2H0GA

Crystal structure of dsbg t200m mutant
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
229
structure length
229
Chain Sequence
b'ELPAPVKAIEKQGITIIKTFDAPGGMKGYLGKYQDMGVTIYLTPDGKHAISGYMYNEKGENLSNTLIEKEIYAPAGREMWQRMEQSHWLLDGKKDAPVIVYVFADPFCPYCKQFWQQARPWVDSGKVQLRTLLVGVIKPESPATAAAILASKDPAKTWQQYEASGGKLKLNVPANVSTEQMKVLSDNEKLMDDLGANVMPAIYYMSKENTLQQAVGLPDQKTLNIIMGN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Thiol:disulfide interchange protein dsbG
publication title Short-circuiting divergent evolution: laboratory evolution of one disulfide isomerase to resemble another
rcsb
source organism Escherichia coli
molecule tags Isomerase
total genus 64
structure length 229
sequence length 229
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-05-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13098 Thioredoxin_2 Thioredoxin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.70 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Disulphide bond isomerase, DsbC/G, N-terminal 2h0gA01
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 2h0gA02
2C8UA 4IGJA 5IMCA 1Z7PA 1FW1A 3ZTLA 4F9ZA 3F3QA 3EYTA 1SU9A 3WT2A 4G9HA 2MZCA 3APOA 2V2GA 3HHVA 4I2TA 1SD9A 5C04A 4OFNA 3VWXA 1PRXA 2MBTA 1OVNA 2HLSA 13GSA 2LSTA 3HYPA 1GSFA 4AGSA 4QL7A 2YWMA 1Z6NA 3UMAA 5ABRA 2LTKA 5D8IA 2VLTA 2X8CA 3RAZA 3TOUA 4ML1A 2MMOA 1R5PA 3UEMA 3C1SA 5ECLB 2GQKA 2FWEA 3DD3A 4H86A 5F05A 4XS1A 1U6TA 5AN1A 1S3DA 2J9HA 2HZEA 1ILOA 2FD3A 3GX0A 5GAPD 1YJ6A 5DALB 3FR9A 2YNXA 4JRRA 3ZIJA 3H1NA 3CBUA 4TW5A 3GSSA 2IIYA 1B9XC 1K3LA 3LEFA 1M99A 1TJDA 4ILFA 1A0FA 3I43A 1T7PB 3LWAA 2YV9A 5CRGA 2TIRA 4XHMA 3DXBA 2DC5A 1WIKA 2LV3A 2CVKA 5DVBA 3L9VA 2O85A 1QUWA 4BWQA 2MMZA 5ECHB 1WWJA 4V2NA 3A2XA 4HJ2A 4DSSB 4OFMA 5DQYA 2PN8A 5CRHA 1TRUA 2L4QA 4FO5A 2GDRA 2HYXA 2ZCTA 4K1FA 2B6MA 1ERUA 5G1KA 4I97A 1OC9B 1JZOA 1NHYA 5DALA 4EF0A 4OO5A 2WDUA 2PUKC 6GSXA 1GTIA 1WRYA 4KAEA 3MAKA 4XTSA 3FR3A 1FO5A 3DVXA 4XRDA 3F4SA 3FEUA 2IYJA 3LXZA 2AUVA 5IPGA 1S3AA 1UN2A 3F3RA 4MF6A 3CSIA 4MABA 5IMZA 1FB0A 2C0EA 3ZVJA 1TTZA 1K0AA 3A2WA 1ACVA 5C00A 2L59A 1R5AA 5KN0A 4TN8A 2JU5A 4HZ4A 3F6DA 4DSSA 1XWAA 4F82A 1XWKA 3ZRDA 3HZ8A 5CAXA 3S9FA 1SKRB 4V1Ap 1OC9A 2R3XA 5ECIB 5HR0A 3EINA 1SK0A 1PQNA 4K0GA 5FHIA 4HU7A 1SL1B 2FY6A 3C8EA 1NW2A 1WP0A 5J4UA 1GSUA 4RQRA 2HE3A 5ECMB 2WB9A 2F9SA 2XBIA 5JWOB 1H4OA 4CW9A 2B5EA 5AGYA 5A4VA 1JLWA 5CO3A 1PGTA 4ISDA 2C3TA 2X64A 2PGTA 3IK9A 5DBQA 1MDJA 2P0GA 3IC4A 4IVFA 4OD7A 5D9TA 1HNBA 3LXTA 3VI5A 4JU5A 3GKNA 1YEXA 4GTUA 1K0CA 3F4TA 2NVLA 2VIMA 2CT6A 5CYYA 2REMA 1ON4A 3PR8A 16GSA 2TRXA 4IJIA 5KN3A 1H75A 3DYRA 3CMIA 3JCML 4L5LA 2B7KA 2M72A 2K8VA 3FK8A 1F37A 1SJ6A 1HNAA 1SK1A 3DWVA 4OCEA 2LRNA 5F0GA 1MD4A 5B6NA 4LMWA 2J23A 4LLRA 3EE2A 2VL3A 2X8HA 3RHBA 5DAKB 2P5QA 1YKAA 2L57A 3C71A 4V1Ag 2HZFA 1GUKA 3D21A 1V58A 1R26A 1THXA 3IE3A 1WPIA 3KZQA 3L4NA 3VWWA 4OMVA 2DBCA 3IK7A 5DJLA 3TRPA 5D73A 2LJAA 1EP8A 1OE8A 4BPYA 2PPTA 2RM5A 3D5JA 3GTUB 2JSZA 1B48A 1TRVA 4MF5A 2KHPA 4D73A 2VOCA 2FA4A 2H6ZA 3ZL5A 2BJXA 3E9JB 3QAGA 2H74A 1XBSA 3K8NA 4FYCA 5IOWA 3CSJA 5IOXA 1DE2A 2YOIA 5DAKA 3RPPA 3FZ5A 1NSWA 2WJUA 2EIQA 1PD21 4NV2A 1GSQA 1TK8B 2X8GA 3UVHA 3C73A 3NZNA 2IWTA 4MZWA 2WGRA 4NAXA 3KH9A 5ECKB 3WGEA 1A8LA 4IQAA 1Q4JA 5AIXA 5ELAA 4J56E 1M0UA 1U88A 2JACA 2GSSA 4TXOA 1EGOA 4V2MA 1PL1A 3W6GA 3TRQA 3GTUA 5GSTA 5D96A 1UC7A 4PURA 6GSVA 4TRXA 2PBJA 4GQCA 4K8MA 2CVBA 1FOVA 1JZRA 4HI7A 4I2UA 3WT1A 1EOHA 3W8JA 1F3AA 1Z7RA 3ERGA 2FCHA 1XIYA 3GUSA 4HUAA 1GUMA 1AUCA 4XCSA 1GWCA 1ERWA 1GSDA 4RI7A 2GZZA 3VPTA 3MWHA 3QMXA 2E7PA 2H0IA 3UJ1A 3TCOA 3GV1A 1PSQA 3QFBC 1PX6A 5JCUA 3GRXA 2IPAA 1GLQA 4YQMA 3D4TA 4BWSA 3GURA 3ZMKA 4WF4A 1KBNA 3OR5A 1TXXA 5LNKe 2LKUA 4MJEA 4XIHA 3QCPA 4V2LA 5L71A 2DJ1A 1EZKA 4DVCA 5ECNB 4MA9A 2AJQB 5G30A 3RPNA 4ZL7A 2KP2A 4TR1B 1SK2A 2H72A 2YWNA 1KNGA 4ZL8A 2V32A 2A2SA 1B4QA 3UBKA 1O73A 3EU4A 2PWJA 4WEYA 3GFKA 3ZFLA 3IOSA 3G7IA 4FYUA 4PUFC 1V9WA 3H4KA 5CRDA 1J0FA 1F2EA 3GNJA 1GRXA 4IQ1A 3H8QA 4K7NA 9GSSA 3I69A 3RDWA 2VLUA 3D22A 4FH8A 2QKEA 3D6IA 2OA7A 4GSSA 1YF1A 4RI6A 3F63A 1A2LA 3P8WA 4HOJA 4HJMA 1OKDA 1T3BA 3ZZXA 1BYEA 1K3YA 3ISOA 4EO3A 4DEJA 1AQWA 4NHZA 4TR1A 3FZ9A 1ZZYA 2IMKA 1R7HA 4ZB6A 4YQUA 3TDGA 3BJ5A 1WJKA 1FHEA 3FHKA 3G7YA 2IFQB 1DSBA 3A2VA 1KTEA 2WS2A 1XWBA 2H6YA 2R2JA 2WCIA 2DIYA 2I3YA 2OKAA 1YQ1A 4O92A 2YV7A 2H70A 3U5RE 3ZFBA 2O87A 1X9MB 2L6CA 4FYBA 1T8EB 2O8VB 4EC0A 3TUEA 5J5NA 4WBJA 4KDXA 1X5EA 5A4UA 1XW9A 4BVXA 1DBYA 1X9WB 2V41A 1TK0B 4EL1A 3KTBA 2H1GA 1O7UA 2QC7A 1NHOA 3UARA 4JEDA 2HSHA 2MYGA 2DJ3A 4NWYA 4YAPA 3DEXA 5ECRB 2IFQA 6GSYA 1VF2A 4IJ3A 2AV4A 3GH6A 1TRWA 4O5RA 2L6DA 2WULA 3SBCA 1AAZA 3PGTA 2RM6A 4MDCA 4KW6A 3GKXA 2CZ2A 3HZ4A 2C0DA 1HD2A 1GSYA 3HJMA 4F2IA 2ES7A 4DSRA 3LFLA 2R5GA 2HI7A 3QD9A 1G7EA 2FNOA 4JE1A 8GSSA 2YWOA 1GNEA 2GZPA 1K3OA 1N2AA 2DLXA 2V6OA 3HJPA 2CX4A 1WMJA 1TW9A 2JZSA 4FIWA 4MZBA 1LJRA 1QQ2A 3M9KA 2VL9A 1JFUA 4F0BA 1AC1A 4HQZA 4IHUA 1IYIA 1V40A 3R2QA 4OCFA 4PX1A 3KM6A 4ZBDA 3EVIA 2YANA 2DMMA 2L4CA 2NPBA 3HJOA 1UVZA 5AISA 1V98A 3D4MA 2JL4A 1XW6A 5EVOA 4EXJA 1M9BA 2DMLA 4N11A 2BMXA 2C1YA 1XPVA 1QXHA 5HR3A 3HKRA 2C3QA 2OE1A 4KNDA 4PUAA 1PKWA 4L8EA 1OC8A 1T4YA 3KCMA 1O8XA 2E2GA 3HY2A 4K2DA 12GSA 2VD1A 3GKKA 4ZXGA 2VAFA 1XCCA 3BBYA 3HDCA 1Y6EA 3F0IA 3DKSA 1SL0B 2XPEA 5AIVA 3AY8A 3HVVA 1YF0A 1NM3A 2P31A 2G0FA 2YZUA 2B1LA 2XBQA 1SKWB 4XS4B 3FKFA 3GHAA 1KEBA 3VK9A 4LL1B 3VWUA 1XWCA 3UBLA 3BCKA 5ID2B 2OJLA 2B5XA 2VL2C 2FHEA 4MH2A 11GSA 3HXSA 4KSOA 5HR2A 4HS1A 4EUYA 3CYNA 2FWFA 3IHQA 3QOUA 1BJXA 4PGTA 4XS6A 4JBBA 4EE0A 4HQSA 3TJFA 2IMFA 2FLSA 5F8BA 2GT5A 3IRAA 4TOPA 2H0GA 1E6BA 1A2MA 2CA8A 3KXOA 2H6XA 1GLPA 5DJMA 1EOGA 2JZRA 2V6KA 3CRTA 2L5OA 2VCVA 1ZYQB 2C80A 4PQIA 3TGZA 3ZIVA 3GN3A 4TR0A 4MH3A 1B9YC 3UVTA 5ID2A 4E8HA 3F8UA 2OADA 3MDKA 2GQMA 4P3YB 5HQPA 1YZXA 4KCEA 2RUFA 1YKCA 2EIOA 2FWGA 1SYXA 3FYGA 3EU3A 1A23A 4O7HA 2PU9C 4NV5A 5LCZA 4LL4B 3I6AA 1Z9HA 2HRNA 4K7OA 1EV4A 1BQ7A 3US3A 3KH7A 3PINA 2CQ9A 1EWXA 5D9XA 2YJHA 2CAIA 3ME7A 1GP1A 4PQ1A 3Q74A 5H5RA 1OE7A 1ZCPA 5B8BA 2YWIA 1A24A 3QAWA 4XRAA 3QDNA 2B1KA 4AJ8A 4I8BA 1GL8A 4MLYA 2RIIA 5F06A 4TVEA 2MBSA 5IQYA 4GLTA 1SJIA 4WXTA 1PL2A 4F0CA 5DCHA 2QSIA 3WD6A 4IELA 3M0FA 1XW5A 1OKTA 2LEGA 3EMXA 5HFGA 3TJKA 2GZYA 3H93A 4KE3A 1SENA 4ML6A 1VF1A 3GYKA 2IY2A 4GCIA 1HNCA 3LSZA 3IBHA 3KJYA 3IA1A 4POMA 4TR4A 2C0GA 2I1UA 2DJJA 4HEA2 3ERFA 4MPFA 2H01A 2OE0A 2B7JA 2YZHA 4ZIJA 3TKSE 2D2ZA 3F9UA 3ZITA 20GSA 1F3BA 1MDIA 4MCUA 5E4WA 4ECIA 4N30A 3GKMA 3TOTA 3LYKA 4GSNA 1MD3A 3GA4A 3GL5A 1GTAA 3SWLA 2QGVA 1TOFA 2N5AA 2C4JA 2VCQA 4QQ7A 4ACSA 1GNWA 1GUHA 5KEJA 1C72A 1AQVA 3F6FA 2YP6A 1N8JA 1ERVA 4MF7A 2K18A 5LD0A 3D0ZA 2R4VA 5ELGA 4YAVA 1SL2B 3NOFA 2CAQA 2AB6A 3QFAC 2YJ7A 4POBA 4EKZA 3C1RA 4ZB9A 3I9V2 4NHWA 2VL2A 1R4WA 2K9FA 3E3EA 4TKYA 4MK3A 5JCWA 4IKHA 2HXKA 4GF0A 1YDKA 4I5QA 4POLA 3HVSA 2GT6A 3QPMA 2XPDA 4NMUA 3TKQA 5E59A 5KN2A 3IPZA 2WRTA 2FWHA 2HT9A 1AQXA 2H71A 2LNSA 4GRFA 3UAPA 3ZREA 5CP1A 2ON5A 2CX3A 1AXDA 4BVYA 1SJZA 1FVKA 1TRSA 1X5DA 1OYJA 3E0UA 2F8FA 1CQHA 2IMIA 3Q6OA 4ULXA 1B4PA 2O89A 3WGDA 3KMNA 4K7IA 1GH2A 4GSTA 2DJ2A 1ST9A 3KP9A 1EV9A 1Z3EA 2LUSA 1QK8A 1UA5A 1EEMA 2YN1A 2LS5A 3J7Yk 1AW9A 3EURA 1MTCA 2JSYA 1EP7A 3P2AA 2FUG2 4L0WA 1VGLA 4PNGA 1X0RA 2EIRA 3P7XA 1ERTA 1PMTA 5B8AA 4OWYA 1BG5A 1A8YA 3P90A 4X0XA 1GSEA 4NXIA 2GTUA 4ECBA 1DE1A 5B6MA 4ZB8A 3TB2A 2XC2A 2CV4A 3CRUA 1X5CA 5A4WA 2VM1A 2RUEA 4CHSA 3LJRA 3ZLPA 2H8LA 2GVPA 4CDOA 3FR6A 3N5OA 5ECQB 3U6VA 3G7JA 4WF5A 1XVWA 2I81A 1TK5B 4BA7A 2N5FA 2JADA 2PVQA 5HFKA 2LQOA 3TKSC 2HZEB 4WR4A 2H1AA 1USBA 4G10A 3VI7A 1ABAA 3TJBA 1PN9A 1RK4A 4JZQA 4BL7A 2PVOC 5G2ZA 4MP4A 3TJGA 4HZ2A 1S3CA 2LQQA 1ZL9A 4EDYA 4WR5A 4ZL9A 4WBRD 3BCIA 4IN0A 4RQXA 2N5BA 1GSSA 5DDLA 4KDYA 7GSSA 2MMAA 4KUNA 4L0UA 2X99A 1TU8A 4YH2A 4Q5QA 2YPMA 2XHFA 2ALBA 5EL8A 2C3NA 1F6MC 4EVMA 3KGKA 2CZ3A 2LJRA 4TXVA 2KUCA 3CXGA 3HA9A 4IP6A 4KB3A 4KGIA 2I9HA 2LJKA 4K6XA 4Q5NA 1J9BA 3LQ7A 1WOUA 3GX8A 5G5FA 5JCGA 10GSA 4IS0A 4PQHA 3HCZA 1FVJA 1WE0A 4GWRA 2ZUPA 4N10A 2I4AA 2MMNA 4GXZA 5INYA 3KIJA 5DCGA 4PXOA 4DSQA 4POKA 1K0MA 3EC3A 4NPBA 3WGXA 4MJCA 2HNLA 1Z5YE 1TKDB 2H75A 2ZNMA 3L9SA 5G31A 5KN1A 4JR6A 5HR1A 1TDIA 5IMDA 5IPHA 1O6JA 3ZYWA 2WFCA 1G6YA 3PH9A 2FGXA 3L0HA 2GS3A 1ZYEA 2B3SA 4OO4A 3IDVA 1RQMA 1QFNA 2KOKA 1X9SB 1M2AA 1QGVA 2IL3A 3O3TA 2L5LA 1K0OA 6GSSA 3MNGA 1XOBA 2FA8A 2GSQA 3KTLA 2GGTA 5ENUA 5GAND 2VD0A 3IAM2 2LNTA 5B7CA 1TI3A 2TRCP 3J7Yb 3CTFA 2H73A 3EWLA 4YQVA 1G6WA 2CVDA 1YY7A 3W8SA 5J9BA 4AJ6A 1FB6A 2EC4A 1JZDA 1K0DA 1TI1A 2H19A 2VCZA 2F51A 3Q18A 1I5GA 4J57E 4HDEA 2OBIA 3A5WA 2LRCA 2A4VA 5F07A 2IJYA 2A2RA 3Q19A 3KP8A 5EY6A 1U3AA 5J41A 2IMDA 2VO4A 4O32A 1OC3A 5CRWA 4IP1A 4GQFA 3VFIA 3ZVJD 1FG4A 3APQA 2YCDA 5HFIA 3LORA 1M2BA 4LMVA 1GTBA 1W89A 3N9JA 3TKRA 2DJ0A 3FW2A 4XS4A 5IM9A 2ON7A 14GSA 1OAZA 2PERA 3TKSA 2DIZA 3ED3A 1PX7A 3M1GA 2DJKA 5J3RA 4WKWA 1HYUA 5H5QA 2M46A 4LA1A 3RBTA 3V1WA 3WYWA 3ME8A 1JZWA 2Z9SA 2BTOT 2H30A 4I6XA 1O81A 1M7TA 3MSZA 1XZOA 3QAVA 6GSWA 1HQOA 4D73B 1JHBA 3EMPA 3C7MA 5FWGA 3ZMLA 1XVQA 5H5SA 1O8WA 3FZ4A 4AJ7A 1GULA 1B8XA 4Q5RA 2NTOA 3IAS2 3GSTA 4TR3A 4KH7A 3GIXA 4IBPA 1CQGA 4KCAA 1O85A 4J2FA 1A0RP 4ECCA 2DSAA 3L78A 1V57A 3TRXA 2AHEA 1A2JA 2VCWA 1IYHA 3M8NA 4TXOB 2NBSA 3NIVA 3O76A 1RW1A 2HFDA 1SYRA 1SKSB 1K0BA 2VUPA 3FY7A 4QL9A 1THOA 2VCTA 3LG6A 3HD5A 2GSRA 5D93A 2VLVA 3CSHA 1G7OA 5ECSA 3TJJA 1TU7A 3L9UA 1Z6MA 2WZ9A 3GL3A 4ID0A 4RUVA 4L5OA 1U3IA 4KSMA 1XWGA 5GZZB 2HSYA 2JZTA 4ECJA 1I9DA 1YEPA 5D9VA 4HU9A 1MDKA 1MEKA 1E2YA 5J9CA 2VCXA 2K6VA 3BD2A 4AF2A 2NDOA 5ECOB 1LBKA 3IV4A 5COHA 1TP9A 2K8SA 2F8AA 2OACA 3VURA 4PNFA 4N0ZA 2O7KA 3FRCA 4G2EA 1URMA 3DGQA 4ZILA 5IMAA 1G0TA 1F9MA 1FAAA 2GSTA 5IO2A 2HRFA 4KX4A 5EPFA 4F03A 3DIEA 1J08A 2F3MA 4K9ZA 1BX9A 2B5YA 2GQLA 3ERWA 1Q98A 2GLRA 1EEJA 19GSA 3BOAA 1VRSD 2IN3A 1GTUA 1XFLA 3GMFA 4WETA 3VPQA 4G19A 3FZAA 1ML6A 3KMOA 4KA0A 2H76A 4ZBBA 2M80A 1U87A 1W4VA 4MZCA 3HVXA 3QR6A 4KDUA 1T00A 4N0VA 2OBKA 5CNWA 4Z7XA 2H1DA 5JWRB 3F4RA 2OE3A 4EDZA 1VF3A 2C0FA 3GH9A 5IIZA 3IR4A 5CREA 1QMVA 3O6TA 2V1MA 3LGCA 4E8EA 1K0NA 3RHCA 2E2MA 2RLIA 1Y25A 1T1VA 4ZBAA 1ZOFA 1PKZA 3UL3A 3KD0A 1JLVA 4OFTA 5ECPB 2E0QA 4X1UA 17GSA 3M3MA 3DRNA 3M9JA 5FT3A 3IXRA 1AIUA 2LRTA 1EGRA 3UIWA 4MPGA 4K0NA 2AAWA 5DQSA 5G5EA 2R37A 1LU4A 4MJBA 1ZGNA 5GSSA 3VLNA 1PA3A 2PMTA 1SD8A 2IMEA 3LYPA 22GSA 1BEDA 3G9BA 5A5KA 2G2QA 2H0HA 5IO0A 3TKPA 2P5RA 1DUGA 2KLXA 2AYTA 4X43A 3DVWA 3DMLA 1BAYA 5IMVA 3VWVA 1V2AA 1ZMAA 3APSA 4MJAA 4MMMA 5D9WA 3A3TA 1XXUA 1XOAA 18GSA 4Q5FA 6GSUA 2KP1A 2R6KA 2H66A 5G1LA 1M2DA 1T4ZA 5JWQB 4IW9A 5IMFA 6GSTA 3UOMA 3KEBA 3CTGA 1VF4A 2VM2A 2H1BA 4JR4A 3H79A 1M9AA
chains in the Genus database with same CATH superfamily
2C8UA 1RCLA 3FG4A 4IGJA 5IMCA 1Z7PA 1FW1A 3ZTLA 4F9ZA 3ROBA 4MNNA 1TTOA 3F3QA 3CCS3 4XM4A 3EYTA 1IVUA 2CFLA 3I0YA 5BXQA 1SU9A 3K5TA 4XDWA 1AR0A 3WT2A 4G9HA 2MZCA 3APOA 5KOWA 4LYLB 2V2GA 3HHVA 4I2TA 1SD9A 4WYKA 5C04A 2AADA 4OFNA 3VWXA 1PRXA 2SBLA 2MBTA 1OVNA 2BMQB 2HLSA 1NDOB 1DMMA 13GSA 1B2MA 2LSTA 3HYPA 5KP4A 1GSFA 4AGSA 1W4NA 1YJ93 4QL7A 2YWMA 1Z6NA 3UMAA 5ABRA 2LTKA 1VQQA 5D8IA 1TUHA 2CFWA 2VLTA 2X8CA 3RAZA 3GZBA 3TOUA 3B8LA 4ML1A 2MMOA 2R0PA 1R5PA 3BNDA 1U8CB 1BVIA 3UEMA 3C1SA 5ECLB 2GQKA 5M18A 1QMAA 1OHOA 2FWEA 3DD3A 4H86A 5F05A 4OUQA 4XS1A 4Z2RA 3G16A 1U6TA 1S3DA 2J9HA 5AN1A 4ORLA 4XBTA 2HZEA 1ILOA 2FD3A 3GX0A 5GAPD 1YJ6A 5DALB 3FR9A 1OUNA 3CPW2 1IT7A 2YNXA 4JRRA 5DRVA 3ZIJA 3BU4A 3H1NA 2F5WA 3N54B 3CBUA 1N9JA 4TW5A 3GSSA 3FG3A 1B9XC 1K3LA 2IIYA 3LEFA 3CCV3 1M99A 1VQ63 1TJDA 2R0CA 4ILFA 1A0FA 3I43A 3CC73 1T7PB 3LWAA 3UB1A 2YV9A 5CRGA 2TIRA 4XHMA 3DXBA 2DC5A 1WIKA 2LV3A 2CVKA 5DVBA 1YIJ3 3L9VA 2IA7A 2O85A 1QUWA 4BWQA 3NBRA 2GEYA 4MMXB 2MMZA 3BNBA 1PFPA 5ECHB 1E97A 4XBYA 4YKGA 4WP5A 1WWJA 2FXTA 2XGLA 3A2XA 4V2NA 4HJ2A 4RNTA 4DSSB 4OFMA 5DQYA 2PN8A 1TRUA 5CRHA 4KVHA 2L4QA 4FO5A 2GDRA 2HYXA 2ZCTA 4K1FA 3R3EA 2B6MA 1ERUA 5G1KA 4I97A 1OC9B 1CH0A 2YFLB 1JZOA 1NHYA 5DALA 4EF0A 5CXOA 4OO5A 1V74A 2WDUA 2PUKC 1ZS7A 6GSXA 4X2HA 1UUGB 1GTIA 1WRYA 2UGIA 3MAKA 4KAEA 4XTSA 3FR3A 3MG3A 3VSYA 1K734 1FO5A 1GYBA 3DVXA 4XRDA 3FSDA 3N8BA 3F4SA 2IYJA 3FEUA 3LXZA 2AUVA 5IPGA 1S3AA 1UN2A 3F3RA 4MF6A 3CSIA 3SOAA 4MABA 2O3OA 2HOHA 2A2PA 1FB0A 5IMZA 2C0EA 3CU3A 1TTZA 3ZVJA 1K0AA 1GY7A 1I3FA 3U97A 2KF6A 4GL6A 3A2WA 1OHPA 2OQEA 1ACVA 5C00A 1BSBA 3JVCA 3WDGB 2L59A 1R5AA 5KN0A 4TN8A 1JJ22 1K41A 1Q7Y4 2ZDJA 2JU5A 4HZ4A 3F6DA 1JN5A 1WQLB 4DSSA 3NM7A 1XWAA 3RGAA 4F82A 1XWKA 3ZRDA 3LTCA 3HZ8A 5CAXA 3S9FA 3ZG0A 1SKRB 3HX8A 4V1Ap 1OC9A 2KXGA 2ZHXB 2R3XA 5ECIB 1BNJA 5HR0A 2BU4A 3EINA 3SXXA 3MHEA 3S5CA 1SK0A 1FGQA 3D4AA 5D81A 1PQNA 4K0GA 5FHIA 4HU7A 1SL1B 1UW1A 2STDA 3FG1A 4KFDA 3IC8A 2FY6A 2OTL3 3C8EA 1RMSA 1NW2A 1WP0A 5J4UA 1GSUA 4RQRA 2HE3A 2W2CA 5ECMB 2WB9A 2F9SA 5FGOA 2XBIA 4HAAA 3CCQ3 4CJNA 5JWOB 1YJW3 1H4OA 4CW9A 2B5EA 5AGYA 5A4VA 1JLWA 5CO3A 1PGTA 2SARA 4ISDA 1I0VA 1FUWA 2C3TA 2X64A 1Q40A 2PGTA 3M8CA 3LZAA 3EJVA 5BMUA 3MSOA 3IK9A 5DBQA 1MDJA 2P0GA 3IC4A 4IVFA 4OD7A 5D9TA 1HNBA 3LXTA 4OVMA 3VI5A 3AHWA 4JU5A 1MWTA 2IUJA 2L1SA 3GKNA 3SOYA 1YEXA 4GTUA 1K0CA 3G713 3F4TA 2NVLA 3PPUA 2VIMA 2CT6A 5CYYA 2REMA 3F8XA 3WMDA 1ON4A 3PR8A 16GSA 2TRXA 4IJIA 5KN3A 3UL5A 1NB5I 3HK4A 1H75A 3DYRA 3CMIA 3UL6A 2ZL8A 3JCML 4L5LA 3WOFB 1AY7A 2B7KA 2M72A 2K8VA 3FK8A 1F37A 2WGQA 2KF4A 1GOYA 1VQ83 1SJ6A 1HNAA 1SK1A 3DWVA 4OCEA 3OXAA 1ULIB 2LRNA 5F0GA 1MD4A 5B6NA 4LMWA 2J23A 4LLRA 1RRHA 1B2XA 3EE2A 4L8OA 2VL3A 2X8HA 2LYXA 3RHBA 5DAKB 3X42A 2P5QA 1YKAA 2L57A 3C71A 4V1Ag 2HZFA 1GUKA 3D21A 3CCU3 1MWSA 1V58A 1R26A 1THXA 1UDII 1JB5A 3IE3A 1WPIA 3KZQA 3L4NA 2CW9A 3OWSA 4K61A 3VWWA 4OMVA 2DBCA 1IDPA 4X2OA 1A2KA 4R4KA 3IK7A 5DJLA 3TRPA 4FCZA 3NM2A 4EBGA 5D73A 2LJAA 1EP8A 4G1MB 1OE8A 4BPYA 2QGUA 3EC9A 2PPTA 3SX1A 1OH0A 3UJMA 2RM5A 3D5JA 3GTUB 2JSZA 1B48A 3GWRA 1TRVA 2R4IA 4KFFA 2HMMB 4MF5A 1BNGA 1T2HA 2KHPA 2X4AA 2RSXA 3A5EA 3DZLA 4KT3B 3ER7A 5AEUB 3CXC2 4D73A 2CWUA 2VOCA 2FA4A 2H6ZA 3ZL5A 3D3LA 1JBTA 2BJXA 3E9JB 3QAGA 2H74A 1YVBI 1LRAA 1XBSA 3K8NA 4FYCA 5IOWA 3CSJA 5IOXA 1DE2A 1BRIA 2YOIA 5DAKA 3RPPA 3FZ5A 4FCJA 1NSWA 2WJUA 2EIQA 1PD21 4NV2A 5AIGA 1GSQA 1TK8B 2ZA4A 2X8GA 3UVHA 4CY8A 3C73A 1STFI 3NZNA 1B2SA 2IWTA 2CH9A 4MZWA 2WGRA 4NAXA 3KH9A 5ECKB 3WGEA 1N5HA 1A8LA 4IQAA 2P0MA 1YJN3 1Q4JA 5AIXA 2MF7A 4J56E 1M0UA 5ELAA 1U88A 2Q07A 1YI23 2JACA 2GSSA 4TXOA 1CQSA 1EGOA 4FMCA 4V2MA 1PL1A 3W6GA 4IIAA 5D82A 4HZ9B 3TRQA 3GTUA 4EYCA 3MG2A 5GSTA 5D96A 1UC7A 1J2BA 4PURA 6GSVA 2CK3H 4TRXA 4XDVA 2PBJA 4GQCA 5D83A 4K8MA 2CVBA 1FOVA 1JZRA 2Z7AA 4HI7A 3DXOA 3DMCA 1VQN3 4I2UA 3WT1A 1EOHA 1WMNA 2HMJB 3W8JA 1F3AA 3E99A 4MEIA 7STDA 1Z7RA 5HOHA 3ERGA 1IQXA 1I2GA 2FCHA 1XIYA 4N6UA 1FW7A 3GUSA 4HUAA 1GUMA 1AUCA 3URPA 4XCSA 1GWCA 4Z2UA 1ERWA 1KWIA 1SPUA 1QAKA 4BVYB 1GSDA 4RI7A 3S67A 8CHOA 2GZZA 3VPTA 3MWHA 1RJOA 3QMXA 1RN1A 2E7PA 2H0IA 1US1A 3GZYB 3UJ1A 3TCOA 5JPUA 3GV1A 3WR2A 1OGZA 1S5AA 1PSQA 3QFBC 2BHMA 2Z77A 1PX6A 5JCUA 1DVDA 3GRXA 2IPAA 3Q3FA 1HYFA 3CD63 1GLQA 4YQMA 1UUWB 3D4TA 4BWSA 3N9HA 1GMRA 4J8TA 3CPOA 3GURA 3ZMKA 4WF4A 1KBNA 3OR5A 3AGNA 1W2B2 2FGTA 1TXXA 5LNKe 2LKUA 4EIPA 4MJEA 3B7CA 4XIHA 4O5UA 3QCPA 4V2LA 1O7NB 4K90B 5L71A 2DJ1A 1EZKA 4DVCA 4L7KA 5ECNB 4MA9A 2AJQB 5G30A 1UI7A 1K28A 3RPNA 3SEDA 6GSPA 4ZL7A 3CCM3 2KP2A 4TR1B 1SK2A 3K63A 2H72A 2YWNA 1NB3I 5CF2A 1KNGA 2V32A 4ZL8A 2A2SA 1B4QA 3UBKA 1DMNA 3MG1A 1E3RA 5IG3A 1O73A 4O02B 3EU4A 2PWJA 4WEYA 3GFKA 3ZFLA 3IOSA 3G7IA 2J8XB 4FYUA 4PUFC 5TGNA 4GHOA 7GSPA 1V9WA 3H4KA 5CRDA 1J0FA 1F2EA 2CC3A 1NO3A 3GNJA 1GRXA 4NHFA 4IQ1A 3DH2A 3H8QA 4K7NA 4GSPA 9GSSA 3H3HA 1MGRA 4J9AA 3I69A 4DKIA 3RDWA 1PYLA 4JF8A 4L8PA 5AI1A 4EW5A 2VLUA 1YIT3 3D22A 1WNHA 2WGOA 4CDLA 1UUVB 2QKEA 3D6IA 3D9RA 4FH8A 1STDA 2OA7A 4GSSA 1FYSA 1YF1A 4RI6A 3F63A 4X4JA 1A2LA 3P8WA 4HOJA 4HJMA 1OKDA 1T3BA 3ZZXA 1BYEA 3KFQC 1K3YA 3ISOA 4EO3A 4DEJA 4BL7B 1AQWA 2W03A 4BVXB 4R9LA 4NHZA 4TR1A 3FZ9A 3J7Yd 1ZZYA 1WMPA 2IMKA 1R7HA 4ZB6A 4YQUA 3TDGA 3BJ5A 1WJKA 1FHEA 3FHKA 3KE7A 3G7YA 2IFQB 2HMNB 5I97A 5CLKA 3WODG 1DSBA 3EN1B 1DE3A 3PCRA 3A2VA 1BRJA 1B3SA 1KTEA 2QA1A 2WS2A 3LTDA 1XWBA 3NHXA 1BUJA 2H6YA 1FGTA 4H61A 2R2JA 2WCIA 2DIYA 2I3YA 2OKAA 1YQ1A 4O92A 2YV7A 2H70A 3U5RE 3ZFBA 5IERA 2O87A 3WA3A 1A90A 1W01A 1KD14 1X9MB 2L6CA 4FYBA 1T8EB 1AVKA 2XRXB 3HI7A 2O8VB 4EC0A 3TUEA 4BL3A 5J5NA 3CMA3 3Q2PA 3DGMA 5ELJA 4WBJA 3OV4A 3JUQA 1BNRA 1X5EA 2DKHA 4KDXA 5A4UA 1XW9A 3GSPA 4BVXA 1T5YA 1DBYA 5LC6A 4N6OB 1X9WB 2V41A 1TK0B 4EL1A 3CCL3 1RGAA 5LC7A 3KTBA 2H1GA 1O7WB 1O7UA 1K9M4 3NQYA 2QC7A 1NHOA 3UARA 4JEDA 2HSHA 2MYGA 2DJ3A 4NWYA 4HVNA 2I9WA 3PYJA 4YAPA 2E2TA 3DEXA 2CFDA 1T2IA 2CWTA 5ECRB 2IFQA 6GSYA 1W02A 1VF2A 4IJ3A 2YFIB 1TFOA 2RBIA 2AV4A 4AKZA 3GH6A 1TRWA 4O5RA 1ZO2A 2L6DA 2WULA 3SBCA 1WTHA 1AAZA 3PGTA 2RM6A 2UUGC 4MDCA 4KW6A 2IUKA 3GKXA 2CZ2A 3HZ4A 1KC84 2C0DA 3CCE3 1HD2A 3V99A 4K5RA 1GSYA 3HJMA 4F2IA 2ES7A 4DSRA 5STDA 3LFLA 2R5GA 2HI7A 3QD9A 1G7EA 2FNOA 4JE1A 1GOUA 4HYZA 1S723 1D6UA 2HRKA 8GSSA 3EF8A 2YWOA 1GNEA 2GZPA 1K3OA 2CG1A 1MWRA 1N2AA 2DLXA 2V6OA 4O2HA 1GY6A 3HJPA 2CX4A 3EB8A 1WMJA 5G2GA 4G0KA 1IVVA 1TW9A 2JZSA 4FIWA 4MZBA 1LJRA 2UX0A 1G96A 2IMJA 1MOLA 2Y74A 5AIIA 1QQ2A 3M9KA 5BIRA 2P38A 2VL9A 1JFUA 1TFKA 4F0BA 1AC1A 4HQZA 4IHUA 1IYIA 1V40A 3R2QA 1JBSA 4OCFA 2JQ5A 4PX1A 4LSOA 3KM6A 4ZBDA 4O3VA 3CC43 2E2VA 3FLJA 1RGEA 3EVIA 2YANA 4GB5A 2DMMA 1MGWA 2L4CA 2NPBA 3HJOA 3EBYA 1VQP3 1VQO3 1UVZA 4LEHA 2XEPA 2MC8A 2OTJ3 1OCVA 5AISA 1V98A 3D4MA 3GRDA 2JL4A 2QEX3 2JDIH 1XW6A 5EVOA 3NX0A 4EXJA 1M9BA 2DMLA 1W5ZA 4N11A 1HU9A 2BMXA 4J5KA 2B1XB 3D79A 3EN8A 1E3VA 2C1YA 3GZRA 5GSPA 1XPVA 1QXHA 5HR3A 3HKRA 2C3QA 2OE1A 4KNDA 4PUAA 2GEXA 1PKWA 2C11A 4L8EA 1OC8A 1T4YA 3KCMA 1O8XA 2E2GA 3HY2A 4K2DA 12GSA 2VD1A 3GKKA 4ZXGA 1DETA 3NBBA 1BRNL 1EA2A 2VAFA 4LGQA 4FCMA 2UZ8A 1EKMA 1Q824 3KKGA 3F14A 1XCCA 3BBYA 3HDCA 1Y6EA 2WOFA 3F0IA 1Q7HA 3DKSA 3LXUX 1SL0B 2XPEA 3H51A 5AIVA 3I563 3AY8A 3HVVA 1YF0A 1RGFA 3DGLA 3FH1A 1NM3A 2P31A 2G0FA 2YZUA 2B1LA 1AV4A 2XBQA 1SKWB 3EQQB 5IEPA 4XS4B 3CNXA 3FKFA 3GHAA 1KEBA 4XBXA 3VK9A 2V1LA 4LL1B 3MIXA 3VWUA 1XWCA 3UBLA 3BCKA 5ID2B 4Q53A 1ROVA 2OJLA 2B5XA 2VL2C 2FHEA 4MH2A 3PGBA 11GSA 1B2ZA 3HXSA 4KSOA 5HR2A 2BIRA 4HS1A 4EUYA 1UCIA 3CYNA 3B4OA 2FWFA 3IHQA 3QOUA 1BJXA 4PGTA 4HM0B 4XS6A 4JBBA 3HOHA 4EE0A 3CQFA 4HQSA 1ROAA 3TJFA 9RNTA 2IMFA 2C10A 2FLSA 5F8BA 2BO9B 3FCSB 1C54A 2GT5A 3IRAA 4N6NB 1B21A 2R0GA 4TOPA 2H0GA 2INXA 4K5SA 2AAEA 1C7HA 1A2MA 1E6BA 2CA8A 3KXOA 2H6XA 3FF2A 1GLPA 5DJMA 1EOGA 1DVCA 2GSPA 2JZRA 2V6KA 3CRTA 2L5OA 3HIGA 2VCVA 1ZYQB 2C80A 3A76A 3DM8A 4PQIA 4A5PA 3TGZA 3ZIVA 3GN3A 4TR0A 3KN4A 1B9YC 4MH3A 3UVTA 4CY6A 5ID2A 2XFSA 4H3UA 4E8HA 3F8UA 2OADA 3MDKA 3IPTA 6STDA 4FMAA 2GQMA 3ALAA 2KF5A 4P3YB 5HQPA 1YZXA 2HMOB 4KCEA 2RUFA 1RDSA 1YKCA 2EIOA 2FWGA 1SYXA 3FYGA 3EU3A 1A23A 4O7HA 2PU9C 4NV5A 1I2EA 5LCZA 1Q9EA 1O7PB 3S29A 4LL4B 3I6AA 2YFJB 1Z9HA 1EUIC 2HRNA 3RNTA 3AGOA 5M1AA 4K7OA 2ML6A 1EV4A 1BQ7A 3LT8A 4HM4B 3US3A 3KH7A 3PINA 2CQ9A 1X1WA 1EWXA 5D9XA 2YJHA 1B27A 5KP1A 2CAIA 4FMBA 3ME7A 1GP1A 1FGOA 1A67A 1I70A 4RZMA 4U13A 2XF3A 3CME3 1OE7A 3Q74A 1ZCPA 4PQ1A 4KFEA 5H5RA 1VQ53 5B8BA 2YWIA 1GMQA 1AVLA 1W7CA 1A24A 1O7GB 3QAWA 2Z6BA 4XRAA 3QDNA 2B1KA 2XGNA 4AJ8A 1LNHA 4I8BA 3GZXB 1GL8A 2DKIA 4MLYA 3RDEA 1VQK3 2RIIA 1BAOA 1GMPA 5F06A 4TVEA 1PFOA 2MBSA 5IQYA 1JV2B 1AQZA 4GLTA 1SJIA 4WXTA 1PL2A 4BIKA 4FQUA 4F0CA 1TU5A 5DCHA 4WHAA 3HZPA 2HRAA 2QSIA 3WD6A 3OWYA 1M3JA 4IELA 3M0FA 1XW5A 1OKTA 2LEGA 3QRDA 3EMXA 5HFGA 3TJKA 2GZYA 3H93A 3CNMA 4KE3A 1IYYA 1TP6A 2W56B 1SENA 4ML6A 1VF1A 3GYKA 2GBWB 2IY2A 4GCIA 1HNCA 4EV2A 1B20A 3LSZA 3IBHA 3KJYA 3EBTA 3IA1A 4POMA 4TR4A 2C0GA 2I1UA 1BRSA 1I0XA 3T8UA 1Q864 2DJJA 4HEA2 3ERFA 4MPFA 1MNLA 2H01A 3O8YA 2OE0A 2PZVA 2B7JA 2YZHA 1OGXA 1JB2A 1TIJA 4ZIJA 3TKSE 2D2ZA 3F9UA 3ZITA 20GSA 1I2FA 1F3BA 1MDIA 3DGNA 4MCUA 5E4WA 4ECIA 3S27A 1HKXA 1JNQA 4N30A 1M1K4 3GKMA 4BL2A 1ZYPA 3DY5A 3TOTA 3LYKA 3F7XA 5IF6A 2BMRB 4GSNA 1MD3A 4PEJA 3GA4A 3GL5A 1GTAA 3SWLA 3X3XA 4WFOA 2QGVA 1TOFA 1SIHA 1RGLA 3SLUA 2N5AA 4Z2TA 2C4JA 1UCJA 1BIRA 2VCQA 4QQ7A 4ACSA 1GNWA 1XG8A 1GUHA 5KEJA 1DMQA 1C72A 1AQVA 3F6FA 1BNIA 2YP6A 1N8JA 1ERVA 4MF7A 5IG5A 2K18A 3V92A 5LD0A 3D0ZA 2R4VA 5ELGA 4RNYA 4YAVA 3X41A 1SL2B 1ULJB 1KQS2 3NOFA 4MJDA 2CAQA 2AB6A 3K7CA 5EEOA 3QFAC 2YJ7A 4POBA 1O7MB 4EKZA 1JRQA 3C1RA 3CCJ3 5DREA 5M19A 4ZB9A 3MWZA 3I9V2 1M1XB 4NHWA 4ZM8A 2CFKA 1EQKA 1BSDA 4EV5A 1G02A 2VL2A 1R4WA 2K9FA 3F9SA 3E3EA 4TKYA 5FW5A 2GXFA 1A2PA 2K54A 5IG0A 4MK3A 5JCWA 4IKHA 3PZWA 2HXKA 2PNCA 4GF0A 1YDKA 4I5QA 4POLA 3HVSA 2GT6A 3QPMA 5IW9A 2E2UA 4KF9A 2XPDA 1QVG2 4MMZB 4NMUA 3TKQA 5E59A 5KN2A 3KCHA 1B2UA 3IPZA 2GU3A 3VF1A 2WRTA 2FWHA 2HT9A 1IQ8A 1AQXA 2H71A 2LNSA 4GRFA 3FMWA 3UAPA 4CCVA 3ZREA 5CP1A 2ON5A 2CX3A 1AXDA 4BVYA 1SJZA 3SVAA 1FVKA 4NREA 1TRSA 3X3YA 1JBRA 1X5DA 4BU4A 1OYJA 2F8FA 1CQHA 2IMIA 3E0UA 1UCLA 3Q6OA 4ULXA 4FR9A 2BMOB 1B4PA 2QA43 2P05A 1BGSA 2O89A 3WGDA 3KMNA 1FUTA 4K7IA 1GH2A 2CG0A 4GSTA 2DJ2A 1ST9A 2F5MA 1RTUA 3KP9A 1EV9A 1Z3EA 2LUSA 2RNTA 3FGYA 1QK8A 1UA5A 5CF1A 1EEMA 2YN1A 2LS5A 3J7Yk 1AW9A 3EURA 1MTCA 2JSYA 4HM2B 4K1UA 1VQ93 1EP7A 4LMIA 1IK3A 1GS3A 3P2AA 1X1YA 2FUG2 4L0WA 1RGCA 1VGLA 4PNGA 1X0RA 2EIRA 3P7XA 1ERTA 1PMTA 5B8AA 4N6LA 4OWYA 1TRQA 1BG5A 1A8YA 1CYUA 3P90A 4LZIA 4X0XA 2CX0A 1FA3A 1GSEA 2GTUA 4NXIA 4ECBA 2W04A 3CCR3 1DE1A 1LQMB 1W2ZA 1FGMA 3CC23 1Q42A 6RNTA 5B6MA 1UCKA 4ZB8A 1LVNA 3TB2A 2CKFB 2OOVC 2XC2A 4N6TA 2CV4A 3CRUA 1X5CA 5A4WA 2VM1A 2RUEA 3LMLA 4CHSA 1Q814 1YNVX 3LJRA 3ZLPA 2H8LA 3B4PA 2F98A 3QK9A 5AIHA 2GVPA 3IHGA 3STDA 1GOVA 4CDOA 1GSPA 3FR6A 3N5OA 4EIQA 5ECQB 3NUVA 3U6VA 1DYUA 2BNGA 3PCSA 5A0OB 3G7JA 4WF5A 3G4S3 1XVWA 1GD4A 2I81A 5AYSC 1TK5B 4BA7A 1W6YA 2N5FA 2JADA 2PVQA 1X1XA 3NQZA 4K1VA 5HFKA 2KCDA 2LQOA 3TKSC 4IT7A 2HZEB 4WR4A 2H1AA 1USBA 4G10A 3VI7A 1BANA 1ABAA 3TJBA 1PN9A 1RK4A 4JZQA 4BL7A 1IQYA 1IV9A 1PN0A 2PVOC 5G2ZA 4MP4A 3TJGA 1YVSA 4HZ2A 1S3CA 3DGYA 2LQQA 2RFRA 1ZL9A 4EDYA 4PTSA 4WR5A 3D5GA 3GAXA 4ZL9A 4WBRD 3V98A 1UGIA 3WA2X 5AYRB 3T0UA 3BCIA 1OF5B 4IN0A 4RQXA 2N5BA 1GSSA 5DDLA 4KDYA 1I3IA 3BNEA 7GSSA 2MMAA 4KUNA 3JUOA 4L0UA 2X99A 1TU8A 4YH2A 4Q5QA 2YPMA 1SARA 1RHLA 2XHFA 2FNQA 2ALBA 1BSCA 5EL8A 2C3NA 1F6MC 4EVMA 1BOXA 4HJLB 3KGKA 3EPTA 1QALA 3UNLA 3FZWA 3DUKA 3BLZA 2CZ3A 3NBJA 2LJRA 4TXVA 2KUCA 3CXGA 3HA9A 4IP6A 4KB3A 4XB5A 4KGIA 2I9HA 2LJKA 4K6XA 4Q5NA 1J9BA 3LQ7A 1RSNA 1WOUA 2XFTA 3GX8A 2K3DA 1X1UA 1RNBA 1D6YA 4CPKA 1S3RA 5G5FA 5JCGA 3BB9A 10GSA 4KZ1A 4IS0A 1RN4A 1ZYNA 4PQHA 3HCZA 2ML5A 3OX9A 3KSED 1FVJA 1WE0A 1OF5A 4GWRA 4QWTA 5KOXA 2ZUPA 4N10A 3EX9A 2I4AA 2MMNA 4GXZA 3K9MC 5INYA 3BNCA 3KIJA 5DCGA 1HZ1A 1A2VA 4PXOA 4HOHA 2OCTA 4DSQA 4POKA 1PU4A 1JN5B 2R41A 1K0MA 3EC3A 3HVNA 4NPBA 3WGXA 2BT3A 2W9QA 4MJCA 1ISKA 2HNLA 2F56A 1Z5YE 1TKDB 2H75A 2ZNMA 3MYDA 2XR8B 3L9SA 1OACA 1GY5A 5G31A 5KN1A 3BIRA 4HM8B 4JR6A 5HR1A 1TDIA 5IMDA 5IPHA 1O6JA 3ZYWA 2WFCA 1G6YA 3PH9A 1R4CA 3EE1A 2FGXA 3L0HA 2W6JH 2GS3A 1ZYEA 2B3SA 4OO4A 2C4BA 5EVHA 3IDVA 1RQMA 1NNVA 1QFNA 2KOKA 1X9SB 4JRFA 1M2AA 1QGVA 2IL3A 3O3TA 7RNTA 1VQM3 1W6CA 2L5LA 1K0OA 1LOYA 6GSSA 3MNGA 4USSA 5IG4A 1XOBA 3Q90A 2RCDA 2FA8A 2GSQA 3OWUA 3KTLA 2GGTA 1BSEA 5ENUA 5GAND 2VD0A 3IAM2 3L0RA 2LNTA 5B7CA 1EG9B 1TI3A 2TRCP 3J7Yb 1YHQ3 3CTFA 3PXMA 3NXJA 1BNSA 3LTBA 2H73A 3EWLA 4YQVA 1G6WA 5BVBA 2CVDA 1YY7A 1Q40B 2A15A 3W8SA 1QVF2 5J9BA 4AJ6A 1FB6A 1N8R4 2EC4A 1LQGC 1W00A 1JZDA 1K0DA 5RNTA 1TI1A 2H19A 1Y4KA 4YKFA 2VCZA 2F51A 3Q18A 1I5GA 4J57E 4HDEA 1BUQA 2OBIA 1N5PA 2GU1A 1KSIA 3A5WA 2LRCA 1GD3A 2A4VA 1RNTA 5F07A 2IJYA 2A2RA 3Q19A 1SIIA 3KP8A 4G0IA 5EY6A 1OHSA 3KSPA 4BIRA 1LXEA 1U3AA 5J41A 2IMDA 2VO4A 2OOVA 1JB4A 4O32A 1OC3A 1BRKA 2XSOB 5CRWA 4IP1A 4GQFA 3VFIA 3ZVJD 3F8HA 1FG4A 4G0LA 1FGRA 3APQA 2YCDA 5HFIA 4HM3B 3LORA 1M2BA 4LMVA 1GTBA 1W89A 3IMAB 4EXRA 3N9JA 3TKRA 2DJ0A 3FW2A 3PS8A 4XS4A 5IM9A 2ON7A 14GSA 3ZFZA 4O8SA 1OAZA 1RRLA 4AKYA 1K8A4 4HZBB 2PERA 3TKSA 2DIZA 3ED3A 1RCKA 1FUSA 1PX7A 3F7SA 3EHCA 3RGRA 3M1GA 2DJKA 5J3RA 4WKWA 5ELUA 1HYUA 5H5QA 2M46A 4LA1A 4N6V0 1VQ43 3RBTA 1NU3A 3V1WA 3WYWA 3ME8A 1UGHI 2Z76A 2XSHB 1JZWA 2Z9SA 3FKAA 2BTOT 2A4HA 2H30A 4I6XA 1O81A 2WO0A 1M7TA 2X49A 5BRTA 1Z1SA 3MSZA 3SYUA 1XZOA 3QAVA 6GSWA 1F8NA 3LOYA 3FF0A 2HMLB 5KP3A 1HQOA 4D73B 1JHBA 3EMPA 3C7MA 5FWGA 1UI8A 3ZMLA 4N3VA 1XVQA 5H5SA 1O8WA 3FZ4A 4AJ7A 1GULA 1B8XA 1W6GA 1SJWA 4Q5RA 2NTOA 5CK6A 3IAS2 3GSTA 3JUNA 4BTYA 3WOEB 2F99A 4TR3A 2W0QA 3GIXA 4KH7A 4IBPA 1RKYA 1CQGA 4KCAA 4R9KA 1O85A 4J2FA 1RLSA 1FOHA 1A0RP 5BU4A 2O9UX 4ECCA 5AEWB 2DSAA 3L78A 1V57A 3TRXA 3MPHA 2AHEA 1A2JA 3G0KA 2CWVA 2Y73A 1QJGA 4RNZA 2VCWA 3HIIA 1IYHA 3M8NA 2NBSA 4TXOB 3NIVA 4BTWA 3O76A 4N6MA 1RW1A 2HFDA 1SYRA 1SKSB 1M3IA 1K0BA 2VUPA 3FY7A 5JBSA 4QL9A 1THOA 2VCTA 3LG6A 3HD5A 2GSRA 5D93A 2VLVA 2KF3A 5IEOA 3CSHA 1G7OA 5ECSA 3TJJA 1TU7A 3L9UA 3G8ZA 1BSAA 4EC6A 1Z6MA 2WZ9A 2OWPA 3GL3A 1RGHA 4WWUC 4ID0A 4RUVA 4BTXA 3DGOA 1U3IA 4L5OA 4KSMA 1XWGA 3KIIA 5GZZB 2HSYA 2JZTA 4ECJA 3Q1CA 1I9DA 1YEPA 5D9VA 4HU9A 1MDKA 1MEKA 1E2YA 4J5GA 5J9CA 4STDA 2VCXA 3U1WA 2K6VA 3BD2A 4AF2A 2L4VA 5HGRA 1LOVA 2NDOA 3MKIA 8RNTA 4R1KA 5ECOB 1LBKA 3IV4A 1M904 5COHA 1TP9A 2K8SA 2F8AA 2OACA 3VURA 1N9EA 2K0MA 4PNFA 2CX1A 4N0ZA 1ASKA 2O7KA 3FRCA 3NV0B 4G2EA 1URMA 4AEQA 3DGQA 2M7OA 4ZILA 1FZUA 5IMAA 1G0TA 3LYGA 1F9MA 1FAAA 2GSTA 2D42A 5IO2A 3X3ZA 1NJI4 1IU7A 2HRFA 1IV7A 4KX4A 5EPFA 4F03A 3DIEA 1J08A 2F3MA 4K9ZA 1BX9A 2B5YA 2GQLA 3ERWA 1Q98A 2GLRA 1EEJA 2W56A 1CYVA 1PY3A 3ECFA 19GSA 3BOAA 1VRSD 2IN3A 1BRHA 1VQ73 1YGWA 4HM6B 1GTUA 1XFLA 3ZG5A 3GMFA 4WETA 3VPQA 1R4YA 4I4KA 3AHSA 3F40A 4G19A 2F86B 3FZAA 2P0XA 4HKVB 1IVXA 1ML6A 3KMOA 4KA0A 2H76A 4ZBBA 2M80A 5AIFA 3LW9A 1U87A 1VQL3 3LH4A 1W4VA 4HM5B 4HSCX 4MZCA 3HVXA 4FMDA 3QR6A 3JUMA 4KDUA 1T00A 1SQWA 1RN7A 4N0VA 1N8QA 2OBKA 3NV0A 3AMOB 2D1WA 5CNWA 4Z7XA 2H1DA 1TRPA 5JWRB 3F4RA 4R80A 3A5IA 2OE3A 4EDZA 3X40A 3OW22 1VF3A 3MYTA 2C0FA 3GH9A 5IIZA 1WMOA 5EQLA 3IR4A 4TX4A 5CREA 1QMVA 1IVWA 4ICYA 1MWUA 3VGNA 3O6TA 2V1MA 3LGCA 4E8EA 4HM1B 1K0NA 1L5GB 2W9PA 3RHCA 2E2MA 1IT8A 2RLIA 1Y25A 1QAFA 2QIYA 3KZTA 1T1VA 4ZBAA 1ZOFA 1PKZA 3UL3A 3KD0A 1JLVA 4OFTA 1BRGA 5ECPB 2WOHA 2E0QA 4X1UA 1NWWA 4OK0A 2F4YA 17GSA 2CFGA 3M3MA 3DRNA 3M9JA 5FT3A 3IXRA 1AIUA 2CIUA 2LRTA 1EGRA 3UIWA 3JUPA 4MPGA 4K0NA 2AAWA 1LNIA 5DQSA 1RGKA 5G5EA 2R37A 2XH9A 1LU4A 4MJBA 3LT9A 2HSMA 1JKGB 1CEWI 1ZGXA 2CHCA 2OQEC 3AMOA 1ZGNA 4RBNA 2YX9A 3T8NA 5GSSA 1LOWA 3VLNA 1LOXA 4HM7B 2QA2A 1OPYA 1PA3A 2PMTA 1SD8A 2IMEA 1BNEA 3LYPA 22GSA 4MMYB 1BEDA 3G9BA 1U5OA 5A5KA 2G2QA 2H0HA 1YGEA 4HBRA 5IO0A 3TKPA 3S28A 2P5RA 2GBXB 5IENA 1ZX2A 1DUGA 1O7HB 5JPPA 3I553 1I8VA 2KLXA 2AYTA 3D5IA 1D6ZA 3WHOA 4X43A 3DVWA 3DMLA 1M9GA 1BAYA 2KAAA 5IMVA 3VWVA 2HMKB 1V2AA 1ZMAA 2P09A 3APSA 4MJAA 4WYKB 4MMMA 5D9WA 3IJEB 3G6E3 3A3TA 1XXUA 4O5QA 3LTAA 1XOAA 4IPBA 18GSA 4Q5FA 6GSUA 2KP1A 2B24B 1JKGA 2R6KA 2H66A 5G1LA 1M2DA 1BU4A 1T4ZA 5JWQB 2LQVA 4IW9A 2RGQA 1BNFA 5IMFA 6GSTA 1VZZA 3K0ZA 1RGGA 2KRTA 3UOMA 3KEBA 3CTGA 1VF4A 2VM2A 4K2XA 2H1BA 4JR4A 3H79A 1M9AA
chains in the Genus database with same CATH topology
2C8UA 4IGJA 5IMCA 1Z7PA 1FW1A 3ZTLA 4F9ZA 4MNNA 3F3QA 3EYTA 1SU9A 3WT2A 4G9HA 2MZCA 3APOA 5KOWA 2V2GA 3HHVA 4I2TA 1SD9A 5C04A 4OFNA 3VWXA 1PRXA 2MBTA 1OVNA 2HLSA 13GSA 2LSTA 3HYPA 1GSFA 4AGSA 4QL7A 2YWMA 1Z6NA 3UMAA 5ABRA 2LTKA 5D8IA 2VLTA 2X8CA 3RAZA 3TOUA 4ML1A 2MMOA 2R0PA 1R5PA 3UEMA 3C1SA 5ECLB 2GQKA 2FWEA 3DD3A 4H86A 5F05A 4XS1A 4Z2RA 1U6TA 5AN1A 1S3DA 2J9HA 2HZEA 1ILOA 2FD3A 3GX0A 5GAPD 1YJ6A 5DALB 3FR9A 2YNXA 4JRRA 3ZIJA 3H1NA 3CBUA 4TW5A 3GSSA 2IIYA 1B9XC 1K3LA 3LEFA 1M99A 1TJDA 2R0CA 4ILFA 1A0FA 3I43A 1T7PB 3LWAA 2YV9A 5CRGA 2TIRA 4XHMA 3DXBA 2DC5A 1WIKA 2LV3A 2CVKA 5DVBA 3L9VA 2O85A 1QUWA 4BWQA 2MMZA 5ECHB 4YKGA 1WWJA 4V2NA 3A2XA 4HJ2A 4DSSB 4OFMA 5DQYA 2PN8A 5CRHA 1TRUA 2L4QA 4FO5A 2GDRA 2HYXA 2ZCTA 4K1FA 3R3EA 2B6MA 1ERUA 5G1KA 4I97A 1OC9B 1JZOA 1NHYA 5DALA 4EF0A 4OO5A 2WDUA 2PUKC 6GSXA 1GTIA 1WRYA 4KAEA 3MAKA 4XTSA 3FR3A 1FO5A 3DVXA 4XRDA 3F4SA 3FEUA 2IYJA 3LXZA 2AUVA 5IPGA 1S3AA 1UN2A 3F3RA 4MF6A 3CSIA 4MABA 2A2PA 1FB0A 5IMZA 2C0EA 3ZVJA 1TTZA 1K0AA 3A2WA 1ACVA 5C00A 2L59A 1R5AA 5KN0A 4TN8A 2JU5A 4HZ4A 3F6DA 4DSSA 1XWAA 4F82A 1XWKA 3ZRDA 3HZ8A 5CAXA 3S9FA 1SKRB 4V1Ap 1OC9A 2R3XA 5ECIB 5HR0A 3EINA 1SK0A 1PQNA 4K0GA 5FHIA 4HU7A 1SL1B 3IC8A 2FY6A 3C8EA 1NW2A 1WP0A 5J4UA 1GSUA 4RQRA 2HE3A 5ECMB 2WB9A 2F9SA 2XBIA 5JWOB 1H4OA 4CW9A 2B5EA 5AGYA 5A4VA 1JLWA 5CO3A 1PGTA 4ISDA 2C3TA 2X64A 2PGTA 5BMUA 3IK9A 5DBQA 1MDJA 2P0GA 3IC4A 4IVFA 4OD7A 5D9TA 1HNBA 3LXTA 3VI5A 4JU5A 3GKNA 1YEXA 4GTUA 1K0CA 3F4TA 2NVLA 3PPUA 2VIMA 2CT6A 5CYYA 2REMA 1ON4A 3PR8A 16GSA 2TRXA 4IJIA 5KN3A 1H75A 3DYRA 3CMIA 3JCML 4L5LA 2B7KA 2M72A 2K8VA 3FK8A 1F37A 1SJ6A 1HNAA 1SK1A 3DWVA 4OCEA 2LRNA 5F0GA 1MD4A 5B6NA 4LMWA 2J23A 4LLRA 3EE2A 2VL3A 2X8HA 3RHBA 5DAKB 2P5QA 1YKAA 2L57A 3C71A 4V1Ag 2HZFA 1GUKA 3D21A 1V58A 1R26A 1THXA 3IE3A 1WPIA 3KZQA 3L4NA 3VWWA 4OMVA 2DBCA 3IK7A 5DJLA 3TRPA 5D73A 2LJAA 1EP8A 1OE8A 4BPYA 2PPTA 2RM5A 3D5JA 3GTUB 2JSZA 1B48A 1TRVA 4MF5A 2KHPA 2X4AA 4D73A 2VOCA 2FA4A 2H6ZA 3ZL5A 2BJXA 3E9JB 3QAGA 2H74A 1XBSA 3K8NA 4FYCA 5IOWA 3CSJA 5IOXA 1DE2A 2YOIA 5DAKA 3RPPA 3FZ5A 1NSWA 2WJUA 2EIQA 1PD21 4NV2A 1GSQA 1TK8B 2X8GA 3UVHA 4CY8A 3C73A 3NZNA 2IWTA 4MZWA 2WGRA 4NAXA 3KH9A 5ECKB 3WGEA 1A8LA 4IQAA 1Q4JA 5AIXA 5ELAA 4J56E 1M0UA 1U88A 2JACA 2GSSA 4TXOA 1EGOA 4V2MA 1PL1A 3W6GA 3TRQA 3GTUA 5GSTA 5D96A 1UC7A 4PURA 6GSVA 4TRXA 2PBJA 4GQCA 4K8MA 2CVBA 1FOVA 1JZRA 4HI7A 4I2UA 3WT1A 1EOHA 3W8JA 1F3AA 1Z7RA 3ERGA 2FCHA 1XIYA 3GUSA 4HUAA 1GUMA 1AUCA 4XCSA 1GWCA 4Z2UA 1ERWA 4BVYB 1GSDA 4RI7A 2GZZA 3VPTA 3MWHA 3QMXA 2E7PA 2H0IA 3UJ1A 3TCOA 3GV1A 1PSQA 3QFBC 1PX6A 5JCUA 3GRXA 2IPAA 1GLQA 4YQMA 3D4TA 4BWSA 3GURA 3ZMKA 4WF4A 1KBNA 3OR5A 1TXXA 5LNKe 2LKUA 4EIPA 4MJEA 4XIHA 4O5UA 3QCPA 4V2LA 5L71A 2DJ1A 1EZKA 4DVCA 5ECNB 4MA9A 2AJQB 5G30A 3RPNA 4ZL7A 2KP2A 4TR1B 1SK2A 2H72A 2YWNA 1KNGA 4ZL8A 2V32A 2A2SA 1B4QA 3UBKA 1O73A 3EU4A 2PWJA 4WEYA 3GFKA 3ZFLA 3IOSA 3G7IA 4FYUA 4PUFC 1V9WA 3H4KA 5CRDA 1J0FA 1F2EA 3GNJA 1GRXA 4IQ1A 3H8QA 4K7NA 9GSSA 3I69A 3RDWA 2VLUA 3D22A 4FH8A 2QKEA 3D6IA 2OA7A 4GSSA 1YF1A 4RI6A 3F63A 4X4JA 1A2LA 3P8WA 4HOJA 4HJMA 1OKDA 1T3BA 3ZZXA 1BYEA 1K3YA 3ISOA 4EO3A 4DEJA 4BL7B 1AQWA 4BVXB 4NHZA 4TR1A 3FZ9A 1ZZYA 2IMKA 1R7HA 4ZB6A 4YQUA 3TDGA 3BJ5A 1WJKA 1FHEA 3FHKA 3G7YA 2IFQB 1DSBA 3A2VA 1KTEA 2QA1A 2WS2A 1XWBA 2H6YA 2R2JA 2WCIA 2DIYA 2I3YA 2OKAA 1YQ1A 4O92A 2YV7A 2H70A 3U5RE 3ZFBA 2O87A 1X9MB 2L6CA 4FYBA 1T8EB 2O8VB 4EC0A 3TUEA 5J5NA 4WBJA 2DKHA 1X5EA 4KDXA 5A4UA 1XW9A 4BVXA 1DBYA 1X9WB 2V41A 1TK0B 4EL1A 3KTBA 2H1GA 1O7UA 2QC7A 1NHOA 3UARA 4JEDA 2HSHA 2MYGA 2DJ3A 4NWYA 4YAPA 3DEXA 5ECRB 2IFQA 6GSYA 1VF2A 4IJ3A 2AV4A 3GH6A 1TRWA 4O5RA 2L6DA 2WULA 3SBCA 1AAZA 3PGTA 2RM6A 4MDCA 4KW6A 3GKXA 2CZ2A 3HZ4A 2C0DA 1HD2A 4K5RA 1GSYA 3HJMA 4F2IA 2ES7A 4DSRA 3LFLA 2R5GA 2HI7A 3QD9A 1G7EA 2FNOA 4JE1A 2HRKA 8GSSA 2YWOA 1GNEA 2GZPA 1K3OA 1N2AA 2DLXA 2V6OA 3HJPA 2CX4A 1WMJA 4G0KA 1TW9A 2JZSA 4FIWA 4MZBA 1LJRA 1QQ2A 3M9KA 2VL9A 1JFUA 4F0BA 1AC1A 4HQZA 4IHUA 1IYIA 1V40A 3R2QA 4OCFA 4PX1A 3KM6A 4ZBDA 3EVIA 2YANA 2DMMA 2L4CA 2NPBA 3HJOA 1UVZA 5AISA 1V98A 3D4MA 2JL4A 1XW6A 5EVOA 4EXJA 1M9BA 2DMLA 4N11A 2BMXA 2C1YA 1XPVA 1QXHA 5HR3A 3HKRA 2C3QA 2OE1A 4KNDA 4PUAA 1PKWA 4L8EA 1OC8A 1T4YA 3KCMA 1O8XA 2E2GA 3HY2A 4K2DA 12GSA 2VD1A 3GKKA 4ZXGA 2VAFA 2UZ8A 1XCCA 3BBYA 3HDCA 1Y6EA 3F0IA 3DKSA 1SL0B 2XPEA 5AIVA 3AY8A 3HVVA 1YF0A 1NM3A 2P31A 2G0FA 2YZUA 2B1LA 2XBQA 1SKWB 4XS4B 3FKFA 3GHAA 1KEBA 3VK9A 4LL1B 3MIXA 3VWUA 1XWCA 3UBLA 3BCKA 5ID2B 2OJLA 2B5XA 2VL2C 2FHEA 4MH2A 11GSA 3HXSA 4KSOA 5HR2A 4HS1A 4EUYA 3CYNA 2FWFA 3IHQA 3QOUA 1BJXA 4PGTA 4XS6A 4JBBA 4EE0A 4HQSA 3TJFA 2IMFA 2FLSA 5F8BA 2GT5A 3IRAA 2R0GA 4TOPA 2H0GA 4K5SA 1E6BA 1A2MA 2CA8A 3KXOA 2H6XA 1GLPA 5DJMA 1EOGA 2JZRA 2V6KA 3CRTA 2L5OA 2VCVA 1ZYQB 2C80A 4PQIA 4A5PA 3TGZA 3ZIVA 3GN3A 4TR0A 4MH3A 1B9YC 4CY6A 3UVTA 5ID2A 4E8HA 3F8UA 2OADA 3MDKA 2GQMA 4P3YB 5HQPA 1YZXA 4KCEA 2RUFA 1YKCA 2EIOA 2FWGA 1SYXA 3FYGA 3EU3A 1A23A 4O7HA 2PU9C 4NV5A 5LCZA 4LL4B 3I6AA 1Z9HA 2HRNA 4K7OA 1EV4A 1BQ7A 3US3A 3KH7A 3PINA 2CQ9A 1EWXA 5D9XA 2YJHA 2CAIA 3ME7A 1GP1A 4PQ1A 3Q74A 5H5RA 1OE7A 1ZCPA 5B8BA 2YWIA 1A24A 3QAWA 4XRAA 3QDNA 2B1KA 4AJ8A 4I8BA 1GL8A 2DKIA 4MLYA 2RIIA 5F06A 4TVEA 2MBSA 5IQYA 4GLTA 1SJIA 4WXTA 1PL2A 4FQUA 4F0CA 5DCHA 2HRAA 2QSIA 3WD6A 4IELA 3M0FA 1XW5A 1OKTA 2LEGA 3EMXA 5HFGA 3TJKA 2GZYA 3H93A 4KE3A 1SENA 4ML6A 1VF1A 3GYKA 2IY2A 4GCIA 1HNCA 3LSZA 3IBHA 3KJYA 3IA1A 4POMA 4TR4A 2C0GA 2I1UA 2DJJA 4HEA2 3ERFA 4MPFA 2H01A 2OE0A 2B7JA 2YZHA 4ZIJA 3TKSE 2D2ZA 3F9UA 3ZITA 20GSA 1F3BA 1MDIA 4MCUA 5E4WA 4ECIA 4N30A 3GKMA 1ZYPA 3TOTA 3LYKA 4GSNA 1MD3A 3GA4A 3GL5A 1GTAA 3SWLA 2QGVA 1TOFA 2N5AA 4Z2TA 2C4JA 2VCQA 4QQ7A 4ACSA 1GNWA 1GUHA 5KEJA 1C72A 1AQVA 3F6FA 2YP6A 1N8JA 1ERVA 4MF7A 2K18A 5LD0A 3D0ZA 2R4VA 5ELGA 4YAVA 1SL2B 3NOFA 2CAQA 2AB6A 3QFAC 2YJ7A 4POBA 4EKZA 3C1RA 4ZB9A 3I9V2 4NHWA 2VL2A 1R4WA 2K9FA 3E3EA 4TKYA 4MK3A 5JCWA 4IKHA 2HXKA 4GF0A 1YDKA 4I5QA 4POLA 3HVSA 2GT6A 3QPMA 4KF9A 2XPDA 4NMUA 3TKQA 5E59A 5KN2A 3IPZA 2WRTA 2FWHA 2HT9A 1AQXA 2H71A 2LNSA 4GRFA 3FMWA 3UAPA 3ZREA 5CP1A 2ON5A 2CX3A 1AXDA 4BVYA 1SJZA 1FVKA 1TRSA 1X5DA 1OYJA 3E0UA 2F8FA 1CQHA 2IMIA 3Q6OA 4ULXA 1B4PA 2O89A 3WGDA 3KMNA 4K7IA 1GH2A 4GSTA 2DJ2A 1ST9A 3KP9A 1EV9A 1Z3EA 2LUSA 1QK8A 1UA5A 1EEMA 2YN1A 2LS5A 3J7Yk 1AW9A 3EURA 1MTCA 2JSYA 1EP7A 3P2AA 2FUG2 4L0WA 1VGLA 4PNGA 1X0RA 2EIRA 3P7XA 1ERTA 1PMTA 5B8AA 4OWYA 1BG5A 1A8YA 3P90A 4X0XA 1GSEA 4NXIA 2GTUA 4ECBA 1DE1A 5B6MA 4ZB8A 3TB2A 2XC2A 2CV4A 3CRUA 1X5CA 5A4WA 2VM1A 2RUEA 4CHSA 3LJRA 3ZLPA 2H8LA 2GVPA 3IHGA 4CDOA 3FR6A 3N5OA 4EIQA 5ECQB 3U6VA 3G7JA 4WF5A 1XVWA 2I81A 1TK5B 4BA7A 2N5FA 2JADA 2PVQA 5HFKA 2LQOA 3TKSC 2HZEB 4WR4A 2H1AA 1USBA 4G10A 3VI7A 1ABAA 3TJBA 4JZQA 1PN9A 1RK4A 4BL7A 1PN0A 2PVOC 5G2ZA 4MP4A 3TJGA 4HZ2A 1S3CA 2LQQA 1ZL9A 4EDYA 4PTSA 4WR5A 4ZL9A 4WBRD 3BCIA 4IN0A 4RQXA 2N5BA 1GSSA 5DDLA 4KDYA 7GSSA 2MMAA 4KUNA 4L0UA 2X99A 1TU8A 4YH2A 4Q5QA 2YPMA 2XHFA 2ALBA 5EL8A 2C3NA 1F6MC 4EVMA 3KGKA 3EPTA 2CZ3A 2LJRA 4TXVA 2KUCA 3CXGA 3HA9A 4IP6A 4KB3A 4KGIA 2I9HA 2LJKA 4K6XA 4Q5NA 1J9BA 3LQ7A 1WOUA 3GX8A 5G5FA 5JCGA 10GSA 4IS0A 1ZYNA 4PQHA 3HCZA 1FVJA 1WE0A 4GWRA 5KOXA 2ZUPA 4N10A 2I4AA 2MMNA 4GXZA 5INYA 3KIJA 5DCGA 4PXOA 4DSQA 4POKA 1K0MA 3EC3A 4NPBA 3WGXA 4MJCA 2HNLA 1Z5YE 1TKDB 2H75A 2ZNMA 3MYDA 3L9SA 5G31A 5KN1A 4JR6A 5HR1A 1TDIA 5IMDA 5IPHA 1O6JA 3ZYWA 2WFCA 1G6YA 3PH9A 2FGXA 3L0HA 2GS3A 1ZYEA 2B3SA 4OO4A 3IDVA 1RQMA 1QFNA 2KOKA 1X9SB 1M2AA 1QGVA 2IL3A 3O3TA 2L5LA 1K0OA 6GSSA 3MNGA 4USSA 1XOBA 2FA8A 2GSQA 3KTLA 2GGTA 5ENUA 5GAND 2VD0A 3IAM2 2LNTA 5B7CA 1TI3A 2TRCP 3J7Yb 3CTFA 2H73A 3EWLA 4YQVA 1G6WA 2CVDA 1YY7A 3W8SA 5J9BA 4AJ6A 1FB6A 2EC4A 1JZDA 1K0DA 1TI1A 2H19A 4YKFA 2VCZA 2F51A 3Q18A 1I5GA 4J57E 4HDEA 2OBIA 3A5WA 2LRCA 2A4VA 5F07A 2IJYA 2A2RA 3Q19A 3KP8A 4G0IA 5EY6A 1U3AA 5J41A 2IMDA 2VO4A 4O32A 1OC3A 5CRWA 4IP1A 4GQFA 3VFIA 3ZVJD 1FG4A 4G0LA 3APQA 2YCDA 5HFIA 3LORA 1M2BA 4LMVA 1GTBA 1W89A 3N9JA 3TKRA 2DJ0A 3FW2A 4XS4A 5IM9A 2ON7A 14GSA 1OAZA 2PERA 3TKSA 2DIZA 3ED3A 1PX7A 3M1GA 2DJKA 5J3RA 4WKWA 1HYUA 5H5QA 2M46A 4LA1A 3RBTA 3V1WA 3WYWA 3ME8A 1JZWA 2Z9SA 2BTOT 2A4HA 2H30A 4I6XA 1O81A 2X49A 1M7TA 5BRTA 3MSZA 1XZOA 3QAVA 6GSWA 1HQOA 4D73B 1JHBA 3EMPA 3C7MA 5FWGA 3ZMLA 1XVQA 5H5SA 1O8WA 3FZ4A 4AJ7A 1GULA 1B8XA 4Q5RA 2NTOA 3IAS2 3GSTA 4TR3A 4KH7A 3GIXA 4IBPA 1CQGA 4KCAA 1O85A 4J2FA 1FOHA 1A0RP 4ECCA 2DSAA 3L78A 1V57A 3TRXA 2AHEA 1A2JA 2VCWA 1IYHA 3M8NA 4TXOB 2NBSA 3NIVA 3O76A 1RW1A 2HFDA 1SYRA 1SKSB 1K0BA 2VUPA 3FY7A 4QL9A 1THOA 2VCTA 3LG6A 3HD5A 2GSRA 5D93A 2VLVA 3CSHA 1G7OA 5ECSA 3TJJA 1TU7A 3L9UA 1Z6MA 2WZ9A 3GL3A 4ID0A 4RUVA 4L5OA 1U3IA 4KSMA 1XWGA 5GZZB 2HSYA 2JZTA 4ECJA 1I9DA 1YEPA 5D9VA 4HU9A 1MDKA 1MEKA 1E2YA 5J9CA 2VCXA 2K6VA 3BD2A 4AF2A 2NDOA 5ECOB 1LBKA 3IV4A 5COHA 1TP9A 2K8SA 2F8AA 2OACA 3VURA 4PNFA 4N0ZA 2O7KA 3FRCA 4G2EA 1URMA 3DGQA 4ZILA 5IMAA 1G0TA 1F9MA 1FAAA 2GSTA 5IO2A 2HRFA 4KX4A 5EPFA 4F03A 3DIEA 1J08A 2F3MA 4K9ZA 1BX9A 2B5YA 2GQLA 3ERWA 1Q98A 2GLRA 1EEJA 19GSA 3BOAA 1VRSD 2IN3A 1GTUA 1XFLA 3GMFA 4WETA 3VPQA 4G19A 3FZAA 1ML6A 3KMOA 4KA0A 2H76A 4ZBBA 2M80A 3LW9A 1U87A 1W4VA 4MZCA 3HVXA 3QR6A 4KDUA 1T00A 4N0VA 2OBKA 5CNWA 4Z7XA 2H1DA 5JWRB 3F4RA 3A5IA 2OE3A 4EDZA 1VF3A 2C0FA 3GH9A 5IIZA 3IR4A 5CREA 1QMVA 4ICYA 3O6TA 2V1MA 3LGCA 4E8EA 1K0NA 3RHCA 2E2MA 2RLIA 1Y25A 1T1VA 4ZBAA 1ZOFA 1PKZA 3UL3A 3KD0A 1JLVA 4OFTA 5ECPB 2E0QA 4X1UA 17GSA 3M3MA 3DRNA 3M9JA 5FT3A 3IXRA 1AIUA 2LRTA 1EGRA 3UIWA 4MPGA 4K0NA 2AAWA 5DQSA 5G5EA 2R37A 1LU4A 4MJBA 2HSMA 1ZGNA 5GSSA 3VLNA 2QA2A 1PA3A 2PMTA 1SD8A 2IMEA 3LYPA 22GSA 1BEDA 3G9BA 5A5KA 2G2QA 2H0HA 5IO0A 3TKPA 2P5RA 1DUGA 2KLXA 2AYTA 4X43A 3DVWA 3DMLA 1BAYA 5IMVA 3VWVA 1V2AA 1ZMAA 3APSA 4MJAA 4MMMA 5D9WA 3A3TA 1XXUA 4O5QA 1XOAA 18GSA 4Q5FA 6GSUA 2KP1A 2R6KA 2H66A 5G1LA 1M2DA 1T4ZA 5JWQB 4IW9A 5IMFA 6GSTA 3UOMA 3KEBA 3CTGA 1VF4A 2VM2A 4K2XA 2H1BA 4JR4A 3H79A 1M9AA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2C8U A;  4IGJ A;  5IMC A;  1Z7P A;  1FW1 A;  3ZTL A;  4F9Z A;  3F3Q A;  3EYT A;  1SU9 A;  3WT2 A;  4G9H A;  2MZC A;  3APO A;  2V2G A;  3HHV A;  4I2T A;  1SD9 A;  5C04 A;  4OFN A;  3VWX A;  1PRX A;  2MBT A;  1OVN A;  2HLS A;  13GS A;  2LST A;  3HYP A;  1GSF A;  4AGS A;  4QL7 A;  2YWM A;  1Z6N A;  3UMA A;  5ABR A;  2LTK A;  5D8I A;  2VLT A;  2X8C A;  3RAZ A;  3TOU A;  4ML1 A;  2MMO A;  1R5P A;  3UEM A;  3C1S A;  5ECL B;  2GQK A;  2FWE A;  3DD3 A;  4H86 A;  5F05 A;  4XS1 A;  1U6T A;  5AN1 A;  1S3D A;  2J9H A;  2HZE A;  1ILO A;  2FD3 A;  3GX0 A;  5GAP D;  1YJ6 A;  5DAL B;  3FR9 A;  2YNX A;  4JRR A;  3ZIJ A;  3H1N A;  3CBU A;  4TW5 A;  3GSS A;  2IIY A;  1B9X C;  1K3L A;  3LEF A;  1M99 A;  1TJD A;  4ILF A;  1A0F A;  3I43 A;  1T7P B;  3LWA A;  2YV9 A;  5CRG A;  2TIR A;  4XHM A;  3DXB A;  2DC5 A;  1WIK A;  2LV3 A;  2CVK A;  5DVB A;  3L9V A;  2O85 A;  1QUW A;  4BWQ A;  2MMZ A;  5ECH B;  1WWJ A;  4V2N A;  3A2X A;  4HJ2 A;  4DSS B;  4OFM A;  5DQY A;  2PN8 A;  5CRH A;  1TRU A;  2L4Q A;  4FO5 A;  2GDR A;  2HYX A;  2ZCT A;  4K1F A;  2B6M A;  1ERU A;  5G1K A;  4I97 A;  1OC9 B;  1JZO A;  1NHY A;  5DAL A;  4EF0 A;  4OO5 A;  2WDU A;  2PUK C;  6GSX A;  1GTI A;  1WRY A;  4KAE A;  3MAK A;  4XTS A;  3FR3 A;  1FO5 A;  3DVX A;  4XRD A;  3F4S A;  3FEU A;  2IYJ A;  3LXZ A;  2AUV A;  5IPG A;  1S3A A;  1UN2 A;  3F3R A;  4MF6 A;  3CSI A;  4MAB A;  5IMZ A;  1FB0 A;  2C0E A;  3ZVJ A;  1TTZ A;  1K0A A;  3A2W A;  1ACV A;  5C00 A;  2L59 A;  1R5A A;  5KN0 A;  4TN8 A;  2JU5 A;  4HZ4 A;  3F6D A;  4DSS A;  1XWA A;  4F82 A;  1XWK A;  3ZRD A;  3HZ8 A;  5CAX A;  3S9F A;  1SKR B;  4V1A p;  1OC9 A;  2R3X A;  5ECI B;  5HR0 A;  3EIN A;  1SK0 A;  1PQN A;  4K0G A;  5FHI A;  4HU7 A;  1SL1 B;  2FY6 A;  3C8E A;  1NW2 A;  1WP0 A;  5J4U A;  1GSU A;  4RQR A;  2HE3 A;  5ECM B;  2WB9 A;  2F9S A;  2XBI A;  5JWO B;  1H4O A;  4CW9 A;  2B5E A;  5AGY A;  5A4V A;  1JLW A;  5CO3 A;  1PGT A;  4ISD A;  2C3T A;  2X64 A;  2PGT A;  3IK9 A;  5DBQ A;  1MDJ A;  2P0G A;  3IC4 A;  4IVF A;  4OD7 A;  5D9T A;  1HNB A;  3LXT A;  3VI5 A;  4JU5 A;  3GKN A;  1YEX A;  4GTU A;  1K0C A;  3F4T A;  2NVL A;  2VIM A;  2CT6 A;  5CYY A;  2REM A;  1ON4 A;  3PR8 A;  16GS A;  2TRX A;  4IJI A;  5KN3 A;  1H75 A;  3DYR A;  3CMI A;  3JCM L;  4L5L A;  2B7K A;  2M72 A;  2K8V A;  3FK8 A;  1F37 A;  1SJ6 A;  1HNA A;  1SK1 A;  3DWV A;  4OCE A;  2LRN A;  5F0G A;  1MD4 A;  5B6N A;  4LMW A;  2J23 A;  4LLR A;  3EE2 A;  2VL3 A;  2X8H A;  3RHB A;  5DAK B;  2P5Q A;  1YKA A;  2L57 A;  3C71 A;  4V1A g;  2HZF A;  1GUK A;  3D21 A;  1V58 A;  1R26 A;  1THX A;  3IE3 A;  1WPI A;  3KZQ A;  3L4N A;  3VWW A;  4OMV A;  2DBC A;  3IK7 A;  5DJL A;  3TRP A;  5D73 A;  2LJA A;  1EP8 A;  1OE8 A;  4BPY A;  2PPT A;  2RM5 A;  3D5J A;  3GTU B;  2JSZ A;  1B48 A;  1TRV A;  4MF5 A;  2KHP A;  4D73 A;  2VOC A;  2FA4 A;  2H6Z A;  3ZL5 A;  2BJX A;  3E9J B;  3QAG A;  2H74 A;  1XBS A;  3K8N A;  4FYC A;  5IOW A;  3CSJ A;  5IOX A;  1DE2 A;  2YOI A;  5DAK A;  3RPP A;  3FZ5 A;  1NSW A;  2WJU A;  2EIQ A;  1PD2 1;  4NV2 A;  1GSQ A;  1TK8 B;  2X8G A;  3UVH A;  3C73 A;  3NZN A;  2IWT A;  4MZW A;  2WGR A;  4NAX A;  3KH9 A;  5ECK B;  3WGE A;  1A8L A;  4IQA A;  1Q4J A;  5AIX A;  5ELA A;  4J56 E;  1M0U A;  1U88 A;  2JAC A;  2GSS A;  4TXO A;  1EGO A;  4V2M A;  1PL1 A;  3W6G A;  3TRQ A;  3GTU A;  5GST A;  5D96 A;  1UC7 A;  4PUR A;  6GSV A;  4TRX A;  2PBJ A;  4GQC A;  4K8M A;  2CVB A;  1FOV A;  1JZR A;  4HI7 A;  4I2U A;  3WT1 A;  1EOH A;  3W8J A;  1F3A A;  1Z7R A;  3ERG A;  2FCH A;  1XIY A;  3GUS A;  4HUA A;  1GUM A;  1AUC A;  4XCS A;  1GWC A;  1ERW A;  1GSD A;  4RI7 A;  2GZZ A;  3VPT A;  3MWH A;  3QMX A;  2E7P A;  2H0I A;  3UJ1 A;  3TCO A;  3GV1 A;  1PSQ A;  3QFB C;  1PX6 A;  5JCU A;  3GRX A;  2IPA A;  1GLQ A;  4YQM A;  3D4T A;  4BWS A;  3GUR A;  3ZMK A;  4WF4 A;  1KBN A;  3OR5 A;  1TXX A;  5LNK e;  2LKU A;  4MJE A;  4XIH A;  3QCP A;  4V2L A;  5L71 A;  2DJ1 A;  1EZK A;  4DVC A;  5ECN B;  4MA9 A;  2AJQ B;  5G30 A;  3RPN A;  4ZL7 A;  2KP2 A;  4TR1 B;  1SK2 A;  2H72 A;  2YWN A;  1KNG A;  4ZL8 A;  2V32 A;  2A2S A;  1B4Q A;  3UBK A;  1O73 A;  3EU4 A;  2PWJ A;  4WEY A;  3GFK A;  3ZFL A;  3IOS A;  3G7I A;  4FYU A;  4PUF C;  1V9W A;  3H4K A;  5CRD A;  1J0F A;  1F2E A;  3GNJ A;  1GRX A;  4IQ1 A;  3H8Q A;  4K7N A;  9GSS A;  3I69 A;  3RDW A;  2VLU A;  3D22 A;  4FH8 A;  2QKE A;  3D6I A;  2OA7 A;  4GSS A;  1YF1 A;  4RI6 A;  3F63 A;  1A2L A;  3P8W A;  4HOJ A;  4HJM A;  1OKD A;  1T3B A;  3ZZX A;  1BYE A;  1K3Y A;  3ISO A;  4EO3 A;  4DEJ A;  1AQW A;  4NHZ A;  4TR1 A;  3FZ9 A;  1ZZY A;  2IMK A;  1R7H A;  4ZB6 A;  4YQU A;  3TDG A;  3BJ5 A;  1WJK A;  1FHE A;  3FHK A;  3G7Y A;  2IFQ B;  1DSB A;  3A2V A;  1KTE A;  2WS2 A;  1XWB A;  2H6Y A;  2R2J A;  2WCI A;  2DIY A;  2I3Y A;  2OKA A;  1YQ1 A;  4O92 A;  2YV7 A;  2H70 A;  3U5R E;  3ZFB A;  2O87 A;  1X9M B;  2L6C A;  4FYB A;  1T8E B;  2O8V B;  4EC0 A;  3TUE A;  5J5N A;  4WBJ A;  4KDX A;  1X5E A;  5A4U A;  1XW9 A;  4BVX A;  1DBY A;  1X9W B;  2V41 A;  1TK0 B;  4EL1 A;  3KTB A;  2H1G A;  1O7U A;  2QC7 A;  1NHO A;  3UAR A;  4JED A;  2HSH A;  2MYG A;  2DJ3 A;  4NWY A;  4YAP A;  3DEX A;  5ECR B;  2IFQ A;  6GSY A;  1VF2 A;  4IJ3 A;  2AV4 A;  3GH6 A;  1TRW A;  4O5R A;  2L6D A;  2WUL A;  3SBC A;  1AAZ A;  3PGT A;  2RM6 A;  4MDC A;  4KW6 A;  3GKX A;  2CZ2 A;  3HZ4 A;  2C0D A;  1HD2 A;  1GSY A;  3HJM A;  4F2I A;  2ES7 A;  4DSR A;  3LFL A;  2R5G A;  2HI7 A;  3QD9 A;  1G7E A;  2FNO A;  4JE1 A;  8GSS A;  2YWO A;  1GNE A;  2GZP A;  1K3O A;  1N2A A;  2DLX A;  2V6O A;  3HJP A;  2CX4 A;  1WMJ A;  1TW9 A;  2JZS A;  4FIW A;  4MZB A;  1LJR A;  1QQ2 A;  3M9K A;  2VL9 A;  1JFU A;  4F0B A;  1AC1 A;  4HQZ A;  4IHU A;  1IYI A;  1V40 A;  3R2Q A;  4OCF A;  4PX1 A;  3KM6 A;  4ZBD A;  3EVI A;  2YAN A;  2DMM A;  2L4C A;  2NPB A;  3HJO A;  1UVZ A;  5AIS A;  1V98 A;  3D4M A;  2JL4 A;  1XW6 A;  5EVO A;  4EXJ A;  1M9B A;  2DML A;  4N11 A;  2BMX A;  2C1Y A;  1XPV A;  1QXH A;  5HR3 A;  3HKR A;  2C3Q A;  2OE1 A;  4KND A;  4PUA A;  1PKW A;  4L8E A;  1OC8 A;  1T4Y A;  3KCM A;  1O8X A;  2E2G A;  3HY2 A;  4K2D A;  12GS A;  2VD1 A;  3GKK A;  4ZXG A;  2VAF A;  1XCC A;  3BBY A;  3HDC A;  1Y6E A;  3F0I A;  3DKS A;  1SL0 B;  2XPE A;  5AIV A;  3AY8 A;  3HVV A;  1YF0 A;  1NM3 A;  2P31 A;  2G0F A;  2YZU A;  2B1L A;  2XBQ A;  1SKW B;  4XS4 B;  3FKF A;  3GHA A;  1KEB A;  3VK9 A;  4LL1 B;  3VWU A;  1XWC A;  3UBL A;  3BCK A;  5ID2 B;  2OJL A;  2B5X A;  2VL2 C;  2FHE A;  4MH2 A;  11GS A;  3HXS A;  4KSO A;  5HR2 A;  4HS1 A;  4EUY A;  3CYN A;  2FWF A;  3IHQ A;  3QOU A;  1BJX A;  4PGT A;  4XS6 A;  4JBB A;  4EE0 A;  4HQS A;  3TJF A;  2IMF A;  2FLS A;  5F8B A;  2GT5 A;  3IRA A;  4TOP A;  2H0G A;  1E6B A;  1A2M A;  2CA8 A;  3KXO A;  2H6X A;  1GLP A;  5DJM A;  1EOG A;  2JZR A;  2V6K A;  3CRT A;  2L5O A;  2VCV A;  1ZYQ B;  2C80 A;  4PQI A;  3TGZ A;  3ZIV A;  3GN3 A;  4TR0 A;  4MH3 A;  1B9Y C;  3UVT A;  5ID2 A;  4E8H A;  3F8U A;  2OAD A;  3MDK A;  2GQM A;  4P3Y B;  5HQP A;  1YZX A;  4KCE A;  2RUF A;  1YKC A;  2EIO A;  2FWG A;  1SYX A;  3FYG A;  3EU3 A;  1A23 A;  4O7H A;  2PU9 C;  4NV5 A;  5LCZ A;  4LL4 B;  3I6A A;  1Z9H A;  2HRN A;  4K7O A;  1EV4 A;  1BQ7 A;  3US3 A;  3KH7 A;  3PIN A;  2CQ9 A;  1EWX A;  5D9X A;  2YJH A;  2CAI A;  3ME7 A;  1GP1 A;  4PQ1 A;  3Q74 A;  5H5R A;  1OE7 A;  1ZCP A;  5B8B A;  2YWI A;  1A24 A;  3QAW A;  4XRA A;  3QDN A;  2B1K A;  4AJ8 A;  4I8B A;  1GL8 A;  4MLY A;  2RII A;  5F06 A;  4TVE A;  2MBS A;  5IQY A;  4GLT A;  1SJI A;  4WXT A;  1PL2 A;  4F0C A;  5DCH A;  2QSI A;  3WD6 A;  4IEL A;  3M0F A;  1XW5 A;  1OKT A;  2LEG A;  3EMX A;  5HFG A;  3TJK A;  2GZY A;  3H93 A;  4KE3 A;  1SEN A;  4ML6 A;  1VF1 A;  3GYK A;  2IY2 A;  4GCI A;  1HNC A;  3LSZ A;  3IBH A;  3KJY A;  3IA1 A;  4POM A;  4TR4 A;  2C0G A;  2I1U A;  2DJJ A;  4HEA 2;  3ERF A;  4MPF A;  2H01 A;  2OE0 A;  2B7J A;  2YZH A;  4ZIJ A;  3TKS E;  2D2Z A;  3F9U A;  3ZIT A;  20GS A;  1F3B A;  1MDI A;  4MCU A;  5E4W A;  4ECI A;  4N30 A;  3GKM A;  3TOT A;  3LYK A;  4GSN A;  1MD3 A;  3GA4 A;  3GL5 A;  1GTA A;  3SWL A;  2QGV A;  1TOF A;  2N5A A;  2C4J A;  2VCQ A;  4QQ7 A;  4ACS A;  1GNW A;  1GUH A;  5KEJ A;  1C72 A;  1AQV A;  3F6F A;  2YP6 A;  1N8J A;  1ERV A;  4MF7 A;  2K18 A;  5LD0 A;  3D0Z A;  2R4V A;  5ELG A;  4YAV A;  1SL2 B;  3NOF A;  2CAQ A;  2AB6 A;  3QFA C;  2YJ7 A;  4POB A;  4EKZ A;  3C1R A;  4ZB9 A;  3I9V 2;  4NHW A;  2VL2 A;  1R4W A;  2K9F A;  3E3E A;  4TKY A;  4MK3 A;  5JCW A;  4IKH A;  2HXK A;  4GF0 A;  1YDK A;  4I5Q A;  4POL A;  3HVS A;  2GT6 A;  3QPM A;  2XPD A;  4NMU A;  3TKQ A;  5E59 A;  5KN2 A;  3IPZ A;  2WRT A;  2FWH A;  2HT9 A;  1AQX A;  2H71 A;  2LNS A;  4GRF A;  3UAP A;  3ZRE A;  5CP1 A;  2ON5 A;  2CX3 A;  1AXD A;  4BVY A;  1SJZ A;  1FVK A;  1TRS A;  1X5D A;  1OYJ A;  3E0U A;  2F8F A;  1CQH A;  2IMI A;  3Q6O A;  4ULX A;  1B4P A;  2O89 A;  3WGD A;  3KMN A;  4K7I A;  1GH2 A;  4GST A;  2DJ2 A;  1ST9 A;  3KP9 A;  1EV9 A;  1Z3E A;  2LUS A;  1QK8 A;  1UA5 A;  1EEM A;  2YN1 A;  2LS5 A;  3J7Y k;  1AW9 A;  3EUR A;  1MTC A;  2JSY A;  1EP7 A;  3P2A A;  2FUG 2;  4L0W A;  1VGL A;  4PNG A;  1X0R A;  2EIR A;  3P7X A;  1ERT A;  1PMT A;  5B8A A;  4OWY A;  1BG5 A;  1A8Y A;  3P90 A;  4X0X A;  1GSE A;  4NXI A;  2GTU A;  4ECB A;  1DE1 A;  5B6M A;  4ZB8 A;  3TB2 A;  2XC2 A;  2CV4 A;  3CRU A;  1X5C A;  5A4W A;  2VM1 A;  2RUE A;  4CHS A;  3LJR A;  3ZLP A;  2H8L A;  2GVP A;  4CDO A;  3FR6 A;  3N5O A;  5ECQ B;  3U6V A;  3G7J A;  4WF5 A;  1XVW A;  2I81 A;  1TK5 B;  4BA7 A;  2N5F A;  2JAD A;  2PVQ A;  5HFK A;  2LQO A;  3TKS C;  2HZE B;  4WR4 A;  2H1A A;  1USB A;  4G10 A;  3VI7 A;  1ABA A;  3TJB A;  1PN9 A;  1RK4 A;  4JZQ A;  4BL7 A;  2PVO C;  5G2Z A;  4MP4 A;  3TJG A;  4HZ2 A;  1S3C A;  2LQQ A;  1ZL9 A;  4EDY A;  4WR5 A;  4ZL9 A;  4WBR D;  3BCI A;  4IN0 A;  4RQX A;  2N5B A;  1GSS A;  5DDL A;  4KDY A;  7GSS A;  2MMA A;  4KUN A;  4L0U A;  2X99 A;  1TU8 A;  4YH2 A;  4Q5Q A;  2YPM A;  2XHF A;  2ALB A;  5EL8 A;  2C3N A;  1F6M C;  4EVM A;  3KGK A;  2CZ3 A;  2LJR A;  4TXV A;  2KUC A;  3CXG A;  3HA9 A;  4IP6 A;  4KB3 A;  4KGI A;  2I9H A;  2LJK A;  4K6X A;  4Q5N A;  1J9B A;  3LQ7 A;  1WOU A;  3GX8 A;  5G5F A;  5JCG A;  10GS A;  4IS0 A;  4PQH A;  3HCZ A;  1FVJ A;  1WE0 A;  4GWR A;  2ZUP A;  4N10 A;  2I4A A;  2MMN A;  4GXZ A;  5INY A;  3KIJ A;  5DCG A;  4PXO A;  4DSQ A;  4POK A;  1K0M A;  3EC3 A;  4NPB A;  3WGX A;  4MJC A;  2HNL A;  1Z5Y E;  1TKD B;  2H75 A;  2ZNM A;  3L9S A;  5G31 A;  5KN1 A;  4JR6 A;  5HR1 A;  1TDI A;  5IMD A;  5IPH A;  1O6J A;  3ZYW A;  2WFC A;  1G6Y A;  3PH9 A;  2FGX A;  3L0H A;  2GS3 A;  1ZYE A;  2B3S A;  4OO4 A;  3IDV A;  1RQM A;  1QFN A;  2KOK A;  1X9S B;  1M2A A;  1QGV A;  2IL3 A;  3O3T A;  2L5L A;  1K0O A;  6GSS A;  3MNG A;  1XOB A;  2FA8 A;  2GSQ A;  3KTL A;  2GGT A;  5ENU A;  5GAN D;  2VD0 A;  3IAM 2;  2LNT A;  5B7C A;  1TI3 A;  2TRC P;  3J7Y b;  3CTF A;  2H73 A;  3EWL A;  4YQV A;  1G6W A;  2CVD A;  1YY7 A;  3W8S A;  5J9B A;  4AJ6 A;  1FB6 A;  2EC4 A;  1JZD A;  1K0D A;  1TI1 A;  2H19 A;  2VCZ A;  2F51 A;  3Q18 A;  1I5G A;  4J57 E;  4HDE A;  2OBI A;  3A5W A;  2LRC A;  2A4V A;  5F07 A;  2IJY A;  2A2R A;  3Q19 A;  3KP8 A;  5EY6 A;  1U3A A;  5J41 A;  2IMD A;  2VO4 A;  4O32 A;  1OC3 A;  5CRW A;  4IP1 A;  4GQF A;  3VFI A;  3ZVJ D;  1FG4 A;  3APQ A;  2YCD A;  5HFI A;  3LOR A;  1M2B A;  4LMV A;  1GTB A;  1W89 A;  3N9J A;  3TKR A;  2DJ0 A;  3FW2 A;  4XS4 A;  5IM9 A;  2ON7 A;  14GS A;  1OAZ A;  2PER A;  3TKS A;  2DIZ A;  3ED3 A;  1PX7 A;  3M1G A;  2DJK A;  5J3R A;  4WKW A;  1HYU A;  5H5Q A;  2M46 A;  4LA1 A;  3RBT A;  3V1W A;  3WYW A;  3ME8 A;  1JZW A;  2Z9S A;  2BTO T;  2H30 A;  4I6X A;  1O81 A;  1M7T A;  3MSZ A;  1XZO A;  3QAV A;  6GSW A;  1HQO A;  4D73 B;  1JHB A;  3EMP A;  3C7M A;  5FWG A;  3ZML A;  1XVQ A;  5H5S A;  1O8W A;  3FZ4 A;  4AJ7 A;  1GUL A;  1B8X A;  4Q5R A;  2NTO A;  3IAS 2;  3GST A;  4TR3 A;  4KH7 A;  3GIX A;  4IBP A;  1CQG A;  4KCA A;  1O85 A;  4J2F A;  1A0R P;  4ECC A;  2DSA A;  3L78 A;  1V57 A;  3TRX A;  2AHE A;  1A2J A;  2VCW A;  1IYH A;  3M8N A;  4TXO B;  2NBS A;  3NIV A;  3O76 A;  1RW1 A;  2HFD A;  1SYR A;  1SKS B;  1K0B A;  2VUP A;  3FY7 A;  4QL9 A;  1THO A;  2VCT A;  3LG6 A;  3HD5 A;  2GSR A;  5D93 A;  2VLV A;  3CSH A;  1G7O A;  5ECS A;  3TJJ A;  1TU7 A;  3L9U A;  1Z6M A;  2WZ9 A;  3GL3 A;  4ID0 A;  4RUV A;  4L5O A;  1U3I A;  4KSM A;  1XWG A;  5GZZ B;  2HSY A;  2JZT A;  4ECJ A;  1I9D A;  1YEP A;  5D9V A;  4HU9 A;  1MDK A;  1MEK A;  1E2Y A;  5J9C A;  2VCX A;  2K6V A;  3BD2 A;  4AF2 A;  2NDO A;  5ECO B;  1LBK A;  3IV4 A;  5COH A;  1TP9 A;  2K8S A;  2F8A A;  2OAC A;  3VUR A;  4PNF A;  4N0Z A;  2O7K A;  3FRC A;  4G2E A;  1URM A;  3DGQ A;  4ZIL A;  5IMA A;  1G0T A;  1F9M A;  1FAA A;  2GST A;  5IO2 A;  2HRF A;  4KX4 A;  5EPF A;  4F03 A;  3DIE A;  1J08 A;  2F3M A;  4K9Z A;  1BX9 A;  2B5Y A;  2GQL A;  3ERW A;  1Q98 A;  2GLR A;  1EEJ A;  19GS A;  3BOA A;  1VRS D;  2IN3 A;  1GTU A;  1XFL A;  3GMF A;  4WET A;  3VPQ A;  4G19 A;  3FZA A;  1ML6 A;  3KMO A;  4KA0 A;  2H76 A;  4ZBB A;  2M80 A;  1U87 A;  1W4V A;  4MZC A;  3HVX A;  3QR6 A;  4KDU A;  1T00 A;  4N0V A;  2OBK A;  5CNW A;  4Z7X A;  2H1D A;  5JWR B;  3F4R A;  2OE3 A;  4EDZ A;  1VF3 A;  2C0F A;  3GH9 A;  5IIZ A;  3IR4 A;  5CRE A;  1QMV A;  3O6T A;  2V1M A;  3LGC A;  4E8E A;  1K0N A;  3RHC A;  2E2M A;  2RLI A;  1Y25 A;  1T1V A;  4ZBA A;  1ZOF A;  1PKZ A;  3UL3 A;  3KD0 A;  1JLV A;  4OFT A;  5ECP B;  2E0Q A;  4X1U A;  17GS A;  3M3M A;  3DRN A;  3M9J A;  5FT3 A;  3IXR A;  1AIU A;  2LRT A;  1EGR A;  3UIW A;  4MPG A;  4K0N A;  2AAW A;  5DQS A;  5G5E A;  2R37 A;  1LU4 A;  4MJB A;  1ZGN A;  5GSS A;  3VLN A;  1PA3 A;  2PMT A;  1SD8 A;  2IME A;  3LYP A;  22GS A;  1BED A;  3G9B A;  5A5K A;  2G2Q A;  2H0H A;  5IO0 A;  3TKP A;  2P5R A;  1DUG A;  2KLX A;  2AYT A;  4X43 A;  3DVW A;  3DML A;  1BAY A;  5IMV A;  3VWV A;  1V2A A;  1ZMA A;  3APS A;  4MJA A;  4MMM A;  5D9W A;  3A3T A;  1XXU A;  1XOA A;  18GS A;  4Q5F A;  6GSU A;  2KP1 A;  2R6K A;  2H66 A;  5G1L A;  1M2D A;  1T4Z A;  5JWQ B;  4IW9 A;  5IMF A;  6GST A;  3UOM A;  3KEB A;  3CTG A;  1VF4 A;  2VM2 A;  2H1B A;  4JR4 A;  3H79 A;  1M9A A; 
#chains in the Genus database with same CATH topology
 2C8U A;  1RCL A;  3FG4 A;  4IGJ A;  5IMC A;  1Z7P A;  1FW1 A;  3ZTL A;  4F9Z A;  3ROB A;  4MNN A;  1TTO A;  3F3Q A;  3CCS 3;  4XM4 A;  3EYT A;  1IVU A;  2CFL A;  3I0Y A;  5BXQ A;  1SU9 A;  3K5T A;  4XDW A;  1AR0 A;  3WT2 A;  4G9H A;  2MZC A;  3APO A;  5KOW A;  4LYL B;  2V2G A;  3HHV A;  4I2T A;  1SD9 A;  4WYK A;  5C04 A;  2AAD A;  4OFN A;  3VWX A;  1PRX A;  2SBL A;  2MBT A;  1OVN A;  2BMQ B;  2HLS A;  1NDO B;  1DMM A;  13GS A;  1B2M A;  2LST A;  3HYP A;  5KP4 A;  1GSF A;  4AGS A;  1W4N A;  1YJ9 3;  4QL7 A;  2YWM A;  1Z6N A;  3UMA A;  5ABR A;  2LTK A;  1VQQ A;  5D8I A;  1TUH A;  2CFW A;  2VLT A;  2X8C A;  3RAZ A;  3GZB A;  3TOU A;  3B8L A;  4ML1 A;  2MMO A;  2R0P A;  1R5P A;  3BND A;  1U8C B;  1BVI A;  3UEM A;  3C1S A;  5ECL B;  2GQK A;  5M18 A;  1QMA A;  1OHO A;  2FWE A;  3DD3 A;  4H86 A;  5F05 A;  4OUQ A;  4XS1 A;  4Z2R A;  3G16 A;  1U6T A;  1S3D A;  2J9H A;  5AN1 A;  4ORL A;  4XBT A;  2HZE A;  1ILO A;  2FD3 A;  3GX0 A;  5GAP D;  1YJ6 A;  5DAL B;  3FR9 A;  1OUN A;  3CPW 2;  1IT7 A;  2YNX A;  4JRR A;  5DRV A;  3ZIJ A;  3BU4 A;  3H1N A;  2F5W A;  3N54 B;  3CBU A;  1N9J A;  4TW5 A;  3GSS A;  3FG3 A;  1B9X C;  1K3L A;  2IIY A;  3LEF A;  3CCV 3;  1M99 A;  1VQ6 3;  1TJD A;  2R0C A;  4ILF A;  1A0F A;  3I43 A;  3CC7 3;  1T7P B;  3LWA A;  3UB1 A;  2YV9 A;  5CRG A;  2TIR A;  4XHM A;  3DXB A;  2DC5 A;  1WIK A;  2LV3 A;  2CVK A;  5DVB A;  1YIJ 3;  3L9V A;  2IA7 A;  2O85 A;  1QUW A;  4BWQ A;  3NBR A;  2GEY A;  4MMX B;  2MMZ A;  3BNB A;  1PFP A;  5ECH B;  1E97 A;  4XBY A;  4YKG A;  4WP5 A;  1WWJ A;  2FXT A;  2XGL A;  3A2X A;  4V2N A;  4HJ2 A;  4RNT A;  4DSS B;  4OFM A;  5DQY A;  2PN8 A;  1TRU A;  5CRH A;  4KVH A;  2L4Q A;  4FO5 A;  2GDR A;  2HYX A;  2ZCT A;  4K1F A;  3R3E A;  2B6M A;  1ERU A;  5G1K A;  4I97 A;  1OC9 B;  1CH0 A;  2YFL B;  1JZO A;  1NHY A;  5DAL A;  4EF0 A;  5CXO A;  4OO5 A;  1V74 A;  2WDU A;  2PUK C;  1ZS7 A;  6GSX A;  4X2H A;  1UUG B;  1GTI A;  1WRY A;  2UGI A;  3MAK A;  4KAE A;  4XTS A;  3FR3 A;  3MG3 A;  3VSY A;  1K73 4;  1FO5 A;  1GYB A;  3DVX A;  4XRD A;  3FSD A;  3N8B A;  3F4S A;  2IYJ A;  3FEU A;  3LXZ A;  2AUV A;  5IPG A;  1S3A A;  1UN2 A;  3F3R A;  4MF6 A;  3CSI A;  3SOA A;  4MAB A;  2O3O A;  2HOH A;  2A2P A;  1FB0 A;  5IMZ A;  2C0E A;  3CU3 A;  1TTZ A;  3ZVJ A;  1K0A A;  1GY7 A;  1I3F A;  3U97 A;  2KF6 A;  4GL6 A;  3A2W A;  1OHP A;  2OQE A;  1ACV A;  5C00 A;  1BSB A;  3JVC A;  3WDG B;  2L59 A;  1R5A A;  5KN0 A;  4TN8 A;  1JJ2 2;  1K41 A;  1Q7Y 4;  2ZDJ A;  2JU5 A;  4HZ4 A;  3F6D A;  1JN5 A;  1WQL B;  4DSS A;  3NM7 A;  1XWA A;  3RGA A;  4F82 A;  1XWK A;  3ZRD A;  3LTC A;  3HZ8 A;  5CAX A;  3S9F A;  3ZG0 A;  1SKR B;  3HX8 A;  4V1A p;  1OC9 A;  2KXG A;  2ZHX B;  2R3X A;  5ECI B;  1BNJ A;  5HR0 A;  2BU4 A;  3EIN A;  3SXX A;  3MHE A;  3S5C A;  1SK0 A;  1FGQ A;  3D4A A;  5D81 A;  1PQN A;  4K0G A;  5FHI A;  4HU7 A;  1SL1 B;  1UW1 A;  2STD A;  3FG1 A;  4KFD A;  3IC8 A;  2FY6 A;  2OTL 3;  3C8E A;  1RMS A;  1NW2 A;  1WP0 A;  5J4U A;  1GSU A;  4RQR A;  2HE3 A;  2W2C A;  5ECM B;  2WB9 A;  2F9S A;  5FGO A;  2XBI A;  4HAA A;  3CCQ 3;  4CJN A;  5JWO B;  1YJW 3;  1H4O A;  4CW9 A;  2B5E A;  5AGY A;  5A4V A;  1JLW A;  5CO3 A;  1PGT A;  2SAR A;  4ISD A;  1I0V A;  1FUW A;  2C3T A;  2X64 A;  1Q40 A;  2PGT A;  3M8C A;  3LZA A;  3EJV A;  5BMU A;  3MSO A;  3IK9 A;  5DBQ A;  1MDJ A;  2P0G A;  3IC4 A;  4IVF A;  4OD7 A;  5D9T A;  1HNB A;  3LXT A;  4OVM A;  3VI5 A;  3AHW A;  4JU5 A;  1MWT A;  2IUJ A;  2L1S A;  3GKN A;  3SOY A;  1YEX A;  4GTU A;  1K0C A;  3G71 3;  3F4T A;  2NVL A;  3PPU A;  2VIM A;  2CT6 A;  5CYY A;  2REM A;  3F8X A;  3WMD A;  1ON4 A;  3PR8 A;  16GS A;  2TRX A;  4IJI A;  5KN3 A;  3UL5 A;  1NB5 I;  3HK4 A;  1H75 A;  3DYR A;  3CMI A;  3UL6 A;  2ZL8 A;  3JCM L;  4L5L A;  3WOF B;  1AY7 A;  2B7K A;  2M72 A;  2K8V A;  3FK8 A;  1F37 A;  2WGQ A;  2KF4 A;  1GOY A;  1VQ8 3;  1SJ6 A;  1HNA A;  1SK1 A;  3DWV A;  4OCE A;  3OXA A;  1ULI B;  2LRN A;  5F0G A;  1MD4 A;  5B6N A;  4LMW A;  2J23 A;  4LLR A;  1RRH A;  1B2X A;  3EE2 A;  4L8O A;  2VL3 A;  2X8H A;  2LYX A;  3RHB A;  5DAK B;  3X42 A;  2P5Q A;  1YKA A;  2L57 A;  3C71 A;  4V1A g;  2HZF A;  1GUK A;  3D21 A;  3CCU 3;  1MWS A;  1V58 A;  1R26 A;  1THX A;  1UDI I;  1JB5 A;  3IE3 A;  1WPI A;  3KZQ A;  3L4N A;  2CW9 A;  3OWS A;  4K61 A;  3VWW A;  4OMV A;  2DBC A;  1IDP A;  4X2O A;  1A2K A;  4R4K A;  3IK7 A;  5DJL A;  3TRP A;  4FCZ A;  3NM2 A;  4EBG A;  5D73 A;  2LJA A;  1EP8 A;  4G1M B;  1OE8 A;  4BPY A;  2QGU A;  3EC9 A;  2PPT A;  3SX1 A;  1OH0 A;  3UJM A;  2RM5 A;  3D5J A;  3GTU B;  2JSZ A;  1B48 A;  3GWR A;  1TRV A;  2R4I A;  4KFF A;  2HMM B;  4MF5 A;  1BNG A;  1T2H A;  2KHP A;  2X4A A;  2RSX A;  3A5E A;  3DZL A;  4KT3 B;  3ER7 A;  5AEU B;  3CXC 2;  4D73 A;  2CWU A;  2VOC A;  2FA4 A;  2H6Z A;  3ZL5 A;  3D3L A;  1JBT A;  2BJX A;  3E9J B;  3QAG A;  2H74 A;  1YVB I;  1LRA A;  1XBS A;  3K8N A;  4FYC A;  5IOW A;  3CSJ A;  5IOX A;  1DE2 A;  1BRI A;  2YOI A;  5DAK A;  3RPP A;  3FZ5 A;  4FCJ A;  1NSW A;  2WJU A;  2EIQ A;  1PD2 1;  4NV2 A;  5AIG A;  1GSQ A;  1TK8 B;  2ZA4 A;  2X8G A;  3UVH A;  4CY8 A;  3C73 A;  1STF I;  3NZN A;  1B2S A;  2IWT A;  2CH9 A;  4MZW A;  2WGR A;  4NAX A;  3KH9 A;  5ECK B;  3WGE A;  1N5H A;  1A8L A;  4IQA A;  2P0M A;  1YJN 3;  1Q4J A;  5AIX A;  2MF7 A;  4J56 E;  1M0U A;  5ELA A;  1U88 A;  2Q07 A;  1YI2 3;  2JAC A;  2GSS A;  4TXO A;  1CQS A;  1EGO A;  4FMC A;  4V2M A;  1PL1 A;  3W6G A;  4IIA A;  5D82 A;  4HZ9 B;  3TRQ A;  3GTU A;  4EYC A;  3MG2 A;  5GST A;  5D96 A;  1UC7 A;  1J2B A;  4PUR A;  6GSV A;  2CK3 H;  4TRX A;  4XDV A;  2PBJ A;  4GQC A;  5D83 A;  4K8M A;  2CVB A;  1FOV A;  1JZR A;  2Z7A A;  4HI7 A;  3DXO A;  3DMC A;  1VQN 3;  4I2U A;  3WT1 A;  1EOH A;  1WMN A;  2HMJ B;  3W8J A;  1F3A A;  3E99 A;  4MEI A;  7STD A;  1Z7R A;  5HOH A;  3ERG A;  1IQX A;  1I2G A;  2FCH A;  1XIY A;  4N6U A;  1FW7 A;  3GUS A;  4HUA A;  1GUM A;  1AUC A;  3URP A;  4XCS A;  1GWC A;  4Z2U A;  1ERW A;  1KWI A;  1SPU A;  1QAK A;  4BVY B;  1GSD A;  4RI7 A;  3S67 A;  8CHO A;  2GZZ A;  3VPT A;  3MWH A;  1RJO A;  3QMX A;  1RN1 A;  2E7P A;  2H0I A;  1US1 A;  3GZY B;  3UJ1 A;  3TCO A;  5JPU A;  3GV1 A;  3WR2 A;  1OGZ A;  1S5A A;  1PSQ A;  3QFB C;  2BHM A;  2Z77 A;  1PX6 A;  5JCU A;  1DVD A;  3GRX A;  2IPA A;  3Q3F A;  1HYF A;  3CD6 3;  1GLQ A;  4YQM A;  1UUW B;  3D4T A;  4BWS A;  3N9H A;  1GMR A;  4J8T A;  3CPO A;  3GUR A;  3ZMK A;  4WF4 A;  1KBN A;  3OR5 A;  3AGN A;  1W2B 2;  2FGT A;  1TXX A;  5LNK e;  2LKU A;  4EIP A;  4MJE A;  3B7C A;  4XIH A;  4O5U A;  3QCP A;  4V2L A;  1O7N B;  4K90 B;  5L71 A;  2DJ1 A;  1EZK A;  4DVC A;  4L7K A;  5ECN B;  4MA9 A;  2AJQ B;  5G30 A;  1UI7 A;  1K28 A;  3RPN A;  3SED A;  6GSP A;  4ZL7 A;  3CCM 3;  2KP2 A;  4TR1 B;  1SK2 A;  3K63 A;  2H72 A;  2YWN A;  1NB3 I;  5CF2 A;  1KNG A;  2V32 A;  4ZL8 A;  2A2S A;  1B4Q A;  3UBK A;  1DMN A;  3MG1 A;  1E3R A;  5IG3 A;  1O73 A;  4O02 B;  3EU4 A;  2PWJ A;  4WEY A;  3GFK A;  3ZFL A;  3IOS A;  3G7I A;  2J8X B;  4FYU A;  4PUF C;  5TGN A;  4GHO A;  7GSP A;  1V9W A;  3H4K A;  5CRD A;  1J0F A;  1F2E A;  2CC3 A;  1NO3 A;  3GNJ A;  1GRX A;  4NHF A;  4IQ1 A;  3DH2 A;  3H8Q A;  4K7N A;  4GSP A;  9GSS A;  3H3H A;  1MGR A;  4J9A A;  3I69 A;  4DKI A;  3RDW A;  1PYL A;  4JF8 A;  4L8P A;  5AI1 A;  4EW5 A;  2VLU A;  1YIT 3;  3D22 A;  1WNH A;  2WGO A;  4CDL A;  1UUV B;  2QKE A;  3D6I A;  3D9R A;  4FH8 A;  1STD A;  2OA7 A;  4GSS A;  1FYS A;  1YF1 A;  4RI6 A;  3F63 A;  4X4J A;  1A2L A;  3P8W A;  4HOJ A;  4HJM A;  1OKD A;  1T3B A;  3ZZX A;  1BYE A;  3KFQ C;  1K3Y A;  3ISO A;  4EO3 A;  4DEJ A;  4BL7 B;  1AQW A;  2W03 A;  4BVX B;  4R9L A;  4NHZ A;  4TR1 A;  3FZ9 A;  3J7Y d;  1ZZY A;  1WMP A;  2IMK A;  1R7H A;  4ZB6 A;  4YQU A;  3TDG A;  3BJ5 A;  1WJK A;  1FHE A;  3FHK A;  3KE7 A;  3G7Y A;  2IFQ B;  2HMN B;  5I97 A;  5CLK A;  3WOD G;  1DSB A;  3EN1 B;  1DE3 A;  3PCR A;  3A2V A;  1BRJ A;  1B3S A;  1KTE A;  2QA1 A;  2WS2 A;  3LTD A;  1XWB A;  3NHX A;  1BUJ A;  2H6Y A;  1FGT A;  4H61 A;  2R2J A;  2WCI A;  2DIY A;  2I3Y A;  2OKA A;  1YQ1 A;  4O92 A;  2YV7 A;  2H70 A;  3U5R E;  3ZFB A;  5IER A;  2O87 A;  3WA3 A;  1A90 A;  1W01 A;  1KD1 4;  1X9M B;  2L6C A;  4FYB A;  1T8E B;  1AVK A;  2XRX B;  3HI7 A;  2O8V B;  4EC0 A;  3TUE A;  4BL3 A;  5J5N A;  3CMA 3;  3Q2P A;  3DGM A;  5ELJ A;  4WBJ A;  3OV4 A;  3JUQ A;  1BNR A;  1X5E A;  2DKH A;  4KDX A;  5A4U A;  1XW9 A;  3GSP A;  4BVX A;  1T5Y A;  1DBY A;  5LC6 A;  4N6O B;  1X9W B;  2V41 A;  1TK0 B;  4EL1 A;  3CCL 3;  1RGA A;  5LC7 A;  3KTB A;  2H1G A;  1O7W B;  1O7U A;  1K9M 4;  3NQY A;  2QC7 A;  1NHO A;  3UAR A;  4JED A;  2HSH A;  2MYG A;  2DJ3 A;  4NWY A;  4HVN A;  2I9W A;  3PYJ A;  4YAP A;  2E2T A;  3DEX A;  2CFD A;  1T2I A;  2CWT A;  5ECR B;  2IFQ A;  6GSY A;  1W02 A;  1VF2 A;  4IJ3 A;  2YFI B;  1TFO A;  2RBI A;  2AV4 A;  4AKZ A;  3GH6 A;  1TRW A;  4O5R A;  1ZO2 A;  2L6D A;  2WUL A;  3SBC A;  1WTH A;  1AAZ A;  3PGT A;  2RM6 A;  2UUG C;  4MDC A;  4KW6 A;  2IUK A;  3GKX A;  2CZ2 A;  3HZ4 A;  1KC8 4;  2C0D A;  3CCE 3;  1HD2 A;  3V99 A;  4K5R A;  1GSY A;  3HJM A;  4F2I A;  2ES7 A;  4DSR A;  5STD A;  3LFL A;  2R5G A;  2HI7 A;  3QD9 A;  1G7E A;  2FNO A;  4JE1 A;  1GOU A;  4HYZ A;  1S72 3;  1D6U A;  2HRK A;  8GSS A;  3EF8 A;  2YWO A;  1GNE A;  2GZP A;  1K3O A;  2CG1 A;  1MWR A;  1N2A A;  2DLX A;  2V6O A;  4O2H A;  1GY6 A;  3HJP A;  2CX4 A;  3EB8 A;  1WMJ A;  5G2G A;  4G0K A;  1IVV A;  1TW9 A;  2JZS A;  4FIW A;  4MZB A;  1LJR A;  2UX0 A;  1G96 A;  2IMJ A;  1MOL A;  2Y74 A;  5AII A;  1QQ2 A;  3M9K A;  5BIR A;  2P38 A;  2VL9 A;  1JFU A;  1TFK A;  4F0B A;  1AC1 A;  4HQZ A;  4IHU A;  1IYI A;  1V40 A;  3R2Q A;  1JBS A;  4OCF A;  2JQ5 A;  4PX1 A;  4LSO A;  3KM6 A;  4ZBD A;  4O3V A;  3CC4 3;  2E2V A;  3FLJ A;  1RGE A;  3EVI A;  2YAN A;  4GB5 A;  2DMM A;  1MGW A;  2L4C A;  2NPB A;  3HJO A;  3EBY A;  1VQP 3;  1VQO 3;  1UVZ A;  4LEH A;  2XEP A;  2MC8 A;  2OTJ 3;  1OCV A;  5AIS A;  1V98 A;  3D4M A;  3GRD A;  2JL4 A;  2QEX 3;  2JDI H;  1XW6 A;  5EVO A;  3NX0 A;  4EXJ A;  1M9B A;  2DML A;  1W5Z A;  4N11 A;  1HU9 A;  2BMX A;  4J5K A;  2B1X B;  3D79 A;  3EN8 A;  1E3V A;  2C1Y A;  3GZR A;  5GSP A;  1XPV A;  1QXH A;  5HR3 A;  3HKR A;  2C3Q A;  2OE1 A;  4KND A;  4PUA A;  2GEX A;  1PKW A;  2C11 A;  4L8E A;  1OC8 A;  1T4Y A;  3KCM A;  1O8X A;  2E2G A;  3HY2 A;  4K2D A;  12GS A;  2VD1 A;  3GKK A;  4ZXG A;  1DET A;  3NBB A;  1BRN L;  1EA2 A;  2VAF A;  4LGQ A;  4FCM A;  2UZ8 A;  1EKM A;  1Q82 4;  3KKG A;  3F14 A;  1XCC A;  3BBY A;  3HDC A;  1Y6E A;  2WOF A;  3F0I A;  1Q7H A;  3DKS A;  3LXU X;  1SL0 B;  2XPE A;  3H51 A;  5AIV A;  3I56 3;  3AY8 A;  3HVV A;  1YF0 A;  1RGF A;  3DGL A;  3FH1 A;  1NM3 A;  2P31 A;  2G0F A;  2YZU A;  2B1L A;  1AV4 A;  2XBQ A;  1SKW B;  3EQQ B;  5IEP A;  4XS4 B;  3CNX A;  3FKF A;  3GHA A;  1KEB A;  4XBX A;  3VK9 A;  2V1L A;  4LL1 B;  3MIX A;  3VWU A;  1XWC A;  3UBL A;  3BCK A;  5ID2 B;  4Q53 A;  1ROV A;  2OJL A;  2B5X A;  2VL2 C;  2FHE A;  4MH2 A;  3PGB A;  11GS A;  1B2Z A;  3HXS A;  4KSO A;  5HR2 A;  2BIR A;  4HS1 A;  4EUY A;  1UCI A;  3CYN A;  3B4O A;  2FWF A;  3IHQ A;  3QOU A;  1BJX A;  4PGT A;  4HM0 B;  4XS6 A;  4JBB A;  3HOH A;  4EE0 A;  3CQF A;  4HQS A;  1ROA A;  3TJF A;  9RNT A;  2IMF A;  2C10 A;  2FLS A;  5F8B A;  2BO9 B;  3FCS B;  1C54 A;  2GT5 A;  3IRA A;  4N6N B;  1B21 A;  2R0G A;  4TOP A;  2H0G A;  2INX A;  4K5S A;  2AAE A;  1C7H A;  1A2M A;  1E6B A;  2CA8 A;  3KXO A;  2H6X A;  3FF2 A;  1GLP A;  5DJM A;  1EOG A;  1DVC A;  2GSP A;  2JZR A;  2V6K A;  3CRT A;  2L5O A;  3HIG A;  2VCV A;  1ZYQ B;  2C80 A;  3A76 A;  3DM8 A;  4PQI A;  4A5P A;  3TGZ A;  3ZIV A;  3GN3 A;  4TR0 A;  3KN4 A;  1B9Y C;  4MH3 A;  3UVT A;  4CY6 A;  5ID2 A;  2XFS A;  4H3U A;  4E8H A;  3F8U A;  2OAD A;  3MDK A;  3IPT A;  6STD A;  4FMA A;  2GQM A;  3ALA A;  2KF5 A;  4P3Y B;  5HQP A;  1YZX A;  2HMO B;  4KCE A;  2RUF A;  1RDS A;  1YKC A;  2EIO A;  2FWG A;  1SYX A;  3FYG A;  3EU3 A;  1A23 A;  4O7H A;  2PU9 C;  4NV5 A;  1I2E A;  5LCZ A;  1Q9E A;  1O7P B;  3S29 A;  4LL4 B;  3I6A A;  2YFJ B;  1Z9H A;  1EUI C;  2HRN A;  3RNT A;  3AGO A;  5M1A A;  4K7O A;  2ML6 A;  1EV4 A;  1BQ7 A;  3LT8 A;  4HM4 B;  3US3 A;  3KH7 A;  3PIN A;  2CQ9 A;  1X1W A;  1EWX A;  5D9X A;  2YJH A;  1B27 A;  5KP1 A;  2CAI A;  4FMB A;  3ME7 A;  1GP1 A;  1FGO A;  1A67 A;  1I70 A;  4RZM A;  4U13 A;  2XF3 A;  3CME 3;  1OE7 A;  3Q74 A;  1ZCP A;  4PQ1 A;  4KFE A;  5H5R A;  1VQ5 3;  5B8B A;  2YWI A;  1GMQ A;  1AVL A;  1W7C A;  1A24 A;  1O7G B;  3QAW A;  2Z6B A;  4XRA A;  3QDN A;  2B1K A;  2XGN A;  4AJ8 A;  1LNH A;  4I8B A;  3GZX B;  1GL8 A;  2DKI A;  4MLY A;  3RDE A;  1VQK 3;  2RII A;  1BAO A;  1GMP A;  5F06 A;  4TVE A;  1PFO A;  2MBS A;  5IQY A;  1JV2 B;  1AQZ A;  4GLT A;  1SJI A;  4WXT A;  1PL2 A;  4BIK A;  4FQU A;  4F0C A;  1TU5 A;  5DCH A;  4WHA A;  3HZP A;  2HRA A;  2QSI A;  3WD6 A;  3OWY A;  1M3J A;  4IEL A;  3M0F A;  1XW5 A;  1OKT A;  2LEG A;  3QRD A;  3EMX A;  5HFG A;  3TJK A;  2GZY A;  3H93 A;  3CNM A;  4KE3 A;  1IYY A;  1TP6 A;  2W56 B;  1SEN A;  4ML6 A;  1VF1 A;  3GYK A;  2GBW B;  2IY2 A;  4GCI A;  1HNC A;  4EV2 A;  1B20 A;  3LSZ A;  3IBH A;  3KJY A;  3EBT A;  3IA1 A;  4POM A;  4TR4 A;  2C0G A;  2I1U A;  1BRS A;  1I0X A;  3T8U A;  1Q86 4;  2DJJ A;  4HEA 2;  3ERF A;  4MPF A;  1MNL A;  2H01 A;  3O8Y A;  2OE0 A;  2PZV A;  2B7J A;  2YZH A;  1OGX A;  1JB2 A;  1TIJ A;  4ZIJ A;  3TKS E;  2D2Z A;  3F9U A;  3ZIT A;  20GS A;  1I2F A;  1F3B A;  1MDI A;  3DGN A;  4MCU A;  5E4W A;  4ECI A;  3S27 A;  1HKX A;  1JNQ A;  4N30 A;  1M1K 4;  3GKM A;  4BL2 A;  1ZYP A;  3DY5 A;  3TOT A;  3LYK A;  3F7X A;  5IF6 A;  2BMR B;  4GSN A;  1MD3 A;  4PEJ A;  3GA4 A;  3GL5 A;  1GTA A;  3SWL A;  3X3X A;  4WFO A;  2QGV A;  1TOF A;  1SIH A;  1RGL A;  3SLU A;  2N5A A;  4Z2T A;  2C4J A;  1UCJ A;  1BIR A;  2VCQ A;  4QQ7 A;  4ACS A;  1GNW A;  1XG8 A;  1GUH A;  5KEJ A;  1DMQ A;  1C72 A;  1AQV A;  3F6F A;  1BNI A;  2YP6 A;  1N8J A;  1ERV A;  4MF7 A;  5IG5 A;  2K18 A;  3V92 A;  5LD0 A;  3D0Z A;  2R4V A;  5ELG A;  4RNY A;  4YAV A;  3X41 A;  1SL2 B;  1ULJ B;  1KQS 2;  3NOF A;  4MJD A;  2CAQ A;  2AB6 A;  3K7C A;  5EEO A;  3QFA C;  2YJ7 A;  4POB A;  1O7M B;  4EKZ A;  1JRQ A;  3C1R A;  3CCJ 3;  5DRE A;  5M19 A;  4ZB9 A;  3MWZ A;  3I9V 2;  1M1X B;  4NHW A;  4ZM8 A;  2CFK A;  1EQK A;  1BSD A;  4EV5 A;  1G02 A;  2VL2 A;  1R4W A;  2K9F A;  3F9S A;  3E3E A;  4TKY A;  5FW5 A;  2GXF A;  1A2P A;  2K54 A;  5IG0 A;  4MK3 A;  5JCW A;  4IKH A;  3PZW A;  2HXK A;  2PNC A;  4GF0 A;  1YDK A;  4I5Q A;  4POL A;  3HVS A;  2GT6 A;  3QPM A;  5IW9 A;  2E2U A;  4KF9 A;  2XPD A;  1QVG 2;  4MMZ B;  4NMU A;  3TKQ A;  5E59 A;  5KN2 A;  3KCH A;  1B2U A;  3IPZ A;  2GU3 A;  3VF1 A;  2WRT A;  2FWH A;  2HT9 A;  1IQ8 A;  1AQX A;  2H71 A;  2LNS A;  4GRF A;  3FMW A;  3UAP A;  4CCV A;  3ZRE A;  5CP1 A;  2ON5 A;  2CX3 A;  1AXD A;  4BVY A;  1SJZ A;  3SVA A;  1FVK A;  4NRE A;  1TRS A;  3X3Y A;  1JBR A;  1X5D A;  4BU4 A;  1OYJ A;  2F8F A;  1CQH A;  2IMI A;  3E0U A;  1UCL A;  3Q6O A;  4ULX A;  4FR9 A;  2BMO B;  1B4P A;  2QA4 3;  2P05 A;  1BGS A;  2O89 A;  3WGD A;  3KMN A;  1FUT A;  4K7I A;  1GH2 A;  2CG0 A;  4GST A;  2DJ2 A;  1ST9 A;  2F5M A;  1RTU A;  3KP9 A;  1EV9 A;  1Z3E A;  2LUS A;  2RNT A;  3FGY A;  1QK8 A;  1UA5 A;  5CF1 A;  1EEM A;  2YN1 A;  2LS5 A;  3J7Y k;  1AW9 A;  3EUR A;  1MTC A;  2JSY A;  4HM2 B;  4K1U A;  1VQ9 3;  1EP7 A;  4LMI A;  1IK3 A;  1GS3 A;  3P2A A;  1X1Y A;  2FUG 2;  4L0W A;  1RGC A;  1VGL A;  4PNG A;  1X0R A;  2EIR A;  3P7X A;  1ERT A;  1PMT A;  5B8A A;  4N6L A;  4OWY A;  1TRQ A;  1BG5 A;  1A8Y A;  1CYU A;  3P90 A;  4LZI A;  4X0X A;  2CX0 A;  1FA3 A;  1GSE A;  2GTU A;  4NXI A;  4ECB A;  2W04 A;  3CCR 3;  1DE1 A;  1LQM B;  1W2Z A;  1FGM A;  3CC2 3;  1Q42 A;  6RNT A;  5B6M A;  1UCK A;  4ZB8 A;  1LVN A;  3TB2 A;  2CKF B;  2OOV C;  2XC2 A;  4N6T A;  2CV4 A;  3CRU A;  1X5C A;  5A4W A;  2VM1 A;  2RUE A;  3LML A;  4CHS A;  1Q81 4;  1YNV X;  3LJR A;  3ZLP A;  2H8L A;  3B4P A;  2F98 A;  3QK9 A;  5AIH A;  2GVP A;  3IHG A;  3STD A;  1GOV A;  4CDO A;  1GSP A;  3FR6 A;  3N5O A;  4EIQ A;  5ECQ B;  3NUV A;  3U6V A;  1DYU A;  2BNG A;  3PCS A;  5A0O B;  3G7J A;  4WF5 A;  3G4S 3;  1XVW A;  1GD4 A;  2I81 A;  5AYS C;  1TK5 B;  4BA7 A;  1W6Y A;  2N5F A;  2JAD A;  2PVQ A;  1X1X A;  3NQZ A;  4K1V A;  5HFK A;  2KCD A;  2LQO A;  3TKS C;  4IT7 A;  2HZE B;  4WR4 A;  2H1A A;  1USB A;  4G10 A;  3VI7 A;  1BAN A;  1ABA A;  3TJB A;  1PN9 A;  1RK4 A;  4JZQ A;  4BL7 A;  1IQY A;  1IV9 A;  1PN0 A;  2PVO C;  5G2Z A;  4MP4 A;  3TJG A;  1YVS A;  4HZ2 A;  1S3C A;  3DGY A;  2LQQ A;  2RFR A;  1ZL9 A;  4EDY A;  4PTS A;  4WR5 A;  3D5G A;  3GAX A;  4ZL9 A;  4WBR D;  3V98 A;  1UGI A;  3WA2 X;  5AYR B;  3T0U A;  3BCI A;  1OF5 B;  4IN0 A;  4RQX A;  2N5B A;  1GSS A;  5DDL A;  4KDY A;  1I3I A;  3BNE A;  7GSS A;  2MMA A;  4KUN A;  3JUO A;  4L0U A;  2X99 A;  1TU8 A;  4YH2 A;  4Q5Q A;  2YPM A;  1SAR A;  1RHL A;  2XHF A;  2FNQ A;  2ALB A;  1BSC A;  5EL8 A;  2C3N A;  1F6M C;  4EVM A;  1BOX A;  4HJL B;  3KGK A;  3EPT A;  1QAL A;  3UNL A;  3FZW A;  3DUK A;  3BLZ A;  2CZ3 A;  3NBJ A;  2LJR A;  4TXV A;  2KUC A;  3CXG A;  3HA9 A;  4IP6 A;  4KB3 A;  4XB5 A;  4KGI A;  2I9H A;  2LJK A;  4K6X A;  4Q5N A;  1J9B A;  3LQ7 A;  1RSN A;  1WOU A;  2XFT A;  3GX8 A;  2K3D A;  1X1U A;  1RNB A;  1D6Y A;  4CPK A;  1S3R A;  5G5F A;  5JCG A;  3BB9 A;  10GS A;  4KZ1 A;  4IS0 A;  1RN4 A;  1ZYN A;  4PQH A;  3HCZ A;  2ML5 A;  3OX9 A;  3KSE D;  1FVJ A;  1WE0 A;  1OF5 A;  4GWR A;  4QWT A;  5KOX A;  2ZUP A;  4N10 A;  3EX9 A;  2I4A A;  2MMN A;  4GXZ A;  3K9M C;  5INY A;  3BNC A;  3KIJ A;  5DCG A;  1HZ1 A;  1A2V A;  4PXO A;  4HOH A;  2OCT A;  4DSQ A;  4POK A;  1PU4 A;  1JN5 B;  2R41 A;  1K0M A;  3EC3 A;  3HVN A;  4NPB A;  3WGX A;  2BT3 A;  2W9Q A;  4MJC A;  1ISK A;  2HNL A;  2F56 A;  1Z5Y E;  1TKD B;  2H75 A;  2ZNM A;  3MYD A;  2XR8 B;  3L9S A;  1OAC A;  1GY5 A;  5G31 A;  5KN1 A;  3BIR A;  4HM8 B;  4JR6 A;  5HR1 A;  1TDI A;  5IMD A;  5IPH A;  1O6J A;  3ZYW A;  2WFC A;  1G6Y A;  3PH9 A;  1R4C A;  3EE1 A;  2FGX A;  3L0H A;  2W6J H;  2GS3 A;  1ZYE A;  2B3S A;  4OO4 A;  2C4B A;  5EVH A;  3IDV A;  1RQM A;  1NNV A;  1QFN A;  2KOK A;  1X9S B;  4JRF A;  1M2A A;  1QGV A;  2IL3 A;  3O3T A;  7RNT A;  1VQM 3;  1W6C A;  2L5L A;  1K0O A;  1LOY A;  6GSS A;  3MNG A;  4USS A;  5IG4 A;  1XOB A;  3Q90 A;  2RCD A;  2FA8 A;  2GSQ A;  3OWU A;  3KTL A;  2GGT A;  1BSE A;  5ENU A;  5GAN D;  2VD0 A;  3IAM 2;  3L0R A;  2LNT A;  5B7C A;  1EG9 B;  1TI3 A;  2TRC P;  3J7Y b;  1YHQ 3;  3CTF A;  3PXM A;  3NXJ A;  1BNS A;  3LTB A;  2H73 A;  3EWL A;  4YQV A;  1G6W A;  5BVB A;  2CVD A;  1YY7 A;  1Q40 B;  2A15 A;  3W8S A;  1QVF 2;  5J9B A;  4AJ6 A;  1FB6 A;  1N8R 4;  2EC4 A;  1LQG C;  1W00 A;  1JZD A;  1K0D A;  5RNT A;  1TI1 A;  2H19 A;  1Y4K A;  4YKF A;  2VCZ A;  2F51 A;  3Q18 A;  1I5G A;  4J57 E;  4HDE A;  1BUQ A;  2OBI A;  1N5P A;  2GU1 A;  1KSI A;  3A5W A;  2LRC A;  1GD3 A;  2A4V A;  1RNT A;  5F07 A;  2IJY A;  2A2R A;  3Q19 A;  1SII A;  3KP8 A;  4G0I A;  5EY6 A;  1OHS A;  3KSP A;  4BIR A;  1LXE A;  1U3A A;  5J41 A;  2IMD A;  2VO4 A;  2OOV A;  1JB4 A;  4O32 A;  1OC3 A;  1BRK A;  2XSO B;  5CRW A;  4IP1 A;  4GQF A;  3VFI A;  3ZVJ D;  3F8H A;  1FG4 A;  4G0L A;  1FGR A;  3APQ A;  2YCD A;  5HFI A;  4HM3 B;  3LOR A;  1M2B A;  4LMV A;  1GTB A;  1W89 A;  3IMA B;  4EXR A;  3N9J A;  3TKR A;  2DJ0 A;  3FW2 A;  3PS8 A;  4XS4 A;  5IM9 A;  2ON7 A;  14GS A;  3ZFZ A;  4O8S A;  1OAZ A;  1RRL A;  4AKY A;  1K8A 4;  4HZB B;  2PER A;  3TKS A;  2DIZ A;  3ED3 A;  1RCK A;  1FUS A;  1PX7 A;  3F7S A;  3EHC A;  3RGR A;  3M1G A;  2DJK A;  5J3R A;  4WKW A;  5ELU A;  1HYU A;  5H5Q A;  2M46 A;  4LA1 A;  4N6V 0;  1VQ4 3;  3RBT A;  1NU3 A;  3V1W A;  3WYW A;  3ME8 A;  1UGH I;  2Z76 A;  2XSH B;  1JZW A;  2Z9S A;  3FKA A;  2BTO T;  2A4H A;  2H30 A;  4I6X A;  1O81 A;  2WO0 A;  1M7T A;  2X49 A;  5BRT A;  1Z1S A;  3MSZ A;  3SYU A;  1XZO A;  3QAV A;  6GSW A;  1F8N A;  3LOY A;  3FF0 A;  2HML B;  5KP3 A;  1HQO A;  4D73 B;  1JHB A;  3EMP A;  3C7M A;  5FWG A;  1UI8 A;  3ZML A;  4N3V A;  1XVQ A;  5H5S A;  1O8W A;  3FZ4 A;  4AJ7 A;  1GUL A;  1B8X A;  1W6G A;  1SJW A;  4Q5R A;  2NTO A;  5CK6 A;  3IAS 2;  3GST A;  3JUN A;  4BTY A;  3WOE B;  2F99 A;  4TR3 A;  2W0Q A;  3GIX A;  4KH7 A;  4IBP A;  1RKY A;  1CQG A;  4KCA A;  4R9K A;  1O85 A;  4J2F A;  1RLS A;  1FOH A;  1A0R P;  5BU4 A;  2O9U X;  4ECC A;  5AEW B;  2DSA A;  3L78 A;  1V57 A;  3TRX A;  3MPH A;  2AHE A;  1A2J A;  3G0K A;  2CWV A;  2Y73 A;  1QJG A;  4RNZ A;  2VCW A;  3HII A;  1IYH A;  3M8N A;  2NBS A;  4TXO B;  3NIV A;  4BTW A;  3O76 A;  4N6M A;  1RW1 A;  2HFD A;  1SYR A;  1SKS B;  1M3I A;  1K0B A;  2VUP A;  3FY7 A;  5JBS A;  4QL9 A;  1THO A;  2VCT A;  3LG6 A;  3HD5 A;  2GSR A;  5D93 A;  2VLV A;  2KF3 A;  5IEO A;  3CSH A;  1G7O A;  5ECS A;  3TJJ A;  1TU7 A;  3L9U A;  3G8Z A;  1BSA A;  4EC6 A;  1Z6M A;  2WZ9 A;  2OWP A;  3GL3 A;  1RGH A;  4WWU C;  4ID0 A;  4RUV A;  4BTX A;  3DGO A;  1U3I A;  4L5O A;  4KSM A;  1XWG A;  3KII A;  5GZZ B;  2HSY A;  2JZT A;  4ECJ A;  3Q1C A;  1I9D A;  1YEP A;  5D9V A;  4HU9 A;  1MDK A;  1MEK A;  1E2Y A;  4J5G A;  5J9C A;  4STD A;  2VCX A;  3U1W A;  2K6V A;  3BD2 A;  4AF2 A;  2L4V A;  5HGR A;  1LOV A;  2NDO A;  3MKI A;  8RNT A;  4R1K A;  5ECO B;  1LBK A;  3IV4 A;  1M90 4;  5COH A;  1TP9 A;  2K8S A;  2F8A A;  2OAC A;  3VUR A;  1N9E A;  2K0M A;  4PNF A;  2CX1 A;  4N0Z A;  1ASK A;  2O7K A;  3FRC A;  3NV0 B;  4G2E A;  1URM A;  4AEQ A;  3DGQ A;  2M7O A;  4ZIL A;  1FZU A;  5IMA A;  1G0T A;  3LYG A;  1F9M A;  1FAA A;  2GST A;  2D42 A;  5IO2 A;  3X3Z A;  1NJI 4;  1IU7 A;  2HRF A;  1IV7 A;  4KX4 A;  5EPF A;  4F03 A;  3DIE A;  1J08 A;  2F3M A;  4K9Z A;  1BX9 A;  2B5Y A;  2GQL A;  3ERW A;  1Q98 A;  2GLR A;  1EEJ A;  2W56 A;  1CYV A;  1PY3 A;  3ECF A;  19GS A;  3BOA A;  1VRS D;  2IN3 A;  1BRH A;  1VQ7 3;  1YGW A;  4HM6 B;  1GTU A;  1XFL A;  3ZG5 A;  3GMF A;  4WET A;  3VPQ A;  1R4Y A;  4I4K A;  3AHS A;  3F40 A;  4G19 A;  2F86 B;  3FZA A;  2P0X A;  4HKV B;  1IVX A;  1ML6 A;  3KMO A;  4KA0 A;  2H76 A;  4ZBB A;  2M80 A;  5AIF A;  3LW9 A;  1U87 A;  1VQL 3;  3LH4 A;  1W4V A;  4HM5 B;  4HSC X;  4MZC A;  3HVX A;  4FMD A;  3QR6 A;  3JUM A;  4KDU A;  1T00 A;  1SQW A;  1RN7 A;  4N0V A;  1N8Q A;  2OBK A;  3NV0 A;  3AMO B;  2D1W A;  5CNW A;  4Z7X A;  2H1D A;  1TRP A;  5JWR B;  3F4R A;  4R80 A;  3A5I A;  2OE3 A;  4EDZ A;  3X40 A;  3OW2 2;  1VF3 A;  3MYT A;  2C0F A;  3GH9 A;  5IIZ A;  1WMO A;  5EQL A;  3IR4 A;  4TX4 A;  5CRE A;  1QMV A;  1IVW A;  4ICY A;  1MWU A;  3VGN A;  3O6T A;  2V1M A;  3LGC A;  4E8E A;  4HM1 B;  1K0N A;  1L5G B;  2W9P A;  3RHC A;  2E2M A;  1IT8 A;  2RLI A;  1Y25 A;  1QAF A;  2QIY A;  3KZT A;  1T1V A;  4ZBA A;  1ZOF A;  1PKZ A;  3UL3 A;  3KD0 A;  1JLV A;  4OFT A;  1BRG A;  5ECP B;  2WOH A;  2E0Q A;  4X1U A;  1NWW A;  4OK0 A;  2F4Y A;  17GS A;  2CFG A;  3M3M A;  3DRN A;  3M9J A;  5FT3 A;  3IXR A;  1AIU A;  2CIU A;  2LRT A;  1EGR A;  3UIW A;  3JUP A;  4MPG A;  4K0N A;  2AAW A;  1LNI A;  5DQS A;  1RGK A;  5G5E A;  2R37 A;  2XH9 A;  1LU4 A;  4MJB A;  3LT9 A;  2HSM A;  1JKG B;  1CEW I;  1ZGX A;  2CHC A;  2OQE C;  3AMO A;  1ZGN A;  4RBN A;  2YX9 A;  3T8N A;  5GSS A;  1LOW A;  3VLN A;  1LOX A;  4HM7 B;  2QA2 A;  1OPY A;  1PA3 A;  2PMT A;  1SD8 A;  2IME A;  1BNE A;  3LYP A;  22GS A;  4MMY B;  1BED A;  3G9B A;  1U5O A;  5A5K A;  2G2Q A;  2H0H A;  1YGE A;  4HBR A;  5IO0 A;  3TKP A;  3S28 A;  2P5R A;  2GBX B;  5IEN A;  1ZX2 A;  1DUG A;  1O7H B;  5JPP A;  3I55 3;  1I8V A;  2KLX A;  2AYT A;  3D5I A;  1D6Z A;  3WHO A;  4X43 A;  3DVW A;  3DML A;  1M9G A;  1BAY A;  2KAA A;  5IMV A;  3VWV A;  2HMK B;  1V2A A;  1ZMA A;  2P09 A;  3APS A;  4MJA A;  4WYK B;  4MMM A;  5D9W A;  3IJE B;  3G6E 3;  3A3T A;  1XXU A;  4O5Q A;  3LTA A;  1XOA A;  4IPB A;  18GS A;  4Q5F A;  6GSU A;  2KP1 A;  2B24 B;  1JKG A;  2R6K A;  2H66 A;  5G1L A;  1M2D A;  1BU4 A;  1T4Z A;  5JWQ B;  2LQV A;  4IW9 A;  2RGQ A;  1BNF A;  5IMF A;  6GST A;  1VZZ A;  3K0Z A;  1RGG A;  2KRT A;  3UOM A;  3KEB A;  3CTG A;  1VF4 A;  2VM2 A;  4K2X A;  2H1B A;  4JR4 A;  3H79 A;  1M9A A; 
#chains in the Genus database with same CATH homology
 2C8U A;  4IGJ A;  5IMC A;  1Z7P A;  1FW1 A;  3ZTL A;  4F9Z A;  4MNN A;  3F3Q A;  3EYT A;  1SU9 A;  3WT2 A;  4G9H A;  2MZC A;  3APO A;  5KOW A;  2V2G A;  3HHV A;  4I2T A;  1SD9 A;  5C04 A;  4OFN A;  3VWX A;  1PRX A;  2MBT A;  1OVN A;  2HLS A;  13GS A;  2LST A;  3HYP A;  1GSF A;  4AGS A;  4QL7 A;  2YWM A;  1Z6N A;  3UMA A;  5ABR A;  2LTK A;  5D8I A;  2VLT A;  2X8C A;  3RAZ A;  3TOU A;  4ML1 A;  2MMO A;  2R0P A;  1R5P A;  3UEM A;  3C1S A;  5ECL B;  2GQK A;  2FWE A;  3DD3 A;  4H86 A;  5F05 A;  4XS1 A;  4Z2R A;  1U6T A;  5AN1 A;  1S3D A;  2J9H A;  2HZE A;  1ILO A;  2FD3 A;  3GX0 A;  5GAP D;  1YJ6 A;  5DAL B;  3FR9 A;  2YNX A;  4JRR A;  3ZIJ A;  3H1N A;  3CBU A;  4TW5 A;  3GSS A;  2IIY A;  1B9X C;  1K3L A;  3LEF A;  1M99 A;  1TJD A;  2R0C A;  4ILF A;  1A0F A;  3I43 A;  1T7P B;  3LWA A;  2YV9 A;  5CRG A;  2TIR A;  4XHM A;  3DXB A;  2DC5 A;  1WIK A;  2LV3 A;  2CVK A;  5DVB A;  3L9V A;  2O85 A;  1QUW A;  4BWQ A;  2MMZ A;  5ECH B;  4YKG A;  1WWJ A;  4V2N A;  3A2X A;  4HJ2 A;  4DSS B;  4OFM A;  5DQY A;  2PN8 A;  5CRH A;  1TRU A;  2L4Q A;  4FO5 A;  2GDR A;  2HYX A;  2ZCT A;  4K1F A;  3R3E A;  2B6M A;  1ERU A;  5G1K A;  4I97 A;  1OC9 B;  1JZO A;  1NHY A;  5DAL A;  4EF0 A;  4OO5 A;  2WDU A;  2PUK C;  6GSX A;  1GTI A;  1WRY A;  4KAE A;  3MAK A;  4XTS A;  3FR3 A;  1FO5 A;  3DVX A;  4XRD A;  3F4S A;  3FEU A;  2IYJ A;  3LXZ A;  2AUV A;  5IPG A;  1S3A A;  1UN2 A;  3F3R A;  4MF6 A;  3CSI A;  4MAB A;  2A2P A;  1FB0 A;  5IMZ A;  2C0E A;  3ZVJ A;  1TTZ A;  1K0A A;  3A2W A;  1ACV A;  5C00 A;  2L59 A;  1R5A A;  5KN0 A;  4TN8 A;  2JU5 A;  4HZ4 A;  3F6D A;  4DSS A;  1XWA A;  4F82 A;  1XWK A;  3ZRD A;  3HZ8 A;  5CAX A;  3S9F A;  1SKR B;  4V1A p;  1OC9 A;  2R3X A;  5ECI B;  5HR0 A;  3EIN A;  1SK0 A;  1PQN A;  4K0G A;  5FHI A;  4HU7 A;  1SL1 B;  3IC8 A;  2FY6 A;  3C8E A;  1NW2 A;  1WP0 A;  5J4U A;  1GSU A;  4RQR A;  2HE3 A;  5ECM B;  2WB9 A;  2F9S A;  2XBI A;  5JWO B;  1H4O A;  4CW9 A;  2B5E A;  5AGY A;  5A4V A;  1JLW A;  5CO3 A;  1PGT A;  4ISD A;  2C3T A;  2X64 A;  2PGT A;  5BMU A;  3IK9 A;  5DBQ A;  1MDJ A;  2P0G A;  3IC4 A;  4IVF A;  4OD7 A;  5D9T A;  1HNB A;  3LXT A;  3VI5 A;  4JU5 A;  3GKN A;  1YEX A;  4GTU A;  1K0C A;  3F4T A;  2NVL A;  3PPU A;  2VIM A;  2CT6 A;  5CYY A;  2REM A;  1ON4 A;  3PR8 A;  16GS A;  2TRX A;  4IJI A;  5KN3 A;  1H75 A;  3DYR A;  3CMI A;  3JCM L;  4L5L A;  2B7K A;  2M72 A;  2K8V A;  3FK8 A;  1F37 A;  1SJ6 A;  1HNA A;  1SK1 A;  3DWV A;  4OCE A;  2LRN A;  5F0G A;  1MD4 A;  5B6N A;  4LMW A;  2J23 A;  4LLR A;  3EE2 A;  2VL3 A;  2X8H A;  3RHB A;  5DAK B;  2P5Q A;  1YKA A;  2L57 A;  3C71 A;  4V1A g;  2HZF A;  1GUK A;  3D21 A;  1V58 A;  1R26 A;  1THX A;  3IE3 A;  1WPI A;  3KZQ A;  3L4N A;  3VWW A;  4OMV A;  2DBC A;  3IK7 A;  5DJL A;  3TRP A;  5D73 A;  2LJA A;  1EP8 A;  1OE8 A;  4BPY A;  2PPT A;  2RM5 A;  3D5J A;  3GTU B;  2JSZ A;  1B48 A;  1TRV A;  4MF5 A;  2KHP A;  2X4A A;  4D73 A;  2VOC A;  2FA4 A;  2H6Z A;  3ZL5 A;  2BJX A;  3E9J B;  3QAG A;  2H74 A;  1XBS A;  3K8N A;  4FYC A;  5IOW A;  3CSJ A;  5IOX A;  1DE2 A;  2YOI A;  5DAK A;  3RPP A;  3FZ5 A;  1NSW A;  2WJU A;  2EIQ A;  1PD2 1;  4NV2 A;  1GSQ A;  1TK8 B;  2X8G A;  3UVH A;  4CY8 A;  3C73 A;  3NZN A;  2IWT A;  4MZW A;  2WGR A;  4NAX A;  3KH9 A;  5ECK B;  3WGE A;  1A8L A;  4IQA A;  1Q4J A;  5AIX A;  5ELA A;  4J56 E;  1M0U A;  1U88 A;  2JAC A;  2GSS A;  4TXO A;  1EGO A;  4V2M A;  1PL1 A;  3W6G A;  3TRQ A;  3GTU A;  5GST A;  5D96 A;  1UC7 A;  4PUR A;  6GSV A;  4TRX A;  2PBJ A;  4GQC A;  4K8M A;  2CVB A;  1FOV A;  1JZR A;  4HI7 A;  4I2U A;  3WT1 A;  1EOH A;  3W8J A;  1F3A A;  1Z7R A;  3ERG A;  2FCH A;  1XIY A;  3GUS A;  4HUA A;  1GUM A;  1AUC A;  4XCS A;  1GWC A;  4Z2U A;  1ERW A;  4BVY B;  1GSD A;  4RI7 A;  2GZZ A;  3VPT A;  3MWH A;  3QMX A;  2E7P A;  2H0I A;  3UJ1 A;  3TCO A;  3GV1 A;  1PSQ A;  3QFB C;  1PX6 A;  5JCU A;  3GRX A;  2IPA A;  1GLQ A;  4YQM A;  3D4T A;  4BWS A;  3GUR A;  3ZMK A;  4WF4 A;  1KBN A;  3OR5 A;  1TXX A;  5LNK e;  2LKU A;  4EIP A;  4MJE A;  4XIH A;  4O5U A;  3QCP A;  4V2L A;  5L71 A;  2DJ1 A;  1EZK A;  4DVC A;  5ECN B;  4MA9 A;  2AJQ B;  5G30 A;  3RPN A;  4ZL7 A;  2KP2 A;  4TR1 B;  1SK2 A;  2H72 A;  2YWN A;  1KNG A;  4ZL8 A;  2V32 A;  2A2S A;  1B4Q A;  3UBK A;  1O73 A;  3EU4 A;  2PWJ A;  4WEY A;  3GFK A;  3ZFL A;  3IOS A;  3G7I A;  4FYU A;  4PUF C;  1V9W A;  3H4K A;  5CRD A;  1J0F A;  1F2E A;  3GNJ A;  1GRX A;  4IQ1 A;  3H8Q A;  4K7N A;  9GSS A;  3I69 A;  3RDW A;  2VLU A;  3D22 A;  4FH8 A;  2QKE A;  3D6I A;  2OA7 A;  4GSS A;  1YF1 A;  4RI6 A;  3F63 A;  4X4J A;  1A2L A;  3P8W A;  4HOJ A;  4HJM A;  1OKD A;  1T3B A;  3ZZX A;  1BYE A;  1K3Y A;  3ISO A;  4EO3 A;  4DEJ A;  4BL7 B;  1AQW A;  4BVX B;  4NHZ A;  4TR1 A;  3FZ9 A;  1ZZY A;  2IMK A;  1R7H A;  4ZB6 A;  4YQU A;  3TDG A;  3BJ5 A;  1WJK A;  1FHE A;  3FHK A;  3G7Y A;  2IFQ B;  1DSB A;  3A2V A;  1KTE A;  2QA1 A;  2WS2 A;  1XWB A;  2H6Y A;  2R2J A;  2WCI A;  2DIY A;  2I3Y A;  2OKA A;  1YQ1 A;  4O92 A;  2YV7 A;  2H70 A;  3U5R E;  3ZFB A;  2O87 A;  1X9M B;  2L6C A;  4FYB A;  1T8E B;  2O8V B;  4EC0 A;  3TUE A;  5J5N A;  4WBJ A;  2DKH A;  1X5E A;  4KDX A;  5A4U A;  1XW9 A;  4BVX A;  1DBY A;  1X9W B;  2V41 A;  1TK0 B;  4EL1 A;  3KTB A;  2H1G A;  1O7U A;  2QC7 A;  1NHO A;  3UAR A;  4JED A;  2HSH A;  2MYG A;  2DJ3 A;  4NWY A;  4YAP A;  3DEX A;  5ECR B;  2IFQ A;  6GSY A;  1VF2 A;  4IJ3 A;  2AV4 A;  3GH6 A;  1TRW A;  4O5R A;  2L6D A;  2WUL A;  3SBC A;  1AAZ A;  3PGT A;  2RM6 A;  4MDC A;  4KW6 A;  3GKX A;  2CZ2 A;  3HZ4 A;  2C0D A;  1HD2 A;  4K5R A;  1GSY A;  3HJM A;  4F2I A;  2ES7 A;  4DSR A;  3LFL A;  2R5G A;  2HI7 A;  3QD9 A;  1G7E A;  2FNO A;  4JE1 A;  2HRK A;  8GSS A;  2YWO A;  1GNE A;  2GZP A;  1K3O A;  1N2A A;  2DLX A;  2V6O A;  3HJP A;  2CX4 A;  1WMJ A;  4G0K A;  1TW9 A;  2JZS A;  4FIW A;  4MZB A;  1LJR A;  1QQ2 A;  3M9K A;  2VL9 A;  1JFU A;  4F0B A;  1AC1 A;  4HQZ A;  4IHU A;  1IYI A;  1V40 A;  3R2Q A;  4OCF A;  4PX1 A;  3KM6 A;  4ZBD A;  3EVI A;  2YAN A;  2DMM A;  2L4C A;  2NPB A;  3HJO A;  1UVZ A;  5AIS A;  1V98 A;  3D4M A;  2JL4 A;  1XW6 A;  5EVO A;  4EXJ A;  1M9B A;  2DML A;  4N11 A;  2BMX A;  2C1Y A;  1XPV A;  1QXH A;  5HR3 A;  3HKR A;  2C3Q A;  2OE1 A;  4KND A;  4PUA A;  1PKW A;  4L8E A;  1OC8 A;  1T4Y A;  3KCM A;  1O8X A;  2E2G A;  3HY2 A;  4K2D A;  12GS A;  2VD1 A;  3GKK A;  4ZXG A;  2VAF A;  2UZ8 A;  1XCC A;  3BBY A;  3HDC A;  1Y6E A;  3F0I A;  3DKS A;  1SL0 B;  2XPE A;  5AIV A;  3AY8 A;  3HVV A;  1YF0 A;  1NM3 A;  2P31 A;  2G0F A;  2YZU A;  2B1L A;  2XBQ A;  1SKW B;  4XS4 B;  3FKF A;  3GHA A;  1KEB A;  3VK9 A;  4LL1 B;  3MIX A;  3VWU A;  1XWC A;  3UBL A;  3BCK A;  5ID2 B;  2OJL A;  2B5X A;  2VL2 C;  2FHE A;  4MH2 A;  11GS A;  3HXS A;  4KSO A;  5HR2 A;  4HS1 A;  4EUY A;  3CYN A;  2FWF A;  3IHQ A;  3QOU A;  1BJX A;  4PGT A;  4XS6 A;  4JBB A;  4EE0 A;  4HQS A;  3TJF A;  2IMF A;  2FLS A;  5F8B A;  2GT5 A;  3IRA A;  2R0G A;  4TOP A;  2H0G A;  4K5S A;  1E6B A;  1A2M A;  2CA8 A;  3KXO A;  2H6X A;  1GLP A;  5DJM A;  1EOG A;  2JZR A;  2V6K A;  3CRT A;  2L5O A;  2VCV A;  1ZYQ B;  2C80 A;  4PQI A;  4A5P A;  3TGZ A;  3ZIV A;  3GN3 A;  4TR0 A;  4MH3 A;  1B9Y C;  4CY6 A;  3UVT A;  5ID2 A;  4E8H A;  3F8U A;  2OAD A;  3MDK A;  2GQM A;  4P3Y B;  5HQP A;  1YZX A;  4KCE A;  2RUF A;  1YKC A;  2EIO A;  2FWG A;  1SYX A;  3FYG A;  3EU3 A;  1A23 A;  4O7H A;  2PU9 C;  4NV5 A;  5LCZ A;  4LL4 B;  3I6A A;  1Z9H A;  2HRN A;  4K7O A;  1EV4 A;  1BQ7 A;  3US3 A;  3KH7 A;  3PIN A;  2CQ9 A;  1EWX A;  5D9X A;  2YJH A;  2CAI A;  3ME7 A;  1GP1 A;  4PQ1 A;  3Q74 A;  5H5R A;  1OE7 A;  1ZCP A;  5B8B A;  2YWI A;  1A24 A;  3QAW A;  4XRA A;  3QDN A;  2B1K A;  4AJ8 A;  4I8B A;  1GL8 A;  2DKI A;  4MLY A;  2RII A;  5F06 A;  4TVE A;  2MBS A;  5IQY A;  4GLT A;  1SJI A;  4WXT A;  1PL2 A;  4FQU A;  4F0C A;  5DCH A;  2HRA A;  2QSI A;  3WD6 A;  4IEL A;  3M0F A;  1XW5 A;  1OKT A;  2LEG A;  3EMX A;  5HFG A;  3TJK A;  2GZY A;  3H93 A;  4KE3 A;  1SEN A;  4ML6 A;  1VF1 A;  3GYK A;  2IY2 A;  4GCI A;  1HNC A;  3LSZ A;  3IBH A;  3KJY A;  3IA1 A;  4POM A;  4TR4 A;  2C0G A;  2I1U A;  2DJJ A;  4HEA 2;  3ERF A;  4MPF A;  2H01 A;  2OE0 A;  2B7J A;  2YZH A;  4ZIJ A;  3TKS E;  2D2Z A;  3F9U A;  3ZIT A;  20GS A;  1F3B A;  1MDI A;  4MCU A;  5E4W A;  4ECI A;  4N30 A;  3GKM A;  1ZYP A;  3TOT A;  3LYK A;  4GSN A;  1MD3 A;  3GA4 A;  3GL5 A;  1GTA A;  3SWL A;  2QGV A;  1TOF A;  2N5A A;  4Z2T A;  2C4J A;  2VCQ A;  4QQ7 A;  4ACS A;  1GNW A;  1GUH A;  5KEJ A;  1C72 A;  1AQV A;  3F6F A;  2YP6 A;  1N8J A;  1ERV A;  4MF7 A;  2K18 A;  5LD0 A;  3D0Z A;  2R4V A;  5ELG A;  4YAV A;  1SL2 B;  3NOF A;  2CAQ A;  2AB6 A;  3QFA C;  2YJ7 A;  4POB A;  4EKZ A;  3C1R A;  4ZB9 A;  3I9V 2;  4NHW A;  2VL2 A;  1R4W A;  2K9F A;  3E3E A;  4TKY A;  4MK3 A;  5JCW A;  4IKH A;  2HXK A;  4GF0 A;  1YDK A;  4I5Q A;  4POL A;  3HVS A;  2GT6 A;  3QPM A;  4KF9 A;  2XPD A;  4NMU A;  3TKQ A;  5E59 A;  5KN2 A;  3IPZ A;  2WRT A;  2FWH A;  2HT9 A;  1AQX A;  2H71 A;  2LNS A;  4GRF A;  3FMW A;  3UAP A;  3ZRE A;  5CP1 A;  2ON5 A;  2CX3 A;  1AXD A;  4BVY A;  1SJZ A;  1FVK A;  1TRS A;  1X5D A;  1OYJ A;  3E0U A;  2F8F A;  1CQH A;  2IMI A;  3Q6O A;  4ULX A;  1B4P A;  2O89 A;  3WGD A;  3KMN A;  4K7I A;  1GH2 A;  4GST A;  2DJ2 A;  1ST9 A;  3KP9 A;  1EV9 A;  1Z3E A;  2LUS A;  1QK8 A;  1UA5 A;  1EEM A;  2YN1 A;  2LS5 A;  3J7Y k;  1AW9 A;  3EUR A;  1MTC A;  2JSY A;  1EP7 A;  3P2A A;  2FUG 2;  4L0W A;  1VGL A;  4PNG A;  1X0R A;  2EIR A;  3P7X A;  1ERT A;  1PMT A;  5B8A A;  4OWY A;  1BG5 A;  1A8Y A;  3P90 A;  4X0X A;  1GSE A;  4NXI A;  2GTU A;  4ECB A;  1DE1 A;  5B6M A;  4ZB8 A;  3TB2 A;  2XC2 A;  2CV4 A;  3CRU A;  1X5C A;  5A4W A;  2VM1 A;  2RUE A;  4CHS A;  3LJR A;  3ZLP A;  2H8L A;  2GVP A;  3IHG A;  4CDO A;  3FR6 A;  3N5O A;  4EIQ A;  5ECQ B;  3U6V A;  3G7J A;  4WF5 A;  1XVW A;  2I81 A;  1TK5 B;  4BA7 A;  2N5F A;  2JAD A;  2PVQ A;  5HFK A;  2LQO A;  3TKS C;  2HZE B;  4WR4 A;  2H1A A;  1USB A;  4G10 A;  3VI7 A;  1ABA A;  3TJB A;  4JZQ A;  1PN9 A;  1RK4 A;  4BL7 A;  1PN0 A;  2PVO C;  5G2Z A;  4MP4 A;  3TJG A;  4HZ2 A;  1S3C A;  2LQQ A;  1ZL9 A;  4EDY A;  4PTS A;  4WR5 A;  4ZL9 A;  4WBR D;  3BCI A;  4IN0 A;  4RQX A;  2N5B A;  1GSS A;  5DDL A;  4KDY A;  7GSS A;  2MMA A;  4KUN A;  4L0U A;  2X99 A;  1TU8 A;  4YH2 A;  4Q5Q A;  2YPM A;  2XHF A;  2ALB A;  5EL8 A;  2C3N A;  1F6M C;  4EVM A;  3KGK A;  3EPT A;  2CZ3 A;  2LJR A;  4TXV A;  2KUC A;  3CXG A;  3HA9 A;  4IP6 A;  4KB3 A;  4KGI A;  2I9H A;  2LJK A;  4K6X A;  4Q5N A;  1J9B A;  3LQ7 A;  1WOU A;  3GX8 A;  5G5F A;  5JCG A;  10GS A;  4IS0 A;  1ZYN A;  4PQH A;  3HCZ A;  1FVJ A;  1WE0 A;  4GWR A;  5KOX A;  2ZUP A;  4N10 A;  2I4A A;  2MMN A;  4GXZ A;  5INY A;  3KIJ A;  5DCG A;  4PXO A;  4DSQ A;  4POK A;  1K0M A;  3EC3 A;  4NPB A;  3WGX A;  4MJC A;  2HNL A;  1Z5Y E;  1TKD B;  2H75 A;  2ZNM A;  3MYD A;  3L9S A;  5G31 A;  5KN1 A;  4JR6 A;  5HR1 A;  1TDI A;  5IMD A;  5IPH A;  1O6J A;  3ZYW A;  2WFC A;  1G6Y A;  3PH9 A;  2FGX A;  3L0H A;  2GS3 A;  1ZYE A;  2B3S A;  4OO4 A;  3IDV A;  1RQM A;  1QFN A;  2KOK A;  1X9S B;  1M2A A;  1QGV A;  2IL3 A;  3O3T A;  2L5L A;  1K0O A;  6GSS A;  3MNG A;  4USS A;  1XOB A;  2FA8 A;  2GSQ A;  3KTL A;  2GGT A;  5ENU A;  5GAN D;  2VD0 A;  3IAM 2;  2LNT A;  5B7C A;  1TI3 A;  2TRC P;  3J7Y b;  3CTF A;  2H73 A;  3EWL A;  4YQV A;  1G6W A;  2CVD A;  1YY7 A;  3W8S A;  5J9B A;  4AJ6 A;  1FB6 A;  2EC4 A;  1JZD A;  1K0D A;  1TI1 A;  2H19 A;  4YKF A;  2VCZ A;  2F51 A;  3Q18 A;  1I5G A;  4J57 E;  4HDE A;  2OBI A;  3A5W A;  2LRC A;  2A4V A;  5F07 A;  2IJY A;  2A2R A;  3Q19 A;  3KP8 A;  4G0I A;  5EY6 A;  1U3A A;  5J41 A;  2IMD A;  2VO4 A;  4O32 A;  1OC3 A;  5CRW A;  4IP1 A;  4GQF A;  3VFI A;  3ZVJ D;  1FG4 A;  4G0L A;  3APQ A;  2YCD A;  5HFI A;  3LOR A;  1M2B A;  4LMV A;  1GTB A;  1W89 A;  3N9J A;  3TKR A;  2DJ0 A;  3FW2 A;  4XS4 A;  5IM9 A;  2ON7 A;  14GS A;  1OAZ A;  2PER A;  3TKS A;  2DIZ A;  3ED3 A;  1PX7 A;  3M1G A;  2DJK A;  5J3R A;  4WKW A;  1HYU A;  5H5Q A;  2M46 A;  4LA1 A;  3RBT A;  3V1W A;  3WYW A;  3ME8 A;  1JZW A;  2Z9S A;  2BTO T;  2A4H A;  2H30 A;  4I6X A;  1O81 A;  2X49 A;  1M7T A;  5BRT A;  3MSZ A;  1XZO A;  3QAV A;  6GSW A;  1HQO A;  4D73 B;  1JHB A;  3EMP A;  3C7M A;  5FWG A;  3ZML A;  1XVQ A;  5H5S A;  1O8W A;  3FZ4 A;  4AJ7 A;  1GUL A;  1B8X A;  4Q5R A;  2NTO A;  3IAS 2;  3GST A;  4TR3 A;  4KH7 A;  3GIX A;  4IBP A;  1CQG A;  4KCA A;  1O85 A;  4J2F A;  1FOH A;  1A0R P;  4ECC A;  2DSA A;  3L78 A;  1V57 A;  3TRX A;  2AHE A;  1A2J A;  2VCW A;  1IYH A;  3M8N A;  4TXO B;  2NBS A;  3NIV A;  3O76 A;  1RW1 A;  2HFD A;  1SYR A;  1SKS B;  1K0B A;  2VUP A;  3FY7 A;  4QL9 A;  1THO A;  2VCT A;  3LG6 A;  3HD5 A;  2GSR A;  5D93 A;  2VLV A;  3CSH A;  1G7O A;  5ECS A;  3TJJ A;  1TU7 A;  3L9U A;  1Z6M A;  2WZ9 A;  3GL3 A;  4ID0 A;  4RUV A;  4L5O A;  1U3I A;  4KSM A;  1XWG A;  5GZZ B;  2HSY A;  2JZT A;  4ECJ A;  1I9D A;  1YEP A;  5D9V A;  4HU9 A;  1MDK A;  1MEK A;  1E2Y A;  5J9C A;  2VCX A;  2K6V A;  3BD2 A;  4AF2 A;  2NDO A;  5ECO B;  1LBK A;  3IV4 A;  5COH A;  1TP9 A;  2K8S A;  2F8A A;  2OAC A;  3VUR A;  4PNF A;  4N0Z A;  2O7K A;  3FRC A;  4G2E A;  1URM A;  3DGQ A;  4ZIL A;  5IMA A;  1G0T A;  1F9M A;  1FAA A;  2GST A;  5IO2 A;  2HRF A;  4KX4 A;  5EPF A;  4F03 A;  3DIE A;  1J08 A;  2F3M A;  4K9Z A;  1BX9 A;  2B5Y A;  2GQL A;  3ERW A;  1Q98 A;  2GLR A;  1EEJ A;  19GS A;  3BOA A;  1VRS D;  2IN3 A;  1GTU A;  1XFL A;  3GMF A;  4WET A;  3VPQ A;  4G19 A;  3FZA A;  1ML6 A;  3KMO A;  4KA0 A;  2H76 A;  4ZBB A;  2M80 A;  3LW9 A;  1U87 A;  1W4V A;  4MZC A;  3HVX A;  3QR6 A;  4KDU A;  1T00 A;  4N0V A;  2OBK A;  5CNW A;  4Z7X A;  2H1D A;  5JWR B;  3F4R A;  3A5I A;  2OE3 A;  4EDZ A;  1VF3 A;  2C0F A;  3GH9 A;  5IIZ A;  3IR4 A;  5CRE A;  1QMV A;  4ICY A;  3O6T A;  2V1M A;  3LGC A;  4E8E A;  1K0N A;  3RHC A;  2E2M A;  2RLI A;  1Y25 A;  1T1V A;  4ZBA A;  1ZOF A;  1PKZ A;  3UL3 A;  3KD0 A;  1JLV A;  4OFT A;  5ECP B;  2E0Q A;  4X1U A;  17GS A;  3M3M A;  3DRN A;  3M9J A;  5FT3 A;  3IXR A;  1AIU A;  2LRT A;  1EGR A;  3UIW A;  4MPG A;  4K0N A;  2AAW A;  5DQS A;  5G5E A;  2R37 A;  1LU4 A;  4MJB A;  2HSM A;  1ZGN A;  5GSS A;  3VLN A;  2QA2 A;  1PA3 A;  2PMT A;  1SD8 A;  2IME A;  3LYP A;  22GS A;  1BED A;  3G9B A;  5A5K A;  2G2Q A;  2H0H A;  5IO0 A;  3TKP A;  2P5R A;  1DUG A;  2KLX A;  2AYT A;  4X43 A;  3DVW A;  3DML A;  1BAY A;  5IMV A;  3VWV A;  1V2A A;  1ZMA A;  3APS A;  4MJA A;  4MMM A;  5D9W A;  3A3T A;  1XXU A;  4O5Q A;  1XOA A;  18GS A;  4Q5F A;  6GSU A;  2KP1 A;  2R6K A;  2H66 A;  5G1L A;  1M2D A;  1T4Z A;  5JWQ B;  4IW9 A;  5IMF A;  6GST A;  3UOM A;  3KEB A;  3CTG A;  1VF4 A;  2VM2 A;  4K2X A;  2H1B A;  4JR4 A;  3H79 A;  1M9A A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...