PGTA 4N0ZA 1JZOA 5D82A 1US1A 3UIWA 5AI1A 5GAND 5ECQB 1F8NA 1XOBA 1SL2B 3D0ZA 5LC7A 2H76A 4AF2A 1G6YA 2YV9A 1RGKA 3HHVA 2BJXA 4EXRA 4KF9A 2L57A 2QA2A 2LJKA 3CU3A 2FWHA 4BIRA 3NIVA 2P38A 1FOVA 4ORLA 3KEBA 1R4WA 1F9MA 2CVDA 1K3YA 1BJXA 4I4KA 4XS1A 2O87A 5KP1A 2JADA 2K9FA 2LNTA 3QR6A 4OO4A 1DYUA 3ZIJA 1DVCA 4HM3B 1ZX2A 1ILOA 4XHMA 1U3AA 3DYRA 1OGZA 1M9GA 2M46A 4RNZA 4DSSA 5LC6A 2ON5A 2VCZA 3GUSA 1OF5A 3LMLA 1LXEA 2FA8A 2AJQB 3DMCA 4DEJA 1FHEA 1Z5YE 3DY5A 4AJ7A 1X1YA 3O76A 1IU7A 2I3YA 4GL6A 3SOAA 4BWQA 1Q40A 2VLVA 5A4UA 1UW1A 3WT1A 1SKSB 2VM1A 4TN8A 1SK2A 4AGSA 5A4WA 4K5SA 3FZ4A 4LL4B 5G30A 4EC0A 4RBNA 1F3AA 1TXXA 1LRAA 14GSA 4HKVB 1GSUA 2X4AA 4HM4B 3PPUA 3EVIA 3FF0A 2VL9A 3LW9A 3B8LA
chains in the Genus database with same CATH topology
2AYTA 4CY8A 3UARA 3KCMA 4OMVA 4AJ8A 1Q4JA 2K6VA 3GA4A 3RPPA 4IGJA 1SK0A 3W8SA 4P3YB 13GSA 4ZL8A 3G9BA 4XIHA 11GSA 3FKFA 3HCZA 3TJJA 3IR4A 1J9BA 1PX6A 1MDIA 3TOTA 4IN0A 1H4OA 4GTUA 4AJ6A 4MCUA 4KSOA 5CREA 5CAXA 1PN9A 2PBJA 1GSYA 6GSWA 2H6ZA 1BAYA 2YPMA 3EU4A 1PN0A 5KN0A 1G0TA 22GSA 2GS3A 2EC4A 2LUSA 4IJ3A 3I43A 4OFMA 1OE7A 1GL8A 3FK8A 1EP7A 3IC8A 3VPQA 1SU9A 4JE1A 3MNGA 2O85A 3IDVA 2H74A 2X8CA 4TR4A 3TCOA 1O81A 1JFUA 1A8YA 4MDCA 3D4TA 3GL5A 4J56E 3HVVA 4KB3A 1WWJA 2K18A 4GWRA 2LQQA 4TR0A 3GSSA 4MJCA 1HNCA 2OBIA 3IA1A 1U3IA 5B6MA 1F37A 4POBA 2MMNA 2MMAA 3D5JA 4NWYA 4KE3A 3US3A 1EOGA 5IPGA 2R2JA 2O8VB 4GLTA 4GSSA 2GZYA 1R26A 1QQ2A 2B5YA 1TI3A 3QAGA 3APQA 2K8VA 5CRDA 1VF3A 2H01A 5H5SA 3ED3A 4LL1B 3R3EA 5F07A 4MZWA 5GZZB 1O6JA 1ON4A 4IBPA 2OADA 2H0HA 4IQ1A 2JZRA 2DKHA 4V2LA 5F0GA 2NBSA 3HVXA 6GSYA 2YJHA 2FWEA 1ABAA 1GWCA 3GKMA 3KMOA 1XVWA 3G7IA 1YZXA 4DSQA 5G1LA 2FWGA 3WGDA 1XW5A 3F3QA 2M72A 1T1VA 1K0OA 2CZ3A 4PUFC 1YKAA 4K0GA 3DD3A 4YH2A 2DJJA 2QKEA 4XS4B 1V2AA 5ABRA 2H75A 1GUKA 5DVBA 3GX8A 1K0NA 3TKSC 1N8JA 4ECIA 3ME8A 1PKWA 2N5AA 4KDXA 4D73A 3P7XA 3IHQA 3EYTA 1OC3A 2R3XA 1QGVA 3P8WA 5KN1A 2A2RA 2F3MA 4OD7A 4I2TA 5JCUA 2QC7A 2L59A 4ULXA 3A3TA 2H70A 4NPBA 5JWQB 2GQLA 4XRDA 4BVYB 3HJOA 3QD9A 5D73A 2CX4A 4ML1A 5ECRB 2FLSA 4XTSA 5ELAA 1MTCA 3GNJA 1Z6NA 2H1DA 2A2SA 1OYJA 1WP0A 1XWBA 4IELA 1R5AA 3MIXA 1TK8B 2O7KA 3UVTA 1URMA 5A4VA 1MDJA 2L5LA 3ZTLA 5INYA 3FR9A 3V1WA 2WS2A 4NAXA 5AISA 1EOHA 4IP6A 2H73A 3TKRA 1M9BA 3M8NA 3GN3A 2CQ9A 1XWGA 3BCKA 1GSQA 2FNOA 3ZRDA 3L0HA 1A2JA 4YAPA 9GSSA 4K6XA 6GSUA 4YKGA 5DBQA 4K9ZA 1DE1A 3O3TA 2WCIA 3F0IA 2PVQA 4WR4A 1GNEA 4TR3A 4F0BA 1B4PA 3KIJA 1VRSD 4ZILA 1SD9A 2CT6A 4X1UA 2KUCA 3H4KA 2YANA 2VUPA 2YCDA 2F8AA 5DCHA 2JZSA 2IFQA 1SJIA 3UBKA 1GNWA 1KTEA 2N5BA 3KP9A 4GSTA 4F82A 5ECKB 2H1GA 3Q18A 1W4VA 5DQSA 1X5DA 2JU5A 1EWXA 4NHZA 4MA9A 3RHBA 2HFDA 5HFKA 3UMAA 3ZIVA 2LTKA 2NTOA 5G5EA 5B8AA 2LKUA 1SJZA 1Z6MA 1FB0A 1RK4A 3KTLA 4H86A 4OFTA 2C3TA 2VCWA 2CVBA 3HZ8A 3KTBA 1TRVA 5ECMB 2PN8A 2GVPA 1YEPA 1A2MA 2C1YA 2AHEA 4YQVA 3IPZA 2X99A 3TUEA 2LJAA 3EE2A 3Q6OA 5ID2B 5ECSA 2WRTA 3L4NA 4V2NA 4EE0A 4IKHA 3FR3A 1TJDA 1VGLA 2VLUA 3KP8A 5IMCA 1K0DA 1K3OA 2R37A 18GSA 1EEMA 1PL1A 1UN2A 1WJKA 2DJKA 5D96A 3LYPA 2QGVA 5IMAA 4TR1A 2C0EA 3HZ4A 1MD4A 2DC5A 3J7Yb 4K7NA 2NVLA 2G0FA 3M0FA 4FYCA 4O92A 3O6TA 3ERGA 5EVOA 1AXDA 1LU4A 3EINA 4YQUA 4F0CA 2XPEA 5HFGA 3DGQA 2B5EA 5IMVA 1OKDA 3EURA 3CTFA 2R6KA 1WRYA 1AQVA 3GMFA 3VLNA 1KEBA 3BCIA 2RIIA 2E2MA 3TJBA 3GX0A 1ZYNA 4MNNA 4HZ4A 3UAPA 1A23A 4MLYA 2KP2A 4QL9A 2WDUA 1K0BA 5BRTA 1ZZYA 5CYYA 1ZYEA 4G0KA 5HR0A 1XXUA 2YWNA 1HNAA 2YOIA 2PU9C 3ZFBA 4EXJA 3HJMA 1QXHA 1TU7A 3H93A 4TRXA 4TXOB 2IL3A 2XBQA 1K0MA 1OC8A 4GXZA 2HRNA 2FCHA 5ECPB 1GTBA 1AQWA 1THXA 4G2EA 2TIRA 5KOXA 2YNXA 1HNBA 4Z2RA 2R5GA 4TW5A 1QK8A 1YY7A 3CSHA 4EIPA 3LXZA 3EU3A 1XWAA 3P90A 1T3BA 4PQHA 1HQOA 4RI7A 2F8FA 2KLXA 3HD5A 5JCWA 4XS4A 4KX4A 1UC7A 3HYPA 4BL7A 1DUGA 3L9UA 5D9WA 4MF7A 1O85A 3TRPA 4BA7A 5ECOB 1ERTA 5G1KA 1AC1A 1LBKA 1IYHA 3KZQA 4JRRA 1GSDA 3DIEA 1TU8A 1FB6A 3CMIA 1K0CA 3IOSA 2HE3A 4G0LA 3GKXA 3KJYA 5DALA 3SBCA 3NZNA 3KMNA 5IO2A 4PURA 2GQKA 3IK7A 4KA0A 2FA4A 4FIWA 1ERWA 5COHA 5DAKA 1X9SB 3F3RA 1RW1A 2CVKA 4HEA2 4N11A 4NV5A 1USBA 3G7JA 1YF0A 3EMPA 1JHBA 2RLIA 2X49A 1NW2A 4HU7A 5HFIA 3VI5A 1A24A 3LFLA 1GLQA 4RQRA 5FHIA 2VIMA 4I6XA 1TTZA 2L5OA 4ICYA 4KAEA 2X8GA 4IS0A 3C71A 4J57E 1HD2A 2GSSA 3F4TA 1PSQA 2H30A 4L0UA 2D2ZA 5J4UA 4E8EA 4N10A 3FZ9A 3LORA 3GKKA 4BWSA 1BG5A 4G0IA 5HR2A 3QPMA 2VL3A 3N5OA 2CV4A 5IMZA 1WPIA 3MSZA 1GSEA 4IP1A 5KN3A 3LJRA 3LEFA 3M9JA 3GH9A 4N30A 2LV3A 3EC3A 5F8BA 2OKAA 1OE8A 2HSHA 3FYGA 4JZQA 4V2MA 4JR4A 3TJFA 1G6WA 3APOA 4BVXB 1TOFA 4KUNA 2PPTA 5D9VA 1FOHA 1OC9B 2YWIA 2YWOA 1YKCA 1J0FA 4PGTA 1ML6A 3DEXA 2X64A 3FRCA 5JWRB 3DMLA 1EV4A 2HNLA 4CDOA 1EEJA 3RBTA 2I4AA 4MH3A 5G5FA 4NXIA 1OVNA 3VWUA 1Z7RA 3FHKA 3MAKA 6GSSA 3BBYA 4IVFA 4ZBBA 5ID2A 1PL2A 4ZXGA 1GUHA 4F2IA 4DSRA 2K8SA 1XOAA 4RI6A 2DJ3A 1GP1A 1W89A 4MJBA 4CY6A 3ZMLA 4KH7A 1SENA 3ZREA 2IMDA 4XRAA 2IN3A 1PD21 2NDOA 5D9XA 2H71A 1TDIA 5D9TA 1M2BA 2L6DA 3W6GA 4KCEA 4ZB8A 1O73A 2HSMA 5J9BA 2HRAA 2CX3A 5LNKe 5B8BA 4OCEA 2LS5A 3PGTA 4LA1A 1HYUA 2H0GA 2HZEB 4K5RA 5JCGA 3QAVA 5C04A 1B9YC 4DVCA 2DIZA 1BX9A 3W8JA 3C1SA 2XPDA 2X8HA 3QMXA 4ML6A 3VI7A 5CRWA 3CYNA 3GIXA 4I8BA 2B7KA 3C73A 4JR6A 3HXSA 2LRCA 2MYGA 5BMUA 4MF5A 3J7Yk 3A2VA 5D8IA 1MEKA 3U6VA 1WE0A 2QSIA 1ZOFA 3QCPA 1ZL9A 4FO5A 1GTAA 3F4SA 3A5WA 4F03A 4IHUA 2R0PA 4V1Ap 4O5RA 3EWLA 3M3MA 20GSA 2IMIA 3KGKA 4DSSB 5IOWA 4TXVA 5HQPA 1YDKA 4Z2UA 5IM9A 4HS1A 3GTUA 4MJEA 4L8EA 4PQ1A 1XVQA 3M1GA 5J9CA 3TOUA 1T4ZA 2HZFA 1VF4A 4Q5QA 5IO0A 4K8MA 5C00A 1FAAA 5DQYA 1QMVA 3C8EA 2KP1A 3WGEA 4TOPA 2VM2A 2GZPA 1SKWB 2RUEA 2JSZA 3SWLA 2H66A 4L0WA 1MD3A 1XBSA 10GSA 1TRUA 4O32A 2VLTA 3VPTA 3EPTA 2JSYA 2OA7A 2VL2C 4NHWA 3MWHA 1JLVA 4HJ2A 17GSA 1BEDA 3FY7A 4EVMA 2L4CA 4MABA 2KOKA 5G2ZA 4ECCA 1Z9HA 1SKRB 3CSIA 2DJ1A 4WF4A 3A2XA 2I9HA 2JL4A 3G7YA 3TKQA 4WETA 5KN2A 5LCZA 3TKSA 1XW6A 2IWTA 1UVZA 1ZYQB 2A4VA 3CRUA 2M80A 4O7HA 4QQ7A 2AV4A 2IYJA 1YEXA 2B6MA 1AUCA 3E0UA 3ZLPA 2C3QA 2IPAA 3GSTA 3QAWA 1R7HA 2OACA 2GSRA 1MDKA 2XC2A 3HJPA 3UJ1A 3NOFA 3BOAA 1Q98A 3UOMA 4IJIA 2WZ9A 4PUAA 4K2DA 5DJMA 3RPNA 5J41A 4HI7A 3H8QA 2WJUA 1ZGNA 4ZBDA 2RUFA 3GFKA 3WD6A 2V32A 5FT3A 1OKTA 4KGIA 1EZKA 2GSQA 2HYXA 1A2LA 3Q19A 1SK1A 3TRQA 2KHPA 2RM6A 3E3EA 1EGRA 4F9ZA 2LRNA 2P0GA 2EIRA 2YN1A 4L5OA 5IOXA 3DWVA 2DMMA 4KCAA 2EIOA 2ON7A 1Y6EA 3RDWA 3FR6A 4WBRD 4HDEA 1F2EA 4LLRA 1OC9A 3ERWA 3A5IA 5G31A 2HRKA 4EIQA 3ME7A 4X0XA 3UBLA 1IYIA 3DRNA 2AUVA 5B6NA 3I69A 5ECIB 3TJGA 3LXTA 4PQIA 2REMA 5CRHA 3WYWA 4ZB6A 1GTIA 4JEDA 2HRFA 2PGTA 2YZHA 4LMWA 2EIQA 2OJLA 2VO4A 3RHCA 3KH9A 3GKNA 3WGXA 2PWJA 3LYKA 5EY6A 1OAZA 2RM5A 2V6KA 2V1MA 3CTGA 3D4MA 2H19A 4GF0A 2J23A 2FD3A 2DMLA 2F9SA 1SD8A 1YF1A 1KNGA 4D73B 4ZL9A 2DSAA 2I1UA 1H75A 4MP4A 2LEGA 3GV1A 4HU9A 1XWKA 3UEMA 3D6IA 3D21A 2YZUA 4ACSA 2HLSA 1E2YA 2IMEA 1K3LA 1E6BA 2OE0A 4HJMA 5GAPD 2O89A 1A8LA 4IW9A 4K1FA 1XFLA 2ZCTA 3GRXA 2VD1A 2TRCP 4MMMA 2VOCA 4RUVA 2QA1A 2HZEA 2HSYA 3TDGA 3ZZXA 5JWOB 5IIZA 2R0GA 3AY8A 5CP1A 4HUAA 3FW2A 3CBUA 2ZUPA 4GQCA 1M2DA 2H72A 3IBHA 3VWWA 2CA8A 5J5NA 4ZBAA 3HY2A 7GSSA 1V9WA 1M7TA 3MDKA 1U87A 4MZBA 1T7PB 4G19A 1FG4A 3HDCA 4POLA 1XCCA 2MBTA 1GH2A 2GTUA 3GYKA 4Q5RA 4I97A 1O8WA 4BVYA 1O7UA 4OWYA 3VURA 2C0GA 5KOWA 3DXBA 2Z9SA 2VCVA 3MYDA 1PMTA 5E4WA 1SJ6A 4BPYA 1K0AA 4PXOA 3R2QA 4KDUA 3IXRA 1FW1A 4WR5A 2GZZA 4FYUA 4NMUA 1B8XA 1B9XC 4WKWA 3TGZA 2C8UA 3D22A 1KBNA 3HA9A 3ZMKA 2P5RA 2C3NA 3K8NA 3LGCA 5F06A 3WT2A 2H1AA 2DJ2A 2XHFA 2IFQB 2H8LA 1TP9A 4EL1A 4QL7A 3KD0A 1N2AA 3IK9A 3UL3A 3VFIA 3FEUA 1TW9A 3TJKA 2A2PA 2ES7A 3ZVJA 4A5PA 3IE3A 1A0FA 4GRFA 2R0CA 1GSSA 1RQMA 4K7IA 4OFNA 4K7OA 4KNDA 3L9SA 2IMFA 2IY2A 4Z2TA 2H0IA 1TK0B 4HOJA 4I5QA 2FUG2 3H1NA 5H5RA 1C72A 3TKPA 2L6CA 1VF1A 6GSXA 1WOUA 2WB9A 3F6DA 1T8EB 2B3SA 3ZFLA 2VCTA 1Y25A 3CRTA 3LG6A 1V58A 2CAQA 3VWVA 2VCQA 3IHGA 1G7OA 1XWCA 2V6OA 1F3BA 4EKZA 4TR1B 4TVEA 5CO3A 4N0VA 4ECBA 12GSA 1EP8A 3ERFA 1WIKA 2B7JA 3CXGA 1PA3A 5E59A 5HR3A 3N9JA 1J08A 2JACA 1VF2A 2J9HA 4HQZA 4WBJA 1T00A 2LJRA 1NHOA 4G10A 4X43A 1SYXA 5ECHB 1S3CA 1X0RA 2MZCA 3IV4A 1AQXA 1YJ6A 2CZ2A 4CHSA 4NV2A 2E2GA 4TKYA 3UVHA 4K0NA 5CRGA 1T4YA 5GSTA 1PKZA 2E7PA 5AIVA 3C1RA 1U6TA 2LQOA 6GSTA 2GT6A 2YJ7A 5H5QA 3KXOA 2A4HA 3TRXA 2B1KA 4POKA 3M9KA 1GSFA 1FVJA 4OO5A 1V98A 1G7EA 3U5RE 2C0DA 8GSSA 3ZYWA 1DBYA 4FQUA 3IAS2 3TKSE 1WMJA 3F6FA 1FVKA 4EUYA 1XZOA 1BQ7A 3P2AA 5EPFA 3F9UA 1X5EA 3L78A 2HXKA 2VAFA 4EDYA 2R4VA 5GSSA 1EGOA 1GLPA 4JU5A 2V41A 2ZNMA 2E0QA 2H6XA 5ELGA 4WF5A 2DIYA 3IRAA 2MMOA 3DVWA 3I6AA 2BTOT 2DLXA 4XCSA 3ZITA 19GSA 4BL7B 2FHEA 1NHYA 4XS6A 2G2QA 3QOUA 4FH8A 5EL8A 4TXOA 1O8XA 4PTSA 2DBCA 2NPBA 4OCFA 1AIUA 1ST9A 1ZCPA 1THOA 2F51A 2IMKA 3IC4A 1SL1B 3PH9A 5DALB 2HI7A 3IAM2 5L71A 3Q74A 1ZYPA 4G9HA 2TRXA 2YP6A 5A5KA 1V57A 1R5PA 4E8HA 3KM6A 2FGXA 4PX1A 2MBSA 5DAKB 3F63A 2I81A 1A0RP 4K2XA 4ISDA 4MH2A 4ILFA 1UA5A 4MPFA 2B5XA 5A4WA 1ERVA 5FWGA 2H1BA 4YKFA 4ZIJA 5CNWA 4MPGA 2OE3A 2WGRA 2GDRA 2H6YA 3RAZA 1JLWA 2DKIA 3CSJA 3F4RA 2P5QA 4HZ2A 4POMA 4LMVA 4V1Ag 2YV7A 1TK5B 2B1LA 2YWMA 4JBBA 1ERUA 3OR5A 4Q5NA 3ISOA 2OE1A 4MF6A 1TKDB 3GURA 4IQAA 5LD0A 2LSTA 3C7MA 2N5FA 1I5GA 5AGYA 1XIYA 1PRXA 1PQNA 3APSA 4GQFA 1B4QA 1AW9A 1TRWA 1B48A 5ENUA 1CQGA 4FYBA 2CAIA 2JZTA 4Z7XA 3ZVJD 1AAZA 2MMZA 1Z7PA 1CQHA 2GLRA 1NSWA 1FO5A 6GSVA 4KW6A 5ECLB 1LJRA 2VCXA 1X5CA 2OBKA 5B7CA 2C80A 4EF0A 4WXTA 4MK3A 2LNSA 2FY6A 5F05A 1NM3A 4KSMA 2VD0A 3EMXA 3DVXA 5AN1A 3PINA 2WFCA 1GULA 5IQYA 2BMXA 1U88A 1YQ1A 4O5UA 16GSA 1TI1A 3JCML 1I9DA 1JZRA 4O5QA 5D93A 4MZCA 2HT9A 1Z3EA 1DE2A 3GHAA 4EDZA 2PERA 4GSNA 3LWAA 4L5LA 4YAVA 1JZDA 3DKSA 4EO3A 5IPHA 1M9AA 4RQXA 2PMTA 2C0FA 4ECJA 5HR1A 1M0UA 5AIXA 4BVXA 3QDNA 5IMDA 2ALBA 3BD2A 4MJAA 5DCGA 3I9V2 4J2FA 3GL3A 1SYRA 3LSZA 1S3AA 1F6MC 4YQMA 2PUKC 2V2GA 3F8UA 1GTUA 1QFNA 1M99A 4HQSA 4KDYA 2VL2A 3HVSA 2GGTA 1X9WB 2GQMA 2DJ0A 1M2AA 1V40A 2P31A 3E9JB 1TRSA 4Q5FA 3S9FA 2IIYA 1ACVA 3FZAA 1BYEA 4CW9A 4ZL7A 3QFBC 5DJLA 1PX7A 1S3DA 3H79A 4WEYA 5IMFA 3BJ5A 1SL0B 2AAWA 1DSBA 4ID0A 1GUMA 4X4JA 2WULA 2AB6A 1XW9A 1ZMAA 4PNGA 2XBIA 2LRTA 5KEJA 5ECNB 3PR8A 1EV9A 3HKRA 3LQ7A 3ZL5A 4I2UA 2UZ8A 2L4QA 4GCIA 3VK9A 1GRXA 1QUWA 2GSTA 3GH6A 2PVOC 4PNFA 3A2WA 1XPVA 3VWXA 3L9VA 3QFAC 4USSA 1X9MB 3FZ5A 5J3RA 2C4JA 4ZB9A 3KH7A 3FMWA 2IJYA 1JZWA 3TB2A 2FWFA 2GT5A 5DDLA 3GTUB 1PGTA 4N0ZA 1JZOA 3UIWA 5GAND 5ECQB 1XOBA 1SL2B 3D0ZA 2H76A 4AF2A 1G6YA 2YV9A 3HHVA 2BJXA 4KF9A 2L57A 2QA2A 2LJKA 2FWHA 3NIVA 1FOVA 3KEBA 1R4WA 1F9MA 2CVDA 1K3YA 1BJXA 4XS1A 2O87A 3QR6A 2JADA 2K9FA 2LNTA 4OO4A 3ZIJA 1ILOA 4XHMA 1U3AA 3DYRA 2M46A 4DSSA 2ON5A 2VCZA 3GUSA 2FA8A 2AJQB 4DEJA 1FHEA 1Z5YE 4AJ7A 3O76A 2I3YA 4BWQA 2VLVA 5A4UA 3WT1A 1SKSB 2VM1A 4TN8A 1SK2A 4AGSA 4K5SA 3FZ4A 4LL4B 5G30A 4EC0A 1F3AA 1TXXA 14GSA 1GSUA 2X4AA 3PPUA 3EVIA 2VL9A 3LW9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2AYT A;  3UAR A;  3KCM A;  4OMV A;  4AJ8 A;  1Q4J A;  2K6V A;  3GA4 A;  3RPP A;  4IGJ A;  1SK0 A;  3W8S A;  4P3Y B;  13GS A;  4ZL8 A;  3G9B A;  4XIH A;  11GS A;  3FKF A;  3HCZ A;  3TJJ A;  3IR4 A;  1J9B A;  1PX6 A;  1MDI A;  3TOT A;  4IN0 A;  1H4O A;  4GTU A;  4AJ6 A;  4MCU A;  4KSO A;  5CRE A;  5CAX A;  1PN9 A;  2PBJ A;  1GSY A;  6GSW A;  2H6Z A;  1BAY A;  2YPM A;  3EU4 A;  5KN0 A;  1G0T A;  22GS A;  2GS3 A;  2EC4 A;  2LUS A;  4IJ3 A;  3I43 A;  4OFM A;  1OE7 A;  1GL8 A;  3FK8 A;  1EP7 A;  3VPQ A;  1SU9 A;  4JE1 A;  3MNG A;  2O85 A;  3IDV A;  2H74 A;  2X8C A;  4TR4 A;  3TCO A;  1O81 A;  1JFU A;  1A8Y A;  4MDC A;  3D4T A;  3GL5 A;  4J56 E;  3HVV A;  4KB3 A;  1WWJ A;  2K18 A;  4GWR A;  2LQQ A;  4TR0 A;  3GSS A;  4MJC A;  1HNC A;  2OBI A;  3IA1 A;  1U3I A;  5B6M A;  1F37 A;  4POB A;  2MMN A;  2MMA A;  3D5J A;  4NWY A;  4KE3 A;  3US3 A;  1EOG A;  5IPG A;  2R2J A;  2O8V B;  4GLT A;  4GSS A;  2GZY A;  1R26 A;  1QQ2 A;  2B5Y A;  1TI3 A;  3QAG A;  3APQ A;  2K8V A;  5CRD A;  1VF3 A;  2H01 A;  5H5S A;  3ED3 A;  4LL1 B;  5F07 A;  4MZW A;  5GZZ B;  1O6J A;  1ON4 A;  4IBP A;  2OAD A;  2H0H A;  4IQ1 A;  2JZR A;  5F0G A;  4V2L A;  2NBS A;  3HVX A;  6GSY A;  2YJH A;  2FWE A;  1ABA A;  1GWC A;  3GKM A;  3KMO A;  1XVW A;  3G7I A;  1YZX A;  4DSQ A;  5G1L A;  2FWG A;  3WGD A;  1XW5 A;  3F3Q A;  2M72 A;  1T1V A;  1K0O A;  2CZ3 A;  4PUF C;  1YKA A;  4K0G A;  3DD3 A;  4YH2 A;  2DJJ A;  2QKE A;  4XS4 B;  1V2A A;  5ABR A;  2H75 A;  1GUK A;  5DVB A;  3GX8 A;  1K0N A;  3TKS C;  1N8J A;  4ECI A;  3ME8 A;  1PKW A;  2N5A A;  4KDX A;  4D73 A;  3P7X A;  3IHQ A;  3EYT A;  1OC3 A;  2R3X A;  1QGV A;  3P8W A;  5KN1 A;  2A2R A;  2F3M A;  4OD7 A;  4I2T A;  5JCU A;  2QC7 A;  2L59 A;  4ULX A;  3A3T A;  2H70 A;  4NPB A;  5JWQ B;  2GQL A;  4XRD A;  3HJO A;  3QD9 A;  5D73 A;  2CX4 A;  4ML1 A;  5ECR B;  2FLS A;  4XTS A;  5ELA A;  1MTC A;  3GNJ A;  1Z6N A;  2H1D A;  2A2S A;  1OYJ A;  1WP0 A;  1XWB A;  4IEL A;  1R5A A;  1TK8 B;  2O7K A;  3UVT A;  1URM A;  5A4V A;  1MDJ A;  2L5L A;  3ZTL A;  5INY A;  3FR9 A;  3V1W A;  2WS2 A;  4NAX A;  5AIS A;  1EOH A;  4IP6 A;  2H73 A;  3TKR A;  1M9B A;  3M8N A;  3GN3 A;  2CQ9 A;  1XWG A;  3BCK A;  1GSQ A;  2FNO A;  3ZRD A;  3L0H A;  1A2J A;  4YAP A;  9GSS A;  4K6X A;  6GSU A;  5DBQ A;  4K9Z A;  1DE1 A;  3O3T A;  2WCI A;  3F0I A;  2PVQ A;  4WR4 A;  1GNE A;  4TR3 A;  4F0B A;  1B4P A;  3KIJ A;  1VRS D;  4ZIL A;  1SD9 A;  2CT6 A;  4X1U A;  2KUC A;  3H4K A;  2YAN A;  2VUP A;  2YCD A;  2F8A A;  5DCH A;  2JZS A;  2IFQ A;  1SJI A;  3UBK A;  1GNW A;  1KTE A;  2N5B A;  3KP9 A;  4GST A;  4F82 A;  5ECK B;  2H1G A;  3Q18 A;  1W4V A;  5DQS A;  1X5D A;  2JU5 A;  1EWX A;  4NHZ A;  4MA9 A;  3RHB A;  2HFD A;  5HFK A;  3UMA A;  3ZIV A;  2LTK A;  2NTO A;  5G5E A;  5B8A A;  2LKU A;  1SJZ A;  1Z6M A;  1FB0 A;  1RK4 A;  3KTL A;  4H86 A;  4OFT A;  2C3T A;  2VCW A;  2CVB A;  3HZ8 A;  3KTB A;  1TRV A;  5ECM B;  2PN8 A;  2GVP A;  1YEP A;  1A2M A;  2C1Y A;  2AHE A;  4YQV A;  3IPZ A;  2X99 A;  3TUE A;  2LJA A;  3EE2 A;  3Q6O A;  5ID2 B;  5ECS A;  2WRT A;  3L4N A;  4V2N A;  4EE0 A;  4IKH A;  3FR3 A;  1TJD A;  1VGL A;  2VLU A;  3KP8 A;  5IMC A;  1K0D A;  1K3O A;  2R37 A;  18GS A;  1EEM A;  1PL1 A;  1UN2 A;  1WJK A;  2DJK A;  5D96 A;  3LYP A;  2QGV A;  5IMA A;  4TR1 A;  2C0E A;  3HZ4 A;  1MD4 A;  2DC5 A;  3J7Y b;  4K7N A;  2NVL A;  2G0F A;  3M0F A;  4FYC A;  4O92 A;  3O6T A;  3ERG A;  5EVO A;  1AXD A;  1LU4 A;  3EIN A;  4YQU A;  4F0C A;  2XPE A;  5HFG A;  3DGQ A;  2B5E A;  5IMV A;  1OKD A;  3EUR A;  3CTF A;  2R6K A;  1WRY A;  1AQV A;  3GMF A;  3VLN A;  1KEB A;  3BCI A;  2RII A;  2E2M A;  3TJB A;  3GX0 A;  4HZ4 A;  3UAP A;  1A23 A;  4MLY A;  2KP2 A;  4QL9 A;  2WDU A;  1K0B A;  1ZZY A;  5CYY A;  1ZYE A;  5HR0 A;  1XXU A;  2YWN A;  1HNA A;  2YOI A;  2PU9 C;  3ZFB A;  4EXJ A;  3HJM A;  1QXH A;  1TU7 A;  3H93 A;  4TRX A;  4TXO B;  2IL3 A;  2XBQ A;  1K0M A;  1OC8 A;  4GXZ A;  2HRN A;  2FCH A;  5ECP B;  1GTB A;  1AQW A;  1THX A;  4G2E A;  2TIR A;  2YNX A;  1HNB A;  2R5G A;  4TW5 A;  1QK8 A;  1YY7 A;  3CSH A;  3LXZ A;  3EU3 A;  1XWA A;  3P90 A;  1T3B A;  4PQH A;  1HQO A;  4RI7 A;  2F8F A;  2KLX A;  3HD5 A;  5JCW A;  4XS4 A;  4KX4 A;  1UC7 A;  3HYP A;  4BL7 A;  1DUG A;  3L9U A;  5D9W A;  4MF7 A;  1O85 A;  3TRP A;  4BA7 A;  5ECO B;  1ERT A;  5G1K A;  1AC1 A;  1LBK A;  1IYH A;  3KZQ A;  4JRR A;  1GSD A;  3DIE A;  1TU8 A;  1FB6 A;  3CMI A;  1K0C A;  3IOS A;  2HE3 A;  3GKX A;  3KJY A;  5DAL A;  3SBC A;  3NZN A;  3KMN A;  5IO2 A;  4PUR A;  2GQK A;  3IK7 A;  4KA0 A;  2FA4 A;  4FIW A;  1ERW A;  5COH A;  5DAK A;  1X9S B;  3F3R A;  1RW1 A;  2CVK A;  4HEA 2;  4N11 A;  4NV5 A;  1USB A;  3G7J A;  1YF0 A;  3EMP A;  1JHB A;  2RLI A;  1NW2 A;  4HU7 A;  5HFI A;  3VI5 A;  1A24 A;  3LFL A;  1GLQ A;  4RQR A;  5FHI A;  2VIM A;  4I6X A;  1TTZ A;  2L5O A;  4KAE A;  2X8G A;  4IS0 A;  3C71 A;  1HD2 A;  2GSS A;  4J57 E;  3F4T A;  1PSQ A;  2H30 A;  4L0U A;  2D2Z A;  5J4U A;  4E8E A;  4N10 A;  3FZ9 A;  3LOR A;  3GKK A;  4BWS A;  1BG5 A;  5HR2 A;  3QPM A;  2VL3 A;  3N5O A;  2CV4 A;  5IMZ A;  1WPI A;  3MSZ A;  1GSE A;  4IP1 A;  5KN3 A;  3LJR A;  3LEF A;  3M9J A;  3GH9 A;  4N30 A;  2LV3 A;  3EC3 A;  5F8B A;  2OKA A;  1OE8 A;  2HSH A;  3FYG A;  4JZQ A;  4V2M A;  4JR4 A;  3TJF A;  1G6W A;  3APO A;  1TOF A;  4KUN A;  2PPT A;  5D9V A;  1OC9 B;  2YWI A;  2YWO A;  1YKC A;  1J0F A;  4PGT A;  1ML6 A;  3DEX A;  2X64 A;  3FRC A;  5JWR B;  3DML A;  1EV4 A;  2HNL A;  4CDO A;  1EEJ A;  3RBT A;  2I4A A;  4MH3 A;  5G5F A;  4NXI A;  1OVN A;  3VWU A;  1Z7R A;  3FHK A;  3MAK A;  6GSS A;  3BBY A;  4IVF A;  4ZBB A;  5ID2 A;  1PL2 A;  4ZXG A;  1GUH A;  4F2I A;  4DSR A;  2K8S A;  1XOA A;  4RI6 A;  2DJ3 A;  1GP1 A;  1W89 A;  4MJB A;  3ZML A;  4KH7 A;  1SEN A;  3ZRE A;  2IMD A;  4XRA A;  2IN3 A;  1PD2 1;  2NDO A;  5D9X A;  2H71 A;  1TDI A;  5D9T A;  1M2B A;  2L6D A;  3W6G A;  4KCE A;  4ZB8 A;  1O73 A;  5J9B A;  2CX3 A;  5LNK e;  5B8B A;  4OCE A;  2LS5 A;  3PGT A;  4LA1 A;  1HYU A;  2H0G A;  2HZE B;  5JCG A;  3QAV A;  5C04 A;  1B9Y C;  4DVC A;  2DIZ A;  1BX9 A;  3W8J A;  3C1S A;  2XPD A;  2X8H A;  3QMX A;  4ML6 A;  3VI7 A;  5CRW A;  3CYN A;  3GIX A;  4I8B A;  2B7K A;  3C73 A;  4JR6 A;  3HXS A;  2LRC A;  2MYG A;  4MF5 A;  3J7Y k;  3A2V A;  5D8I A;  1MEK A;  3U6V A;  1WE0 A;  2QSI A;  1ZOF A;  3QCP A;  1ZL9 A;  4FO5 A;  1GTA A;  3F4S A;  3A5W A;  4F03 A;  4IHU A;  4V1A p;  4O5R A;  3EWL A;  3M3M A;  20GS A;  2IMI A;  3KGK A;  4DSS B;  5IOW A;  4TXV A;  5HQP A;  1YDK A;  5IM9 A;  4HS1 A;  3GTU A;  4MJE A;  4L8E A;  4PQ1 A;  1XVQ A;  3M1G A;  5J9C A;  3TOU A;  1T4Z A;  2HZF A;  1VF4 A;  4Q5Q A;  5IO0 A;  4K8M A;  5C00 A;  1FAA A;  5DQY A;  1QMV A;  3C8E A;  2KP1 A;  3WGE A;  4TOP A;  2VM2 A;  2GZP A;  1SKW B;  2RUE A;  2JSZ A;  3SWL A;  2H66 A;  4L0W A;  1MD3 A;  1XBS A;  10GS A;  1TRU A;  4O32 A;  2VLT A;  3VPT A;  2JSY A;  2OA7 A;  2VL2 C;  4NHW A;  3MWH A;  1JLV A;  4HJ2 A;  17GS A;  1BED A;  3FY7 A;  4EVM A;  2L4C A;  4MAB A;  2KOK A;  5G2Z A;  4ECC A;  1Z9H A;  1SKR B;  3CSI A;  2DJ1 A;  4WF4 A;  3A2X A;  2I9H A;  2JL4 A;  3G7Y A;  3TKQ A;  4WET A;  5KN2 A;  5LCZ A;  3TKS A;  1XW6 A;  2IWT A;  1UVZ A;  1ZYQ B;  2A4V A;  3CRU A;  2M80 A;  4O7H A;  4QQ7 A;  2AV4 A;  2IYJ A;  1YEX A;  2B6M A;  1AUC A;  3E0U A;  3ZLP A;  2C3Q A;  2IPA A;  3GST A;  3QAW A;  1R7H A;  2OAC A;  2GSR A;  1MDK A;  2XC2 A;  3HJP A;  3UJ1 A;  3NOF A;  3BOA A;  1Q98 A;  3UOM A;  4IJI A;  2WZ9 A;  4PUA A;  4K2D A;  5DJM A;  3RPN A;  5J41 A;  4HI7 A;  3H8Q A;  2WJU A;  1ZGN A;  4ZBD A;  2RUF A;  3GFK A;  3WD6 A;  2V32 A;  5FT3 A;  1OKT A;  4KGI A;  1EZK A;  2GSQ A;  2HYX A;  1A2L A;  3Q19 A;  1SK1 A;  3TRQ A;  2KHP A;  2RM6 A;  3E3E A;  1EGR A;  4F9Z A;  2LRN A;  2P0G A;  2EIR A;  2YN1 A;  4L5O A;  5IOX A;  3DWV A;  2DMM A;  4KCA A;  2EIO A;  2ON7 A;  1Y6E A;  3RDW A;  3FR6 A;  4WBR D;  4HDE A;  1F2E A;  4LLR A;  1OC9 A;  3ERW A;  5G31 A;  3ME7 A;  4X0X A;  3UBL A;  1IYI A;  3DRN A;  2AUV A;  5B6N A;  3I69 A;  5ECI B;  3TJG A;  3LXT A;  4PQI A;  2REM A;  5CRH A;  3WYW A;  4ZB6 A;  1GTI A;  4JED A;  2HRF A;  2PGT A;  2YZH A;  4LMW A;  2EIQ A;  2OJL A;  2VO4 A;  3RHC A;  3KH9 A;  3GKN A;  3WGX A;  2PWJ A;  5EY6 A;  3LYK A;  1OAZ A;  2RM5 A;  2V6K A;  2V1M A;  3CTG A;  3D4M A;  2H19 A;  4GF0 A;  2J23 A;  2FD3 A;  2DML A;  2F9S A;  1SD8 A;  1YF1 A;  1KNG A;  4D73 B;  4ZL9 A;  2DSA A;  2I1U A;  1H75 A;  4MP4 A;  2LEG A;  3GV1 A;  4HU9 A;  1XWK A;  3UEM A;  3D6I A;  3D21 A;  2YZU A;  4ACS A;  2HLS A;  1E2Y A;  2IME A;  1K3L A;  1E6B A;  2OE0 A;  4HJM A;  5GAP D;  2O89 A;  1A8L A;  4IW9 A;  4K1F A;  1XFL A;  2ZCT A;  3GRX A;  2VD1 A;  2TRC P;  4MMM A;  2VOC A;  4RUV A;  2HZE A;  2HSY A;  3TDG A;  3ZZX A;  5JWO B;  5IIZ A;  3AY8 A;  5CP1 A;  4HUA A;  3FW2 A;  3CBU A;  2ZUP A;  4GQC A;  1M2D A;  2H72 A;  3IBH A;  3VWW A;  2CA8 A;  5J5N A;  4ZBA A;  3HY2 A;  7GSS A;  1V9W A;  1M7T A;  3MDK A;  1U87 A;  4MZB A;  1T7P B;  4G19 A;  1FG4 A;  3HDC A;  4POL A;  1XCC A;  2MBT A;  1GH2 A;  2GTU A;  3GYK A;  4Q5R A;  4I97 A;  1O8W A;  4BVY A;  1O7U A;  4OWY A;  3VUR A;  2C0G A;  3DXB A;  2Z9S A;  2VCV A;  1PMT A;  5E4W A;  1SJ6 A;  4BPY A;  1K0A A;  4PXO A;  3R2Q A;  4KDU A;  3IXR A;  1FW1 A;  4WR5 A;  2GZZ A;  4FYU A;  4NMU A;  1B8X A;  1B9X C;  4WKW A;  3TGZ A;  2C8U A;  3D22 A;  1KBN A;  3HA9 A;  3ZMK A;  2P5R A;  2C3N A;  3K8N A;  3LGC A;  5F06 A;  3WT2 A;  2H1A A;  2DJ2 A;  2XHF A;  2IFQ B;  2H8L A;  1TP9 A;  4EL1 A;  4QL7 A;  3KD0 A;  1N2A A;  3IK9 A;  3UL3 A;  3VFI A;  3FEU A;  1TW9 A;  3TJK A;  2ES7 A;  3ZVJ A;  3IE3 A;  1A0F A;  4GRF A;  1GSS A;  1RQM A;  4K7I A;  4OFN A;  4K7O A;  4KND A;  3L9S A;  2IMF A;  2IY2 A;  2H0I A;  1TK0 B;  4HOJ A;  4I5Q A;  2FUG 2;  3H1N A;  5H5R A;  1C72 A;  3TKP A;  2L6C A;  1VF1 A;  6GSX A;  1WOU A;  2WB9 A;  3F6D A;  1T8E B;  2B3S A;  3ZFL A;  2VCT A;  1Y25 A;  3CRT A;  3LG6 A;  1V58 A;  2CAQ A;  3VWV A;  2VCQ A;  1G7O A;  1XWC A;  2V6O A;  1F3B A;  4EKZ A;  4TR1 B;  4TVE A;  5CO3 A;  4N0V A;  4ECB A;  12GS A;  1EP8 A;  3ERF A;  1WIK A;  2B7J A;  3CXG A;  1PA3 A;  5E59 A;  5HR3 A;  3N9J A;  1J08 A;  2JAC A;  1VF2 A;  2J9H A;  4HQZ A;  4WBJ A;  1T00 A;  2LJR A;  1NHO A;  4G10 A;  4X43 A;  1SYX A;  5ECH B;  1S3C A;  1X0R A;  2MZC A;  3IV4 A;  1AQX A;  1YJ6 A;  2CZ2 A;  4CHS A;  4NV2 A;  2E2G A;  4TKY A;  3UVH A;  4K0N A;  5CRG A;  1T4Y A;  5GST A;  1PKZ A;  2E7P A;  5AIV A;  3C1R A;  1U6T A;  2LQO A;  6GST A;  2GT6 A;  2YJ7 A;  5H5Q A;  3KXO A;  3TRX A;  2B1K A;  4POK A;  3M9K A;  1GSF A;  1FVJ A;  4OO5 A;  1V98 A;  1G7E A;  3U5R E;  2C0D A;  8GSS A;  3ZYW A;  1DBY A;  3IAS 2;  3TKS E;  1WMJ A;  3F6F A;  1FVK A;  4EUY A;  1XZO A;  1BQ7 A;  3P2A A;  5EPF A;  3F9U A;  1X5E A;  3L78 A;  2HXK A;  2VAF A;  4EDY A;  2R4V A;  5GSS A;  1EGO A;  1GLP A;  4JU5 A;  2V41 A;  2ZNM A;  2E0Q A;  2H6X A;  5ELG A;  4WF5 A;  2DIY A;  3IRA A;  2MMO A;  3DVW A;  3I6A A;  2BTO T;  2DLX A;  4XCS A;  3ZIT A;  19GS A;  2FHE A;  1NHY A;  4XS6 A;  2G2Q A;  3QOU A;  4FH8 A;  5EL8 A;  4TXO A;  1O8X A;  2DBC A;  2NPB A;  4OCF A;  1AIU A;  1ST9 A;  1ZCP A;  1THO A;  2F51 A;  2IMK A;  3IC4 A;  1SL1 B;  3PH9 A;  5DAL B;  2HI7 A;  3IAM 2;  5L71 A;  3Q74 A;  4G9H A;  2TRX A;  2YP6 A;  5A5K A;  1V57 A;  1R5P A;  4E8H A;  3KM6 A;  2FGX A;  4PX1 A;  2MBS A;  5DAK B;  3F63 A;  2I81 A;  1A0R P;  4ISD A;  4MH2 A;  4ILF A;  1UA5 A;  4MPF A;  2B5X A;  5A4W A;  1ERV A;  5FWG A;  2H1B A;  4ZIJ A;  5CNW A;  4MPG A;  2OE3 A;  2WGR A;  2GDR A;  2H6Y A;  3RAZ A;  1JLW A;  3CSJ A;  3F4R A;  2P5Q A;  4HZ2 A;  4POM A;  4LMV A;  4V1A g;  2YV7 A;  1TK5 B;  2B1L A;  2YWM A;  4JBB A;  1ERU A;  3OR5 A;  4Q5N A;  3ISO A;  2OE1 A;  4MF6 A;  1TKD B;  3GUR A;  4IQA A;  5LD0 A;  2LST A;  3C7M A;  2N5F A;  1I5G A;  5AGY A;  1XIY A;  1PRX A;  1PQN A;  3APS A;  4GQF A;  1B4Q A;  1AW9 A;  1TRW A;  1B48 A;  5ENU A;  1CQG A;  4FYB A;  2CAI A;  2JZT A;  4Z7X A;  3ZVJ D;  1AAZ A;  2MMZ A;  1Z7P A;  1CQH A;  2GLR A;  1NSW A;  1FO5 A;  6GSV A;  4KW6 A;  5ECL B;  1LJR A;  2VCX A;  1X5C A;  2OBK A;  5B7C A;  2C80 A;  4EF0 A;  4WXT A;  4MK3 A;  2LNS A;  2FY6 A;  5F05 A;  1NM3 A;  4KSM A;  2VD0 A;  3EMX A;  3DVX A;  5AN1 A;  3PIN A;  2WFC A;  1GUL A;  5IQY A;  2BMX A;  1U88 A;  1YQ1 A;  16GS A;  1TI1 A;  3JCM L;  1I9D A;  1JZR A;  5D93 A;  4MZC A;  2HT9 A;  1Z3E A;  1DE2 A;  3GHA A;  4EDZ A;  2PER A;  4GSN A;  3LWA A;  4L5L A;  4YAV A;  1JZD A;  3DKS A;  4EO3 A;  5IPH A;  1M9A A;  4RQX A;  2PMT A;  2C0F A;  4ECJ A;  5HR1 A;  1M0U A;  5AIX A;  4BVX A;  3QDN A;  5IMD A;  2ALB A;  3BD2 A;  4MJA A;  5DCG A;  3I9V 2;  4J2F A;  3GL3 A;  1SYR A;  3LSZ A;  1S3A A;  1F6M C;  4YQM A;  2PUK C;  2V2G A;  3F8U A;  1GTU A;  1QFN A;  1M99 A;  4HQS A;  4KDY A;  2VL2 A;  3HVS A;  2GGT A;  1X9W B;  2GQM A;  2DJ0 A;  1M2A A;  1V40 A;  2P31 A;  3E9J B;  1TRS A;  4Q5F A;  3S9F A;  2IIY A;  1ACV A;  3FZA A;  1BYE A;  4CW9 A;  4ZL7 A;  3QFB C;  5DJL A;  1PX7 A;  1S3D A;  3H79 A;  4WEY A;  5IMF A;  3BJ5 A;  1SL0 B;  2AAW A;  1DSB A;  4ID0 A;  1GUM A;  2WUL A;  2AB6 A;  1XW9 A;  1ZMA A;  4PNG A;  2XBI A;  2LRT A;  5KEJ A;  5ECN B;  3PR8 A;  1EV9 A;  3HKR A;  3LQ7 A;  3ZL5 A;  4I2U A;  4GCI A;  2L4Q A;  3VK9 A;  1GRX A;  1QUW A;  2GST A;  3GH6 A;  2PVO C;  4PNF A;  3A2W A;  1XPV A;  3VWX A;  3L9V A;  3QFA C;  1X9M B;  3FZ5 A;  5J3R A;  2C4J A;  4ZB9 A;  3KH7 A;  2IJY A;  1JZW A;  3TB2 A;  2FWF A;  2GT5 A;  5DDL A;  3GTU B;  1PGT A;  4N0Z A;  1JZO A;  3UIW A;  5GAN D;  5ECQ B;  1XOB A;  1SL2 B;  3D0Z A;  2H76 A;  4AF2 A;  1G6Y A;  2YV9 A;  3HHV A;  2BJX A;  2L57 A;  2LJK A;  2FWH A;  3NIV A;  1FOV A;  3KEB A;  1R4W A;  1F9M A;  2CVD A;  1K3Y A;  1BJX A;  4XS1 A;  2O87 A;  3QR6 A;  2JAD A;  2K9F A;  2LNT A;  4OO4 A;  3ZIJ A;  1ILO A;  4XHM A;  1U3A A;  3DYR A;  2M46 A;  4DSS A;  2ON5 A;  2VCZ A;  3GUS A;  2FA8 A;  2AJQ B;  4DEJ A;  1FHE A;  1Z5Y E;  4AJ7 A;  3O76 A;  2I3Y A;  4BWQ A;  2VLV A;  5A4U A;  3WT1 A;  1SKS B;  2VM1 A;  4TN8 A;  1SK2 A;  4AGS A;  3FZ4 A;  4LL4 B;  5G30 A;  4EC0 A;  1F3A A;  1TXX A;  14GS A;  1GSU A;  3EVI A;  2VL9 A; 
#chains in the Genus database with same CATH topology
 3OWS A;  2AYT A;  3K7C A;  4CY8 A;  1VQM 3;  3KCM A;  3UAR A;  4OMV A;  4AJ8 A;  1Q4J A;  2K6V A;  3GA4 A;  1IQX A;  2BT3 A;  3RPP A;  4IGJ A;  1SK0 A;  3W8S A;  4P3Y B;  13GS A;  3AMO B;  1VQN 3;  1T2I A;  3NXJ A;  3HOH A;  4FMA A;  4ZL8 A;  3NV0 A;  3G9B A;  4XIH A;  1FGT A;  4HM2 B;  11GS A;  3FKF A;  3HCZ A;  3TJJ A;  3IR4 A;  1J9B A;  1PX6 A;  1MDI A;  3TOT A;  2GBX B;  4IN0 A;  1JB5 A;  1LNH A;  3VGN A;  1H4O A;  4GTU A;  4AJ6 A;  4MCU A;  4KSO A;  5CRE A;  1I3I A;  5CAX A;  1PN9 A;  1Q7Y 4;  2PBJ A;  1GSY A;  6GSW A;  5IG4 A;  2H6Z A;  1BAY A;  2YPM A;  3GSP A;  3EU4 A;  1PN0 A;  5KN0 A;  1G0T A;  2RSX A;  22GS A;  2GS3 A;  2EC4 A;  3FKA A;  2LUS A;  4IJ3 A;  3I43 A;  4OFM A;  1OE7 A;  1GL8 A;  1OHP A;  2GSP A;  3FK8 A;  1HU9 A;  1EP7 A;  1TU5 A;  3IC8 A;  3VPQ A;  1JKG B;  3MSO A;  1SU9 A;  3MNG A;  4JE1 A;  3CPW 2;  4RZM A;  1IDP A;  2O85 A;  2K0M A;  3IDV A;  2H74 A;  2X8C A;  1E3R A;  1EKM A;  4TR4 A;  3TCO A;  2BIR A;  1N8Q A;  1BIR A;  1O81 A;  1JFU A;  1A8Y A;  2KAA A;  4MDC A;  3D4T A;  3CPO A;  1IVX A;  3GL5 A;  1T5Y A;  4J56 E;  3HVV A;  2RCD A;  4ZM8 A;  4KB3 A;  3D79 A;  1WWJ A;  2K18 A;  4GWR A;  2LQQ A;  4TR0 A;  3GSS A;  2SBL A;  4MJC A;  1HNC A;  2OQE A;  2OBI A;  1BSE A;  3IA1 A;  1U3I A;  1NO3 A;  5B6M A;  1F37 A;  4POB A;  2MMN A;  4XDV A;  1BSB A;  2MMA A;  5JPU A;  1JBS A;  3D5J A;  4NWY A;  2LQV A;  4KE3 A;  1UGH I;  4L7K A;  3US3 A;  4R4K A;  1EOG A;  5IPG A;  3FG3 A;  3ZG5 A;  2R2J A;  2WO0 A;  2O8V B;  3HX8 A;  4GLT A;  3GZY B;  4GSS A;  2GZY A;  1R26 A;  1QQ2 A;  3EN1 B;  3FG1 A;  1Q82 4;  1TI3 A;  2B5Y A;  3QAG A;  3APQ A;  2XH9 A;  1VQ6 3;  8RNT A;  2K8V A;  2W6J H;  3IJE B;  3QRD A;  5CRD A;  3JUO A;  1VF3 A;  3JUQ A;  1B3S A;  2H01 A;  3NM7 A;  5BXQ A;  5H5S A;  3ED3 A;  1NWW A;  4LL1 B;  3R3E A;  5F07 A;  4MZW A;  5GZZ B;  1O6J A;  1ON4 A;  1W6G A;  4IBP A;  4GSP A;  2OAD A;  2H0H A;  2W56 B;  4IQ1 A;  4STD A;  2JZR A;  2DKH A;  4V2L A;  5F0G A;  1K73 4;  2NBS A;  3HVX A;  6GSY A;  2BO9 B;  2YJH A;  1SPU A;  3NX0 A;  2FWE A;  8CHO A;  1ABA A;  1KC8 4;  1GWC A;  3GKM A;  4BL2 A;  3NBJ A;  1TUH A;  3KMO A;  1XVW A;  1GY5 A;  3G7I A;  1YZX A;  4DSQ A;  5G1L A;  2FWG A;  3WGD A;  3DGY A;  1XW5 A;  3LOY A;  3F3Q A;  2M72 A;  1T1V A;  4KVH A;  1K0O A;  2CZ3 A;  4PUF C;  1YKA A;  1HZ1 A;  2BMO B;  3BND A;  4K0G A;  3LTA A;  1Q81 4;  3DD3 A;  4EV2 A;  4YH2 A;  2DJJ A;  2QKE A;  4XS4 B;  1V2A A;  1N5P A;  5ABR A;  2H75 A;  1GUK A;  5DVB A;  3GX8 A;  2XF3 A;  1JBR A;  1K0N A;  3TKS C;  3SYU A;  1N8J A;  4ECI A;  3ME8 A;  1PKW A;  3CCL 3;  2N5A A;  4KDX A;  4D73 A;  3P7X A;  3IHQ A;  3EYT A;  1UCI A;  1OC3 A;  2R3X A;  1QGV A;  3P8W A;  1JN5 A;  1BNR A;  2A2R A;  1YGE A;  2F3M A;  4OD7 A;  5KN1 A;  4I2T A;  3B4P A;  5JCU A;  2QC7 A;  2L59 A;  4ULX A;  1GS3 A;  3A3T A;  2H70 A;  1VZZ A;  4NPB A;  1A2K A;  5JWQ B;  4LSO A;  1FGM A;  3CME 3;  1BGS A;  2E2U A;  2GQL A;  3HVN A;  4XRD A;  3NHX A;  4BVY B;  3LXU X;  3HJO A;  3QD9 A;  4CCV A;  5D73 A;  1B2S A;  1MGW A;  2CX4 A;  1BNE A;  4ML1 A;  5ECR B;  2FLS A;  1DET A;  4XTS A;  5ELA A;  1MTC A;  2XR8 B;  3GNJ A;  5M18 A;  1Z6N A;  2XGL A;  2H1D A;  2A2S A;  1OYJ A;  4G1M B;  1BUJ A;  1NNV A;  1WP0 A;  1XWB A;  4IEL A;  1LOY A;  1R4Y A;  1R5A A;  3MIX A;  4WYK A;  7RNT A;  2CFD A;  1TK8 B;  2O7K A;  3UVT A;  1X1U A;  2IUK A;  1URM A;  5A4V A;  1MDJ A;  2L5L A;  3ZTL A;  5INY A;  3FR9 A;  3V1W A;  2WS2 A;  4NAX A;  5AIS A;  1EOH A;  4IP6 A;  2H73 A;  3TKR A;  1M9B A;  3M8N A;  5AIG A;  3GN3 A;  2CQ9 A;  1XWG A;  3WOF B;  3BCK A;  1GSQ A;  3KII A;  1I70 A;  2FNO A;  1GSP A;  3ZRD A;  3L0H A;  1QJG A;  3D9R A;  1OHO A;  1A2J A;  5KP3 A;  4YAP A;  9GSS A;  4K6X A;  6GSU A;  5I97 A;  4YKG A;  1QVG 2;  5DBQ A;  5AYS C;  4K9Z A;  4J8T A;  1I2G A;  1DE1 A;  3G6E 3;  1BAO A;  3O3T A;  2WCI A;  3F0I A;  2PVQ A;  4WR4 A;  1GNE A;  3EF8 A;  4TR3 A;  3MHE A;  4F0B A;  1B4P A;  3KIJ A;  1VRS D;  4ZIL A;  1SD9 A;  2CT6 A;  5EEO A;  4X1U A;  2KUC A;  3H4K A;  2YAN A;  2VUP A;  1IK3 A;  3FLJ A;  2YCD A;  3GZB A;  2F8A A;  5IG0 A;  2D42 A;  3G0K A;  5DCH A;  2JZS A;  2IFQ A;  3FCS B;  1SJI A;  5EQL A;  1Q86 4;  3M8C A;  3UBK A;  1GNW A;  1KTE A;  1W00 A;  2N5B A;  3KP9 A;  4GST A;  4F82 A;  5ECK B;  2H1G A;  3Q18 A;  3NUV A;  1G02 A;  1RRL A;  1W4V A;  3SXX A;  5DQS A;  1X5D A;  2JU5 A;  1EWX A;  4NHZ A;  4MA9 A;  3RHB A;  3J7Y d;  2HFD A;  5HFK A;  3UMA A;  3ZIV A;  4MMY B;  2LTK A;  2NTO A;  5G5E A;  5B8A A;  3FZW A;  2LKU A;  3NQY A;  1M1K 4;  1SJZ A;  1DMN A;  1Z6M A;  1FB0 A;  1M3I A;  2W04 A;  1IV7 A;  3AMO A;  1RK4 A;  2W9Q A;  3KTL A;  4H86 A;  4OFT A;  2C3T A;  2VCW A;  5TGN A;  2Q07 A;  1M90 4;  2CVB A;  1RGG A;  3NBB A;  3HZ8 A;  3KTB A;  3EQQ B;  2HMJ B;  3OV4 A;  1YIJ 3;  1TRV A;  2PN8 A;  5ECM B;  2GVP A;  1YEP A;  1A2M A;  3WOE B;  2C1Y A;  2CX0 A;  2AHE A;  2P05 A;  3IPZ A;  4YQV A;  1IYY A;  2X99 A;  3ROB A;  3TUE A;  2LJA A;  4KFD A;  3EE2 A;  3Q6O A;  5ID2 B;  5HOH A;  5ECS A;  2WRT A;  3L4N A;  1FUW A;  1OPY A;  4V2N A;  4EE0 A;  9RNT A;  3FR3 A;  1TJD A;  1VGL A;  2VLU A;  3KP8 A;  4IKH A;  2W2C A;  5IMC A;  1K0D A;  1ZGX A;  1K3O A;  2R37 A;  18GS A;  2KCD A;  1EEM A;  1PL1 A;  1UN2 A;  1WJK A;  1MOL A;  3S28 A;  2DJK A;  3X3X A;  5D96 A;  3LYP A;  1OUN A;  1UUG B;  4X2H A;  1PYL A;  4XM4 A;  2QGV A;  5IMA A;  3CCJ 3;  4TR1 A;  2HML B;  1E3V A;  2C0E A;  3HZ4 A;  1MD4 A;  2DC5 A;  3J7Y b;  3K0Z A;  2OOV C;  2NVL A;  4K7N A;  2G0F A;  3M0F A;  1A67 A;  4FYC A;  4O92 A;  3EJV A;  3S27 A;  5IG5 A;  2GEX A;  3O6T A;  3PYJ A;  3ERG A;  5EVO A;  4BL3 A;  3B7C A;  1AXD A;  3RGA A;  1LU4 A;  3EIN A;  2BU4 A;  4YQU A;  4F0C A;  2B24 B;  2XPE A;  5HFG A;  3DGQ A;  1RGF A;  2CX1 A;  2B5E A;  5IMV A;  1OKD A;  3RNT A;  4GHO A;  3EUR A;  1IQY A;  1EUI C;  2R6K A;  3CTF A;  1WRY A;  1CYU A;  1AQV A;  3GMF A;  3VLN A;  1KEB A;  2STD A;  3BCI A;  2RII A;  2AAD A;  2E2M A;  3TJB A;  3GX0 A;  2KRT A;  1ZYN A;  4MNN A;  5CF2 A;  2Z7A A;  4HZ4 A;  1SJW A;  3UAP A;  1A23 A;  1YJN 3;  4MLY A;  4R80 A;  2KP2 A;  2YX9 A;  4QL9 A;  2WDU A;  1K0B A;  5BRT A;  1BRH A;  1ZZY A;  1BRJ A;  5CYY A;  1ZYE A;  4G0K A;  5HR0 A;  1ASK A;  1XXU A;  2JDI H;  2YWN A;  1HNA A;  5CLK A;  2YOI A;  2PU9 C;  3ZFB A;  4EXJ A;  3HII A;  1UCJ A;  3HJM A;  1QXH A;  1SAR A;  4KFE A;  1TU7 A;  3ECF A;  3H93 A;  1RGE A;  3PZW A;  4TRX A;  1IVV A;  1W7C A;  4TXO B;  2IL3 A;  2XBQ A;  1K0M A;  1OC8 A;  4GXZ A;  2HRN A;  2FCH A;  7GSP A;  2W56 A;  5ECP B;  1BRN L;  1GTB A;  1UUV B;  1AQW A;  1THX A;  1SII A;  1VQ9 3;  4G2E A;  2TIR A;  5KOX A;  1A2P A;  1UCK A;  2YNX A;  1HNB A;  1RN1 A;  4Z2R A;  1DE3 A;  2R5G A;  1I2E A;  1KSI A;  4TW5 A;  4U13 A;  2J8X B;  1QK8 A;  1YY7 A;  3DM8 A;  3CSH A;  4EIP A;  3LXZ A;  3EU3 A;  1NB3 I;  3FG4 A;  1XWA A;  3P90 A;  1T3B A;  1ROV A;  4PQH A;  1HQO A;  1FW7 A;  4H61 A;  4RI7 A;  3X40 A;  3WA3 A;  2F8F A;  1CQS A;  1O7G B;  2KLX A;  3HD5 A;  5JCW A;  4XS4 A;  1HYF A;  4KX4 A;  1UC7 A;  4K1V A;  3HYP A;  1QAK A;  1TFO A;  4BL7 A;  1DUG A;  3L9U A;  5D9W A;  4MF7 A;  1YNV X;  1JB4 A;  1O85 A;  3TRP A;  4BA7 A;  5ECO B;  1WNH A;  1ERT A;  5G1K A;  1AC1 A;  1LBK A;  3D4A A;  2FNQ A;  3KCH A;  3SED A;  3FSD A;  1IYH A;  3KZQ A;  4JRR A;  1GSD A;  5RNT A;  3DIE A;  1TU8 A;  1RSN A;  5AIF A;  1FB6 A;  3CMI A;  1K0C A;  3IOS A;  2HE3 A;  4G0L A;  3GKX A;  3KJY A;  2UGI A;  5DAL A;  3SBC A;  3NBR A;  3NZN A;  3KMN A;  5IO2 A;  4PUR A;  1RNT A;  2GQK A;  2OQE C;  3IK7 A;  4KA0 A;  4EYC A;  2FA4 A;  3AHS A;  2RFR A;  4FIW A;  1ERW A;  1C7H A;  1QAL A;  1ULJ B;  5COH A;  5DAK A;  1X9S B;  1LOW A;  3F3R A;  4BTW A;  1RW1 A;  2CVK A;  2QEX 3;  4HEA 2;  4N11 A;  4NV5 A;  2CKF B;  1USB A;  3G7J A;  1YF0 A;  2F5M A;  1W6Y A;  3EMP A;  1JHB A;  2RLI A;  2X49 A;  1LVN A;  1NW2 A;  4HU7 A;  5HFI A;  3VI5 A;  1A24 A;  3LFL A;  1IQ8 A;  1GLQ A;  3LT9 A;  2A15 A;  4RQR A;  5FHI A;  4KFF A;  2VIM A;  2CFG A;  1BRG A;  4I6X A;  3EX9 A;  1WMO A;  3DXO A;  1TTZ A;  2L5O A;  4ICY A;  4KAE A;  2X8G A;  4IS0 A;  3C71 A;  1HD2 A;  2GSS A;  4WHA A;  3BIR A;  3LZA A;  1PSQ A;  4AEQ A;  2H30 A;  3F4T A;  4J57 E;  4L0U A;  1FGR A;  1M3J A;  2D2Z A;  5J4U A;  2IUJ A;  4E8E A;  4N10 A;  3AHW A;  3FZ9 A;  2BMQ B;  3LOR A;  3GKK A;  4BWS A;  3A5E A;  1OAC A;  1BG5 A;  4G0I A;  3KZT A;  5HR2 A;  3QPM A;  2VL3 A;  3N5O A;  2CV4 A;  5IMZ A;  1WPI A;  3MSZ A;  1GSE A;  1U8C B;  4WWU C;  4IP1 A;  5KN3 A;  4H3U A;  1V74 A;  3GAX A;  3LJR A;  3LEF A;  3M9J A;  3GH9 A;  4N30 A;  2XRX B;  2LV3 A;  3EC3 A;  5HGR A;  2OKA A;  5F8B A;  1OE8 A;  2HSH A;  3FYG A;  4JZQ A;  4V2M A;  5KP4 A;  4XDW A;  4JR4 A;  1EA2 A;  3U1W A;  3TJF A;  1T2H A;  3LH4 A;  1G6W A;  1XG8 A;  2C4B A;  3ZFZ A;  3APO A;  3GZR A;  4BVX B;  2Z76 A;  2KXG A;  4IIA A;  1TOF A;  5D83 A;  1GOV A;  4KUN A;  2PPT A;  5D9V A;  2W9P A;  1FOH A;  3DZL A;  1OC9 B;  1YGW A;  2HMM B;  3UL6 A;  2YWI A;  4LGQ A;  2YWO A;  1YKC A;  1FA3 A;  1J0F A;  3JUN A;  4PGT A;  1ML6 A;  3DEX A;  2X64 A;  3FRC A;  5JWR B;  3DML A;  1EV4 A;  2HNL A;  1IV9 A;  4CDO A;  1EEJ A;  2INX A;  2ZHX B;  1O7N B;  3RBT A;  2I4A A;  4MH3 A;  1UCL A;  3CCQ 3;  4J9A A;  5G5F A;  5IF6 A;  4NXI A;  1OVN A;  3VWU A;  1QVF 2;  1Z7R A;  3F7X A;  3FHK A;  1RGA A;  3JUP A;  3F14 A;  1B21 A;  3MAK A;  6GSS A;  3BBY A;  1CEW I;  1WMP A;  2P09 A;  2GXF A;  4IVF A;  4ZBB A;  5ID2 A;  2KF5 A;  3URP A;  1QAF A;  4BTY A;  4MMX B;  4HJL B;  4HM6 B;  1PL2 A;  4ZXG A;  1GUH A;  1O7H B;  4F2I A;  4DSR A;  4FMB A;  2K8S A;  1XOA A;  4RI6 A;  3T8U A;  2DJ3 A;  3KKG A;  3RDE A;  3ZG0 A;  1GP1 A;  2RNT A;  3F9S A;  5IEN A;  3D5G A;  1W89 A;  4MJB A;  4CY6 A;  3ZML A;  4X2O A;  4KH7 A;  1B27 A;  1SEN A;  3ZRE A;  4O02 B;  3HK4 A;  4CPK A;  2IMD A;  4Q53 A;  4XRA A;  3EBY A;  2IN3 A;  1PD2 1;  2NDO A;  1I3F A;  3Q90 A;  2UUG C;  1W01 A;  1M1X B;  5D9X A;  2H71 A;  1TDI A;  5D9T A;  1M2B A;  2L6D A;  3W6G A;  4CJN A;  4KCE A;  2MF7 A;  1O73 A;  4ZB8 A;  2HSM A;  1JRQ A;  5J9B A;  2HRA A;  4FCZ A;  3DGL A;  2CX3 A;  1S5A A;  5LNK e;  2QIY A;  1I2F A;  5B8B A;  4OCE A;  2LS5 A;  2CFW A;  2CFL A;  3PGT A;  4K90 B;  4LA1 A;  1HYU A;  2H0G A;  1OCV A;  2HZE B;  4K5R A;  5JCG A;  1DMM A;  1WQL B;  4OUQ A;  3QAV A;  2WGO A;  5C04 A;  1B9Y C;  4R9K A;  4DVC A;  1BNF A;  2DIZ A;  1N9J A;  1I0V A;  3S29 A;  1BX9 A;  3W8J A;  3C1S A;  2XPD A;  2X8H A;  4FMD A;  3QMX A;  4ML6 A;  3VI7 A;  1OH0 A;  1BNI A;  5CRW A;  3CYN A;  3GIX A;  5EVH A;  4I8B A;  2YFJ B;  2B7K A;  3C73 A;  4JR6 A;  3HXS A;  2LRC A;  2MYG A;  1BAN A;  1AVK A;  3EC9 A;  5BMU A;  4MF5 A;  4PEJ A;  4HVN A;  4O3V A;  3J7Y k;  3A2V A;  5D8I A;  1O7W B;  2I9W A;  1MEK A;  3U6V A;  1WE0 A;  2QSI A;  4HZ9 B;  1ZOF A;  3QCP A;  2FGT A;  4KT3 B;  1S72 3;  1ZL9 A;  1K28 A;  4FO5 A;  1GTA A;  3A76 A;  4BU4 A;  3FH1 A;  3F4S A;  3A5W A;  5ELU A;  4F03 A;  1FUT A;  4IHU A;  1BOX A;  3NQZ A;  2R0P A;  1RCK A;  4V1A p;  4O5R A;  5JPP A;  3EWL A;  3M3M A;  1R4C A;  4AKY A;  20GS A;  3EBT A;  2IMI A;  4TX4 A;  3SVA A;  3KGK A;  4DSS B;  5IOW A;  3CCU 3;  2WGQ A;  4TXV A;  5HQP A;  2XFS A;  1YDK A;  1AVL A;  1GY7 A;  4Z2U A;  6GSP A;  5IM9 A;  4HS1 A;  3GWR A;  1S3R A;  3GTU A;  1D6Z A;  1Q40 B;  4MJE A;  4L8E A;  4PQ1 A;  1XVQ A;  1MWT A;  5JBS A;  3M1G A;  3PCR A;  5J9C A;  3TOU A;  1T4Z A;  3KFQ C;  2HZF A;  1VF4 A;  4N6N B;  4Q5Q A;  5IO0 A;  4K8M A;  5C00 A;  1FAA A;  1GYB A;  5DQY A;  1QMV A;  2ML5 A;  3C8E A;  1OGX A;  2KP1 A;  1NJI 4;  3CC4 3;  3WGE A;  1IT7 A;  4TOP A;  2VM2 A;  2GZP A;  1SKW B;  3MG1 A;  2RUE A;  2JSZ A;  4HM1 B;  3SWL A;  2H66 A;  4L0W A;  3UB1 A;  4MMZ B;  1MD3 A;  1VQ5 3;  4J5K A;  1XBS A;  4MJD A;  10GS A;  1TRU A;  4O32 A;  3NV0 B;  2VLT A;  3VPT A;  3EPT A;  4EC6 A;  2JSY A;  2OA7 A;  2VL2 C;  3N9H A;  4NHW A;  3WHO A;  3MWH A;  2XFT A;  1JLV A;  4HJ2 A;  17GS A;  1BED A;  3FY7 A;  4EVM A;  2L4C A;  4O2H A;  4MAB A;  2KOK A;  5G2Z A;  2R41 A;  4ECC A;  1GD3 A;  1Z9H A;  2GEY A;  1SKR B;  3CSI A;  2DJ1 A;  2XGN A;  4WF4 A;  1BU4 A;  3A2X A;  2BNG A;  2W0Q A;  2I9H A;  2JL4 A;  3G7Y A;  3TKQ A;  4WET A;  1RCL A;  5KN2 A;  3LT8 A;  3KN4 A;  5LCZ A;  1LQG C;  3TKS A;  1BNS A;  4XBX A;  1XW6 A;  2KF4 A;  2IWT A;  1ISK A;  1UVZ A;  1ZYQ B;  3SLU A;  3Q2P A;  4N6L A;  4FR9 A;  2A4V A;  1BNG A;  3CRU A;  3CCS 3;  2M80 A;  4O7H A;  1RHL A;  1D6Y A;  1TIJ A;  4QQ7 A;  2AV4 A;  2IYJ A;  1YEX A;  1MWS A;  2B6M A;  1AUC A;  1E97 A;  3E0U A;  3ZLP A;  2C3Q A;  2IPA A;  3GST A;  4LMI A;  3MWZ A;  3CCE 3;  3QAW A;  1R7H A;  1IVU A;  2SAR A;  2OAC A;  2F98 A;  2GSR A;  2YFI B;  1VQ8 3;  2F99 A;  1MDK A;  3F40 A;  2XC2 A;  2O9U X;  3HJP A;  3UJ1 A;  3NOF A;  3BOA A;  1Q98 A;  4AKZ A;  1RDS A;  3UOM A;  5G2G A;  2R4I A;  4IJI A;  2WZ9 A;  4PUA A;  4K2D A;  1Q7H A;  1TRP A;  5DJM A;  3RPN A;  5J41 A;  4HI7 A;  3H8Q A;  4FMC A;  2WJU A;  1ZGN A;  1UGI A;  4ZBD A;  3BNB A;  3EE1 A;  4EV5 A;  1VQP 3;  2RUF A;  3GFK A;  1RGL A;  1VQL 3;  3WD6 A;  2V32 A;  5FT3 A;  1OKT A;  3V92 A;  4KGI A;  1EZK A;  2GSQ A;  4R1K A;  2HYX A;  1RMS A;  3HI7 A;  1IT8 A;  1A2L A;  3Q19 A;  1SK1 A;  3TRQ A;  2KHP A;  2RM6 A;  3E3E A;  1EGR A;  1JKG A;  1B2X A;  4F9Z A;  2LRN A;  2P0G A;  2EIR A;  2YN1 A;  1AR0 A;  4L5O A;  5IOX A;  3DWV A;  2DMM A;  4KCA A;  2EIO A;  1DVD A;  1Y6E A;  2ON7 A;  1HKX A;  3RDW A;  1ROA A;  3FR6 A;  4WBR D;  4HDE A;  1F2E A;  4LLR A;  3HZP A;  1OC9 A;  3ERW A;  3A5I A;  5G31 A;  2Z77 A;  2HRK A;  5IEP A;  4EIQ A;  3ME7 A;  3SOY A;  4X0X A;  6RNT A;  3UBL A;  1IYI A;  2Y74 A;  5IEO A;  3DRN A;  3G8Z A;  3QK9 A;  2AUV A;  5B6N A;  3I69 A;  5ECI B;  5M1A A;  4QWT A;  4LEH A;  3TJG A;  4JRF A;  3LXT A;  4PQI A;  1MWU A;  2REM A;  5CRH A;  3WYW A;  4ZB6 A;  1GTI A;  4JED A;  2HRF A;  2PGT A;  2YZH A;  3K5T A;  2ZDJ A;  4LMW A;  2EIQ A;  2OJL A;  6STD A;  2VO4 A;  1L5G B;  3RHC A;  3Q1C A;  2CWT A;  3D5I A;  3KH9 A;  3GKN A;  3WGX A;  2HMK B;  2XEP A;  2B1X B;  2IMJ A;  2PWJ A;  3LYK A;  5EY6 A;  1OAZ A;  1TTO A;  2RM5 A;  2V6K A;  1WMN A;  1X1W A;  2V1M A;  3CTG A;  3D4M A;  2H19 A;  1UDI I;  4GF0 A;  1BRS A;  1NU3 A;  2J23 A;  2FD3 A;  2AAE A;  2DML A;  5CF1 A;  1SD8 A;  2F9S A;  2HMN B;  4O8S A;  2CHC A;  2D1W A;  1YF1 A;  1KNG A;  4D73 B;  4ZL9 A;  1YHQ 3;  2DSA A;  2I1U A;  1H75 A;  4MP4 A;  2LEG A;  3UJM A;  5BVB A;  1Q42 A;  3HIG A;  3OWU A;  3GV1 A;  4HU9 A;  1XWK A;  3S67 A;  3UEM A;  1BSC A;  3D6I A;  1WTH A;  3D21 A;  2YZU A;  4ACS A;  2HLS A;  1E2Y A;  3OX9 A;  2IME A;  2CG1 A;  5M19 A;  1K3L A;  3DH2 A;  1E6B A;  2OE0 A;  4HJM A;  1STD A;  5GAP D;  2O89 A;  3DGN A;  1A8L A;  4IW9 A;  3WA2 X;  4K1F A;  1XFL A;  4L8P A;  3H3H A;  3EB8 A;  2ZCT A;  3GRX A;  2KF6 A;  1GMQ A;  2VD1 A;  2ZA4 A;  2TRC P;  4HM7 B;  4MMM A;  3G4S 3;  3AGO A;  3MKI A;  2YFL B;  2VOC A;  4RUV A;  2QA1 A;  1K9M 4;  1JB2 A;  2K54 A;  1BSD A;  2HZE A;  3L0R A;  3TDG A;  2HSY A;  3ZZX A;  5JWO B;  5IIZ A;  2R0G A;  3AY8 A;  5CP1 A;  3X41 A;  1AQZ A;  3K9M C;  4HUA A;  3FW2 A;  3CBU A;  2ZUP A;  4HM5 B;  4GQC A;  1M2D A;  2H72 A;  3IBH A;  3VWW A;  4J5G A;  2CA8 A;  3CC2 3;  5J5N A;  4ZBA A;  3HY2 A;  7GSS A;  2BHM A;  3CC7 3;  1V9W A;  1LNI A;  3BNE A;  1FUS A;  4N6T A;  1M7T A;  1U87 A;  3MDK A;  4MZB A;  1T7P B;  1YIT 3;  4G19 A;  1FG4 A;  3V99 A;  3MG2 A;  3HDC A;  4POL A;  3OW2 2;  2OOV A;  5D81 A;  1XCC A;  2MBT A;  1GH2 A;  2GTU A;  3GYK A;  1TFK A;  4Q5R A;  3GZX B;  4I97 A;  1SIH A;  1O8W A;  3DGM A;  3OWY A;  5FGO A;  4BVY A;  1O7U A;  4OWY A;  3VUR A;  2P0M A;  2C0G A;  5KOW A;  3DXB A;  2Z9S A;  2VCV A;  3MYD A;  1PMT A;  4XBY A;  5E4W A;  1SJ6 A;  4BPY A;  1K0A A;  3DUK A;  2F4Y A;  1STF I;  1W2Z A;  2GU1 A;  3EN8 A;  3IXR A;  3R2Q A;  2OCT A;  4KDU A;  4PXO A;  1FW1 A;  4NHF A;  2GZZ A;  4WR5 A;  1LQM B;  1KWI A;  4FYU A;  4NMU A;  3KSP A;  1A2V A;  1B8X A;  4R9L A;  1B9X C;  3BLZ A;  4WKW A;  3TGZ A;  2C8U A;  3D22 A;  1KBN A;  1W2B 2;  3HA9 A;  3ZMK A;  2P5R A;  2C3N A;  3K8N A;  3LGC A;  5F06 A;  2WOH A;  3WT2 A;  2H1A A;  3CCR 3;  3GRD A;  2DJ2 A;  3MYT A;  2XHF A;  4LYL B;  2IFQ B;  2H8L A;  1TP9 A;  4EL1 A;  4QL7 A;  3KD0 A;  1N2A A;  3PS8 A;  3IK9 A;  3UL3 A;  2CFK A;  3VFI A;  3FEU A;  1TW9 A;  2F56 A;  3TJK A;  2A2P A;  3IMA B;  2ES7 A;  3ZVJ A;  3G16 A;  1W02 A;  2CWV A;  4A5P A;  3IE3 A;  1A0F A;  4GRF A;  3FF2 A;  1ZO2 A;  2R0C A;  1GSS A;  1TP6 A;  1RQM A;  4K7I A;  4OFN A;  4N6U A;  1YVB I;  3E99 A;  4K7O A;  2KF3 A;  4KND A;  3I55 3;  3L9S A;  2IMF A;  2QA4 3;  5CXO A;  2CC3 A;  2IY2 A;  1CH0 A;  4Z2T A;  2H0I A;  1TK0 B;  2E2T A;  1Y4K A;  4HOJ A;  2CK3 H;  2BMR B;  3JVC A;  4I5Q A;  2FUG 2;  1BUQ A;  3H1N A;  5H5R A;  5AYR B;  1C72 A;  2XSO B;  3TKP A;  2L6C A;  1VF1 A;  6GSX A;  1WOU A;  2WB9 A;  3V98 A;  3F6D A;  1T8E B;  2B3S A;  1FGO A;  3ZFL A;  2VCT A;  1Y25 A;  3CRT A;  3LG6 A;  1V58 A;  2CAQ A;  3VWV A;  2VCQ A;  1RTU A;  3IHG A;  1G7O A;  1XWC A;  1RGC A;  2CW9 A;  2E2V A;  2IA7 A;  2V6O A;  3N8B A;  1KQS 2;  2OTJ 3;  1F3B A;  1BRK A;  3BNC A;  4EKZ A;  2W03 A;  4TR1 B;  4HYZ A;  4TVE A;  3PGB A;  3T8N A;  5CO3 A;  5GSP A;  4N0V A;  4ECB A;  3X42 A;  12GS A;  1EP8 A;  3ERF A;  1U5O A;  1WIK A;  2B7J A;  4HBR A;  3AGN A;  3CXG A;  1PA3 A;  5E59 A;  2CWU A;  5AEW B;  1PU4 A;  5HR3 A;  3U97 A;  3CQF A;  3N9J A;  2HOH A;  2FXT A;  1J08 A;  2V1L A;  2JAC A;  5DRE A;  1VF2 A;  4BTX A;  2J9H A;  4HQZ A;  4WBJ A;  5ELJ A;  3I0Y A;  1T00 A;  1G96 A;  2F86 B;  1NHO A;  2LJR A;  4G10 A;  4X43 A;  1SYX A;  3ER7 A;  1MNL A;  2ML6 A;  5ECH B;  1S3C A;  1X0R A;  1W5Z A;  1W6C A;  2MZC A;  5IG3 A;  3IV4 A;  3F8X A;  1AQX A;  1YJ6 A;  2CZ2 A;  4CHS A;  4NV2 A;  2E2G A;  4TKY A;  3UVH A;  4K0N A;  4LZI A;  4DKI A;  5CRG A;  3PXM A;  1T4Y A;  5GST A;  3CXC 2;  4WFO A;  1PKZ A;  2E7P A;  3S5C A;  1GOU A;  5AIV A;  3C1R A;  1U6T A;  2LQO A;  6GST A;  2GT6 A;  1YJW 3;  2YJ7 A;  5H5Q A;  3KXO A;  2A4H A;  1PFP A;  3TRX A;  2B1K A;  4POK A;  3CCV 3;  2PNC A;  4CDL A;  3M9K A;  1GSF A;  1FVJ A;  4IPB A;  4OO5 A;  3I56 3;  1V98 A;  1G7E A;  3U5R E;  4EW5 A;  3CD6 3;  2ZL8 A;  2C0D A;  3WDG B;  4MEI A;  8GSS A;  1FZU A;  5AII A;  3ZYW A;  1DBY A;  4FQU A;  1K8A 4;  3IAS 2;  3TKS E;  1WMJ A;  3F6F A;  1FVK A;  4L8O A;  2GU3 A;  1VQK 3;  4EUY A;  1JJ2 2;  4K1U A;  1XZO A;  2OWP A;  1BQ7 A;  1GMR A;  3P2A A;  5EPF A;  2HMO B;  3F9U A;  1X5E A;  3L78 A;  2HXK A;  2VAF A;  4EDY A;  2R4V A;  5GSS A;  1RN7 A;  1EGO A;  1GLP A;  4JU5 A;  4BIK A;  2Z6B A;  2V41 A;  2ZNM A;  4XB5 A;  3WR2 A;  2E0Q A;  2H6X A;  5ELG A;  4WF5 A;  1RNB A;  1YJ9 3;  2DIY A;  3IRA A;  5DRV A;  2MMO A;  3DVW A;  3I6A A;  2BTO T;  2DLX A;  4XCS A;  3ZIT A;  19GS A;  4BL7 B;  2FHE A;  1TRQ A;  1NHY A;  1Q9E A;  1IVW A;  4XS6 A;  2G2Q A;  3QOU A;  4FH8 A;  5EL8 A;  4TXO A;  2CG0 A;  1RRH A;  1O8X A;  4PTS A;  1MWR A;  4OVM A;  2DBC A;  2NPB A;  4OCF A;  1AIU A;  1ST9 A;  3O8Y A;  2K3D A;  2M7O A;  1ZCP A;  1THO A;  2F51 A;  2IMK A;  3IC4 A;  5CK6 A;  3N54 B;  1SL1 B;  5FW5 A;  4EBG A;  1FGQ A;  1N8R 4;  1KD1 4;  2PZV A;  1DMQ A;  4HM8 B;  3PH9 A;  5DAL B;  1VQ4 3;  2HI7 A;  3IAM 2;  1OF5 B;  5L71 A;  3Q74 A;  1ZYP A;  4G9H A;  1NDO B;  3JUM A;  2TRX A;  2YP6 A;  5A5K A;  4FCJ A;  1V57 A;  1R5P A;  4IT7 A;  4E8H A;  3VF1 A;  3KM6 A;  2FGX A;  4PX1 A;  2MBS A;  3NM2 A;  5AEU B;  3F63 A;  5DAK B;  2I81 A;  3LTB A;  1A0R P;  4K2X A;  1LOV A;  4ISD A;  3WMD A;  4MH2 A;  4ILF A;  3KE7 A;  2C10 A;  1UA5 A;  1B2Z A;  1ERV A;  2B5X A;  1B2M A;  2H1B A;  4MPF A;  5FWG A;  4YKF A;  4ZIJ A;  5CNW A;  4MPG A;  1NB5 I;  2JQ5 A;  2OE3 A;  2WGR A;  2GDR A;  2H6Y A;  3RAZ A;  1UI8 A;  1SQW A;  1JLW A;  2DKI A;  3CSJ A;  3F4R A;  3OXA A;  2P5Q A;  3UL5 A;  4HZ2 A;  4POM A;  4K61 A;  1BVI A;  4LMV A;  2MC8 A;  3MPH A;  1EQK A;  4V1A g;  2YV7 A;  1TK5 B;  3LTC A;  2B1L A;  2YWM A;  3CCM 3;  4JBB A;  1ERU A;  1I0X A;  3OR5 A;  1RLS A;  1O7M B;  4Q5N A;  3SX1 A;  3ISO A;  2OE1 A;  4MF6 A;  1TKD B;  3CMA 3;  3GUR A;  1N9E A;  1JNQ A;  4IQA A;  2LST A;  5LD0 A;  3C7M A;  2N5F A;  1VQQ A;  1I5G A;  5AGY A;  3CNX A;  1XIY A;  1PRX A;  1PQN A;  3APS A;  3RGR A;  4GQF A;  3F7S A;  1B4Q A;  1AW9 A;  1TRW A;  4KZ1 A;  1B48 A;  5ENU A;  1CQG A;  4FYB A;  2CAI A;  2UX0 A;  4HAA A;  2JZT A;  5BU4 A;  7STD A;  1B20 A;  4N3V A;  4Z7X A;  3ZVJ D;  1AAZ A;  2C11 A;  2MMZ A;  1Z7P A;  1CQH A;  2GLR A;  4N6V 0;  1NSW A;  1JBT A;  1VQ7 3;  1FO5 A;  1BRI A;  3VSY A;  6GSV A;  4KW6 A;  5IER A;  1W4N A;  5ECL B;  2GBW B;  1LJR A;  2VCX A;  1X5C A;  4RNY A;  2OTL 3;  1A90 A;  2OBK A;  1B2U A;  1RGH A;  3UNL A;  5B7C A;  2RBI A;  5AIH A;  4GB5 A;  2C80 A;  4EF0 A;  2WOF A;  2QGU A;  4WXT A;  4MK3 A;  2LNS A;  2FY6 A;  1LOX A;  5F05 A;  1NM3 A;  4KSM A;  2VD0 A;  3EMX A;  3DVX A;  2XSH B;  1I8V A;  5AN1 A;  3PIN A;  2WFC A;  5BIR A;  2LYX A;  1GUL A;  5IQY A;  3G71 3;  2BMX A;  1U88 A;  1YQ1 A;  4O5U A;  16GS A;  1TI1 A;  1GOY A;  3JCM L;  1I9D A;  1JZR A;  3BU4 A;  1YI2 3;  3ALA A;  4O5Q A;  2Y73 A;  1MGR A;  5D93 A;  1CYV A;  1OHS A;  4MZC A;  1ULI B;  1PY3 A;  1BSA A;  2HT9 A;  1Z3E A;  4HSC X;  1DE2 A;  3GHA A;  1UI7 A;  4EDZ A;  2PER A;  4GSN A;  3LWA A;  2O3O A;  4L5L A;  1JZD A;  1RN4 A;  2CH9 A;  3DKS A;  4YAV A;  4EO3 A;  5IPH A;  1M9A A;  4RQX A;  2PMT A;  2C0F A;  3KSE D;  4ECJ A;  5HR1 A;  1RJO A;  1M0U A;  5AIX A;  4BVX A;  2P0X A;  3QDN A;  4XBT A;  3WOD G;  5IMD A;  4N6M A;  2RGQ A;  2ALB A;  3BD2 A;  4MJA A;  1GMP A;  1JV2 B;  1D6U A;  2F5W A;  5DCG A;  1ZS7 A;  3I9V 2;  4J2F A;  3GL3 A;  1SYR A;  3LSZ A;  3D3L A;  1S3A A;  3EHC A;  2L4V A;  3IPT A;  3F8H A;  3X3Z A;  1F6M C;  4YQM A;  2PUK C;  2V2G A;  3F8U A;  1GTU A;  1RKY A;  1PFO A;  4HM0 B;  1QFN A;  1M99 A;  1AY7 A;  1BNJ A;  1VQO 3;  4HQS A;  3T0U A;  2VL2 A;  4KDY A;  3HVS A;  2GGT A;  4HZB B;  1AV4 A;  1X9W B;  2GQM A;  2DJ0 A;  1M2A A;  1V40 A;  2P31 A;  1GD4 A;  3E9J B;  2L1S A;  3LYG A;  1TRS A;  4Q5F A;  3K63 A;  5IW9 A;  4HOH A;  3H51 A;  3MG3 A;  4NRE A;  3S9F A;  3X3Y A;  2IIY A;  3DGO A;  1ACV A;  1J2B A;  1QMA A;  2CIU A;  1YVS A;  3FZA A;  4RNT A;  1BYE A;  4CW9 A;  4ZL7 A;  3QFB C;  5DJL A;  1Z1S A;  1GY6 A;  3FGY A;  1PX7 A;  1S3D A;  3H79 A;  4WEY A;  5IMF A;  3BJ5 A;  1SL0 B;  2AAW A;  5STD A;  1DSB A;  1X1X A;  4ID0 A;  1JN5 B;  4WP5 A;  1GUM A;  1O7P B;  4X4J A;  2WUL A;  2AB6 A;  1XW9 A;  1ZMA A;  4PNG A;  2XBI A;  4N6O B;  2LRT A;  5KEJ A;  1N5H A;  5ECN B;  3PR8 A;  1EV9 A;  3Q3F A;  3HKR A;  3LQ7 A;  3ZL5 A;  1EG9 B;  4OK0 A;  4I2U A;  3BB9 A;  4FCM A;  2UZ8 A;  2L4Q A;  4GCI A;  3VK9 A;  1C54 A;  3LTD A;  1GRX A;  1QUW A;  2GST A;  3GH6 A;  1FYS A;  2PVO C;  3CNM A;  4PNF A;  4JF8 A;  3A2W A;  1XPV A;  3VWX A;  3L9V A;  3QFA C;  3PCS A;  4USS A;  1X9M B;  4WYK B;  3FZ5 A;  5J3R A;  1K41 A;  2C4J A;  3STD A;  4ZB9 A;  3KH7 A;  3FMW A;  1UUW B;  2IJY A;  1JZW A;  3TB2 A;  3B4O A;  2FWF A;  2GT5 A;  5DDL A;  3GTU B;  5A0O B;  1PGT A;  4N0Z A;  1JZO A;  5D82 A;  1US1 A;  3UIW A;  5AI1 A;  5GAN D;  5ECQ B;  1F8N A;  1XOB A;  1SL2 B;  3D0Z A;  5LC7 A;  2H76 A;  4AF2 A;  1G6Y A;  2YV9 A;  1RGK A;  3HHV A;  2BJX A;  4EXR A;  4KF9 A;  2L57 A;  2QA2 A;  2LJK A;  3CU3 A;  2FWH A;  4BIR A;  3NIV A;  2P38 A;  1FOV A;  4ORL A;  3KEB A;  1R4W A;  1F9M A;  2CVD A;  1K3Y A;  1BJX A;  4I4K A;  4XS1 A;  2O87 A;  5KP1 A;  2JAD A;  2K9F A;  2LNT A;  3QR6 A;  4OO4 A;  1DYU A;  3ZIJ A;  1DVC A;  4HM3 B;  1ZX2 A;  1ILO A;  4XHM A;  1U3A A;  3DYR A;  1OGZ A;  1M9G A;  2M46 A;  4RNZ A;  4DSS A;  5LC6 A;  2ON5 A;  2VCZ A;  3GUS A;  1OF5 A;  3LML A;  1LXE A;  2FA8 A;  2AJQ B;  3DMC A;  4DEJ A;  1FHE A;  1Z5Y E;  3DY5 A;  4AJ7 A;  1X1Y A;  3O76 A;  1IU7 A;  2I3Y A;  4GL6 A;  3SOA A;  4BWQ A;  1Q40 A;  2VLV A;  5A4U A;  1UW1 A;  3WT1 A;  1SKS B;  2VM1 A;  4TN8 A;  1SK2 A;  4AGS A;  5A4W A;  4K5S A;  3FZ4 A;  4LL4 B;  5G30 A;  4EC0 A;  4RBN A;  1F3A A;  1TXX A;  1LRA A;  14GS A;  4HKV B;  1GSU A;  2X4A A;  4HM4 B;  3PPU A;  3EVI A;  3FF0 A;  2VL9 A;  3LW9 A;  3B8L A; 
#chains in the Genus database with same CATH homology
 2AYT A;  4CY8 A;  3UAR A;  3KCM A;  4OMV A;  4AJ8 A;  1Q4J A;  2K6V A;  3GA4 A;  3RPP A;  4IGJ A;  1SK0 A;  3W8S A;  4P3Y B;  13GS A;  4ZL8 A;  3G9B A;  4XIH A;  11GS A;  3FKF A;  3HCZ A;  3TJJ A;  3IR4 A;  1J9B A;  1PX6 A;  1MDI A;  3TOT A;  4IN0 A;  1H4O A;  4GTU A;  4AJ6 A;  4MCU A;  4KSO A;  5CRE A;  5CAX A;  1PN9 A;  2PBJ A;  1GSY A;  6GSW A;  2H6Z A;  1BAY A;  2YPM A;  3EU4 A;  1PN0 A;  5KN0 A;  1G0T A;  22GS A;  2GS3 A;  2EC4 A;  2LUS A;  4IJ3 A;  3I43 A;  4OFM A;  1OE7 A;  1GL8 A;  3FK8 A;  1EP7 A;  3IC8 A;  3VPQ A;  1SU9 A;  4JE1 A;  3MNG A;  2O85 A;  3IDV A;  2H74 A;  2X8C A;  4TR4 A;  3TCO A;  1O81 A;  1JFU A;  1A8Y A;  4MDC A;  3D4T A;  3GL5 A;  4J56 E;  3HVV A;  4KB3 A;  1WWJ A;  2K18 A;  4GWR A;  2LQQ A;  4TR0 A;  3GSS A;  4MJC A;  1HNC A;  2OBI A;  3IA1 A;  1U3I A;  5B6M A;  1F37 A;  4POB A;  2MMN A;  2MMA A;  3D5J A;  4NWY A;  4KE3 A;  3US3 A;  1EOG A;  5IPG A;  2R2J A;  2O8V B;  4GLT A;  4GSS A;  2GZY A;  1R26 A;  1QQ2 A;  2B5Y A;  1TI3 A;  3QAG A;  3APQ A;  2K8V A;  5CRD A;  1VF3 A;  2H01 A;  5H5S A;  3ED3 A;  4LL1 B;  3R3E A;  5F07 A;  4MZW A;  5GZZ B;  1O6J A;  1ON4 A;  4IBP A;  2OAD A;  2H0H A;  4IQ1 A;  2JZR A;  2DKH A;  4V2L A;  5F0G A;  2NBS A;  3HVX A;  6GSY A;  2YJH A;  2FWE A;  1ABA A;  1GWC A;  3GKM A;  3KMO A;  1XVW A;  3G7I A;  1YZX A;  4DSQ A;  5G1L A;  2FWG A;  3WGD A;  1XW5 A;  3F3Q A;  2M72 A;  1T1V A;  1K0O A;  2CZ3 A;  4PUF C;  1YKA A;  4K0G A;  3DD3 A;  4YH2 A;  2DJJ A;  2QKE A;  4XS4 B;  1V2A A;  5ABR A;  2H75 A;  1GUK A;  5DVB A;  3GX8 A;  1K0N A;  3TKS C;  1N8J A;  4ECI A;  3ME8 A;  1PKW A;  2N5A A;  4KDX A;  4D73 A;  3P7X A;  3IHQ A;  3EYT A;  1OC3 A;  2R3X A;  1QGV A;  3P8W A;  5KN1 A;  2A2R A;  2F3M A;  4OD7 A;  4I2T A;  5JCU A;  2QC7 A;  2L59 A;  4ULX A;  3A3T A;  2H70 A;  4NPB A;  5JWQ B;  2GQL A;  4XRD A;  4BVY B;  3HJO A;  3QD9 A;  5D73 A;  2CX4 A;  4ML1 A;  5ECR B;  2FLS A;  4XTS A;  5ELA A;  1MTC A;  3GNJ A;  1Z6N A;  2H1D A;  2A2S A;  1OYJ A;  1WP0 A;  1XWB A;  4IEL A;  1R5A A;  3MIX A;  1TK8 B;  2O7K A;  3UVT A;  1URM A;  5A4V A;  1MDJ A;  2L5L A;  3ZTL A;  5INY A;  3FR9 A;  3V1W A;  2WS2 A;  4NAX A;  5AIS A;  1EOH A;  4IP6 A;  2H73 A;  3TKR A;  1M9B A;  3M8N A;  3GN3 A;  2CQ9 A;  1XWG A;  3BCK A;  1GSQ A;  2FNO A;  3ZRD A;  3L0H A;  1A2J A;  4YAP A;  9GSS A;  4K6X A;  6GSU A;  4YKG A;  5DBQ A;  4K9Z A;  1DE1 A;  3O3T A;  2WCI A;  3F0I A;  2PVQ A;  4WR4 A;  1GNE A;  4TR3 A;  4F0B A;  1B4P A;  3KIJ A;  1VRS D;  4ZIL A;  1SD9 A;  2CT6 A;  4X1U A;  2KUC A;  3H4K A;  2YAN A;  2VUP A;  2YCD A;  2F8A A;  5DCH A;  2JZS A;  2IFQ A;  1SJI A;  3UBK A;  1GNW A;  1KTE A;  2N5B A;  3KP9 A;  4GST A;  4F82 A;  5ECK B;  2H1G A;  3Q18 A;  1W4V A;  5DQS A;  1X5D A;  2JU5 A;  1EWX A;  4NHZ A;  4MA9 A;  3RHB A;  2HFD A;  5HFK A;  3UMA A;  3ZIV A;  2LTK A;  2NTO A;  5G5E A;  5B8A A;  2LKU A;  1SJZ A;  1Z6M A;  1FB0 A;  1RK4 A;  3KTL A;  4H86 A;  4OFT A;  2C3T A;  2VCW A;  2CVB A;  3HZ8 A;  3KTB A;  1TRV A;  5ECM B;  2PN8 A;  2GVP A;  1YEP A;  1A2M A;  2C1Y A;  2AHE A;  4YQV A;  3IPZ A;  2X99 A;  3TUE A;  2LJA A;  3EE2 A;  3Q6O A;  5ID2 B;  5ECS A;  2WRT A;  3L4N A;  4V2N A;  4EE0 A;  4IKH A;  3FR3 A;  1TJD A;  1VGL A;  2VLU A;  3KP8 A;  5IMC A;  1K0D A;  1K3O A;  2R37 A;  18GS A;  1EEM A;  1PL1 A;  1UN2 A;  1WJK A;  2DJK A;  5D96 A;  3LYP A;  2QGV A;  5IMA A;  4TR1 A;  2C0E A;  3HZ4 A;  1MD4 A;  2DC5 A;  3J7Y b;  4K7N A;  2NVL A;  2G0F A;  3M0F A;  4FYC A;  4O92 A;  3O6T A;  3ERG A;  5EVO A;  1AXD A;  1LU4 A;  3EIN A;  4YQU A;  4F0C A;  2XPE A;  5HFG A;  3DGQ A;  2B5E A;  5IMV A;  1OKD A;  3EUR A;  3CTF A;  2R6K A;  1WRY A;  1AQV A;  3GMF A;  3VLN A;  1KEB A;  3BCI A;  2RII A;  2E2M A;  3TJB A;  3GX0 A;  1ZYN A;  4MNN A;  4HZ4 A;  3UAP A;  1A23 A;  4MLY A;  2KP2 A;  4QL9 A;  2WDU A;  1K0B A;  5BRT A;  1ZZY A;  5CYY A;  1ZYE A;  4G0K A;  5HR0 A;  1XXU A;  2YWN A;  1HNA A;  2YOI A;  2PU9 C;  3ZFB A;  4EXJ A;  3HJM A;  1QXH A;  1TU7 A;  3H93 A;  4TRX A;  4TXO B;  2IL3 A;  2XBQ A;  1K0M A;  1OC8 A;  4GXZ A;  2HRN A;  2FCH A;  5ECP B;  1GTB A;  1AQW A;  1THX A;  4G2E A;  2TIR A;  5KOX A;  2YNX A;  1HNB A;  4Z2R A;  2R5G A;  4TW5 A;  1QK8 A;  1YY7 A;  3CSH A;  4EIP A;  3LXZ A;  3EU3 A;  1XWA A;  3P90 A;  1T3B A;  4PQH A;  1HQO A;  4RI7 A;  2F8F A;  2KLX A;  3HD5 A;  5JCW A;  4XS4 A;  4KX4 A;  1UC7 A;  3HYP A;  4BL7 A;  1DUG A;  3L9U A;  5D9W A;  4MF7 A;  1O85 A;  3TRP A;  4BA7 A;  5ECO B;  1ERT A;  5G1K A;  1AC1 A;  1LBK A;  1IYH A;  3KZQ A;  4JRR A;  1GSD A;  3DIE A;  1TU8 A;  1FB6 A;  3CMI A;  1K0C A;  3IOS A;  2HE3 A;  4G0L A;  3GKX A;  3KJY A;  5DAL A;  3SBC A;  3NZN A;  3KMN A;  5IO2 A;  4PUR A;  2GQK A;  3IK7 A;  4KA0 A;  2FA4 A;  4FIW A;  1ERW A;  5COH A;  5DAK A;  1X9S B;  3F3R A;  1RW1 A;  2CVK A;  4HEA 2;  4N11 A;  4NV5 A;  1USB A;  3G7J A;  1YF0 A;  3EMP A;  1JHB A;  2RLI A;  2X49 A;  1NW2 A;  4HU7 A;  5HFI A;  3VI5 A;  1A24 A;  3LFL A;  1GLQ A;  4RQR A;  5FHI A;  2VIM A;  4I6X A;  1TTZ A;  2L5O A;  4ICY A;  4KAE A;  2X8G A;  4IS0 A;  3C71 A;  4J57 E;  1HD2 A;  2GSS A;  3F4T A;  1PSQ A;  2H30 A;  4L0U A;  2D2Z A;  5J4U A;  4E8E A;  4N10 A;  3FZ9 A;  3LOR A;  3GKK A;  4BWS A;  1BG5 A;  4G0I A;  5HR2 A;  3QPM A;  2VL3 A;  3N5O A;  2CV4 A;  5IMZ A;  1WPI A;  3MSZ A;  1GSE A;  4IP1 A;  5KN3 A;  3LJR A;  3LEF A;  3M9J A;  3GH9 A;  4N30 A;  2LV3 A;  3EC3 A;  5F8B A;  2OKA A;  1OE8 A;  2HSH A;  3FYG A;  4JZQ A;  4V2M A;  4JR4 A;  3TJF A;  1G6W A;  3APO A;  4BVX B;  1TOF A;  4KUN A;  2PPT A;  5D9V A;  1FOH A;  1OC9 B;  2YWI A;  2YWO A;  1YKC A;  1J0F A;  4PGT A;  1ML6 A;  3DEX A;  2X64 A;  3FRC A;  5JWR B;  3DML A;  1EV4 A;  2HNL A;  4CDO A;  1EEJ A;  3RBT A;  2I4A A;  4MH3 A;  5G5F A;  4NXI A;  1OVN A;  3VWU A;  1Z7R A;  3FHK A;  3MAK A;  6GSS A;  3BBY A;  4IVF A;  4ZBB A;  5ID2 A;  1PL2 A;  4ZXG A;  1GUH A;  4F2I A;  4DSR A;  2K8S A;  1XOA A;  4RI6 A;  2DJ3 A;  1GP1 A;  1W89 A;  4MJB A;  4CY6 A;  3ZML A;  4KH7 A;  1SEN A;  3ZRE A;  2IMD A;  4XRA A;  2IN3 A;  1PD2 1;  2NDO A;  5D9X A;  2H71 A;  1TDI A;  5D9T A;  1M2B A;  2L6D A;  3W6G A;  4KCE A;  4ZB8 A;  1O73 A;  2HSM A;  5J9B A;  2HRA A;  2CX3 A;  5LNK e;  5B8B A;  4OCE A;  2LS5 A;  3PGT A;  4LA1 A;  1HYU A;  2H0G A;  2HZE B;  4K5R A;  5JCG A;  3QAV A;  5C04 A;  1B9Y C;  4DVC A;  2DIZ A;  1BX9 A;  3W8J A;  3C1S A;  2XPD A;  2X8H A;  3QMX A;  4ML6 A;  3VI7 A;  5CRW A;  3CYN A;  3GIX A;  4I8B A;  2B7K A;  3C73 A;  4JR6 A;  3HXS A;  2LRC A;  2MYG A;  5BMU A;  4MF5 A;  3J7Y k;  3A2V A;  5D8I A;  1MEK A;  3U6V A;  1WE0 A;  2QSI A;  1ZOF A;  3QCP A;  1ZL9 A;  4FO5 A;  1GTA A;  3F4S A;  3A5W A;  4F03 A;  4IHU A;  2R0P A;  4V1A p;  4O5R A;  3EWL A;  3M3M A;  20GS A;  2IMI A;  3KGK A;  4DSS B;  5IOW A;  4TXV A;  5HQP A;  1YDK A;  4Z2U A;  5IM9 A;  4HS1 A;  3GTU A;  4MJE A;  4L8E A;  4PQ1 A;  1XVQ A;  3M1G A;  5J9C A;  3TOU A;  1T4Z A;  2HZF A;  1VF4 A;  4Q5Q A;  5IO0 A;  4K8M A;  5C00 A;  1FAA A;  5DQY A;  1QMV A;  3C8E A;  2KP1 A;  3WGE A;  4TOP A;  2VM2 A;  2GZP A;  1SKW B;  2RUE A;  2JSZ A;  3SWL A;  2H66 A;  4L0W A;  1MD3 A;  1XBS A;  10GS A;  1TRU A;  4O32 A;  2VLT A;  3VPT A;  3EPT A;  2JSY A;  2OA7 A;  2VL2 C;  4NHW A;  3MWH A;  1JLV A;  4HJ2 A;  17GS A;  1BED A;  3FY7 A;  4EVM A;  2L4C A;  4MAB A;  2KOK A;  5G2Z A;  4ECC A;  1Z9H A;  1SKR B;  3CSI A;  2DJ1 A;  4WF4 A;  3A2X A;  2I9H A;  2JL4 A;  3G7Y A;  3TKQ A;  4WET A;  5KN2 A;  5LCZ A;  3TKS A;  1XW6 A;  2IWT A;  1UVZ A;  1ZYQ B;  2A4V A;  3CRU A;  2M80 A;  4O7H A;  4QQ7 A;  2AV4 A;  2IYJ A;  1YEX A;  2B6M A;  1AUC A;  3E0U A;  3ZLP A;  2C3Q A;  2IPA A;  3GST A;  3QAW A;  1R7H A;  2OAC A;  2GSR A;  1MDK A;  2XC2 A;  3HJP A;  3UJ1 A;  3NOF A;  3BOA A;  1Q98 A;  3UOM A;  4IJI A;  2WZ9 A;  4PUA A;  4K2D A;  5DJM A;  3RPN A;  5J41 A;  4HI7 A;  3H8Q A;  2WJU A;  1ZGN A;  4ZBD A;  2RUF A;  3GFK A;  3WD6 A;  2V32 A;  5FT3 A;  1OKT A;  4KGI A;  1EZK A;  2GSQ A;  2HYX A;  1A2L A;  3Q19 A;  1SK1 A;  3TRQ A;  2KHP A;  2RM6 A;  3E3E A;  1EGR A;  4F9Z A;  2LRN A;  2P0G A;  2EIR A;  2YN1 A;  4L5O A;  5IOX A;  3DWV A;  2DMM A;  4KCA A;  2EIO A;  2ON7 A;  1Y6E A;  3RDW A;  3FR6 A;  4WBR D;  4HDE A;  1F2E A;  4LLR A;  1OC9 A;  3ERW A;  3A5I A;  5G31 A;  2HRK A;  4EIQ A;  3ME7 A;  4X0X A;  3UBL A;  1IYI A;  3DRN A;  2AUV A;  5B6N A;  3I69 A;  5ECI B;  3TJG A;  3LXT A;  4PQI A;  2REM A;  5CRH A;  3WYW A;  4ZB6 A;  1GTI A;  4JED A;  2HRF A;  2PGT A;  2YZH A;  4LMW A;  2EIQ A;  2OJL A;  2VO4 A;  3RHC A;  3KH9 A;  3GKN A;  3WGX A;  2PWJ A;  3LYK A;  5EY6 A;  1OAZ A;  2RM5 A;  2V6K A;  2V1M A;  3CTG A;  3D4M A;  2H19 A;  4GF0 A;  2J23 A;  2FD3 A;  2DML A;  2F9S A;  1SD8 A;  1YF1 A;  1KNG A;  4D73 B;  4ZL9 A;  2DSA A;  2I1U A;  1H75 A;  4MP4 A;  2LEG A;  3GV1 A;  4HU9 A;  1XWK A;  3UEM A;  3D6I A;  3D21 A;  2YZU A;  4ACS A;  2HLS A;  1E2Y A;  2IME A;  1K3L A;  1E6B A;  2OE0 A;  4HJM A;  5GAP D;  2O89 A;  1A8L A;  4IW9 A;  4K1F A;  1XFL A;  2ZCT A;  3GRX A;  2VD1 A;  2TRC P;  4MMM A;  2VOC A;  4RUV A;  2QA1 A;  2HZE A;  2HSY A;  3TDG A;  3ZZX A;  5JWO B;  5IIZ A;  2R0G A;  3AY8 A;  5CP1 A;  4HUA A;  3FW2 A;  3CBU A;  2ZUP A;  4GQC A;  1M2D A;  2H72 A;  3IBH A;  3VWW A;  2CA8 A;  5J5N A;  4ZBA A;  3HY2 A;  7GSS A;  1V9W A;  1M7T A;  3MDK A;  1U87 A;  4MZB A;  1T7P B;  4G19 A;  1FG4 A;  3HDC A;  4POL A;  1XCC A;  2MBT A;  1GH2 A;  2GTU A;  3GYK A;  4Q5R A;  4I97 A;  1O8W A;  4BVY A;  1O7U A;  4OWY A;  3VUR A;  2C0G A;  5KOW A;  3DXB A;  2Z9S A;  2VCV A;  3MYD A;  1PMT A;  5E4W A;  1SJ6 A;  4BPY A;  1K0A A;  4PXO A;  3R2Q A;  4KDU A;  3IXR A;  1FW1 A;  4WR5 A;  2GZZ A;  4FYU A;  4NMU A;  1B8X A;  1B9X C;  4WKW A;  3TGZ A;  2C8U A;  3D22 A;  1KBN A;  3HA9 A;  3ZMK A;  2P5R A;  2C3N A;  3K8N A;  3LGC A;  5F06 A;  3WT2 A;  2H1A A;  2DJ2 A;  2XHF A;  2IFQ B;  2H8L A;  1TP9 A;  4EL1 A;  4QL7 A;  3KD0 A;  1N2A A;  3IK9 A;  3UL3 A;  3VFI A;  3FEU A;  1TW9 A;  3TJK A;  2A2P A;  2ES7 A;  3ZVJ A;  4A5P A;  3IE3 A;  1A0F A;  4GRF A;  2R0C A;  1GSS A;  1RQM A;  4K7I A;  4OFN A;  4K7O A;  4KND A;  3L9S A;  2IMF A;  2IY2 A;  4Z2T A;  2H0I A;  1TK0 B;  4HOJ A;  4I5Q A;  2FUG 2;  3H1N A;  5H5R A;  1C72 A;  3TKP A;  2L6C A;  1VF1 A;  6GSX A;  1WOU A;  2WB9 A;  3F6D A;  1T8E B;  2B3S A;  3ZFL A;  2VCT A;  1Y25 A;  3CRT A;  3LG6 A;  1V58 A;  2CAQ A;  3VWV A;  2VCQ A;  3IHG A;  1G7O A;  1XWC A;  2V6O A;  1F3B A;  4EKZ A;  4TR1 B;  4TVE A;  5CO3 A;  4N0V A;  4ECB A;  12GS A;  1EP8 A;  3ERF A;  1WIK A;  2B7J A;  3CXG A;  1PA3 A;  5E59 A;  5HR3 A;  3N9J A;  1J08 A;  2JAC A;  1VF2 A;  2J9H A;  4HQZ A;  4WBJ A;  1T00 A;  2LJR A;  1NHO A;  4G10 A;  4X43 A;  1SYX A;  5ECH B;  1S3C A;  1X0R A;  2MZC A;  3IV4 A;  1AQX A;  1YJ6 A;  2CZ2 A;  4CHS A;  4NV2 A;  2E2G A;  4TKY A;  3UVH A;  4K0N A;  5CRG A;  1T4Y A;  5GST A;  1PKZ A;  2E7P A;  5AIV A;  3C1R A;  1U6T A;  2LQO A;  6GST A;  2GT6 A;  2YJ7 A;  5H5Q A;  3KXO A;  2A4H A;  3TRX A;  2B1K A;  4POK A;  3M9K A;  1GSF A;  1FVJ A;  4OO5 A;  1V98 A;  1G7E A;  3U5R E;  2C0D A;  8GSS A;  3ZYW A;  1DBY A;  4FQU A;  3IAS 2;  3TKS E;  1WMJ A;  3F6F A;  1FVK A;  4EUY A;  1XZO A;  1BQ7 A;  3P2A A;  5EPF A;  3F9U A;  1X5E A;  3L78 A;  2HXK A;  2VAF A;  4EDY A;  2R4V A;  5GSS A;  1EGO A;  1GLP A;  4JU5 A;  2V41 A;  2ZNM A;  2E0Q A;  2H6X A;  5ELG A;  4WF5 A;  2DIY A;  3IRA A;  2MMO A;  3DVW A;  3I6A A;  2BTO T;  2DLX A;  4XCS A;  3ZIT A;  19GS A;  4BL7 B;  2FHE A;  1NHY A;  4XS6 A;  2G2Q A;  3QOU A;  4FH8 A;  5EL8 A;  4TXO A;  1O8X A;  4PTS A;  2DBC A;  2NPB A;  4OCF A;  1AIU A;  1ST9 A;  1ZCP A;  1THO A;  2F51 A;  2IMK A;  3IC4 A;  1SL1 B;  3PH9 A;  5DAL B;  2HI7 A;  3IAM 2;  5L71 A;  3Q74 A;  1ZYP A;  4G9H A;  2TRX A;  2YP6 A;  5A5K A;  1V57 A;  1R5P A;  4E8H A;  3KM6 A;  2FGX A;  4PX1 A;  2MBS A;  5DAK B;  3F63 A;  2I81 A;  1A0R P;  4K2X A;  4ISD A;  4MH2 A;  4ILF A;  1UA5 A;  4MPF A;  2B5X A;  5A4W A;  1ERV A;  5FWG A;  2H1B A;  4YKF A;  4ZIJ A;  5CNW A;  4MPG A;  2OE3 A;  2WGR A;  2GDR A;  2H6Y A;  3RAZ A;  1JLW A;  2DKI A;  3CSJ A;  3F4R A;  2P5Q A;  4HZ2 A;  4POM A;  4LMV A;  4V1A g;  2YV7 A;  1TK5 B;  2B1L A;  2YWM A;  4JBB A;  1ERU A;  3OR5 A;  4Q5N A;  3ISO A;  2OE1 A;  4MF6 A;  1TKD B;  3GUR A;  4IQA A;  5LD0 A;  2LST A;  3C7M A;  2N5F A;  1I5G A;  5AGY A;  1XIY A;  1PRX A;  1PQN A;  3APS A;  4GQF A;  1B4Q A;  1AW9 A;  1TRW A;  1B48 A;  5ENU A;  1CQG A;  4FYB A;  2CAI A;  2JZT A;  4Z7X A;  3ZVJ D;  1AAZ A;  2MMZ A;  1Z7P A;  1CQH A;  2GLR A;  1NSW A;  1FO5 A;  6GSV A;  4KW6 A;  5ECL B;  1LJR A;  2VCX A;  1X5C A;  2OBK A;  5B7C A;  2C80 A;  4EF0 A;  4WXT A;  4MK3 A;  2LNS A;  2FY6 A;  5F05 A;  1NM3 A;  4KSM A;  2VD0 A;  3EMX A;  3DVX A;  5AN1 A;  3PIN A;  2WFC A;  1GUL A;  5IQY A;  2BMX A;  1U88 A;  1YQ1 A;  4O5U A;  16GS A;  1TI1 A;  3JCM L;  1I9D A;  1JZR A;  4O5Q A;  5D93 A;  4MZC A;  2HT9 A;  1Z3E A;  1DE2 A;  3GHA A;  4EDZ A;  2PER A;  4GSN A;  3LWA A;  4L5L A;  4YAV A;  1JZD A;  3DKS A;  4EO3 A;  5IPH A;  1M9A A;  4RQX A;  2PMT A;  2C0F A;  4ECJ A;  5HR1 A;  1M0U A;  5AIX A;  4BVX A;  3QDN A;  5IMD A;  2ALB A;  3BD2 A;  4MJA A;  5DCG A;  3I9V 2;  4J2F A;  3GL3 A;  1SYR A;  3LSZ A;  1S3A A;  1F6M C;  4YQM A;  2PUK C;  2V2G A;  3F8U A;  1GTU A;  1QFN A;  1M99 A;  4HQS A;  4KDY A;  2VL2 A;  3HVS A;  2GGT A;  1X9W B;  2GQM A;  2DJ0 A;  1M2A A;  1V40 A;  2P31 A;  3E9J B;  1TRS A;  4Q5F A;  3S9F A;  2IIY A;  1ACV A;  3FZA A;  1BYE A;  4CW9 A;  4ZL7 A;  3QFB C;  5DJL A;  1PX7 A;  1S3D A;  3H79 A;  4WEY A;  5IMF A;  3BJ5 A;  1SL0 B;  2AAW A;  1DSB A;  4ID0 A;  1GUM A;  4X4J A;  2WUL A;  2AB6 A;  1XW9 A;  1ZMA A;  4PNG A;  2XBI A;  2LRT A;  5KEJ A;  5ECN B;  3PR8 A;  1EV9 A;  3HKR A;  3LQ7 A;  3ZL5 A;  4I2U A;  2UZ8 A;  2L4Q A;  4GCI A;  3VK9 A;  1GRX A;  1QUW A;  2GST A;  3GH6 A;  2PVO C;  4PNF A;  3A2W A;  1XPV A;  3VWX A;  3L9V A;  3QFA C;  4USS A;  1X9M B;  3FZ5 A;  5J3R A;  2C4J A;  4ZB9 A;  3KH7 A;  3FMW A;  2IJY A;  1JZW A;  3TB2 A;  2FWF A;  2GT5 A;  5DDL A;  3GTU B;  1PGT A;  4N0Z A;  1JZO A;  3UIW A;  5GAN D;  5ECQ B;  1XOB A;  1SL2 B;  3D0Z A;  2H76 A;  4AF2 A;  1G6Y A;  2YV9 A;  3HHV A;  2BJX A;  4KF9 A;  2L57 A;  2QA2 A;  2LJK A;  2FWH A;  3NIV A;  1FOV A;  3KEB A;  1R4W A;  1F9M A;  2CVD A;  1K3Y A;  1BJX A;  4XS1 A;  2O87 A;  3QR6 A;  2JAD A;  2K9F A;  2LNT A;  4OO4 A;  3ZIJ A;  1ILO A;  4XHM A;  1U3A A;  3DYR A;  2M46 A;  4DSS A;  2ON5 A;  2VCZ A;  3GUS A;  2FA8 A;  2AJQ B;  4DEJ A;  1FHE A;  1Z5Y E;  4AJ7 A;  3O76 A;  2I3Y A;  4BWQ A;  2VLV A;  5A4U A;  3WT1 A;  1SKS B;  2VM1 A;  4TN8 A;  1SK2 A;  4AGS A;  4K5S A;  3FZ4 A;  4LL4 B;  5G30 A;  4EC0 A;  1F3A A;  1TXX A;  14GS A;  1GSU A;  2X4A A;  3PPU A;  3EVI A;  2VL9 A;  3LW9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...