2H0GA

Crystal structure of dsbg t200m mutant
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
229
structure length
229
Chain Sequence
ELPAPVKAIEKQGITIIKTFDAPGGMKGYLGKYQDMGVTIYLTPDGKHAISGYMYNEKGENLSNTLIEKEIYAPAGREMWQRMEQSHWLLDGKKDAPVIVYVFADPFCPYCKQFWQQARPWVDSGKVQLRTLLVGVIKPESPATAAAILASKDPAKTWQQYEASGGKLKLNVPANVSTEQMKVLSDNEKLMDDLGANVMPAIYYMSKENTLQQAVGLPDQKTLNIIMGN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Short-circuiting divergent evolution: laboratory evolution of one disulfide isomerase to resemble another
rcsb
source organism Escherichia coli
molecule tags Isomerase
molecule keywords Thiol:disulfide interchange protein dsbG
total genus 64
structure length 229
sequence length 229
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-05-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13098 Thioredoxin_2 Thioredoxin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.70 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Disulphide bond isomerase, DsbC/G, N-terminal 2h0gA01
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 2h0gA02
4HU7A 3RHCA 4EL1A 2MBTA 2IPAA 3ZFLA 2LV3A 12GSA 2M80A 1XBSA 4WKWA 2GT6A 1NHOA 4E8EA 3G7IA 1GUHA 2LRTA 4HS1A 3UARA 2F3MA 3VWXA 3PINA 4MZWA 3GHAA 1G6YA 1K0AA 1YZXA 2FNOA 2VOCA 2DBCA 2GZZA 5AGYA 2H8LA 2E2MA 4TR4A 1YKAA 3H79A 4PUAA 1F3BA 1A8YA 3PR8A 2QSIA 5E4WA 1H75A 2HI7A 4I6XA 1HQOA 4LA1A 1A2MA 3KXOA 4X43A 3KEBA 2OADA 2D2ZA 3MAKA 1U6TA 2X8HA 2WB9A 2IMEA 3ZL5A 2LQQA 5D9VA 2B1LA 3C7MA 2ES7A 3QCPA 1SKSB 1JLWA 2GTUA 4WEYA 1OAZA 5C04A 4IQAA 2OACA 4E8HA 1QGVA 4ZB8A 4HJMA 1CQGA 4JZQA 2LEGA 1V2AA 2FA8A 1URMA 2RUEA 1UVZA 5F05A 5DQYA 1GP1A 3UVTA 2OKAA 5DCHA 4I2TA 5B8BA 3W8SA 1MDJA 1V98A 2YP6A 2IN3A 3TRQA 3CMIA 2HT9A 1B48A 1ZYEA 1F37A 3IOSA 3F9UA 3QAWA 4KDXA 1DSBA 1X5CA 4FYCA 4O7HA 2H1BA 5IO2A 1Y6EA 3MWHA 1Y25A 1G7OA 4G19A 1ILOA 2I9HA 1JZDA 1DE2A 1GSYA 2B1KA 2GZPA 4PQIA 2DJ2A 3TJBA 3RDWA 3UJ1A 4GTUA 4V1Ap 2GQLA 5IMVA 4DVCA 3PGTA 1EP7A 3VK9A 4K2DA 4ECCA 2DIYA 3IC4A 3A5WA 3WGXA 3DEXA 1LU4A 1AQXA 2ON7A 4EVMA 5KN2A 2C0DA 2C3NA 3A2VA 2PERA 2GQKA 3GKXA 2HYXA 2EIRA 1JZWA 4TRXA 5LCZA 3HCZA 3LWAA 1UC7A 5DQSA 3VFIA 3M0FA 3KCMA 4NHZA 3ME7A 5ECHB 3HXSA 2VLUA 4DSSB 4XRAA 3DWVA 1TJDA 2R3XA 2KLXA 1BG5A 1CQHA 3VWVA 3IR4A 4JE1A 4WF4A 2J9HA 4IJ3A 4NMUA 5ECRB 4L5OA 2MMZA 2GT5A 2HZEA 4WXTA 3UIWA 5L71A 4TW5A 1A24A 2GSRA 2A2RA 1RW1A 2LQOA 3DKSA 2E7PA 4RQRA 3UEMA 2K6VA 2C1YA 3E9JB 2K18A 1XIYA 2LKUA 2PU9C 3HVSA 2PVOC 4TN8A 3ZIJA 3Q18A 4MJEA 3GRXA 2YV9A 1UN2A 4JBBA 1V57A 2YJHA 4I97A 3DXBA 2OBKA 1M2AA 2VIMA 5IMFA 3F63A 4EO3A 2CZ2A 2WS2A 1O81A 5INYA 2O8VB 8GSSA 6GSUA 2FHEA 4OO5A 1X9SB 2C3TA 5JCUA 2VAFA 4IKHA 3HZ8A 4HDEA 2L6CA 2I81A 4J2FA 2LUSA 3P7XA 3ZFBA 2RUFA 4HZ4A 1B9YC 4NXIA 2HRNA 2EC4A 2V41A 1M2DA 4MH2A 3M1GA 4ZILA 2CX4A 1FB6A 3TJGA 1O8WA 4L8EA 4TVEA 1TK5B 1XVQA 3GFKA 1ACVA 3GYKA 4J57E 2DMMA 2WJUA 4GF0A 3PH9A 4JR6A 4NV2A 2ALBA 4O5RA 4GXZA 4FYUA 1R5PA 4OD7A 2R4VA 2OE3A 1U3AA 4MZCA 3ZTLA 3QFAC 4I8BA 2P31A 3ERWA 2H6XA 3Q6OA 2FUG2 3F8UA 3TOTA 6GSXA 5EY6A 3LJRA 5KN0A 1SYXA 5D96A 1JZRA 1BJXA 4PNGA 3KD0A 2GS3A 3HKRA 5HQPA 4ULXA 1YDKA 5DDLA 1HNBA 2TRXA 3UBKA 3L9VA 1GSUA 3TKSE 3A3TA 2IFQA 2G2QA 4PURA 1B4PA 2FWFA 13GSA 4I5QA 2VCVA 5CNWA 4CHSA 2PWJA 1PX6A 3ED3A 5ELGA 3GH9A 4K0GA 4N11A 2LRNA 1TI1A 2IIYA 3FZ9A 4X1UA 4IN0A 3KMNA 4ZBAA 4EE0A 1ZYQB 2YV7A 1ZMAA 2CX3A 5DAKB 4KDUA 2REMA 3CRTA 4MABA 4QL7A 1GTUA 4NAXA 3FR3A 2CT6A 4MP4A 1GTIA 1ML6A 6GSWA 2B7JA 2K8VA 3EINA 5ECSA 3S9FA 1XXUA 5EL8A 4GSSA 3U5RE 4HUAA 3TKPA 2C4JA 4MMMA 3APSA 4HEA2 4PQ1A 3LFLA 1XW5A 5JCGA 2FLSA 4D73B 16GSA 4FH8A 3TJFA 3W6GA 1IYIA 3LYKA 4IGJA 2H0HA 1B4QA 3F6DA 4WR4A 1TKDB 5H5SA 2IJYA 3GIXA 3ZVJA 4IBPA 4AJ7A 2O85A 3L4NA 4KB3A 2H1GA 1GLPA 4TR1B 3TGZA 3FZAA 1TDIA 5DBQA 2VCWA 5H5QA 3F3QA 2R5GA 1WIKA 3CTGA 2WRTA 3G7YA 2YWMA 4N30A 4JU5A 5A4VA 2PMTA 3P90A 1TRWA 4IJIA 3APQA 3FY7A 4BWQA 3GSSA 1WE0A 5DJLA 5CP1A 1J0FA 2MBSA 1Z7PA 4YAPA 1QMVA 4MK3A 3K8NA 3WYWA 1PRXA 3A2WA 1GSDA 2V6KA 2N5FA 1RQMA 4KNDA 3TRPA 4ZL8A 1ZZYA 2KOKA 4WBJA 3GX8A 1H4OA 4FIWA 3WGDA 4AJ6A 5J4UA 1XWGA 4K8MA 2BJXA 2M46A 4GWRA 1XWAA 4EDYA 2E0QA 2HSHA 3FW2A 2LJRA 3VPQA 1SL1B 1K0MA 2X8CA 4DEJA 4HU9A 3O76A 2HE3A 4MCUA 2FD3A 4MDCA 2P0GA 2R2JA 1YKCA 2H01A 2YNXA 3IV4A 1THXA 4GCIA 3NOFA 3R2QA 1AW9A 1TI3A 5HR3A 3FYGA 5IMZA 2XHFA 4LL1B 1U3IA 2DJKA 2H6YA 3GMFA 3V1WA 4EUYA 20GSA 4YQMA 5G2ZA 4LMVA 1SJ6A 4IW9A 3VWWA 1GH2A 5KN1A 3QAVA 3SWLA 2IMFA 4JEDA 2KP1A 1TK8B 4KUNA 4OWYA 3TOUA 3UAPA 2MMNA 1JLVA 1XWKA 4GRFA 4BWSA 4ZXGA 2CVKA 5IMCA 2C0GA 1F6MC 3ZZXA 1A8LA 2H30A 4KA0A 3H1NA 4ECIA 1O85A 5ECNB 3WGEA 3MDKA 5DVBA 4WF5A 1TK0B 3TDGA 3DGQA 1MEKA 5JWQB 4F9ZA 1WRYA 4H86A 1V58A 5D93A 1V40A 1SKRB 1PL1A 3LEFA 1FW1A 2JU5A 3KZQA 2CZ3A 5E59A 5FT3A 3ZREA 9GSSA 1ON4A 4WR5A 1SYRA 2YJ7A 5CREA 2CVBA 2QGVA 5G31A 1M99A 1JZOA 4MLYA 3BJ5A 4ZL9A 1GUMA 1Q98A 1T00A 1ABAA 5J3RA 3EURA 2VCTA 5FWGA 2IYJA 3M9KA 3H4KA 3I69A 1TRSA 3GX0A 2K9FA 3EWLA 1EGRA 3FZ5A 3WD6A 3DVWA 1OC9B 4KAEA 2GQMA 2FWHA 3F0IA 2X8GA 4G2EA 3FKFA 1M2BA 4EDZA 1M9BA 1SL0B 1S3DA 5KEJA 2WULA 4HQSA 4HZ2A 1ERVA 1XOAA 19GSA 2X99A 3M3MA 2NVLA 5F07A 3L0HA 2VL2A 4MZBA 3QOUA 3LSZA 1RK4A 3EVIA 3HHVA 3ZIVA 5IO0A 2H75A 4YQVA 5AISA 4ZL7A 1GSSA 2YOIA 5HFGA 3NIVA 1EOGA 2VD0A 1J08A 2C3QA 1K0CA 2VCQA 4F82A 1MTCA 1EGOA 4MPFA 2F51A 3UBLA 2ZCTA 3GTUB 3GH6A 2VLTA 2H71A 10GSA 1S3AA 1B8XA 2HXKA 3ERGA 4IQ1A 2V6OA 1T4YA 3KP9A 2CV4A 4RQXA 18GSA 3TUEA 2AJQB 1A0FA 4XS6A 2A2SA 5DAKA 4N0VA 5FHIA 1FG4A 1QFNA 2NPBA 2LJKA 2WFCA 4YAVA 1T3BA 2C0FA 3C1RA 1Z9HA 2DJ0A 4CW9A 3P8WA 1OYJA 3IK7A 1Z7RA 3NZNA 1KTEA 5CO3A 4JRRA 3F4RA 3EU4A 2HLSA 1VRSD 4MA9A 2VL2C 1VF3A 5IM9A 4OFTA 4XS1A 2H66A 3HY2A 1Z3EA 2BMXA 2QKEA 4ID0A 5IOXA 4HQZA 1ZOFA 3L78A 3N9JA 1GNEA 2H76A 3RHBA 4K7NA 11GSA 4ILFA 3UOMA 4ECJA 2OBIA 5HFKA 4OCEA 2NDOA 2Z9SA 3C8EA 4BPYA 3UL3A 5AN1A 5CRDA 5D73A 3KH7A 3C1SA 1GNWA 2B5YA 4V2MA 1M9AA 4N10A 1HNAA 1R26A 1WJKA 3ZRDA 3BD2A 4Q5FA 1WPIA 3D4MA 3VI7A 2GDRA 4IP1A 4XIHA 3IDVA 1XWBA 3CSJA 4L5LA 2H74A 1B9XC 3WT2A 2AV4A 2O89A 4KX4A 1OE7A 1FB0A 2FWEA 4K1FA 1TOFA 4MJBA 1MDKA 2DC5A 4KH7A 4CDOA 1GUKA 1K3OA 3GV1A 1X9MB 3TJKA 3KM6A 2OJLA 3FR9A 4XTSA 6GSTA 4GSTA 5A4UA 1X5EA 4EKZA 3IAS2 4HJ2A 2AB6A 4RUVA 5JCWA 2VCXA 3RPNA 1DBYA 5G30A 1SD8A 3DIEA 3KJYA 3HDCA 3RAZA 2L5LA 2HRFA 2DJJA 3IRAA 4GQCA 2YWIA 5ECPB 2V32A 4POBA 2AHEA 2MYGA 4N0ZA 4TR3A 4BVYA 3LYPA 3O6TA 4IP6A 1YY7A 2YWOA 3HA9A 4TXOA 1XOBA 2F9SA 1SK0A 4P3YB 3QAGA 5GAPD 4ML6A 2PGTA 2IMIA 4LMWA 3D6IA 2WDUA 5CYYA 2P5QA 3HJPA 5F0GA 3BCKA 2H0GA 1HD2A 2HZEB 1PN9A 5B7CA 1FOVA 4NPBA 3GA4A 3FRCA 2VUPA 5H5RA 3KTBA 1TP9A 3TJJA 1KEBA 4YQUA 2XBQA 1U88A 4DSSA 1BYEA 4MH3A 1OVNA 5GAND 1OC9A 2JL4A 2B6MA 3M9JA 1AAZA 3FEUA 4V1Ag 4FO5A 4BL7A 3GKNA 3KH9A 1O8XA 1SJIA 2LSTA 3FK8A 4YH2A 4NHWA 2FGXA 4ECBA 4TKYA 3QMXA 2JACA 3D21A 2YZHA 2J23A 1M0UA 2JADA 2IY2A 3W8JA 5IOWA 1BAYA 4Q5NA 3DMLA 5D9WA 1EEMA 4EXJA 1AUCA 2M72A 1F2EA 3E0UA 4OO4A 3APOA 3GN3A 1O73A 2IMDA 5G1LA 2EIQA 1JFUA 2GZYA 1AQVA 2KP2A 2GSSA 4FYBA 4L0UA 2L57A 3TKSA 1PKZA 3HVVA 2B3SA 1LJRA 2HSYA 3IE3A 2H6ZA 2L4QA 4K0NA 4PNFA 2TRCP 2XBIA 2EIOA 1T8EB 1V9WA 1VF1A 5AIXA 2VL9A 4BVXA 5J5NA 1S3CA 3GL3A 5HR2A 3EC3A 5IMAA 3KGKA 3D4TA 2MZCA 1SL2B 4WBRD 5B8AA 1M7TA 3ME8A 5ECIB 5CRHA 2YWNA 4IHUA 1MDIA 1G7EA 5ABRA 3F4SA 4DSQA 1XWCA 2HNLA 3WT1A 22GSA 2E2GA 4RI7A 4MPGA 4OCFA 3Q19A 3C73A 4LLRA 2DLXA 2JZRA 3SBCA 6GSSA 3LORA 1BQ7A 3U6VA 1ERTA 5DALB 1ERWA 2H0IA 3CBUA 1XPVA 4O92A 3KMOA 4POKA 1YJ6A 2YN1A 4KCEA 4ML1A 3GSTA 1TRUA 1PSQA 4TXVA 4G9HA 4I2UA 4ZIJA 4F2IA 1YF0A 2OA7A 4PXOA 4BA7A 3BCIA 2I4AA 1HYUA 5IMDA 1F3AA 1WMJA 4JR4A 2DIZA 1FAAA 3J7Yb 4K7OA 1AC1A 2P5RA 2IFQB 2XPEA 5CRWA 4OFMA 3TRXA 4PQHA 2N5BA 2CA8A 1DUGA 1PQNA 1K3YA 1DE1A 2B5EA 1W4VA 4MF6A 4EC0A 1O6JA 3QR6A 5COHA 3ZYWA 1ZL9A 1QQ2A 1AXDA 3O3TA 2LJAA 5GZZB 2GLRA 3G7JA 4IVFA 1WP0A 3FHKA 1X0RA 3IK9A 1GULA 2L5OA 4G10A 5IPGA 3HYPA 3LQ7A 3CSHA 1WOUA 1EV4A 4ZBBA 3FR6A 5EVOA 3L9UA 2OE0A 3MNGA 5J9BA 2B7KA 1XVWA 2G0FA 3DVXA 3LXTA 5J41A 3ISOA 2F8FA 2VL3A 1EWXA 2N5AA 5LD0A 2R37A 1YEXA 4IS0A 2PVQA 2FA4A 3VLNA 1USBA 3Q74A 2V1MA 1X9WB 3DYRA 5CAXA 3LXZA 4MJCA 2WCIA 2I3YA 3GNJA 1SENA 1PMTA 2H73A 4NWYA 1THOA 1Q4JA 1AIUA 2AYTA 5C00A 1YF1A 2C80A 4Q5RA 1GL8A 4ZB6A 3J7Yk 1A0RP 3CRUA 3IBHA 3VPTA 5J9CA 2DJ3A 3IPZA 3D0ZA 3N5OA 2I1UA 4NV5A 2IL3A 2L6DA 1PL2A 1R4WA 3QDNA 1IYHA 1N2AA 1E2YA 5JWRB 4HOJA 3G9BA 1TRVA 3ZVJD 1NSWA 3I43A 3OR5A 4QL9A 3LG6A 1T1VA 3HJMA 1TXXA 1C72A 2R6KA 1MD4A 1BEDA 2L4CA 1A2JA 1K0OA 2H72A 1XCCA 4K6XA 2H19A 1OKTA 2PPTA 5GSSA 4KSMA 1I9DA 1PKWA 1XW9A 2GSQA 5D9XA 1BX9A 1TW9A 4GSNA 2KUCA 2X64A 1VF2A 4KCAA 5IPHA 3F4TA 1R5AA 2DJ1A 1EZKA 3CYNA 4TR1A 4KDYA 2O87A 1O7UA 5DCGA 1SK1A 3BBYA 3KIJA 3TCOA 2NBSA 3IA1A 1QK8A 2V2GA 4HI7A 4MF7A 1J9BA 3I9V2 2PUKC 4OMVA 3I6AA 1Z6NA 1SK2A 1R7HA 5AIVA 5G5FA 1PD21 2AUVA 4PX1A 1LBKA 4MJAA 3ZLPA 3GKMA 6GSVA 4K9ZA 4OFNA 5GSTA 2DMLA 2H1AA 4QQ7A 3VWUA 2C0EA 3KTLA 5IIZA 1SD9A 2FWGA 4GLTA 5D8IA 1OKDA 2A4VA 5DJMA 5ECLB 5D9TA 4TR0A 1TTZA 2H1DA 4Q5QA 1I5GA 1Z5YE 4L0WA 2YANA 3EMPA 2HZFA 6GSYA 4XCSA 5KN3A 1ERUA 4TOPA 1VF4A 4PGTA 2PN8A 4POLA 5ID2B 2DSAA 5G1KA 1YQ1A 3UVHA 4AGSA 1TU8A 1NW2A 4V2NA 4KE3A 3IXRA 2XC2A 3ZITA 1K0DA 3TB2A 3TKRA 2LTKA 5A4WA 2K8SA 1KBNA 1GTBA 3EYTA 1VGLA 1ZGNA 3F3RA 1ZCPA 1GSFA 2GVPA 2OE1A 3HJOA 3US3A 4F03A 4TXOB 2MMOA 1E6BA 1EV9A 3IHQA 1GSQA 4KW6A 2WGRA 5G5EA 4ISDA 2VCZA 1PGTA 2LRCA 2MMAA 3AY8A 1GRXA 4KGIA 2CQ9A 2LNSA 2CVDA 3CXGA 2HFDA 4F0BA 1OC3A 3H8QA 1EP8A 2FY6A 2JSYA 3MSZA 1SU9A 4K7IA 4J56E 2JZTA 1XZOA 2TIRA 1KNGA 4LL4B 1K0NA 3RPPA 3EMXA 3M8NA 3GUSA 3ZMLA 4KSOA 4ZB9A 2GGTA 4AJ8A 3EE2A 3UMAA 4PUFC 2YZUA 2KHPA 2QC7A 3CTFA 7GSSA 4ZBDA 1SJZA 1NM3A 1TU7A 3TKSC 2F8AA 1PA3A 1FVJA 3BOAA 1FO5A 5HFIA 3GL5A 2GSTA 4RI6A 4XHMA 3HVXA 2PBJA 4O32A 2ON5A 1FHEA 5HR0A 2ZUPA 3F6FA 5A5KA 1YEPA 3QD9A 4XS4A 2VLVA 1QXHA 2O7KA 3QPMA 5LNKe 5ID2A 1QUWA 3D5JA 2RM5A 1HNCA 3IAM2 2ZNMA 3GURA 5F8BA 1AQWA 2VD1A 2IWTA 3P2AA 5CRGA 3DD3A 1OC8A 3FZ4A 2YPMA 2LS5A 2WZ9A 3LGCA 1FVKA 1X5DA 3ERFA 4POMA 5EPFA 3E3EA 1XFLA 1W89A 2LNTA 5ECQB 3VURA 2JSZA 1UA5A 5B6MA 2B5XA 3C71A 5ENUA 3TKQA 5ECMB 5B6NA 3JCML 17GSA 2BTOT 3H93A 4XRDA 3CSIA 4ACSA 1GSEA 3GTUA 3RBTA 14GSA 2AAWA 1N8JA 1PX7A 1A2LA 2VO4A 1G6WA 4GQFA 1WWJA 1GLQA 1MD3A 3D22A 4X0XA 4F0CA 5IQYA 1GTAA 4Z7XA 3KP8A 4V2LA 1T7PB 2CAIA 4DSRA 1SKWB 3EU3A 5ECOB 3QFBC 4D73A 2FCHA 1F9MA 1K0BA 3HD5A 2RIIA 3L9SA 3HZ4A 4AF2A 5DALA 3VI5A 2VM2A 5ELAA 2YCDA 1OE8A 5JWOB 3ZMKA 3DRNA 5ECKB 1EEJA 4WETA 2RLIA 1K3LA 1T4ZA 4IELA 3GKKA 5F06A 1EOHA 1GWCA 1Z6MA 2RM6A 1G0TA 1NHYA 2H70A 2VM1A 2IMKA 2NTOA 1U87A 4XS4B 1ST9A 3A2XA 2CAQA 1XW6A 1A23A 2XPDA 2L59A 2JZSA 4MF5A 2C8UA 5HR1A 4EF0A 1JHBA
chains in the Genus database with same CATH superfamily
4G0LA 3BLZA 4HU7A 3RHCA 4EL1A 2MBTA 2IPAA 3ZFLA 2LV3A 12GSA 2M80A 1XBSA 4IPBA 4WKWA 1NO3A 2GT6A 1NHOA 1O7NB 3X3ZA 4E8EA 3G7IA 4MEIA 1GUHA 6STDA 2LRTA 3OWYA 2P09A 4HS1A 3UARA 1BU4A 2F3MA 3DMCA 3VWXA 3PINA 4MZWA 4MJDA 3GHAA 1G6YA 1K0AA 1YZXA 2FNOA 1FGTA 1OF5A 2GBWB 3CNXA 4K1VA 2VOCA 2DBCA 2GZZA 5AGYA 5TGNA 3V99A 1N5HA 1GOVA 2H8LA 2E2MA 4TR4A 1YKAA 3H79A 4R80A 3MYDA 4KF9A 1VQ63 4PUAA 1F3BA 1A8YA 1XG8A 4KFFA 1D6YA 1SPUA 3PR8A 3GZBA 2QSIA 5EEOA 5E4WA 2XGNA 1H75A 2HI7A 4I6XA 1HQOA 4LA1A 1A2MA 3KXOA 2RSXA 4X43A 1EG9B 3KEBA 3FF2A 3KSED 1R4CA 1Q7Y4 2D2ZA 1U6TA 2OADA 3MAKA 1VZZA 2WB9A 2X8HA 2IMEA 3ZL5A 2LQQA 1W6GA 5D9VA 5BVBA 5JPUA 2XSOB 2B1LA 3C7MA 1GMPA 1TTOA 3J7Yd 3ZG5A 3UB1A 2ES7A 3QCPA 3N8BA 1SKSB 1JLWA 2GTUA 2K3DA 4WEYA 1OAZA 5C04A 4IQAA 2OACA 3NQZA 7GSPA 4E8HA 1UUGB 1QGVA 1BSEA 4ZB8A 3A5EA 1A90A 4HJMA 1CQGA 3CCL3 2LEGA 4JZQA 1V2AA 2FA8A 3LH4A 1URMA 2RUEA 1UVZA 5F05A 5DQYA 2GSPA 4USSA 1OCVA 1GP1A 1QAFA 3BNEA 3UL5A 2A15A 5BRTA 3BNBA 5CLKA 3UVTA 1GYBA 5D83A 2OKAA 4R9LA 1NDOB 5DCHA 4I2TA 5B8BA 3MKIA 3W8SA 1WMOA 1W2ZA 3OXAA 1MDJA 1JB2A 1V98A 2YP6A 2IN3A 3TRQA 3CMIA 2HT9A 1B48A 3K9MC 1F37A 1ZYEA 3F9UA 3IOSA 3QAWA 4KDXA 3MHEA 1DSBA 1X5CA 2ML5A 4FYCA 1RLSA 4O7HA 2H1BA 4HM5B 5IO2A 2HMKB 1Y6EA 2V1LA 1S723 1B2XA 2W56A 3MWHA 1Y25A 1B27A 1JV2B 4GB5A 2RNTA 2WO0A 1G7OA 1B2SA 4NREA 5ELJA 5AYSC 4FR9A 1K9M4 4G19A 1UGIA 2I9HA 1PU4A 5KOWA 1ILOA 1JZDA 3EX9A 3CCU3 1DE2A 1GSYA 2B1KA 2GZPA 3Q90A 2DJ2A 4PQIA 2CC3A 3TJBA 3RDWA 3UJ1A 2E2VA 3FLJA 4GTUA 4V1Ap 2GQLA 5IMVA 3VSYA 3GAXA 4DVCA 1JN5A 3PGTA 1EP7A 4BIRA 3VK9A 4K2DA 4ECCA 1ULJB 2DIYA 3IC4A 3A5WA 3WGXA 1BRHA 2STDA 3DEXA 1LU4A 1AQXA 2ON7A 4EVMA 5KN2A 2C0DA 2HMOB 2C3NA 5JBSA 3VF1A 3A2VA 2SBLA 3KE7A 2OCTA 2PERA 2GQKA 3GKXA 2HYXA 1YNVX 2K54A 1W01A 2OTL3 1N9JA 1YHQ3 2EIRA 4Z2UA 1JZWA 4TRXA 2Z6BA 5LCZA 2AAEA 4O5QA 4O02B 3HCZA 3LWAA 5AIGA 1UC7A 5DQSA 3VFIA 1T2IA 3M0FA 3KCMA 1ASKA 1BSCA 3EE1A 4NHZA 3ME7A 5ECHB 3HXSA 2OTJ3 2VLUA 4DSSB 4XRAA 3DWVA 1TJDA 2R3XA 2KLXA 1BG5A 1CQHA 1SJWA 2ZDJA 3VWVA 3IR4A 2KRTA 4JE1A 4WF4A 4EW5A 1DMQA 2J9HA 4X2OA 4IJ3A 4NMUA 4L5OA 5ECRB 2MMZA 4X4JA 2GT5A 3DGMA 1UCKA 2YFJB 2HZEA 4WXTA 3UIWA 5L71A 4TW5A 1A24A 2GSRA 1Q9EA 2A2RA 5FW5A 2X4AA 1RW1A 3V92A 2W9QA 2LQOA 3DKSA 2E7PA 2X49A 3IHGA 1KSIA 4R9KA 1SIIA 4RQRA 3UEMA 2K6VA 2C1YA 3E9JB 2K18A 1XIYA 2LKUA 2PU9C 3HVSA 3LMLA 5AI1A 2PVOC 4TN8A 3ZIJA 4RNTA 3LYGA 3Q18A 4MJEA 3GRXA 2YV9A 3SYUA 1UN2A 4JBBA 5GSPA 3S5CA 1V57A 3FSDA 2RGQA 2BMQB 1VQP3 4JF8A 4OUQA 2YJHA 3AMOA 4I97A 3DXBA 2AADA 1M2AA 2OBKA 3GZYB 2ML6A 2VIMA 5IMFA 4MMXB 9RNTA 3F63A 4EO3A 3GSPA 2CZ2A 2JDIH 2WS2A 4CY8A 1O81A 5INYA 2O8VB 3ZG0A 2P38A 6GSUA 8GSSA 2FHEA 4N6LA 4OO5A 1N8QA 1X9SB 2C3TA 5JCUA 2KCDA 4OK0A 2VAFA 3X3XA 2MF7A 4MMZB 4IKHA 5RNTA 3HZ8A 4BVXB 1A67A 4HDEA 1OUNA 2L6CA 2I81A 4J2FA 3S29A 3K5TA 2Z77A 2LUSA 4J5GA 2CFKA 3I0YA 1BNEA 1UDII 3P7XA 3Q2PA 3ZFBA 1CEWI 2RUFA 1M9GA 4HZ4A 1B9YC 1ISKA 5AEUB 2F5MA 4NXIA 2HRNA 1WMPA 4CY6A 2XSHB 7RNTA 3X40A 2EC4A 2V41A 1M2DA 4MH2A 1UCJA 3WDGB 3M1GA 1A2KA 4ZILA 2CX4A 1FB6A 1O8WA 4L8EA 4TVEA 5HGRA 3TJGA 1TK5B 1XVQA 4EIQA 3GFKA 1ACVA 4BTYA 3GYKA 4J57E 3H3HA 3UL6A 5IF6A 2DMMA 2WJUA 4GF0A 3PH9A 4JR6A 4NV2A 2ALBA 4O5RA 4GXZA 4FYUA 1R5PA 6GSPA 3PYJA 3GRDA 4J9AA 4OD7A 4HM8B 2R4VA 2OE3A 1LXEA 1U3AA 4MZCA 3ZTLA 4FMDA 1IU7A 3L0RA 3QFAC 2P31A 4I8BA 3ERWA 2H6XA 3Q6OA 2FUG2 3F8UA 3TOTA 4N6TA 1C54A 6GSXA 1U8CB 5EY6A 2XR8B 3LJRA 5KN0A 4XBTA 1SYXA 5D96A 2Z7AA 1JZRA 1BJXA 4PNGA 1IV9A 2UGIA 1IVUA 3KD0A 2GS3A 3N9HA 3HKRA 5HQPA 4ULXA 1GSPA 1YDKA 5DDLA 1TP6A 1HNBA 2TRXA 3L9VA 3SOYA 3UBKA 1GSUA 1RSNA 3TKSE 3A3TA 2IFQA 2G2QA 4PURA 1DVDA 1B4PA 2FWFA 2F86B 13GSA 4I5QA 3DXOA 2VCVA 5CNWA 4CHSA 2PWJA 4EYCA 2L1SA 4RNYA 1PX6A 1KQS2 3ED3A 3PPUA 1W4NA 3RGAA 1Q824 1YIJ3 5ELGA 3GH9A 4K0GA 4N11A 1LOWA 2GU3A 3I563 2LRNA 1TI1A 2IIYA 3FZ9A 1NB5I 4X1UA 4IN0A 3KMNA 4ZBAA 4EE0A 1ZYQB 2YV7A 1ZMAA 5STDA 2CX3A 5DAKB 4KDUA 2REMA 5EQLA 3CRTA 2W9PA 4MABA 2HMLB 4QL7A 5LC6A 1GTUA 4Z2TA 3FR3A 4NAXA 2R0CA 3NV0A 2CT6A 1WNHA 4MP4A 1GTIA 1ML6A 6GSWA 2B7JA 4BTWA 2K8VA 2R41A 3LTBA 3EINA 4FMBA 5ECSA 3S9FA 1XXUA 5EL8A 4GSSA 3U5RE 4J5KA 3EB8A 4HUAA 3EPTA 3TKPA 2FNQA 3S67A 2C4JA 4MMMA 3APSA 4HEA2 4PQ1A 4L8PA 3LFLA 1JRQA 1XW5A 1CH0A 5JCGA 1BSAA 2FLSA 3G8ZA 4K5RA 4D73B 1GD3A 16GSA 5AEWB 4WHAA 2PNCA 4FH8A 3TJFA 3W6GA 1IYIA 5CK6A 3LYKA 4IGJA 2H0HA 1B4QA 5M19A 3F6DA 1ROVA 4WR4A 1IQXA 1TKDB 5H5SA 2IJYA 3GIXA 3ZVJA 4IBPA 2KXGA 4AJ7A 2O85A 1GD4A 3L4NA 4KB3A 2H1GA 3KZTA 1GLPA 4TR1B 3G713 3TGZA 3FZAA 1KD14 1TDIA 5DBQA 2VCWA 5H5QA 3F3QA 2R5GA 1WTHA 3EN8A 1WIKA 3CTGA 2WRTA 3G7YA 2YWMA 4HM7B 4N30A 1BNFA 3CCE3 4JU5A 5A4VA 2PMTA 3P90A 1TRWA 4IJIA 3APQA 3FY7A 3PS8A 4BWQA 3CXC2 3GSSA 1WE0A 5DJLA 3MWZA 4HM2B 5CP1A 3HX8A 1G96A 4N6OB 3CCR3 1AR0A 4OVMA 1J0FA 1JB5A 3EJVA 2MBSA 1Z7PA 4YAPA 3DGOA 1I70A 5IG3A 3FZWA 1QMVA 4MK3A 3K8NA 4KVHA 2W04A 1PFOA 3WYWA 1PRXA 3SLUA 4QWTA 3A2WA 2WOFA 1UI8A 1GSDA 2KAAA 2V6KA 2N5FA 1RQMA 4KNDA 3TRPA 4ZL8A 1ZZYA 4PTSA 1X1YA 3NM2A 2WGOA 2KOKA 4WBJA 3GX8A 2A2PA 1H4OA 3LT8A 4FMAA 1MGWA 1PFPA 4FIWA 5AYRB 3WGDA 4AJ6A 5IEPA 2Z76A 5J4UA 2OQEA 1B20A 2HRKA 4HSCX 1XWGA 4K8MA 2BJXA 2M46A 4GWRA 1XWAA 3CD63 2E0QA 4EDYA 2HSHA 3FW2A 2LJRA 3VPQA 1SL1B 4G1MB 1K0MA 1I2EA 2OOVA 2X8CA 4DEJA 1T2HA 2ZA4A 4HU9A 1EUIC 1Q7HA 3EHCA 3O76A 2HE3A 4MCUA 2FD3A 4MDCA 2KF5A 1LQMB 2P0GA 2R2JA 3IMAB 1JBSA 1YKCA 4RNZA 2H01A 2YNXA 1BSBA 3IV4A 1THXA 3LTDA 4GCIA 3NOFA 1HYFA 3R2QA 3FH1A 1AW9A 1TI3A 1L5GB 5HR3A 3FYGA 1E97A 5IMZA 2XHFA 4BL2A 4LL1B 1U3IA 2DJKA 2H6YA 3GMFA 3V1WA 4EUYA 20GSA 4YQMA 4X2HA 5G2ZA 4LMVA 2W03A 1SJ6A 4IW9A 1YVBI 1GH2A 2QA1A 2E2UA 3QAVA 5KN1A 3VWWA 3SWLA 1IV7A 1BRGA 2IMFA 4JEDA 2KP1A 1TK8B 1B2UA 2IMJA 3U1WA 4KUNA 4OWYA 1SIHA 3TOUA 3UAPA 3T0UA 4LZIA 2MMNA 1JLVA 3LTAA 3KSPA 1OHOA 3CC23 1XWKA 4GRFA 4BWSA 4ZXGA 1W7CA 2CG1A 2CVKA 1NNVA 1ZYPA 1AVLA 3B4OA 3B4PA 3CC43 5IMCA 2C0GA 1NJI4 1F6MC 3ZZXA 1A8LA 1YGEA 2H30A 4KA0A 2XF3A 3H1NA 4ECIA 1O85A 5ECNB 3WGEA 3G16A 3N54B 3MDKA 1PN0A 5DVBA 4WF5A 1TK0B 3TDGA 2P0XA 1VQ83 1S5AA 4N6MA 3MG1A 3DGQA 1MEKA 5JWQB 5M18A 4F9ZA 1WRYA 3NX0A 2OOVC 5AIHA 2XFSA 4H86A 1V58A 5IERA 2QIYA 1V40A 5D93A 1SKRB 1PL1A 3FGYA 2F99A 3LEFA 1OGZA 1GOYA 1FW1A 1GMRA 2JU5A 3KZQA 2CZ3A 2CKFB 1X1UA 5E59A 5CXOA 5FT3A 3PCSA 3ZREA 3RNTA 1R4YA 9GSSA 1ON4A 4WR5A 1LOYA 1SYRA 1CQSA 4LMIA 1JBTA 2YJ7A 5CREA 2I9WA 1S3RA 2CVBA 2QGVA 3LZAA 5G31A 1I2GA 1B2MA 1M99A 1JZOA 4MLYA 1JN5B 3BJ5A 4ZL9A 1GUMA 1Q98A 1T00A 1ABAA 5J3RA 2KF4A 3EURA 2VCTA 5FWGA 2IYJA 3M9KA 3H4KA 5EVHA 3I69A 1GY7A 4HBRA 1TRSA 3GX0A 2K9FA 3EWLA 1EGRA 3NXJA 3FZ5A 2IA7A 3WD6A 3DGYA 3DVWA 1OC9B 3HZPA 4YKGA 4KAEA 2GQMA 3FG4A 3OWUA 2FWHA 1Q40B 1IQ8A 3AGOA 3F0IA 2X8GA 4G2EA 1OF5B 1AQZA 3BIRA 3MIXA 3FKFA 1M2BA 4EDZA 4BTXA 1IVVA 1M9BA 1SL0B 1S3DA 5KEJA 4BIKA 2WULA 4HM4B 4HQSA 4HZ2A 1ERVA 1XOAA 1FA3A 4HM0B 19GSA 2X99A 2NVLA 3M3MA 5F07A 1DETA 3L0HA 2VL2A 1SARA 4MZBA 4H61A 5G2GA 3QOUA 3LSZA 1RK4A 3Q1CA 4L7KA 3EVIA 3HHVA 3ZIVA 5IO0A 2H75A 4YQVA 5AISA 4ZL7A 1GSSA 5IEOA 2RBIA 1VQ43 2YOIA 5HFGA 4J8TA 3NIVA 1EOGA 2VD0A 2QGUA 2GEYA 4FQUA 4WFOA 1J08A 2C3QA 2CFDA 3EQQB 1K0CA 2VCQA 4F82A 1MTCA 1EGOA 4MPFA 3WOFB 2F51A 2GXFA 2ZCTA 3GTUB 3UBLA 3GH6A 1I2FA 3KN4A 2VLTA 3SXXA 2H71A 1MWTA 10GSA 1S3AA 1B8XA 2HXKA 1PY3A 3D79A 7STDA 3ERGA 4IQ1A 2V6OA 1T4YA 3KP9A 2CV4A 4RQXA 18GSA 3TUEA 2AJQB 1A0FA 4XS6A 2A2SA 1Q42A 1FW7A 5DAKA 4N0VA 5FHIA 3NBRA 3HIIA 4AKYA 1FG4A 1QFNA 2NPBA 3JUNA 1VQK3 2LJKA 3NHXA 2WFCA 1TUHA 5IW9A 4YAVA 1RDSA 1T3BA 2C0FA 3C1RA 1Z9HA 2DJ0A 4CW9A 1VQ93 3P8WA 1N5PA 1OYJA 3IK7A 1Z7RA 3NZNA 1KTEA 5CO3A 3G4S3 3MSOA 4JRRA 2P0MA 3F4RA 3EU4A 2HLSA 1VRSD 1V74A 2BHMA 4MA9A 2VL2C 1VF3A 5IM9A 4OFTA 4XS1A 4GSPA 4AKZA 2H66A 3HY2A 4IIAA 1Z3EA 2BMXA 3MPHA 2QKEA 1K28A 4ID0A 5IOXA 3HVNA 4HQZA 3S27A 1ZOFA 3L78A 3N9JA 2GU1A 1GNEA 2H76A 3RHBA 4K7NA 2HOHA 5IENA 1BUJA 11GSA 4ILFA 3UOMA 3F8XA 2HMMB 4ECJA 4O8SA 4K61A 2OBIA 5HFKA 4OCEA 2NDOA 1KWIA 2Z9SA 1DVCA 1FUWA 3WA2X 1LOXA 1ZX2A 2UUGC 3C8EA 1BIRA 4BPYA 3UL3A 3LTCA 5CRDA 5D73A 5AN1A 1MNLA 3KH7A 3C1SA 1GNWA 2B5YA 1IK3A 1M3IA 3FCSB 1DE3A 5ELUA 1TRPA 2C10A 4V2MA 1M9AA 4N10A 1GMQA 1HNAA 1WMNA 4CPKA 1R26A 1US1A 1WJKA 3ZRDA 3BD2A 4Q5FA 1B3SA 1YGWA 2B24B 5KP1A 1WPIA 4HM3B 3D4MA 3VI7A 2GDRA 4IP1A 3CCS3 4XIHA 1BRIA 3IDVA 1XWBA 3CSJA 4LEHA 4L5LA 1D6ZA 2H74A 2DKIA 1B9XC 3WT2A 2AV4A 1QAKA 1IT8A 2O89A 4KX4A 1OE7A 4EXRA 1FB0A 2FWEA 4K1FA 1JB4A 1TOFA 3WODG 4MJBA 1MDKA 2SARA 3GZRA 2DC5A 4KH7A 4CDOA 1GUKA 1K3OA 3GV1A 2W0QA 1X9MB 2OWPA 3TJKA 3KM6A 2OJLA 3FR9A 4XTSA 6GSTA 1T5YA 4GSTA 5A4UA 1X5EA 4EKZA 4PEJA 3IAS2 4HJ2A 2AB6A 4RUVA 3LOYA 2KF3A 5JCWA 2VCXA 4RBNA 1LNIA 3RPNA 3F40A 1DBYA 3BB9A 4EC6A 1W6YA 1M3JA 1RJOA 5G30A 4XB5A 1SD8A 3DIEA 3KJYA 5KP4A 3HDCA 3RAZA 3K7CA 2L5LA 1TU5A 2HRFA 2CFGA 2DJJA 3IRAA 4GQCA 2YWIA 5ECPB 2V32A 4POBA 4LSOA 2AHEA 2MYGA 4EIPA 2IUJA 1VQO3 4N0ZA 4TR3A 4BVYA 1BRNL 3LYPA 3O6TA 5HOHA 4IP6A 4TX4A 1YY7A 1UUWB 3CNMA 3AMOB 2YWOA 1C7HA 3HA9A 1RGLA 4TXOA 1XOBA 1A2PA 1SK0A 2F9SA 3QAGA 4P3YB 5GAPD 4HM1B 1VQ73 1UI7A 1RMSA 4ML6A 2PGTA 2IMIA 4LMWA 2YFIB 3D6IA 2WDUA 4K5SA 1W6CA 5CYYA 3KFQC 2P5QA 1IVWA 3HJPA 3NUVA 4KFEA 5F0GA 3BCKA 2H0GA 1HD2A 2HZEB 3OW22 5IG5A 3PGBA 1PN9A 8CHOA 5B7CA 1FOVA 1LVNA 3QRDA 4NPBA 1K734 3GA4A 3FRCA 3WMDA 2VUPA 3WA3A 3JUQA 3FG1A 1D6UA 1VQL3 1E3RA 1BNIA 2M7OA 1IT7A 3T8UA 5H5RA 1K41A 1STFI 3KTBA 1TP9A 3TJJA 1LOVA 1FUSA 1KEBA 4YQUA 2D42A 2XBQA 1U88A 4DSSA 4O3VA 1BYEA 4MH3A 3ALAA 1OVNA 5GAND 8RNTA 1OC9A 2JL4A 2B6MA 3M9JA 2XGLA 1AAZA 1ZGXA 1O7GB 3FEUA 1QMAA 3ZFZA 4V1Ag 4FO5A 4BL7A 3CQFA 1X1WA 3GKNA 3KH9A 1O8XA 1SJIA 2LSTA 3FK8A 4YH2A 1Q40A 2L4VA 3D5IA 2C11A 3D3LA 4NHWA 1I0XA 2FGXA 4ECBA 3HOHA 4DKIA 4TKYA 3QMXA 2JACA 3D21A 2J23A 2YZHA 1M0UA 1GY5A 2JADA 2IY2A 4O2HA 3W8JA 1M904 2JQ5A 5IOWA 3A5IA 1BNJA 1BAYA 3DMLA 4Q5NA 4YKFA 5D9WA 1EEMA 4XBYA 4HJLB 4EXJA 1AUCA 2M72A 1F2EA 1RHLA 1N8R4 3EC9A 1Y4KA 3EBTA 4EBGA 1RGAA 3E0UA 4EV2A 4OO4A 3APOA 3GN3A 1BAOA 5DRVA 1O73A 3EN1B 2IMDA 5G1LA 2EIQA 1JFUA 1BANA 2J8XB 3PCRA 2GZYA 1Q864 1AQVA 4L8OA 2KP2A 1PYLA 2GSSA 4FYBA 4L0UA 2L57A 3TKSA 1PKZA 3HVVA 2B3SA 2CFLA 1LJRA 2HSYA 3MG3A 3IE3A 2H6ZA 4HOHA 4FCZA 1G02A 2L4QA 3KIIA 4K0NA 4PNFA 2TRCP 2XBIA 1BUQA 2HRAA 3FG3A 2EIOA 1T8EB 1V9WA 1VF1A 3M8CA 5JPPA 5AIXA 2VL9A 4BVXA 1FOHA 5J5NA 1S3CA 3GL3A 5HR2A 3EC3A 3JUOA 5IMAA 3KGKA 3F9SA 4XM4A 1RCLA 1BRSA 3D4TA 2MZCA 1W2B2 3K0ZA 4K1UA 1SL2B 1JKGB 1BNGA 4WBRD 1OHSA 5B8AA 1RTUA 1W00A 1KC84 1M7TA 2CWVA 3ME8A 3LT9A 1RNTA 5ECIB 5CRHA 4WWUC 2YWNA 4IHUA 4N6UA 1MDIA 1G7EA 5ABRA 3F4SA 4DSQA 1XWCA 2HNLA 2KF6A 1Q814 2R0PA 3WT1A 22GSA 1MWSA 2E2GA 4RI7A 2CW9A 3DH2A 4MPGA 4OCFA 3Q19A 5FGOA 4HZ9B 3C73A 4LLRA 2DLXA 2JZRA 4ORLA 3SBCA 1IYYA 4A5PA 6GSSA 3BNDA 3LORA 3ER7A 1BQ7A 3U6VA 1ERTA 5DALB 1FYSA 1O7MB 1ERWA 2H0IA 3NM7A 3NQYA 3S28A 4GHOA 3CBUA 2HMJB 3RDEA 1NB3I 1XPVA 1TRQA 2QEX3 2YFLB 1BRJA 4O92A 1RN1A 3KMOA 4POKA 1YJ6A 2YN1A 1VQQA 1BOXA 4KCEA 4ML1A 3GSTA 1UUVB 1TRUA 2FGTA 1PSQA 4TXVA 4G9HA 4I2UA 3PZWA 4ZIJA 4MNNA 1NWWA 2CHCA 4F2IA 1YF0A 2OA7A 4PXOA 4BA7A 1O7PB 2I4AA 3BCIA 1HYUA 5IMDA 1F3AA 3Q3FA 1WMJA 4JR4A 2DIZA 3DY5A 1FAAA 3J7Yb 4K7OA 1AC1A 4I4KA 2P5RA 2IFQB 5CF2A 4CCVA 2XPEA 5CRWA 4OFMA 3TRXA 4XDWA 4PQHA 2N5BA 2CA8A 1DUGA 1PQNA 2O3OA 1BNRA 4WYKA 1K3YA 1RGFA 1DE1A 1IQYA 2QA43 2B5EA 1GOUA 1W4VA 4MF6A 3R3EA 4EC0A 3IPTA 1O6JA 3QR6A 5COHA 3ZYWA 4BL7B 3F14A 1DYUA 5DREA 1ZL9A 1QQ2A 3CU3A 1AXDA 1AV4A 3DGNA 4JRFA 2LJAA 1BNSA 3O3TA 5GZZB 2GLRA 3G7JA 4IVFA 1WP0A 4U13A 2CWUA 1X0RA 3FHKA 3IK9A 1GULA 4STDA 2L5OA 2B1XB 4G10A 5IPGA 3HYPA 3LQ7A 3CSHA 2BMOB 1WOUA 4H3UA 1EV4A 4ZBBA 4GL6A 1JJ22 1YJN3 3FR6A 5EVOA 3L9UA 2OE0A 3MNGA 5J9BA 3LW9A 2B7KA 1XVWA 2G0FA 3DVXA 3LXTA 5J41A 3ISOA 5D81A 2F8FA 2CX0A 3X42A 2VL3A 3D5GA 5KOXA 1EWXA 2N5AA 5LD0A 2R37A 1YEXA 4IS0A 2PVQA 2FA4A 1STDA 3H51A 3VLNA 1USBA 3Q74A 1LQGC 2V1MA 1X9WB 3X3YA 3GWRA 1I3FA 3DYRA 5CAXA 3LXZA 4MJCA 2WCIA 2I3YA 4R4KA 3GNJA 1SENA 5I97A 1IVXA 5KP3A 1PMTA 2H73A 4NWYA 1THOA 3UJMA 1Q4JA 1HU9A 4FCJA 1AIUA 2AYTA 5C00A 3I553 1YF1A 2C80A 4Q5RA 1GL8A 2QA2A 4ZB6A 3J7Yk 1O7WB 1A0RP 3CRUA 3IBHA 3VPTA 5J9CA 2DJ3A 3IPZA 3D0ZA 3N5OA 2I1UA 4NV5A 1IDPA 2PZVA 3F7SA 2IL3A 2F5WA 2XEPA 2L6DA 3WR2A 5A0OB 1PL2A 1R4WA 3QDNA 1IYHA 1FGMA 1RNBA 1N2AA 1E2YA 5JWRB 3DGLA 1ZO2A 4HOJA 3G9BA 3CMA3 1TRVA 3ZVJD 1MGRA 1NSWA 3I43A 3OR5A 4QL9A 1YI23 3LG6A 1RCKA 1T1VA 3HJMA 1TXXA 1C72A 2R6KA 2F98A 3F8HA 1MD4A 3LXUX 2W56B 1BEDA 2CH9A 2O9UX 3CPOA 2L4CA 2R4IA 1A2JA 3X41A 1K0OA 2H72A 1EA2A 1XCCA 3QK9A 4K6XA 2H19A 1OKTA 2PPTA 5GSSA 4KSMA 1I9DA 1PKWA 1XW9A 2OQEC 2GSQA 4BL3A 5D9XA 1BX9A 1TW9A 4GSNA 2KUCA 2X64A 1B2ZA 4XBXA 1VF2A 4KCAA 5IPHA 1DMNA 1FGOA 1ZS7A 3F4TA 1JBRA 2MC8A 1R5AA 3KKGA 2DJ1A 3CCQ3 3HI7A 1M1K4 1E3VA 1EZKA 3CYNA 4TR1A 4KDYA 2UZ8A 1OGXA 3FF0A 2O87A 1O7UA 5DCGA 1SK1A 3BBYA 3KIJA 3TCOA 1FZUA 2NBSA 1UGHI 3IA1A 1JNQA 5CF1A 1QK8A 2V2GA 4HI7A 4MF7A 2LYXA 1J9BA 2XH9A 5LC7A 3I9V2 1OACA 2PUKC 1YIT3 4K2XA 4HKVB 4OMVA 1BGSA 3I6AA 2E2TA 1Z6NA 3JVCA 1SK2A 1R7HA 5AIVA 1A2VA 5G5FA 1PD21 2AUVA 4PX1A 5IG4A 4LGQA 4WYKB 2R0GA 1TIJA 3SOAA 1Z1SA 3D9RA 2C4BA 1RGCA 3FKAA 1LBKA 4MJAA 4KZ1A 2INXA 1QJGA 3F7XA 3ZLPA 3GKMA 6GSVA 4K9ZA 4OFNA 3OWSA 5GSTA 1NU3A 1U5OA 2DMLA 2H1AA 3AHWA 3SX1A 4QQ7A 2FXTA 3UNLA 3VWUA 2C0EA 3KTLA 5IIZA 1SD9A 4RZMA 2D1WA 2FWGA 4GLTA 5D8IA 2BT3A 1OKDA 2A4VA 2GEXA 3JUMA 1RRHA 2BO9B 5DJMA 5ECLB 1W02A 5D9TA 1UCLA 4TR0A 1TTZA 1RGKA 2H1DA 3STDA 3SEDA 1YJ93 4Q5QA 1N9EA 1I5GA 1Z5YE 2CWTA 4R1KA 4L0WA 1YJW3 5D82A 4ICYA 3K63A 2YANA 3EMPA 1I3IA 1WQLB 2HZFA 6GSYA 4XCSA 5KN3A 1ERUA 4TOPA 1TFKA 1FGQA 1VF4A 4PGTA 1F8NA 2PN8A 4POLA 5ID2B 2YX9A 2A4HA 2DSAA 5G1KA 1YQ1A 3ECFA 2BIRA 3UVHA 4AGSA 1UCIA 3AGNA 2CX1A 1TU8A 4N6NB 1NW2A 4V2NA 1HKXA 4Q53A 4KE3A 3IXRA 2XC2A 3ZITA 1K0DA 3TB2A 3TKRA 3EF8A 2LTKA 5A4WA 2K8SA 1KBNA 1GTBA 3EYTA 1AVKA 1RGEA 1QVG2 1QALA 1VGLA 2BNGA 1ZGNA 3F3RA 1ZYNA 1ZCPA 4BVYB 1GSFA 5BIRA 5AIFA 2GVPA 2OE1A 3HJOA 3US3A 4F03A 4TXOB 2MMOA 3WHOA 1E6BA 1I0VA 6RNTA 1EV9A 4ZM8A 3IHQA 1GSQA 4KW6A 2WGRA 5G5EA 4ISDA 2VCZA 5BMUA 3A76A 1PGTA 2LRCA 2MMAA 3CC73 2GBXB 4N6V0 2XRXB 3AY8A 1GRXA 4KGIA 2CQ9A 2LNSA 2CVDA 3CXGA 2HFDA 1GY6A 3NBJA 1W5ZA 3CPW2 4F0BA 1OC3A 3H8QA 1EP8A 2FY6A 2JSYA 3MSZA 1SU9A 3B7CA 4Z2RA 4HZBB 4G0IA 4K7IA 4J56E 4FCMA 2JZTA 3JUPA 1XZOA 2TIRA 3CCV3 4K90B 1KNGA 4LL4B 2HMNB 1K0NA 3RPPA 3EMXA 3U97A 3G0KA 3WOEB 3M8NA 3GUSA 1ROAA 3ZMLA 4KSOA 4ZB9A 1BVIA 2GGTA 4AJ8A 3PXMA 1OH0A 1M1XB 3G6E3 3CCM3 3CCJ3 3EE2A 2RCDA 3UMAA 4PUFC 3OV4A 2YZUA 2KHPA 1K8A4 2QC7A 3CTFA 2Y74A 7GSSA 4ZBDA 3BU4A 1SJZA 1NM3A 1TU7A 3TKSC 4EV5A 2Q07A 3DUKA 2CK3H 2DKHA 1GS3A 2F8AA 2ZL8A 1PA3A 1FVJA 4BU4A 3BOAA 1FO5A 1CYUA 5HFIA 3GL5A 2GSTA 3URPA 2IUKA 4RI6A 4XHMA 3HVXA 2PBJA 4O32A 1JKGA 3MG2A 2ON5A 4AEQA 3D4AA 1FHEA 5HR0A 2ZUPA 1X1XA 3F6FA 5A5KA 1YEPA 2K0MA 3QD9A 4XS4A 2VLVA 1QXHA 4LYLB 1TFOA 2O7KA 1CYVA 3QPMA 5LNKe 5ID2A 1QUWA 3D5JA 1SQWA 1AY7A 4NHFA 2RM5A 1HZ1A 4FMCA 1HNCA 1B21A 1RRLA 2W6JH 2ZNMA 3GURA 3IAM2 1VQN3 5F8BA 2BU4A 4HAAA 1AQWA 2VD1A 1O7HB 3HIGA 1VQM3 2IWTA 1OHPA 2CFWA 1MOLA 3DD3A 3P2AA 5CRGA 1OC8A 3FZ4A 2YPMA 2LS5A 2WZ9A 3LGCA 4N3VA 1FVKA 2F4YA 1X5DA 4HYZA 3ERFA 2F56A 3SVAA 4POMA 2Y73A 5EPFA 2UX0A 3E3EA 1XFLA 1W89A 1VQ53 3AHSA 2LNTA 5ECQB 2CIUA 3VURA 2JSZA 1UA5A 5AIIA 4O5UA 4MMYB 5BU4A 5B6MA 2B5XA 3IJEB 3C71A 2P05A 5ENUA 3V98A 4CDLA 3TKQA 2CG0A 3DZLA 2WGQA 5ECMB 1EQKA 5B6NA 1LNHA 3JCML 17GSA 2BTOT 3H93A 4XRDA 3CSIA 3NV0B 4ACSA 1GSEA 3GTUA 3RBTA 14GSA 5BXQA 2AAWA 1N8JA 1PX7A 1QVF2 1A2LA 2VO4A 2LQVA 1MWRA 3E99A 1ULIB 3HK4A 1G6WA 4GQFA 1UW1A 1WWJA 1GLQA 1MD3A 4G0KA 3D22A 4X0XA 4F0CA 3FMWA 5IQYA 3KCHA 1GTAA 4Z7XA 3MYTA 1EKMA 3KP8A 2WOHA 1YVSA 4V2LA 1T7PB 4CJNA 1RGGA 2CAIA 4DSRA 1SKWB 1FGRA 4XDVA 1RN4A 1RGHA 2W2CA 3EU3A 3DM8A 3B8LA 5ECOB 4HVNA 3QFBC 4D73A 2FCHA 1F9MA 1K0BA 3HD5A 2BMRB 2RIIA 3L9SA 3T8NA 3HZ4A 1OPYA 4AF2A 5DALA 3O8YA 4KT3B 3VI5A 4HM6B 3GZXB 2VM2A 5ELAA 3RGRA 2YCDA 1OE8A 2HSMA 3BNCA 5JWOB 3ZMKA 3DRNA 5ECKB 2ZHXB 1EEJA 4WETA 2RLIA 1K3LA 4WP5A 5M1AA 1T4ZA 1RKYA 4IELA 2XFTA 1BSDA 3GKKA 1DMMA 5F06A 3IC8A 1FUTA 1BRKA 1EOHA 3NBBA 1GWCA 1Z6MA 2RM6A 1G0TA 1NHYA 2H70A 2VM1A 3CME3 4KFDA 2IMKA 1I8VA 1MWUA 2RFRA 5IG0A 2NTOA 1U87A 4XS4B 1ST9A 1LRAA 3OX9A 1J2BA 3A2XA 2CAQA 1XW6A 1RN7A 1A23A 2XPDA 3ROBA 2L59A 2JZSA 3VGNA 4MF5A 4IT7A 3EBYA 2C8UA 5HR1A 4EF0A 1JHBA
chains in the Genus database with same CATH topology
4G0LA 4HU7A 3RHCA 4EL1A 2MBTA 2IPAA 3ZFLA 2LV3A 12GSA 2M80A 1XBSA 4WKWA 2GT6A 1NHOA 4E8EA 3G7IA 1GUHA 2LRTA 4HS1A 3UARA 2F3MA 3VWXA 3PINA 4MZWA 3GHAA 1G6YA 1K0AA 1YZXA 2FNOA 2VOCA 2DBCA 2GZZA 5AGYA 2H8LA 2E2MA 4TR4A 1YKAA 3H79A 3MYDA 4KF9A 4PUAA 1F3BA 1A8YA 3PR8A 2QSIA 5E4WA 1H75A 2HI7A 4I6XA 1HQOA 4LA1A 1A2MA 3KXOA 4X43A 3KEBA 2OADA 2D2ZA 3MAKA 1U6TA 2X8HA 2WB9A 2IMEA 3ZL5A 2LQQA 5D9VA 2B1LA 3C7MA 2ES7A 3QCPA 1SKSB 1JLWA 2GTUA 4WEYA 1OAZA 5C04A 4IQAA 2OACA 4E8HA 1QGVA 4ZB8A 4HJMA 1CQGA 4JZQA 2LEGA 1V2AA 2FA8A 1URMA 2RUEA 1UVZA 5F05A 5DQYA 4USSA 1GP1A 5BRTA 3UVTA 2OKAA 5DCHA 4I2TA 5B8BA 3W8SA 1MDJA 1V98A 2YP6A 2IN3A 3TRQA 3CMIA 2HT9A 1B48A 1ZYEA 1F37A 3IOSA 3F9UA 3QAWA 4KDXA 1DSBA 1X5CA 4FYCA 4O7HA 2H1BA 5IO2A 1Y6EA 3MWHA 1Y25A 1G7OA 4G19A 1ILOA 2I9HA 5KOWA 1JZDA 1DE2A 1GSYA 2B1KA 2GZPA 4PQIA 2DJ2A 3TJBA 3RDWA 3UJ1A 4GTUA 4V1Ap 2GQLA 5IMVA 4DVCA 3PGTA 1EP7A 3VK9A 4K2DA 4ECCA 2DIYA 3IC4A 3A5WA 3WGXA 3DEXA 1LU4A 1AQXA 2ON7A 4EVMA 5KN2A 2C0DA 2C3NA 3A2VA 2PERA 2GQKA 3GKXA 2HYXA 2EIRA 4Z2UA 1JZWA 4TRXA 5LCZA 4O5QA 3HCZA 3LWAA 1UC7A 5DQSA 3VFIA 3M0FA 3KCMA 4NHZA 3ME7A 5ECHB 3HXSA 2VLUA 4DSSB 4XRAA 3DWVA 1TJDA 2R3XA 2KLXA 1BG5A 1CQHA 3VWVA 3IR4A 4JE1A 4WF4A 2J9HA 4IJ3A 4NMUA 5ECRB 4L5OA 2MMZA 4X4JA 2GT5A 2HZEA 4WXTA 3UIWA 5L71A 4TW5A 1A24A 2GSRA 2A2RA 2X4AA 1RW1A 2LQOA 3DKSA 2E7PA 2X49A 3IHGA 4RQRA 3UEMA 2K6VA 2C1YA 3E9JB 2K18A 1XIYA 2LKUA 2PU9C 3HVSA 2PVOC 4TN8A 3ZIJA 3Q18A 4MJEA 3GRXA 2YV9A 1UN2A 4JBBA 1V57A 2YJHA 4I97A 3DXBA 2OBKA 1M2AA 2VIMA 5IMFA 3F63A 4EO3A 2CZ2A 2WS2A 4CY8A 1O81A 5INYA 2O8VB 8GSSA 6GSUA 2FHEA 4OO5A 1X9SB 2C3TA 5JCUA 2VAFA 4IKHA 3HZ8A 4BVXB 4HDEA 2L6CA 2I81A 4J2FA 2LUSA 3P7XA 3ZFBA 2RUFA 4HZ4A 1B9YC 4NXIA 2HRNA 4CY6A 2EC4A 2V41A 1M2DA 4MH2A 3M1GA 4ZILA 2CX4A 1FB6A 3TJGA 1O8WA 4L8EA 4TVEA 1TK5B 1XVQA 4EIQA 3GFKA 1ACVA 3GYKA 4J57E 2DMMA 2WJUA 4GF0A 3PH9A 4JR6A 4NV2A 2ALBA 4O5RA 4GXZA 4FYUA 1R5PA 4OD7A 2R4VA 2OE3A 1U3AA 4MZCA 3ZTLA 3QFAC 4I8BA 2P31A 3ERWA 2H6XA 3Q6OA 2FUG2 3F8UA 3TOTA 6GSXA 5EY6A 3LJRA 5KN0A 1SYXA 5D96A 1JZRA 1BJXA 4PNGA 3KD0A 2GS3A 3HKRA 5HQPA 4ULXA 1YDKA 5DDLA 1HNBA 2TRXA 3UBKA 3L9VA 1GSUA 3TKSE 3A3TA 2IFQA 2G2QA 4PURA 1B4PA 2FWFA 13GSA 4I5QA 2VCVA 5CNWA 4CHSA 2PWJA 1PX6A 3PPUA 3ED3A 5ELGA 3GH9A 4K0GA 4N11A 2LRNA 1TI1A 2IIYA 3FZ9A 4X1UA 4IN0A 3KMNA 4ZBAA 4EE0A 1ZYQB 2YV7A 1ZMAA 2CX3A 5DAKB 4KDUA 2REMA 3CRTA 4MABA 4QL7A 1GTUA 4Z2TA 4NAXA 3FR3A 2R0CA 2CT6A 4MP4A 1GTIA 1ML6A 6GSWA 2B7JA 2K8VA 3EINA 5ECSA 3S9FA 1XXUA 5EL8A 4GSSA 3U5RE 4HUAA 3EPTA 3TKPA 2C4JA 4MMMA 3APSA 4HEA2 4PQ1A 3LFLA 1XW5A 5JCGA 2FLSA 4K5RA 4D73B 16GSA 4FH8A 3TJFA 3W6GA 1IYIA 3LYKA 4IGJA 2H0HA 1B4QA 3F6DA 4WR4A 1TKDB 5H5SA 2IJYA 3GIXA 3ZVJA 4IBPA 4AJ7A 2O85A 3L4NA 4KB3A 2H1GA 1GLPA 4TR1B 3TGZA 3FZAA 1TDIA 5DBQA 2VCWA 5H5QA 3F3QA 2R5GA 1WIKA 3CTGA 2WRTA 3G7YA 2YWMA 4N30A 4JU5A 5A4VA 2PMTA 3P90A 1TRWA 4IJIA 3APQA 3FY7A 4BWQA 3GSSA 1WE0A 5DJLA 5CP1A 1J0FA 2MBSA 1Z7PA 4YAPA 1QMVA 4MK3A 3K8NA 3WYWA 1PRXA 3A2WA 1GSDA 2V6KA 2N5FA 1RQMA 4KNDA 3TRPA 4ZL8A 1ZZYA 4PTSA 2KOKA 4WBJA 3GX8A 1H4OA 2A2PA 4FIWA 3WGDA 4AJ6A 5J4UA 2HRKA 1XWGA 4K8MA 2BJXA 2M46A 4GWRA 1XWAA 4EDYA 2E0QA 2HSHA 3FW2A 2LJRA 3VPQA 1SL1B 1K0MA 2X8CA 4DEJA 4HU9A 3O76A 2HE3A 4MCUA 2FD3A 4MDCA 2P0GA 2R2JA 1YKCA 2H01A 2YNXA 3IV4A 1THXA 4GCIA 3NOFA 3R2QA 1AW9A 1TI3A 5HR3A 3FYGA 5IMZA 2XHFA 4LL1B 1U3IA 2DJKA 2H6YA 3GMFA 3V1WA 4EUYA 20GSA 4YQMA 5G2ZA 4LMVA 1SJ6A 4IW9A 3VWWA 1GH2A 5KN1A 2QA1A 3QAVA 3SWLA 2IMFA 4JEDA 2KP1A 1TK8B 4KUNA 4OWYA 3TOUA 3UAPA 2MMNA 1JLVA 1XWKA 4GRFA 4BWSA 4ZXGA 2CVKA 1ZYPA 5IMCA 2C0GA 1F6MC 3ZZXA 1A8LA 2H30A 4KA0A 3H1NA 4ECIA 1O85A 5ECNB 3WGEA 3MDKA 1PN0A 5DVBA 4WF5A 1TK0B 3TDGA 3DGQA 1MEKA 5JWQB 4F9ZA 1WRYA 4H86A 1V58A 5D93A 1V40A 1SKRB 1PL1A 3LEFA 1FW1A 2JU5A 3KZQA 2CZ3A 5E59A 5FT3A 3ZREA 9GSSA 1ON4A 4WR5A 1SYRA 2YJ7A 5CREA 2CVBA 2QGVA 5G31A 1M99A 1JZOA 4MLYA 3BJ5A 4ZL9A 1GUMA 1Q98A 1T00A 1ABAA 5J3RA 3EURA 2VCTA 5FWGA 2IYJA 3M9KA 3H4KA 3I69A 1TRSA 3GX0A 2K9FA 3EWLA 1EGRA 3FZ5A 3WD6A 3DVWA 1OC9B 4YKGA 4KAEA 2GQMA 2FWHA 3F0IA 2X8GA 4G2EA 3MIXA 3FKFA 1M2BA 4EDZA 1M9BA 1SL0B 1S3DA 5KEJA 2WULA 4HQSA 4HZ2A 1ERVA 1XOAA 19GSA 2X99A 3M3MA 2NVLA 5F07A 3L0HA 2VL2A 4MZBA 3QOUA 3LSZA 1RK4A 3EVIA 3HHVA 3ZIVA 5IO0A 2H75A 4YQVA 5AISA 4ZL7A 1GSSA 2YOIA 5HFGA 3NIVA 1EOGA 2VD0A 4FQUA 1J08A 2C3QA 1K0CA 2VCQA 4F82A 1MTCA 1EGOA 4MPFA 2F51A 3UBLA 2ZCTA 3GTUB 3GH6A 2VLTA 2H71A 10GSA 1S3AA 1B8XA 2HXKA 3ERGA 4IQ1A 2V6OA 1T4YA 3KP9A 2CV4A 4RQXA 3TUEA 18GSA 2AJQB 1A0FA 4XS6A 2A2SA 5DAKA 4N0VA 5FHIA 1FG4A 1QFNA 2NPBA 2LJKA 2WFCA 4YAVA 1T3BA 2C0FA 3C1RA 1Z9HA 2DJ0A 4CW9A 3P8WA 1OYJA 3IK7A 1Z7RA 3NZNA 1KTEA 5CO3A 4JRRA 3F4RA 3EU4A 2HLSA 1VRSD 4MA9A 2VL2C 1VF3A 5IM9A 4OFTA 4XS1A 2H66A 3HY2A 1Z3EA 2BMXA 2QKEA 4ID0A 5IOXA 4HQZA 1ZOFA 3L78A 3N9JA 1GNEA 2H76A 3RHBA 4K7NA 11GSA 4ILFA 3UOMA 4ECJA 2OBIA 5HFKA 4OCEA 2NDOA 2Z9SA 3C8EA 4BPYA 3UL3A 5AN1A 5CRDA 5D73A 3KH7A 3C1SA 1GNWA 2B5YA 4V2MA 1M9AA 4N10A 1HNAA 1R26A 1WJKA 3ZRDA 3BD2A 4Q5FA 1WPIA 3D4MA 3VI7A 2GDRA 4IP1A 4XIHA 3IDVA 1XWBA 3CSJA 4L5LA 2H74A 2DKIA 1B9XC 3WT2A 2AV4A 2O89A 4KX4A 1OE7A 1FB0A 2FWEA 4K1FA 1TOFA 4MJBA 1MDKA 2DC5A 4KH7A 4CDOA 1GUKA 1K3OA 3GV1A 1X9MB 3TJKA 3KM6A 2OJLA 3FR9A 4XTSA 6GSTA 4GSTA 5A4UA 1X5EA 4EKZA 3IAS2 4HJ2A 2AB6A 4RUVA 5JCWA 2VCXA 3RPNA 1DBYA 5G30A 1SD8A 3DIEA 3KJYA 3HDCA 3RAZA 2L5LA 2HRFA 2DJJA 3IRAA 4GQCA 2YWIA 5ECPB 2V32A 4POBA 2AHEA 2MYGA 4EIPA 4N0ZA 4TR3A 4BVYA 3LYPA 3O6TA 4IP6A 1YY7A 2YWOA 3HA9A 4TXOA 1XOBA 2F9SA 1SK0A 4P3YB 3QAGA 5GAPD 4ML6A 2PGTA 2IMIA 4LMWA 3D6IA 2WDUA 4K5SA 5CYYA 2P5QA 3HJPA 5F0GA 3BCKA 2H0GA 1HD2A 2HZEB 1PN9A 5B7CA 1FOVA 4NPBA 3GA4A 3FRCA 2VUPA 5H5RA 3KTBA 1TP9A 3TJJA 1KEBA 4YQUA 2XBQA 1U88A 4DSSA 1BYEA 4MH3A 1OVNA 5GAND 1OC9A 2JL4A 2B6MA 3M9JA 1AAZA 3FEUA 4V1Ag 4FO5A 4BL7A 3GKNA 3KH9A 1O8XA 1SJIA 2LSTA 3FK8A 4YH2A 4NHWA 2FGXA 4ECBA 4TKYA 3QMXA 2JACA 3D21A 2YZHA 2J23A 1M0UA 2JADA 2IY2A 3W8JA 5IOWA 3A5IA 1BAYA 4Q5NA 3DMLA 4YKFA 5D9WA 1EEMA 4EXJA 1AUCA 2M72A 1F2EA 3E0UA 4OO4A 3APOA 3GN3A 1O73A 2IMDA 5G1LA 2EIQA 1JFUA 2GZYA 1AQVA 2KP2A 2GSSA 4FYBA 4L0UA 2L57A 3TKSA 1PKZA 3HVVA 2B3SA 1LJRA 2HSYA 3IE3A 2H6ZA 2L4QA 4K0NA 4PNFA 2TRCP 2XBIA 2HRAA 2EIOA 1T8EB 1V9WA 1VF1A 5AIXA 2VL9A 4BVXA 1FOHA 5J5NA 1S3CA 3GL3A 5HR2A 3EC3A 5IMAA 3KGKA 3D4TA 2MZCA 1SL2B 4WBRD 5B8AA 1M7TA 3ME8A 5ECIB 5CRHA 2YWNA 4IHUA 1MDIA 1G7EA 5ABRA 3F4SA 4DSQA 1XWCA 2HNLA 2R0PA 3WT1A 22GSA 2E2GA 4RI7A 4MPGA 4OCFA 3Q19A 3C73A 4LLRA 2DLXA 2JZRA 3SBCA 4A5PA 6GSSA 3LORA 1BQ7A 3U6VA 1ERTA 5DALB 1ERWA 2H0IA 3CBUA 1XPVA 4O92A 3KMOA 4POKA 1YJ6A 2YN1A 4KCEA 4ML1A 3GSTA 1TRUA 1PSQA 4TXVA 4G9HA 4I2UA 4ZIJA 4MNNA 4F2IA 1YF0A 2OA7A 4PXOA 4BA7A 3BCIA 2I4AA 1HYUA 5IMDA 1F3AA 1WMJA 4JR4A 2DIZA 1FAAA 3J7Yb 4K7OA 1AC1A 2P5RA 2IFQB 2XPEA 5CRWA 4OFMA 3TRXA 4PQHA 2N5BA 2CA8A 1DUGA 1PQNA 1K3YA 1DE1A 2B5EA 1W4VA 4MF6A 3R3EA 4EC0A 1O6JA 3QR6A 5COHA 3ZYWA 4BL7B 1ZL9A 1QQ2A 1AXDA 3O3TA 2LJAA 5GZZB 2GLRA 3G7JA 4IVFA 1WP0A 3FHKA 1X0RA 3IK9A 1GULA 2L5OA 4G10A 5IPGA 3HYPA 3LQ7A 3CSHA 1WOUA 1EV4A 4ZBBA 3FR6A 5EVOA 3L9UA 2OE0A 3MNGA 5J9BA 3LW9A 2B7KA 1XVWA 2G0FA 3DVXA 3LXTA 5J41A 3ISOA 2F8FA 2VL3A 5KOXA 1EWXA 2N5AA 5LD0A 2R37A 1YEXA 4IS0A 2PVQA 2FA4A 3VLNA 1USBA 3Q74A 2V1MA 1X9WB 3DYRA 5CAXA 3LXZA 4MJCA 2WCIA 2I3YA 3GNJA 1SENA 1PMTA 2H73A 4NWYA 1THOA 1Q4JA 1AIUA 2AYTA 5C00A 1YF1A 2C80A 4Q5RA 1GL8A 2QA2A 4ZB6A 3J7Yk 1A0RP 3CRUA 3IBHA 3VPTA 5J9CA 2DJ3A 3IPZA 3D0ZA 3N5OA 2I1UA 4NV5A 2IL3A 2L6DA 1PL2A 1R4WA 3QDNA 1IYHA 1N2AA 1E2YA 5JWRB 4HOJA 3G9BA 1TRVA 3ZVJD 1NSWA 3I43A 3OR5A 4QL9A 3LG6A 1T1VA 3HJMA 1TXXA 1C72A 2R6KA 1MD4A 1BEDA 2L4CA 1A2JA 1K0OA 2H72A 1XCCA 4K6XA 2H19A 1OKTA 2PPTA 5GSSA 4KSMA 1I9DA 1PKWA 1XW9A 2GSQA 5D9XA 1BX9A 1TW9A 4GSNA 2KUCA 2X64A 1VF2A 4KCAA 5IPHA 3F4TA 1R5AA 2DJ1A 1EZKA 3CYNA 4TR1A 4KDYA 2UZ8A 2O87A 1O7UA 5DCGA 1SK1A 3BBYA 3KIJA 3TCOA 2NBSA 3IA1A 1QK8A 2V2GA 4HI7A 4MF7A 1J9BA 3I9V2 2PUKC 4K2XA 4OMVA 3I6AA 1Z6NA 1SK2A 1R7HA 5AIVA 5G5FA 1PD21 2AUVA 4PX1A 2R0GA 1LBKA 4MJAA 3ZLPA 3GKMA 6GSVA 4K9ZA 4OFNA 5GSTA 2DMLA 2H1AA 4QQ7A 3VWUA 2C0EA 3KTLA 5IIZA 1SD9A 2FWGA 4GLTA 5D8IA 1OKDA 2A4VA 5DJMA 5ECLB 5D9TA 4TR0A 1TTZA 2H1DA 4Q5QA 1I5GA 1Z5YE 4L0WA 4ICYA 2YANA 3EMPA 2HZFA 6GSYA 4XCSA 5KN3A 1ERUA 4TOPA 1VF4A 4PGTA 2PN8A 4POLA 5ID2B 2A4HA 2DSAA 5G1KA 1YQ1A 3UVHA 4AGSA 1TU8A 1NW2A 4V2NA 4KE3A 3IXRA 2XC2A 3ZITA 1K0DA 3TB2A 3TKRA 2LTKA 5A4WA 2K8SA 1KBNA 1GTBA 3EYTA 1VGLA 1ZGNA 3F3RA 1ZYNA 1ZCPA 4BVYB 1GSFA 2GVPA 2OE1A 3HJOA 3US3A 4F03A 4TXOB 2MMOA 1E6BA 1EV9A 3IHQA 1GSQA 4KW6A 2WGRA 5G5EA 4ISDA 2VCZA 5BMUA 1PGTA 2LRCA 2MMAA 3AY8A 1GRXA 4KGIA 2CQ9A 2LNSA 2CVDA 3CXGA 2HFDA 4F0BA 1OC3A 3H8QA 1EP8A 2FY6A 2JSYA 3MSZA 1SU9A 4Z2RA 4G0IA 4K7IA 4J56E 2JZTA 1XZOA 2TIRA 1KNGA 4LL4B 1K0NA 3RPPA 3EMXA 3M8NA 3GUSA 3ZMLA 4KSOA 4ZB9A 2GGTA 4AJ8A 3EE2A 3UMAA 4PUFC 2YZUA 2KHPA 2QC7A 3CTFA 7GSSA 4ZBDA 1SJZA 1NM3A 1TU7A 3TKSC 2DKHA 2F8AA 1PA3A 1FVJA 3BOAA 1FO5A 5HFIA 3GL5A 2GSTA 4RI6A 4XHMA 3HVXA 2PBJA 4O32A 2ON5A 1FHEA 5HR0A 2ZUPA 3F6FA 5A5KA 1YEPA 3QD9A 4XS4A 2VLVA 1QXHA 2O7KA 3QPMA 5LNKe 5ID2A 1QUWA 3D5JA 2RM5A 1HNCA 3IAM2 2ZNMA 3GURA 5F8BA 1AQWA 2VD1A 2IWTA 3P2AA 5CRGA 3DD3A 1OC8A 3FZ4A 2YPMA 2LS5A 2WZ9A 3LGCA 1FVKA 1X5DA 3ERFA 4POMA 5EPFA 3E3EA 1XFLA 1W89A 2LNTA 5ECQB 3VURA 2JSZA 1UA5A 4O5UA 5B6MA 2B5XA 3C71A 5ENUA 3TKQA 5ECMB 5B6NA 3JCML 17GSA 2BTOT 3H93A 4XRDA 3CSIA 4ACSA 1GSEA 3GTUA 3RBTA 14GSA 2AAWA 1N8JA 1PX7A 1A2LA 2VO4A 1G6WA 4GQFA 1WWJA 1GLQA 1MD3A 4G0KA 3D22A 4X0XA 4F0CA 3FMWA 5IQYA 1GTAA 4Z7XA 3KP8A 4V2LA 1T7PB 2CAIA 4DSRA 1SKWB 3EU3A 5ECOB 3QFBC 4D73A 2FCHA 1F9MA 1K0BA 3HD5A 2RIIA 3L9SA 3HZ4A 4AF2A 5DALA 3VI5A 2VM2A 5ELAA 2YCDA 1OE8A 2HSMA 5JWOB 3ZMKA 3DRNA 5ECKB 1EEJA 4WETA 2RLIA 1K3LA 1T4ZA 4IELA 3GKKA 5F06A 3IC8A 1EOHA 1GWCA 1Z6MA 2RM6A 1G0TA 1NHYA 2H70A 2VM1A 2IMKA 2NTOA 1U87A 4XS4B 1ST9A 3A2XA 2CAQA 1XW6A 1A23A 2XPDA 2L59A 2JZSA 4MF5A 2C8UA 5HR1A 4EF0A 1JHBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4HU7 A;  3RHC A;  4EL1 A;  2MBT A;  2IPA A;  3ZFL A;  2LV3 A;  12GS A;  2M80 A;  1XBS A;  4WKW A;  2GT6 A;  1NHO A;  4E8E A;  3G7I A;  1GUH A;  2LRT A;  4HS1 A;  3UAR A;  2F3M A;  3VWX A;  3PIN A;  4MZW A;  3GHA A;  1G6Y A;  1K0A A;  1YZX A;  2FNO A;  2VOC A;  2DBC A;  2GZZ A;  5AGY A;  2H8L A;  2E2M A;  4TR4 A;  1YKA A;  3H79 A;  4PUA A;  1F3B A;  1A8Y A;  3PR8 A;  2QSI A;  5E4W A;  1H75 A;  2HI7 A;  4I6X A;  1HQO A;  4LA1 A;  1A2M A;  3KXO A;  4X43 A;  3KEB A;  2OAD A;  2D2Z A;  3MAK A;  1U6T A;  2X8H A;  2WB9 A;  2IME A;  3ZL5 A;  2LQQ A;  5D9V A;  2B1L A;  3C7M A;  2ES7 A;  3QCP A;  1SKS B;  1JLW A;  2GTU A;  4WEY A;  1OAZ A;  5C04 A;  4IQA A;  2OAC A;  4E8H A;  1QGV A;  4ZB8 A;  4HJM A;  1CQG A;  4JZQ A;  2LEG A;  1V2A A;  2FA8 A;  1URM A;  2RUE A;  1UVZ A;  5F05 A;  5DQY A;  1GP1 A;  3UVT A;  2OKA A;  5DCH A;  4I2T A;  5B8B A;  3W8S A;  1MDJ A;  1V98 A;  2YP6 A;  2IN3 A;  3TRQ A;  3CMI A;  2HT9 A;  1B48 A;  1ZYE A;  1F37 A;  3IOS A;  3F9U A;  3QAW A;  4KDX A;  1DSB A;  1X5C A;  4FYC A;  4O7H A;  2H1B A;  5IO2 A;  1Y6E A;  3MWH A;  1Y25 A;  1G7O A;  4G19 A;  1ILO A;  2I9H A;  1JZD A;  1DE2 A;  1GSY A;  2B1K A;  2GZP A;  4PQI A;  2DJ2 A;  3TJB A;  3RDW A;  3UJ1 A;  4GTU A;  4V1A p;  2GQL A;  5IMV A;  4DVC A;  3PGT A;  1EP7 A;  3VK9 A;  4K2D A;  4ECC A;  2DIY A;  3IC4 A;  3A5W A;  3WGX A;  3DEX A;  1LU4 A;  1AQX A;  2ON7 A;  4EVM A;  5KN2 A;  2C0D A;  2C3N A;  3A2V A;  2PER A;  2GQK A;  3GKX A;  2HYX A;  2EIR A;  1JZW A;  4TRX A;  5LCZ A;  3HCZ A;  3LWA A;  1UC7 A;  5DQS A;  3VFI A;  3M0F A;  3KCM A;  4NHZ A;  3ME7 A;  5ECH B;  3HXS A;  2VLU A;  4DSS B;  4XRA A;  3DWV A;  1TJD A;  2R3X A;  2KLX A;  1BG5 A;  1CQH A;  3VWV A;  3IR4 A;  4JE1 A;  4WF4 A;  2J9H A;  4IJ3 A;  4NMU A;  5ECR B;  4L5O A;  2MMZ A;  2GT5 A;  2HZE A;  4WXT A;  3UIW A;  5L71 A;  4TW5 A;  1A24 A;  2GSR A;  2A2R A;  1RW1 A;  2LQO A;  3DKS A;  2E7P A;  4RQR A;  3UEM A;  2K6V A;  2C1Y A;  3E9J B;  2K18 A;  1XIY A;  2LKU A;  2PU9 C;  3HVS A;  2PVO C;  4TN8 A;  3ZIJ A;  3Q18 A;  4MJE A;  3GRX A;  2YV9 A;  1UN2 A;  4JBB A;  1V57 A;  2YJH A;  4I97 A;  3DXB A;  2OBK A;  1M2A A;  2VIM A;  5IMF A;  3F63 A;  4EO3 A;  2CZ2 A;  2WS2 A;  1O81 A;  5INY A;  2O8V B;  8GSS A;  6GSU A;  2FHE A;  4OO5 A;  1X9S B;  2C3T A;  5JCU A;  2VAF A;  4IKH A;  3HZ8 A;  4HDE A;  2L6C A;  2I81 A;  4J2F A;  2LUS A;  3P7X A;  3ZFB A;  2RUF A;  4HZ4 A;  1B9Y C;  4NXI A;  2HRN A;  2EC4 A;  2V41 A;  1M2D A;  4MH2 A;  3M1G A;  4ZIL A;  2CX4 A;  1FB6 A;  3TJG A;  1O8W A;  4L8E A;  4TVE A;  1TK5 B;  1XVQ A;  3GFK A;  1ACV A;  3GYK A;  4J57 E;  2DMM A;  2WJU A;  4GF0 A;  3PH9 A;  4JR6 A;  4NV2 A;  2ALB A;  4O5R A;  4GXZ A;  4FYU A;  1R5P A;  4OD7 A;  2R4V A;  2OE3 A;  1U3A A;  4MZC A;  3ZTL A;  3QFA C;  4I8B A;  2P31 A;  3ERW A;  2H6X A;  3Q6O A;  2FUG 2;  3F8U A;  3TOT A;  6GSX A;  5EY6 A;  3LJR A;  5KN0 A;  1SYX A;  5D96 A;  1JZR A;  1BJX A;  4PNG A;  3KD0 A;  2GS3 A;  3HKR A;  5HQP A;  4ULX A;  1YDK A;  5DDL A;  1HNB A;  2TRX A;  3UBK A;  3L9V A;  1GSU A;  3TKS E;  3A3T A;  2IFQ A;  2G2Q A;  4PUR A;  1B4P A;  2FWF A;  13GS A;  4I5Q A;  2VCV A;  5CNW A;  4CHS A;  2PWJ A;  1PX6 A;  3ED3 A;  5ELG A;  3GH9 A;  4K0G A;  4N11 A;  2LRN A;  1TI1 A;  2IIY A;  3FZ9 A;  4X1U A;  4IN0 A;  3KMN A;  4ZBA A;  4EE0 A;  1ZYQ B;  2YV7 A;  1ZMA A;  2CX3 A;  5DAK B;  4KDU A;  2REM A;  3CRT A;  4MAB A;  4QL7 A;  1GTU A;  4NAX A;  3FR3 A;  2CT6 A;  4MP4 A;  1GTI A;  1ML6 A;  6GSW A;  2B7J A;  2K8V A;  3EIN A;  5ECS A;  3S9F A;  1XXU A;  5EL8 A;  4GSS A;  3U5R E;  4HUA A;  3TKP A;  2C4J A;  4MMM A;  3APS A;  4HEA 2;  4PQ1 A;  3LFL A;  1XW5 A;  5JCG A;  2FLS A;  4D73 B;  16GS A;  4FH8 A;  3TJF A;  3W6G A;  1IYI A;  3LYK A;  4IGJ A;  2H0H A;  1B4Q A;  3F6D A;  4WR4 A;  1TKD B;  5H5S A;  2IJY A;  3GIX A;  3ZVJ A;  4IBP A;  4AJ7 A;  2O85 A;  3L4N A;  4KB3 A;  2H1G A;  1GLP A;  4TR1 B;  3TGZ A;  3FZA A;  1TDI A;  5DBQ A;  2VCW A;  5H5Q A;  3F3Q A;  2R5G A;  1WIK A;  3CTG A;  2WRT A;  3G7Y A;  2YWM A;  4N30 A;  4JU5 A;  5A4V A;  2PMT A;  3P90 A;  1TRW A;  4IJI A;  3APQ A;  3FY7 A;  4BWQ A;  3GSS A;  1WE0 A;  5DJL A;  5CP1 A;  1J0F A;  2MBS A;  1Z7P A;  4YAP A;  1QMV A;  4MK3 A;  3K8N A;  3WYW A;  1PRX A;  3A2W A;  1GSD A;  2V6K A;  2N5F A;  1RQM A;  4KND A;  3TRP A;  4ZL8 A;  1ZZY A;  2KOK A;  4WBJ A;  3GX8 A;  1H4O A;  4FIW A;  3WGD A;  4AJ6 A;  5J4U A;  1XWG A;  4K8M A;  2BJX A;  2M46 A;  4GWR A;  1XWA A;  4EDY A;  2E0Q A;  2HSH A;  3FW2 A;  2LJR A;  3VPQ A;  1SL1 B;  1K0M A;  2X8C A;  4DEJ A;  4HU9 A;  3O76 A;  2HE3 A;  4MCU A;  2FD3 A;  4MDC A;  2P0G A;  2R2J A;  1YKC A;  2H01 A;  2YNX A;  3IV4 A;  1THX A;  4GCI A;  3NOF A;  3R2Q A;  1AW9 A;  1TI3 A;  5HR3 A;  3FYG A;  5IMZ A;  2XHF A;  4LL1 B;  1U3I A;  2DJK A;  2H6Y A;  3GMF A;  3V1W A;  4EUY A;  20GS A;  4YQM A;  5G2Z A;  4LMV A;  1SJ6 A;  4IW9 A;  3VWW A;  1GH2 A;  5KN1 A;  3QAV A;  3SWL A;  2IMF A;  4JED A;  2KP1 A;  1TK8 B;  4KUN A;  4OWY A;  3TOU A;  3UAP A;  2MMN A;  1JLV A;  1XWK A;  4GRF A;  4BWS A;  4ZXG A;  2CVK A;  5IMC A;  2C0G A;  1F6M C;  3ZZX A;  1A8L A;  2H30 A;  4KA0 A;  3H1N A;  4ECI A;  1O85 A;  5ECN B;  3WGE A;  3MDK A;  5DVB A;  4WF5 A;  1TK0 B;  3TDG A;  3DGQ A;  1MEK A;  5JWQ B;  4F9Z A;  1WRY A;  4H86 A;  1V58 A;  5D93 A;  1V40 A;  1SKR B;  1PL1 A;  3LEF A;  1FW1 A;  2JU5 A;  3KZQ A;  2CZ3 A;  5E59 A;  5FT3 A;  3ZRE A;  9GSS A;  1ON4 A;  4WR5 A;  1SYR A;  2YJ7 A;  5CRE A;  2CVB A;  2QGV A;  5G31 A;  1M99 A;  1JZO A;  4MLY A;  3BJ5 A;  4ZL9 A;  1GUM A;  1Q98 A;  1T00 A;  1ABA A;  5J3R A;  3EUR A;  2VCT A;  5FWG A;  2IYJ A;  3M9K A;  3H4K A;  3I69 A;  1TRS A;  3GX0 A;  2K9F A;  3EWL A;  1EGR A;  3FZ5 A;  3WD6 A;  3DVW A;  1OC9 B;  4KAE A;  2GQM A;  2FWH A;  3F0I A;  2X8G A;  4G2E A;  3FKF A;  1M2B A;  4EDZ A;  1M9B A;  1SL0 B;  1S3D A;  5KEJ A;  2WUL A;  4HQS A;  4HZ2 A;  1ERV A;  1XOA A;  19GS A;  2X99 A;  3M3M A;  2NVL A;  5F07 A;  3L0H A;  2VL2 A;  4MZB A;  3QOU A;  3LSZ A;  1RK4 A;  3EVI A;  3HHV A;  3ZIV A;  5IO0 A;  2H75 A;  4YQV A;  5AIS A;  4ZL7 A;  1GSS A;  2YOI A;  5HFG A;  3NIV A;  1EOG A;  2VD0 A;  1J08 A;  2C3Q A;  1K0C A;  2VCQ A;  4F82 A;  1MTC A;  1EGO A;  4MPF A;  2F51 A;  3UBL A;  2ZCT A;  3GTU B;  3GH6 A;  2VLT A;  2H71 A;  10GS A;  1S3A A;  1B8X A;  2HXK A;  3ERG A;  4IQ1 A;  2V6O A;  1T4Y A;  3KP9 A;  2CV4 A;  4RQX A;  18GS A;  3TUE A;  2AJQ B;  1A0F A;  4XS6 A;  2A2S A;  5DAK A;  4N0V A;  5FHI A;  1FG4 A;  1QFN A;  2NPB A;  2LJK A;  2WFC A;  4YAV A;  1T3B A;  2C0F A;  3C1R A;  1Z9H A;  2DJ0 A;  4CW9 A;  3P8W A;  1OYJ A;  3IK7 A;  1Z7R A;  3NZN A;  1KTE A;  5CO3 A;  4JRR A;  3F4R A;  3EU4 A;  2HLS A;  1VRS D;  4MA9 A;  2VL2 C;  1VF3 A;  5IM9 A;  4OFT A;  4XS1 A;  2H66 A;  3HY2 A;  1Z3E A;  2BMX A;  2QKE A;  4ID0 A;  5IOX A;  4HQZ A;  1ZOF A;  3L78 A;  3N9J A;  1GNE A;  2H76 A;  3RHB A;  4K7N A;  11GS A;  4ILF A;  3UOM A;  4ECJ A;  2OBI A;  5HFK A;  4OCE A;  2NDO A;  2Z9S A;  3C8E A;  4BPY A;  3UL3 A;  5AN1 A;  5CRD A;  5D73 A;  3KH7 A;  3C1S A;  1GNW A;  2B5Y A;  4V2M A;  1M9A A;  4N10 A;  1HNA A;  1R26 A;  1WJK A;  3ZRD A;  3BD2 A;  4Q5F A;  1WPI A;  3D4M A;  3VI7 A;  2GDR A;  4IP1 A;  4XIH A;  3IDV A;  1XWB A;  3CSJ A;  4L5L A;  2H74 A;  1B9X C;  3WT2 A;  2AV4 A;  2O89 A;  4KX4 A;  1OE7 A;  1FB0 A;  2FWE A;  4K1F A;  1TOF A;  4MJB A;  1MDK A;  2DC5 A;  4KH7 A;  4CDO A;  1GUK A;  1K3O A;  3GV1 A;  1X9M B;  3TJK A;  3KM6 A;  2OJL A;  3FR9 A;  4XTS A;  6GST A;  4GST A;  5A4U A;  1X5E A;  4EKZ A;  3IAS 2;  4HJ2 A;  2AB6 A;  4RUV A;  5JCW A;  2VCX A;  3RPN A;  1DBY A;  5G30 A;  1SD8 A;  3DIE A;  3KJY A;  3HDC A;  3RAZ A;  2L5L A;  2HRF A;  2DJJ A;  3IRA A;  4GQC A;  2YWI A;  5ECP B;  2V32 A;  4POB A;  2AHE A;  2MYG A;  4N0Z A;  4TR3 A;  4BVY A;  3LYP A;  3O6T A;  4IP6 A;  1YY7 A;  2YWO A;  3HA9 A;  4TXO A;  1XOB A;  2F9S A;  1SK0 A;  4P3Y B;  3QAG A;  5GAP D;  4ML6 A;  2PGT A;  2IMI A;  4LMW A;  3D6I A;  2WDU A;  5CYY A;  2P5Q A;  3HJP A;  5F0G A;  3BCK A;  2H0G A;  1HD2 A;  2HZE B;  1PN9 A;  5B7C A;  1FOV A;  4NPB A;  3GA4 A;  3FRC A;  2VUP A;  5H5R A;  3KTB A;  1TP9 A;  3TJJ A;  1KEB A;  4YQU A;  2XBQ A;  1U88 A;  4DSS A;  1BYE A;  4MH3 A;  1OVN A;  5GAN D;  1OC9 A;  2JL4 A;  2B6M A;  3M9J A;  1AAZ A;  3FEU A;  4V1A g;  4FO5 A;  4BL7 A;  3GKN A;  3KH9 A;  1O8X A;  1SJI A;  2LST A;  3FK8 A;  4YH2 A;  4NHW A;  2FGX A;  4ECB A;  4TKY A;  3QMX A;  2JAC A;  3D21 A;  2YZH A;  2J23 A;  1M0U A;  2JAD A;  2IY2 A;  3W8J A;  5IOW A;  1BAY A;  4Q5N A;  3DML A;  5D9W A;  1EEM A;  4EXJ A;  1AUC A;  2M72 A;  1F2E A;  3E0U A;  4OO4 A;  3APO A;  3GN3 A;  1O73 A;  2IMD A;  5G1L A;  2EIQ A;  1JFU A;  2GZY A;  1AQV A;  2KP2 A;  2GSS A;  4FYB A;  4L0U A;  2L57 A;  3TKS A;  1PKZ A;  3HVV A;  2B3S A;  1LJR A;  2HSY A;  3IE3 A;  2H6Z A;  2L4Q A;  4K0N A;  4PNF A;  2TRC P;  2XBI A;  2EIO A;  1T8E B;  1V9W A;  1VF1 A;  5AIX A;  2VL9 A;  4BVX A;  5J5N A;  1S3C A;  3GL3 A;  5HR2 A;  3EC3 A;  5IMA A;  3KGK A;  3D4T A;  2MZC A;  1SL2 B;  4WBR D;  5B8A A;  1M7T A;  3ME8 A;  5ECI B;  5CRH A;  2YWN A;  4IHU A;  1MDI A;  1G7E A;  5ABR A;  3F4S A;  4DSQ A;  1XWC A;  2HNL A;  3WT1 A;  22GS A;  2E2G A;  4RI7 A;  4MPG A;  4OCF A;  3Q19 A;  3C73 A;  4LLR A;  2DLX A;  2JZR A;  3SBC A;  6GSS A;  3LOR A;  1BQ7 A;  3U6V A;  1ERT A;  5DAL B;  1ERW A;  2H0I A;  3CBU A;  1XPV A;  4O92 A;  3KMO A;  4POK A;  1YJ6 A;  2YN1 A;  4KCE A;  4ML1 A;  3GST A;  1TRU A;  1PSQ A;  4TXV A;  4G9H A;  4I2U A;  4ZIJ A;  4F2I A;  1YF0 A;  2OA7 A;  4PXO A;  4BA7 A;  3BCI A;  2I4A A;  1HYU A;  5IMD A;  1F3A A;  1WMJ A;  4JR4 A;  2DIZ A;  1FAA A;  3J7Y b;  4K7O A;  1AC1 A;  2P5R A;  2IFQ B;  2XPE A;  5CRW A;  4OFM A;  3TRX A;  4PQH A;  2N5B A;  2CA8 A;  1DUG A;  1PQN A;  1K3Y A;  1DE1 A;  2B5E A;  1W4V A;  4MF6 A;  4EC0 A;  1O6J A;  3QR6 A;  5COH A;  3ZYW A;  1ZL9 A;  1QQ2 A;  1AXD A;  3O3T A;  2LJA A;  5GZZ B;  2GLR A;  3G7J A;  4IVF A;  1WP0 A;  3FHK A;  1X0R A;  3IK9 A;  1GUL A;  2L5O A;  4G10 A;  5IPG A;  3HYP A;  3LQ7 A;  3CSH A;  1WOU A;  1EV4 A;  4ZBB A;  3FR6 A;  5EVO A;  3L9U A;  2OE0 A;  3MNG A;  5J9B A;  2B7K A;  1XVW A;  2G0F A;  3DVX A;  3LXT A;  5J41 A;  3ISO A;  2F8F A;  2VL3 A;  1EWX A;  2N5A A;  5LD0 A;  2R37 A;  1YEX A;  4IS0 A;  2PVQ A;  2FA4 A;  3VLN A;  1USB A;  3Q74 A;  2V1M A;  1X9W B;  3DYR A;  5CAX A;  3LXZ A;  4MJC A;  2WCI A;  2I3Y A;  3GNJ A;  1SEN A;  1PMT A;  2H73 A;  4NWY A;  1THO A;  1Q4J A;  1AIU A;  2AYT A;  5C00 A;  1YF1 A;  2C80 A;  4Q5R A;  1GL8 A;  4ZB6 A;  3J7Y k;  1A0R P;  3CRU A;  3IBH A;  3VPT A;  5J9C A;  2DJ3 A;  3IPZ A;  3D0Z A;  3N5O A;  2I1U A;  4NV5 A;  2IL3 A;  2L6D A;  1PL2 A;  1R4W A;  3QDN A;  1IYH A;  1N2A A;  1E2Y A;  5JWR B;  4HOJ A;  3G9B A;  1TRV A;  3ZVJ D;  1NSW A;  3I43 A;  3OR5 A;  4QL9 A;  3LG6 A;  1T1V A;  3HJM A;  1TXX A;  1C72 A;  2R6K A;  1MD4 A;  1BED A;  2L4C A;  1A2J A;  1K0O A;  2H72 A;  1XCC A;  4K6X A;  2H19 A;  1OKT A;  2PPT A;  5GSS A;  4KSM A;  1I9D A;  1PKW A;  1XW9 A;  2GSQ A;  5D9X A;  1BX9 A;  1TW9 A;  4GSN A;  2KUC A;  2X64 A;  1VF2 A;  4KCA A;  5IPH A;  3F4T A;  1R5A A;  2DJ1 A;  1EZK A;  3CYN A;  4TR1 A;  4KDY A;  2O87 A;  1O7U A;  5DCG A;  1SK1 A;  3BBY A;  3KIJ A;  3TCO A;  2NBS A;  3IA1 A;  1QK8 A;  2V2G A;  4HI7 A;  4MF7 A;  1J9B A;  3I9V 2;  2PUK C;  4OMV A;  3I6A A;  1Z6N A;  1SK2 A;  1R7H A;  5AIV A;  5G5F A;  1PD2 1;  2AUV A;  4PX1 A;  1LBK A;  4MJA A;  3ZLP A;  3GKM A;  6GSV A;  4K9Z A;  4OFN A;  5GST A;  2DML A;  2H1A A;  4QQ7 A;  3VWU A;  2C0E A;  3KTL A;  5IIZ A;  1SD9 A;  2FWG A;  4GLT A;  5D8I A;  1OKD A;  2A4V A;  5DJM A;  5ECL B;  5D9T A;  4TR0 A;  1TTZ A;  2H1D A;  4Q5Q A;  1I5G A;  1Z5Y E;  4L0W A;  2YAN A;  3EMP A;  2HZF A;  6GSY A;  4XCS A;  5KN3 A;  1ERU A;  4TOP A;  1VF4 A;  4PGT A;  2PN8 A;  4POL A;  5ID2 B;  2DSA A;  5G1K A;  1YQ1 A;  3UVH A;  4AGS A;  1TU8 A;  1NW2 A;  4V2N A;  4KE3 A;  3IXR A;  2XC2 A;  3ZIT A;  1K0D A;  3TB2 A;  3TKR A;  2LTK A;  5A4W A;  2K8S A;  1KBN A;  1GTB A;  3EYT A;  1VGL A;  1ZGN A;  3F3R A;  1ZCP A;  1GSF A;  2GVP A;  2OE1 A;  3HJO A;  3US3 A;  4F03 A;  4TXO B;  2MMO A;  1E6B A;  1EV9 A;  3IHQ A;  1GSQ A;  4KW6 A;  2WGR A;  5G5E A;  4ISD A;  2VCZ A;  1PGT A;  2LRC A;  2MMA A;  3AY8 A;  1GRX A;  4KGI A;  2CQ9 A;  2LNS A;  2CVD A;  3CXG A;  2HFD A;  4F0B A;  1OC3 A;  3H8Q A;  1EP8 A;  2FY6 A;  2JSY A;  3MSZ A;  1SU9 A;  4K7I A;  4J56 E;  2JZT A;  1XZO A;  2TIR A;  1KNG A;  4LL4 B;  1K0N A;  3RPP A;  3EMX A;  3M8N A;  3GUS A;  3ZML A;  4KSO A;  4ZB9 A;  2GGT A;  4AJ8 A;  3EE2 A;  3UMA A;  4PUF C;  2YZU A;  2KHP A;  2QC7 A;  3CTF A;  7GSS A;  4ZBD A;  1SJZ A;  1NM3 A;  1TU7 A;  3TKS C;  2F8A A;  1PA3 A;  1FVJ A;  3BOA A;  1FO5 A;  5HFI A;  3GL5 A;  2GST A;  4RI6 A;  4XHM A;  3HVX A;  2PBJ A;  4O32 A;  2ON5 A;  1FHE A;  5HR0 A;  2ZUP A;  3F6F A;  5A5K A;  1YEP A;  3QD9 A;  4XS4 A;  2VLV A;  1QXH A;  2O7K A;  3QPM A;  5LNK e;  5ID2 A;  1QUW A;  3D5J A;  2RM5 A;  1HNC A;  3IAM 2;  2ZNM A;  3GUR A;  5F8B A;  1AQW A;  2VD1 A;  2IWT A;  3P2A A;  5CRG A;  3DD3 A;  1OC8 A;  3FZ4 A;  2YPM A;  2LS5 A;  2WZ9 A;  3LGC A;  1FVK A;  1X5D A;  3ERF A;  4POM A;  5EPF A;  3E3E A;  1XFL A;  1W89 A;  2LNT A;  5ECQ B;  3VUR A;  2JSZ A;  1UA5 A;  5B6M A;  2B5X A;  3C71 A;  5ENU A;  3TKQ A;  5ECM B;  5B6N A;  3JCM L;  17GS A;  2BTO T;  3H93 A;  4XRD A;  3CSI A;  4ACS A;  1GSE A;  3GTU A;  3RBT A;  14GS A;  2AAW A;  1N8J A;  1PX7 A;  1A2L A;  2VO4 A;  1G6W A;  4GQF A;  1WWJ A;  1GLQ A;  1MD3 A;  3D22 A;  4X0X A;  4F0C A;  5IQY A;  1GTA A;  4Z7X A;  3KP8 A;  4V2L A;  1T7P B;  2CAI A;  4DSR A;  1SKW B;  3EU3 A;  5ECO B;  3QFB C;  4D73 A;  2FCH A;  1F9M A;  1K0B A;  3HD5 A;  2RII A;  3L9S A;  3HZ4 A;  4AF2 A;  5DAL A;  3VI5 A;  2VM2 A;  5ELA A;  2YCD A;  1OE8 A;  5JWO B;  3ZMK A;  3DRN A;  5ECK B;  1EEJ A;  4WET A;  2RLI A;  1K3L A;  1T4Z A;  4IEL A;  3GKK A;  5F06 A;  1EOH A;  1GWC A;  1Z6M A;  2RM6 A;  1G0T A;  1NHY A;  2H70 A;  2VM1 A;  2IMK A;  2NTO A;  1U87 A;  4XS4 B;  1ST9 A;  3A2X A;  2CAQ A;  1XW6 A;  1A23 A;  2XPD A;  2L59 A;  2JZS A;  4MF5 A;  2C8U A;  5HR1 A;  4EF0 A;  1JHB A; 
#chains in the Genus database with same CATH topology
 4G0L A;  3BLZ A;  4HU7 A;  3RHC A;  4EL1 A;  2MBT A;  2IPA A;  3ZFL A;  2LV3 A;  12GS A;  2M80 A;  1XBS A;  4IPB A;  4WKW A;  1NO3 A;  2GT6 A;  1NHO A;  1O7N B;  3X3Z A;  4E8E A;  3G7I A;  4MEI A;  1GUH A;  6STD A;  2LRT A;  3OWY A;  2P09 A;  4HS1 A;  3UAR A;  1BU4 A;  2F3M A;  3DMC A;  3VWX A;  3PIN A;  4MZW A;  4MJD A;  3GHA A;  1G6Y A;  1K0A A;  1YZX A;  2FNO A;  1FGT A;  1OF5 A;  2GBW B;  3CNX A;  4K1V A;  2VOC A;  2DBC A;  2GZZ A;  5AGY A;  5TGN A;  3V99 A;  1N5H A;  1GOV A;  2H8L A;  2E2M A;  4TR4 A;  1YKA A;  3H79 A;  4R80 A;  3MYD A;  4KF9 A;  1VQ6 3;  4PUA A;  1F3B A;  1A8Y A;  1XG8 A;  4KFF A;  1D6Y A;  1SPU A;  3PR8 A;  3GZB A;  2QSI A;  5EEO A;  5E4W A;  2XGN A;  1H75 A;  2HI7 A;  4I6X A;  1HQO A;  4LA1 A;  1A2M A;  3KXO A;  2RSX A;  4X43 A;  1EG9 B;  3KEB A;  3FF2 A;  3KSE D;  1R4C A;  1Q7Y 4;  2D2Z A;  1U6T A;  2OAD A;  3MAK A;  1VZZ A;  2WB9 A;  2X8H A;  2IME A;  3ZL5 A;  2LQQ A;  1W6G A;  5D9V A;  5BVB A;  5JPU A;  2XSO B;  2B1L A;  3C7M A;  1GMP A;  1TTO A;  3J7Y d;  3ZG5 A;  3UB1 A;  2ES7 A;  3QCP A;  3N8B A;  1SKS B;  1JLW A;  2GTU A;  2K3D A;  4WEY A;  1OAZ A;  5C04 A;  4IQA A;  2OAC A;  3NQZ A;  7GSP A;  4E8H A;  1UUG B;  1QGV A;  1BSE A;  4ZB8 A;  3A5E A;  1A90 A;  4HJM A;  1CQG A;  3CCL 3;  2LEG A;  4JZQ A;  1V2A A;  2FA8 A;  3LH4 A;  1URM A;  2RUE A;  1UVZ A;  5F05 A;  5DQY A;  2GSP A;  4USS A;  1OCV A;  1GP1 A;  1QAF A;  3BNE A;  3UL5 A;  2A15 A;  5BRT A;  3BNB A;  5CLK A;  3UVT A;  1GYB A;  5D83 A;  2OKA A;  4R9L A;  1NDO B;  5DCH A;  4I2T A;  5B8B A;  3MKI A;  3W8S A;  1WMO A;  1W2Z A;  3OXA A;  1MDJ A;  1JB2 A;  1V98 A;  2YP6 A;  2IN3 A;  3TRQ A;  3CMI A;  2HT9 A;  1B48 A;  3K9M C;  1F37 A;  1ZYE A;  3F9U A;  3IOS A;  3QAW A;  4KDX A;  3MHE A;  1DSB A;  1X5C A;  2ML5 A;  4FYC A;  1RLS A;  4O7H A;  2H1B A;  4HM5 B;  5IO2 A;  2HMK B;  1Y6E A;  2V1L A;  1S72 3;  1B2X A;  2W56 A;  3MWH A;  1Y25 A;  1B27 A;  1JV2 B;  4GB5 A;  2RNT A;  2WO0 A;  1G7O A;  1B2S A;  4NRE A;  5ELJ A;  5AYS C;  4FR9 A;  1K9M 4;  4G19 A;  1UGI A;  2I9H A;  1PU4 A;  5KOW A;  1ILO A;  1JZD A;  3EX9 A;  3CCU 3;  1DE2 A;  1GSY A;  2B1K A;  2GZP A;  3Q90 A;  2DJ2 A;  4PQI A;  2CC3 A;  3TJB A;  3RDW A;  3UJ1 A;  2E2V A;  3FLJ A;  4GTU A;  4V1A p;  2GQL A;  5IMV A;  3VSY A;  3GAX A;  4DVC A;  1JN5 A;  3PGT A;  1EP7 A;  4BIR A;  3VK9 A;  4K2D A;  4ECC A;  1ULJ B;  2DIY A;  3IC4 A;  3A5W A;  3WGX A;  1BRH A;  2STD A;  3DEX A;  1LU4 A;  1AQX A;  2ON7 A;  4EVM A;  5KN2 A;  2C0D A;  2HMO B;  2C3N A;  5JBS A;  3VF1 A;  3A2V A;  2SBL A;  3KE7 A;  2OCT A;  2PER A;  2GQK A;  3GKX A;  2HYX A;  1YNV X;  2K54 A;  1W01 A;  2OTL 3;  1N9J A;  1YHQ 3;  2EIR A;  4Z2U A;  1JZW A;  4TRX A;  2Z6B A;  5LCZ A;  2AAE A;  4O5Q A;  4O02 B;  3HCZ A;  3LWA A;  5AIG A;  1UC7 A;  5DQS A;  3VFI A;  1T2I A;  3M0F A;  3KCM A;  1ASK A;  1BSC A;  3EE1 A;  4NHZ A;  3ME7 A;  5ECH B;  3HXS A;  2OTJ 3;  2VLU A;  4DSS B;  4XRA A;  3DWV A;  1TJD A;  2R3X A;  2KLX A;  1BG5 A;  1CQH A;  1SJW A;  2ZDJ A;  3VWV A;  3IR4 A;  2KRT A;  4JE1 A;  4WF4 A;  4EW5 A;  1DMQ A;  2J9H A;  4X2O A;  4IJ3 A;  4NMU A;  4L5O A;  5ECR B;  2MMZ A;  4X4J A;  2GT5 A;  3DGM A;  1UCK A;  2YFJ B;  2HZE A;  4WXT A;  3UIW A;  5L71 A;  4TW5 A;  1A24 A;  2GSR A;  1Q9E A;  2A2R A;  5FW5 A;  2X4A A;  1RW1 A;  3V92 A;  2W9Q A;  2LQO A;  3DKS A;  2E7P A;  2X49 A;  3IHG A;  1KSI A;  4R9K A;  1SII A;  4RQR A;  3UEM A;  2K6V A;  2C1Y A;  3E9J B;  2K18 A;  1XIY A;  2LKU A;  2PU9 C;  3HVS A;  3LML A;  5AI1 A;  2PVO C;  4TN8 A;  3ZIJ A;  4RNT A;  3LYG A;  3Q18 A;  4MJE A;  3GRX A;  2YV9 A;  3SYU A;  1UN2 A;  4JBB A;  5GSP A;  3S5C A;  1V57 A;  3FSD A;  2RGQ A;  2BMQ B;  1VQP 3;  4JF8 A;  4OUQ A;  2YJH A;  3AMO A;  4I97 A;  3DXB A;  2AAD A;  1M2A A;  2OBK A;  3GZY B;  2ML6 A;  2VIM A;  5IMF A;  4MMX B;  9RNT A;  3F63 A;  4EO3 A;  3GSP A;  2CZ2 A;  2JDI H;  2WS2 A;  4CY8 A;  1O81 A;  5INY A;  2O8V B;  3ZG0 A;  2P38 A;  6GSU A;  8GSS A;  2FHE A;  4N6L A;  4OO5 A;  1N8Q A;  1X9S B;  2C3T A;  5JCU A;  2KCD A;  4OK0 A;  2VAF A;  3X3X A;  2MF7 A;  4MMZ B;  4IKH A;  5RNT A;  3HZ8 A;  4BVX B;  1A67 A;  4HDE A;  1OUN A;  2L6C A;  2I81 A;  4J2F A;  3S29 A;  3K5T A;  2Z77 A;  2LUS A;  4J5G A;  2CFK A;  3I0Y A;  1BNE A;  1UDI I;  3P7X A;  3Q2P A;  3ZFB A;  1CEW I;  2RUF A;  1M9G A;  4HZ4 A;  1B9Y C;  1ISK A;  5AEU B;  2F5M A;  4NXI A;  2HRN A;  1WMP A;  4CY6 A;  2XSH B;  7RNT A;  3X40 A;  2EC4 A;  2V41 A;  1M2D A;  4MH2 A;  1UCJ A;  3WDG B;  3M1G A;  1A2K A;  4ZIL A;  2CX4 A;  1FB6 A;  1O8W A;  4L8E A;  4TVE A;  5HGR A;  3TJG A;  1TK5 B;  1XVQ A;  4EIQ A;  3GFK A;  1ACV A;  4BTY A;  3GYK A;  4J57 E;  3H3H A;  3UL6 A;  5IF6 A;  2DMM A;  2WJU A;  4GF0 A;  3PH9 A;  4JR6 A;  4NV2 A;  2ALB A;  4O5R A;  4GXZ A;  4FYU A;  1R5P A;  6GSP A;  3PYJ A;  3GRD A;  4J9A A;  4OD7 A;  4HM8 B;  2R4V A;  2OE3 A;  1LXE A;  1U3A A;  4MZC A;  3ZTL A;  4FMD A;  1IU7 A;  3L0R A;  3QFA C;  2P31 A;  4I8B A;  3ERW A;  2H6X A;  3Q6O A;  2FUG 2;  3F8U A;  3TOT A;  4N6T A;  1C54 A;  6GSX A;  1U8C B;  5EY6 A;  2XR8 B;  3LJR A;  5KN0 A;  4XBT A;  1SYX A;  5D96 A;  2Z7A A;  1JZR A;  1BJX A;  4PNG A;  1IV9 A;  2UGI A;  1IVU A;  3KD0 A;  2GS3 A;  3N9H A;  3HKR A;  5HQP A;  4ULX A;  1GSP A;  1YDK A;  5DDL A;  1TP6 A;  1HNB A;  2TRX A;  3L9V A;  3SOY A;  3UBK A;  1GSU A;  1RSN A;  3TKS E;  3A3T A;  2IFQ A;  2G2Q A;  4PUR A;  1DVD A;  1B4P A;  2FWF A;  2F86 B;  13GS A;  4I5Q A;  3DXO A;  2VCV A;  5CNW A;  4CHS A;  2PWJ A;  4EYC A;  2L1S A;  4RNY A;  1PX6 A;  1KQS 2;  3ED3 A;  3PPU A;  1W4N A;  3RGA A;  1Q82 4;  1YIJ 3;  5ELG A;  3GH9 A;  4K0G A;  4N11 A;  1LOW A;  2GU3 A;  3I56 3;  2LRN A;  1TI1 A;  2IIY A;  3FZ9 A;  1NB5 I;  4X1U A;  4IN0 A;  3KMN A;  4ZBA A;  4EE0 A;  1ZYQ B;  2YV7 A;  1ZMA A;  5STD A;  2CX3 A;  5DAK B;  4KDU A;  2REM A;  5EQL A;  3CRT A;  2W9P A;  4MAB A;  2HML B;  4QL7 A;  5LC6 A;  1GTU A;  4Z2T A;  3FR3 A;  4NAX A;  2R0C A;  3NV0 A;  2CT6 A;  1WNH A;  4MP4 A;  1GTI A;  1ML6 A;  6GSW A;  2B7J A;  4BTW A;  2K8V A;  2R41 A;  3LTB A;  3EIN A;  4FMB A;  5ECS A;  3S9F A;  1XXU A;  5EL8 A;  4GSS A;  3U5R E;  4J5K A;  3EB8 A;  4HUA A;  3EPT A;  3TKP A;  2FNQ A;  3S67 A;  2C4J A;  4MMM A;  3APS A;  4HEA 2;  4PQ1 A;  4L8P A;  3LFL A;  1JRQ A;  1XW5 A;  1CH0 A;  5JCG A;  1BSA A;  2FLS A;  3G8Z A;  4K5R A;  4D73 B;  1GD3 A;  16GS A;  5AEW B;  4WHA A;  2PNC A;  4FH8 A;  3TJF A;  3W6G A;  1IYI A;  5CK6 A;  3LYK A;  4IGJ A;  2H0H A;  1B4Q A;  5M19 A;  3F6D A;  1ROV A;  4WR4 A;  1IQX A;  1TKD B;  5H5S A;  2IJY A;  3GIX A;  3ZVJ A;  4IBP A;  2KXG A;  4AJ7 A;  2O85 A;  1GD4 A;  3L4N A;  4KB3 A;  2H1G A;  3KZT A;  1GLP A;  4TR1 B;  3G71 3;  3TGZ A;  3FZA A;  1KD1 4;  1TDI A;  5DBQ A;  2VCW A;  5H5Q A;  3F3Q A;  2R5G A;  1WTH A;  3EN8 A;  1WIK A;  3CTG A;  2WRT A;  3G7Y A;  2YWM A;  4HM7 B;  4N30 A;  1BNF A;  3CCE 3;  4JU5 A;  5A4V A;  2PMT A;  3P90 A;  1TRW A;  4IJI A;  3APQ A;  3FY7 A;  3PS8 A;  4BWQ A;  3CXC 2;  3GSS A;  1WE0 A;  5DJL A;  3MWZ A;  4HM2 B;  5CP1 A;  3HX8 A;  1G96 A;  4N6O B;  3CCR 3;  1AR0 A;  4OVM A;  1J0F A;  1JB5 A;  3EJV A;  2MBS A;  1Z7P A;  4YAP A;  3DGO A;  1I70 A;  5IG3 A;  3FZW A;  1QMV A;  4MK3 A;  3K8N A;  4KVH A;  2W04 A;  1PFO A;  3WYW A;  1PRX A;  3SLU A;  4QWT A;  3A2W A;  2WOF A;  1UI8 A;  1GSD A;  2KAA A;  2V6K A;  2N5F A;  1RQM A;  4KND A;  3TRP A;  4ZL8 A;  1ZZY A;  4PTS A;  1X1Y A;  3NM2 A;  2WGO A;  2KOK A;  4WBJ A;  3GX8 A;  2A2P A;  1H4O A;  3LT8 A;  4FMA A;  1MGW A;  1PFP A;  4FIW A;  5AYR B;  3WGD A;  4AJ6 A;  5IEP A;  2Z76 A;  5J4U A;  2OQE A;  1B20 A;  2HRK A;  4HSC X;  1XWG A;  4K8M A;  2BJX A;  2M46 A;  4GWR A;  1XWA A;  3CD6 3;  2E0Q A;  4EDY A;  2HSH A;  3FW2 A;  2LJR A;  3VPQ A;  1SL1 B;  4G1M B;  1K0M A;  1I2E A;  2OOV A;  2X8C A;  4DEJ A;  1T2H A;  2ZA4 A;  4HU9 A;  1EUI C;  1Q7H A;  3EHC A;  3O76 A;  2HE3 A;  4MCU A;  2FD3 A;  4MDC A;  2KF5 A;  1LQM B;  2P0G A;  2R2J A;  3IMA B;  1JBS A;  1YKC A;  4RNZ A;  2H01 A;  2YNX A;  1BSB A;  3IV4 A;  1THX A;  3LTD A;  4GCI A;  3NOF A;  1HYF A;  3R2Q A;  3FH1 A;  1AW9 A;  1TI3 A;  1L5G B;  5HR3 A;  3FYG A;  1E97 A;  5IMZ A;  2XHF A;  4BL2 A;  4LL1 B;  1U3I A;  2DJK A;  2H6Y A;  3GMF A;  3V1W A;  4EUY A;  20GS A;  4YQM A;  4X2H A;  5G2Z A;  4LMV A;  2W03 A;  1SJ6 A;  4IW9 A;  1YVB I;  1GH2 A;  2QA1 A;  2E2U A;  3QAV A;  5KN1 A;  3VWW A;  3SWL A;  1IV7 A;  1BRG A;  2IMF A;  4JED A;  2KP1 A;  1TK8 B;  1B2U A;  2IMJ A;  3U1W A;  4KUN A;  4OWY A;  1SIH A;  3TOU A;  3UAP A;  3T0U A;  4LZI A;  2MMN A;  1JLV A;  3LTA A;  3KSP A;  1OHO A;  3CC2 3;  1XWK A;  4GRF A;  4BWS A;  4ZXG A;  1W7C A;  2CG1 A;  2CVK A;  1NNV A;  1ZYP A;  1AVL A;  3B4O A;  3B4P A;  3CC4 3;  5IMC A;  2C0G A;  1NJI 4;  1F6M C;  3ZZX A;  1A8L A;  1YGE A;  2H30 A;  4KA0 A;  2XF3 A;  3H1N A;  4ECI A;  1O85 A;  5ECN B;  3WGE A;  3G16 A;  3N54 B;  3MDK A;  1PN0 A;  5DVB A;  4WF5 A;  1TK0 B;  3TDG A;  2P0X A;  1VQ8 3;  1S5A A;  4N6M A;  3MG1 A;  3DGQ A;  1MEK A;  5JWQ B;  5M18 A;  4F9Z A;  1WRY A;  3NX0 A;  2OOV C;  5AIH A;  2XFS A;  4H86 A;  1V58 A;  5IER A;  2QIY A;  1V40 A;  5D93 A;  1SKR B;  1PL1 A;  3FGY A;  2F99 A;  3LEF A;  1OGZ A;  1GOY A;  1FW1 A;  1GMR A;  2JU5 A;  3KZQ A;  2CZ3 A;  2CKF B;  1X1U A;  5E59 A;  5CXO A;  5FT3 A;  3PCS A;  3ZRE A;  3RNT A;  1R4Y A;  9GSS A;  1ON4 A;  4WR5 A;  1LOY A;  1SYR A;  1CQS A;  4LMI A;  1JBT A;  2YJ7 A;  5CRE A;  2I9W A;  1S3R A;  2CVB A;  2QGV A;  3LZA A;  5G31 A;  1I2G A;  1B2M A;  1M99 A;  1JZO A;  4MLY A;  1JN5 B;  3BJ5 A;  4ZL9 A;  1GUM A;  1Q98 A;  1T00 A;  1ABA A;  5J3R A;  2KF4 A;  3EUR A;  2VCT A;  5FWG A;  2IYJ A;  3M9K A;  3H4K A;  5EVH A;  3I69 A;  1GY7 A;  4HBR A;  1TRS A;  3GX0 A;  2K9F A;  3EWL A;  1EGR A;  3NXJ A;  3FZ5 A;  2IA7 A;  3WD6 A;  3DGY A;  3DVW A;  1OC9 B;  3HZP A;  4YKG A;  4KAE A;  2GQM A;  3FG4 A;  3OWU A;  2FWH A;  1Q40 B;  1IQ8 A;  3AGO A;  3F0I A;  2X8G A;  4G2E A;  1OF5 B;  1AQZ A;  3BIR A;  3MIX A;  3FKF A;  1M2B A;  4EDZ A;  4BTX A;  1IVV A;  1M9B A;  1SL0 B;  1S3D A;  5KEJ A;  4BIK A;  2WUL A;  4HM4 B;  4HQS A;  4HZ2 A;  1ERV A;  1XOA A;  1FA3 A;  4HM0 B;  19GS A;  2X99 A;  2NVL A;  3M3M A;  5F07 A;  1DET A;  3L0H A;  2VL2 A;  1SAR A;  4MZB A;  4H61 A;  5G2G A;  3QOU A;  3LSZ A;  1RK4 A;  3Q1C A;  4L7K A;  3EVI A;  3HHV A;  3ZIV A;  5IO0 A;  2H75 A;  4YQV A;  5AIS A;  4ZL7 A;  1GSS A;  5IEO A;  2RBI A;  1VQ4 3;  2YOI A;  5HFG A;  4J8T A;  3NIV A;  1EOG A;  2VD0 A;  2QGU A;  2GEY A;  4FQU A;  4WFO A;  1J08 A;  2C3Q A;  2CFD A;  3EQQ B;  1K0C A;  2VCQ A;  4F82 A;  1MTC A;  1EGO A;  4MPF A;  3WOF B;  2F51 A;  2GXF A;  2ZCT A;  3GTU B;  3UBL A;  3GH6 A;  1I2F A;  3KN4 A;  2VLT A;  3SXX A;  2H71 A;  1MWT A;  10GS A;  1S3A A;  1B8X A;  2HXK A;  1PY3 A;  3D79 A;  7STD A;  3ERG A;  4IQ1 A;  2V6O A;  1T4Y A;  3KP9 A;  2CV4 A;  4RQX A;  18GS A;  3TUE A;  2AJQ B;  1A0F A;  4XS6 A;  2A2S A;  1Q42 A;  1FW7 A;  5DAK A;  4N0V A;  5FHI A;  3NBR A;  3HII A;  4AKY A;  1FG4 A;  1QFN A;  2NPB A;  3JUN A;  1VQK 3;  2LJK A;  3NHX A;  2WFC A;  1TUH A;  5IW9 A;  4YAV A;  1RDS A;  1T3B A;  2C0F A;  3C1R A;  1Z9H A;  2DJ0 A;  4CW9 A;  1VQ9 3;  3P8W A;  1N5P A;  1OYJ A;  3IK7 A;  1Z7R A;  3NZN A;  1KTE A;  5CO3 A;  3G4S 3;  3MSO A;  4JRR A;  2P0M A;  3F4R A;  3EU4 A;  2HLS A;  1VRS D;  1V74 A;  2BHM A;  4MA9 A;  2VL2 C;  1VF3 A;  5IM9 A;  4OFT A;  4XS1 A;  4GSP A;  4AKZ A;  2H66 A;  3HY2 A;  4IIA A;  1Z3E A;  2BMX A;  3MPH A;  2QKE A;  1K28 A;  4ID0 A;  5IOX A;  3HVN A;  4HQZ A;  3S27 A;  1ZOF A;  3L78 A;  3N9J A;  2GU1 A;  1GNE A;  2H76 A;  3RHB A;  4K7N A;  2HOH A;  5IEN A;  1BUJ A;  11GS A;  4ILF A;  3UOM A;  3F8X A;  2HMM B;  4ECJ A;  4O8S A;  4K61 A;  2OBI A;  5HFK A;  4OCE A;  2NDO A;  1KWI A;  2Z9S A;  1DVC A;  1FUW A;  3WA2 X;  1LOX A;  1ZX2 A;  2UUG C;  3C8E A;  1BIR A;  4BPY A;  3UL3 A;  3LTC A;  5CRD A;  5D73 A;  5AN1 A;  1MNL A;  3KH7 A;  3C1S A;  1GNW A;  2B5Y A;  1IK3 A;  1M3I A;  3FCS B;  1DE3 A;  5ELU A;  1TRP A;  2C10 A;  4V2M A;  1M9A A;  4N10 A;  1GMQ A;  1HNA A;  1WMN A;  4CPK A;  1R26 A;  1US1 A;  1WJK A;  3ZRD A;  3BD2 A;  4Q5F A;  1B3S A;  1YGW A;  2B24 B;  5KP1 A;  1WPI A;  4HM3 B;  3D4M A;  3VI7 A;  2GDR A;  4IP1 A;  3CCS 3;  4XIH A;  1BRI A;  3IDV A;  1XWB A;  3CSJ A;  4LEH A;  4L5L A;  1D6Z A;  2H74 A;  2DKI A;  1B9X C;  3WT2 A;  2AV4 A;  1QAK A;  1IT8 A;  2O89 A;  4KX4 A;  1OE7 A;  4EXR A;  1FB0 A;  2FWE A;  4K1F A;  1JB4 A;  1TOF A;  3WOD G;  4MJB A;  1MDK A;  2SAR A;  3GZR A;  2DC5 A;  4KH7 A;  4CDO A;  1GUK A;  1K3O A;  3GV1 A;  2W0Q A;  1X9M B;  2OWP A;  3TJK A;  3KM6 A;  2OJL A;  3FR9 A;  4XTS A;  6GST A;  1T5Y A;  4GST A;  5A4U A;  1X5E A;  4EKZ A;  4PEJ A;  3IAS 2;  4HJ2 A;  2AB6 A;  4RUV A;  3LOY A;  2KF3 A;  5JCW A;  2VCX A;  4RBN A;  1LNI A;  3RPN A;  3F40 A;  1DBY A;  3BB9 A;  4EC6 A;  1W6Y A;  1M3J A;  1RJO A;  5G30 A;  4XB5 A;  1SD8 A;  3DIE A;  3KJY A;  5KP4 A;  3HDC A;  3RAZ A;  3K7C A;  2L5L A;  1TU5 A;  2HRF A;  2CFG A;  2DJJ A;  3IRA A;  4GQC A;  2YWI A;  5ECP B;  2V32 A;  4POB A;  4LSO A;  2AHE A;  2MYG A;  4EIP A;  2IUJ A;  1VQO 3;  4N0Z A;  4TR3 A;  4BVY A;  1BRN L;  3LYP A;  3O6T A;  5HOH A;  4IP6 A;  4TX4 A;  1YY7 A;  1UUW B;  3CNM A;  3AMO B;  2YWO A;  1C7H A;  3HA9 A;  1RGL A;  4TXO A;  1XOB A;  1A2P A;  1SK0 A;  2F9S A;  3QAG A;  4P3Y B;  5GAP D;  4HM1 B;  1VQ7 3;  1UI7 A;  1RMS A;  4ML6 A;  2PGT A;  2IMI A;  4LMW A;  2YFI B;  3D6I A;  2WDU A;  4K5S A;  1W6C A;  5CYY A;  3KFQ C;  2P5Q A;  1IVW A;  3HJP A;  3NUV A;  4KFE A;  5F0G A;  3BCK A;  2H0G A;  1HD2 A;  2HZE B;  3OW2 2;  5IG5 A;  3PGB A;  1PN9 A;  8CHO A;  5B7C A;  1FOV A;  1LVN A;  3QRD A;  4NPB A;  1K73 4;  3GA4 A;  3FRC A;  3WMD A;  2VUP A;  3WA3 A;  3JUQ A;  3FG1 A;  1D6U A;  1VQL 3;  1E3R A;  1BNI A;  2M7O A;  1IT7 A;  3T8U A;  5H5R A;  1K41 A;  1STF I;  3KTB A;  1TP9 A;  3TJJ A;  1LOV A;  1FUS A;  1KEB A;  4YQU A;  2D42 A;  2XBQ A;  1U88 A;  4DSS A;  4O3V A;  1BYE A;  4MH3 A;  3ALA A;  1OVN A;  5GAN D;  8RNT A;  1OC9 A;  2JL4 A;  2B6M A;  3M9J A;  2XGL A;  1AAZ A;  1ZGX A;  1O7G B;  3FEU A;  1QMA A;  3ZFZ A;  4V1A g;  4FO5 A;  4BL7 A;  3CQF A;  1X1W A;  3GKN A;  3KH9 A;  1O8X A;  1SJI A;  2LST A;  3FK8 A;  4YH2 A;  1Q40 A;  2L4V A;  3D5I A;  2C11 A;  3D3L A;  4NHW A;  1I0X A;  2FGX A;  4ECB A;  3HOH A;  4DKI A;  4TKY A;  3QMX A;  2JAC A;  3D21 A;  2J23 A;  2YZH A;  1M0U A;  1GY5 A;  2JAD A;  2IY2 A;  4O2H A;  3W8J A;  1M90 4;  2JQ5 A;  5IOW A;  3A5I A;  1BNJ A;  1BAY A;  3DML A;  4Q5N A;  4YKF A;  5D9W A;  1EEM A;  4XBY A;  4HJL B;  4EXJ A;  1AUC A;  2M72 A;  1F2E A;  1RHL A;  1N8R 4;  3EC9 A;  1Y4K A;  3EBT A;  4EBG A;  1RGA A;  3E0U A;  4EV2 A;  4OO4 A;  3APO A;  3GN3 A;  1BAO A;  5DRV A;  1O73 A;  3EN1 B;  2IMD A;  5G1L A;  2EIQ A;  1JFU A;  1BAN A;  2J8X B;  3PCR A;  2GZY A;  1Q86 4;  1AQV A;  4L8O A;  2KP2 A;  1PYL A;  2GSS A;  4FYB A;  4L0U A;  2L57 A;  3TKS A;  1PKZ A;  3HVV A;  2B3S A;  2CFL A;  1LJR A;  2HSY A;  3MG3 A;  3IE3 A;  2H6Z A;  4HOH A;  4FCZ A;  1G02 A;  2L4Q A;  3KII A;  4K0N A;  4PNF A;  2TRC P;  2XBI A;  1BUQ A;  2HRA A;  3FG3 A;  2EIO A;  1T8E B;  1V9W A;  1VF1 A;  3M8C A;  5JPP A;  5AIX A;  2VL9 A;  4BVX A;  1FOH A;  5J5N A;  1S3C A;  3GL3 A;  5HR2 A;  3EC3 A;  3JUO A;  5IMA A;  3KGK A;  3F9S A;  4XM4 A;  1RCL A;  1BRS A;  3D4T A;  2MZC A;  1W2B 2;  3K0Z A;  4K1U A;  1SL2 B;  1JKG B;  1BNG A;  4WBR D;  1OHS A;  5B8A A;  1RTU A;  1W00 A;  1KC8 4;  1M7T A;  2CWV A;  3ME8 A;  3LT9 A;  1RNT A;  5ECI B;  5CRH A;  4WWU C;  2YWN A;  4IHU A;  4N6U A;  1MDI A;  1G7E A;  5ABR A;  3F4S A;  4DSQ A;  1XWC A;  2HNL A;  2KF6 A;  1Q81 4;  2R0P A;  3WT1 A;  22GS A;  1MWS A;  2E2G A;  4RI7 A;  2CW9 A;  3DH2 A;  4MPG A;  4OCF A;  3Q19 A;  5FGO A;  4HZ9 B;  3C73 A;  4LLR A;  2DLX A;  2JZR A;  4ORL A;  3SBC A;  1IYY A;  4A5P A;  6GSS A;  3BND A;  3LOR A;  3ER7 A;  1BQ7 A;  3U6V A;  1ERT A;  5DAL B;  1FYS A;  1O7M B;  1ERW A;  2H0I A;  3NM7 A;  3NQY A;  3S28 A;  4GHO A;  3CBU A;  2HMJ B;  3RDE A;  1NB3 I;  1XPV A;  1TRQ A;  2QEX 3;  2YFL B;  1BRJ A;  4O92 A;  1RN1 A;  3KMO A;  4POK A;  1YJ6 A;  2YN1 A;  1VQQ A;  1BOX A;  4KCE A;  4ML1 A;  3GST A;  1UUV B;  1TRU A;  2FGT A;  1PSQ A;  4TXV A;  4G9H A;  4I2U A;  3PZW A;  4ZIJ A;  4MNN A;  1NWW A;  2CHC A;  4F2I A;  1YF0 A;  2OA7 A;  4PXO A;  4BA7 A;  1O7P B;  2I4A A;  3BCI A;  1HYU A;  5IMD A;  1F3A A;  3Q3F A;  1WMJ A;  4JR4 A;  2DIZ A;  3DY5 A;  1FAA A;  3J7Y b;  4K7O A;  1AC1 A;  4I4K A;  2P5R A;  2IFQ B;  5CF2 A;  4CCV A;  2XPE A;  5CRW A;  4OFM A;  3TRX A;  4XDW A;  4PQH A;  2N5B A;  2CA8 A;  1DUG A;  1PQN A;  2O3O A;  1BNR A;  4WYK A;  1K3Y A;  1RGF A;  1DE1 A;  1IQY A;  2QA4 3;  2B5E A;  1GOU A;  1W4V A;  4MF6 A;  3R3E A;  4EC0 A;  3IPT A;  1O6J A;  3QR6 A;  5COH A;  3ZYW A;  4BL7 B;  3F14 A;  1DYU A;  5DRE A;  1ZL9 A;  1QQ2 A;  3CU3 A;  1AXD A;  1AV4 A;  3DGN A;  4JRF A;  2LJA A;  1BNS A;  3O3T A;  5GZZ B;  2GLR A;  3G7J A;  4IVF A;  1WP0 A;  4U13 A;  2CWU A;  1X0R A;  3FHK A;  3IK9 A;  1GUL A;  4STD A;  2L5O A;  2B1X B;  4G10 A;  5IPG A;  3HYP A;  3LQ7 A;  3CSH A;  2BMO B;  1WOU A;  4H3U A;  1EV4 A;  4ZBB A;  4GL6 A;  1JJ2 2;  1YJN 3;  3FR6 A;  5EVO A;  3L9U A;  2OE0 A;  3MNG A;  5J9B A;  3LW9 A;  2B7K A;  1XVW A;  2G0F A;  3DVX A;  3LXT A;  5J41 A;  3ISO A;  5D81 A;  2F8F A;  2CX0 A;  3X42 A;  2VL3 A;  3D5G A;  5KOX A;  1EWX A;  2N5A A;  5LD0 A;  2R37 A;  1YEX A;  4IS0 A;  2PVQ A;  2FA4 A;  1STD A;  3H51 A;  3VLN A;  1USB A;  3Q74 A;  1LQG C;  2V1M A;  1X9W B;  3X3Y A;  3GWR A;  1I3F A;  3DYR A;  5CAX A;  3LXZ A;  4MJC A;  2WCI A;  2I3Y A;  4R4K A;  3GNJ A;  1SEN A;  5I97 A;  1IVX A;  5KP3 A;  1PMT A;  2H73 A;  4NWY A;  1THO A;  3UJM A;  1Q4J A;  1HU9 A;  4FCJ A;  1AIU A;  2AYT A;  5C00 A;  3I55 3;  1YF1 A;  2C80 A;  4Q5R A;  1GL8 A;  2QA2 A;  4ZB6 A;  3J7Y k;  1O7W B;  1A0R P;  3CRU A;  3IBH A;  3VPT A;  5J9C A;  2DJ3 A;  3IPZ A;  3D0Z A;  3N5O A;  2I1U A;  4NV5 A;  1IDP A;  2PZV A;  3F7S A;  2IL3 A;  2F5W A;  2XEP A;  2L6D A;  3WR2 A;  5A0O B;  1PL2 A;  1R4W A;  3QDN A;  1IYH A;  1FGM A;  1RNB A;  1N2A A;  1E2Y A;  5JWR B;  3DGL A;  1ZO2 A;  4HOJ A;  3G9B A;  3CMA 3;  1TRV A;  3ZVJ D;  1MGR A;  1NSW A;  3I43 A;  3OR5 A;  4QL9 A;  1YI2 3;  3LG6 A;  1RCK A;  1T1V A;  3HJM A;  1TXX A;  1C72 A;  2R6K A;  2F98 A;  3F8H A;  1MD4 A;  3LXU X;  2W56 B;  1BED A;  2CH9 A;  2O9U X;  3CPO A;  2L4C A;  2R4I A;  1A2J A;  3X41 A;  1K0O A;  2H72 A;  1EA2 A;  1XCC A;  3QK9 A;  4K6X A;  2H19 A;  1OKT A;  2PPT A;  5GSS A;  4KSM A;  1I9D A;  1PKW A;  1XW9 A;  2OQE C;  2GSQ A;  4BL3 A;  5D9X A;  1BX9 A;  1TW9 A;  4GSN A;  2KUC A;  2X64 A;  1B2Z A;  4XBX A;  1VF2 A;  4KCA A;  5IPH A;  1DMN A;  1FGO A;  1ZS7 A;  3F4T A;  1JBR A;  2MC8 A;  1R5A A;  3KKG A;  2DJ1 A;  3CCQ 3;  3HI7 A;  1M1K 4;  1E3V A;  1EZK A;  3CYN A;  4TR1 A;  4KDY A;  2UZ8 A;  1OGX A;  3FF0 A;  2O87 A;  1O7U A;  5DCG A;  1SK1 A;  3BBY A;  3KIJ A;  3TCO A;  1FZU A;  2NBS A;  1UGH I;  3IA1 A;  1JNQ A;  5CF1 A;  1QK8 A;  2V2G A;  4HI7 A;  4MF7 A;  2LYX A;  1J9B A;  2XH9 A;  5LC7 A;  3I9V 2;  1OAC A;  2PUK C;  1YIT 3;  4K2X A;  4HKV B;  4OMV A;  1BGS A;  3I6A A;  2E2T A;  1Z6N A;  3JVC A;  1SK2 A;  1R7H A;  5AIV A;  1A2V A;  5G5F A;  1PD2 1;  2AUV A;  4PX1 A;  5IG4 A;  4LGQ A;  4WYK B;  2R0G A;  1TIJ A;  3SOA A;  1Z1S A;  3D9R A;  2C4B A;  1RGC A;  3FKA A;  1LBK A;  4MJA A;  4KZ1 A;  2INX A;  1QJG A;  3F7X A;  3ZLP A;  3GKM A;  6GSV A;  4K9Z A;  4OFN A;  3OWS A;  5GST A;  1NU3 A;  1U5O A;  2DML A;  2H1A A;  3AHW A;  3SX1 A;  4QQ7 A;  2FXT A;  3UNL A;  3VWU A;  2C0E A;  3KTL A;  5IIZ A;  1SD9 A;  4RZM A;  2D1W A;  2FWG A;  4GLT A;  5D8I A;  2BT3 A;  1OKD A;  2A4V A;  2GEX A;  3JUM A;  1RRH A;  2BO9 B;  5DJM A;  5ECL B;  1W02 A;  5D9T A;  1UCL A;  4TR0 A;  1TTZ A;  1RGK A;  2H1D A;  3STD A;  3SED A;  1YJ9 3;  4Q5Q A;  1N9E A;  1I5G A;  1Z5Y E;  2CWT A;  4R1K A;  4L0W A;  1YJW 3;  5D82 A;  4ICY A;  3K63 A;  2YAN A;  3EMP A;  1I3I A;  1WQL B;  2HZF A;  6GSY A;  4XCS A;  5KN3 A;  1ERU A;  4TOP A;  1TFK A;  1FGQ A;  1VF4 A;  4PGT A;  1F8N A;  2PN8 A;  4POL A;  5ID2 B;  2YX9 A;  2A4H A;  2DSA A;  5G1K A;  1YQ1 A;  3ECF A;  2BIR A;  3UVH A;  4AGS A;  1UCI A;  3AGN A;  2CX1 A;  1TU8 A;  4N6N B;  1NW2 A;  4V2N A;  1HKX A;  4Q53 A;  4KE3 A;  3IXR A;  2XC2 A;  3ZIT A;  1K0D A;  3TB2 A;  3TKR A;  3EF8 A;  2LTK A;  5A4W A;  2K8S A;  1KBN A;  1GTB A;  3EYT A;  1AVK A;  1RGE A;  1QVG 2;  1QAL A;  1VGL A;  2BNG A;  1ZGN A;  3F3R A;  1ZYN A;  1ZCP A;  4BVY B;  1GSF A;  5BIR A;  5AIF A;  2GVP A;  2OE1 A;  3HJO A;  3US3 A;  4F03 A;  4TXO B;  2MMO A;  3WHO A;  1E6B A;  1I0V A;  6RNT A;  1EV9 A;  4ZM8 A;  3IHQ A;  1GSQ A;  4KW6 A;  2WGR A;  5G5E A;  4ISD A;  2VCZ A;  5BMU A;  3A76 A;  1PGT A;  2LRC A;  2MMA A;  3CC7 3;  2GBX B;  4N6V 0;  2XRX B;  3AY8 A;  1GRX A;  4KGI A;  2CQ9 A;  2LNS A;  2CVD A;  3CXG A;  2HFD A;  1GY6 A;  3NBJ A;  1W5Z A;  3CPW 2;  4F0B A;  1OC3 A;  3H8Q A;  1EP8 A;  2FY6 A;  2JSY A;  3MSZ A;  1SU9 A;  3B7C A;  4Z2R A;  4HZB B;  4G0I A;  4K7I A;  4J56 E;  4FCM A;  2JZT A;  3JUP A;  1XZO A;  2TIR A;  3CCV 3;  4K90 B;  1KNG A;  4LL4 B;  2HMN B;  1K0N A;  3RPP A;  3EMX A;  3U97 A;  3G0K A;  3WOE B;  3M8N A;  3GUS A;  1ROA A;  3ZML A;  4KSO A;  4ZB9 A;  1BVI A;  2GGT A;  4AJ8 A;  3PXM A;  1OH0 A;  1M1X B;  3G6E 3;  3CCM 3;  3CCJ 3;  3EE2 A;  2RCD A;  3UMA A;  4PUF C;  3OV4 A;  2YZU A;  2KHP A;  1K8A 4;  2QC7 A;  3CTF A;  2Y74 A;  7GSS A;  4ZBD A;  3BU4 A;  1SJZ A;  1NM3 A;  1TU7 A;  3TKS C;  4EV5 A;  2Q07 A;  3DUK A;  2CK3 H;  2DKH A;  1GS3 A;  2F8A A;  2ZL8 A;  1PA3 A;  1FVJ A;  4BU4 A;  3BOA A;  1FO5 A;  1CYU A;  5HFI A;  3GL5 A;  2GST A;  3URP A;  2IUK A;  4RI6 A;  4XHM A;  3HVX A;  2PBJ A;  4O32 A;  1JKG A;  3MG2 A;  2ON5 A;  4AEQ A;  3D4A A;  1FHE A;  5HR0 A;  2ZUP A;  1X1X A;  3F6F A;  5A5K A;  1YEP A;  2K0M A;  3QD9 A;  4XS4 A;  2VLV A;  1QXH A;  4LYL B;  1TFO A;  2O7K A;  1CYV A;  3QPM A;  5LNK e;  5ID2 A;  1QUW A;  3D5J A;  1SQW A;  1AY7 A;  4NHF A;  2RM5 A;  1HZ1 A;  4FMC A;  1HNC A;  1B21 A;  1RRL A;  2W6J H;  2ZNM A;  3GUR A;  3IAM 2;  1VQN 3;  5F8B A;  2BU4 A;  4HAA A;  1AQW A;  2VD1 A;  1O7H B;  3HIG A;  1VQM 3;  2IWT A;  1OHP A;  2CFW A;  1MOL A;  3DD3 A;  3P2A A;  5CRG A;  1OC8 A;  3FZ4 A;  2YPM A;  2LS5 A;  2WZ9 A;  3LGC A;  4N3V A;  1FVK A;  2F4Y A;  1X5D A;  4HYZ A;  3ERF A;  2F56 A;  3SVA A;  4POM A;  2Y73 A;  5EPF A;  2UX0 A;  3E3E A;  1XFL A;  1W89 A;  1VQ5 3;  3AHS A;  2LNT A;  5ECQ B;  2CIU A;  3VUR A;  2JSZ A;  1UA5 A;  5AII A;  4O5U A;  4MMY B;  5BU4 A;  5B6M A;  2B5X A;  3IJE B;  3C71 A;  2P05 A;  5ENU A;  3V98 A;  4CDL A;  3TKQ A;  2CG0 A;  3DZL A;  2WGQ A;  5ECM B;  1EQK A;  5B6N A;  1LNH A;  3JCM L;  17GS A;  2BTO T;  3H93 A;  4XRD A;  3CSI A;  3NV0 B;  4ACS A;  1GSE A;  3GTU A;  3RBT A;  14GS A;  5BXQ A;  2AAW A;  1N8J A;  1PX7 A;  1QVF 2;  1A2L A;  2VO4 A;  2LQV A;  1MWR A;  3E99 A;  1ULI B;  3HK4 A;  1G6W A;  4GQF A;  1UW1 A;  1WWJ A;  1GLQ A;  1MD3 A;  4G0K A;  3D22 A;  4X0X A;  4F0C A;  3FMW A;  5IQY A;  3KCH A;  1GTA A;  4Z7X A;  3MYT A;  1EKM A;  3KP8 A;  2WOH A;  1YVS A;  4V2L A;  1T7P B;  4CJN A;  1RGG A;  2CAI A;  4DSR A;  1SKW B;  1FGR A;  4XDV A;  1RN4 A;  1RGH A;  2W2C A;  3EU3 A;  3DM8 A;  3B8L A;  5ECO B;  4HVN A;  3QFB C;  4D73 A;  2FCH A;  1F9M A;  1K0B A;  3HD5 A;  2BMR B;  2RII A;  3L9S A;  3T8N A;  3HZ4 A;  1OPY A;  4AF2 A;  5DAL A;  3O8Y A;  4KT3 B;  3VI5 A;  4HM6 B;  3GZX B;  2VM2 A;  5ELA A;  3RGR A;  2YCD A;  1OE8 A;  2HSM A;  3BNC A;  5JWO B;  3ZMK A;  3DRN A;  5ECK B;  2ZHX B;  1EEJ A;  4WET A;  2RLI A;  1K3L A;  4WP5 A;  5M1A A;  1T4Z A;  1RKY A;  4IEL A;  2XFT A;  1BSD A;  3GKK A;  1DMM A;  5F06 A;  3IC8 A;  1FUT A;  1BRK A;  1EOH A;  3NBB A;  1GWC A;  1Z6M A;  2RM6 A;  1G0T A;  1NHY A;  2H70 A;  2VM1 A;  3CME 3;  4KFD A;  2IMK A;  1I8V A;  1MWU A;  2RFR A;  5IG0 A;  2NTO A;  1U87 A;  4XS4 B;  1ST9 A;  1LRA A;  3OX9 A;  1J2B A;  3A2X A;  2CAQ A;  1XW6 A;  1RN7 A;  1A23 A;  2XPD A;  3ROB A;  2L59 A;  2JZS A;  3VGN A;  4MF5 A;  4IT7 A;  3EBY A;  2C8U A;  5HR1 A;  4EF0 A;  1JHB A; 
#chains in the Genus database with same CATH homology
 4G0L A;  4HU7 A;  3RHC A;  4EL1 A;  2MBT A;  2IPA A;  3ZFL A;  2LV3 A;  12GS A;  2M80 A;  1XBS A;  4WKW A;  2GT6 A;  1NHO A;  4E8E A;  3G7I A;  1GUH A;  2LRT A;  4HS1 A;  3UAR A;  2F3M A;  3VWX A;  3PIN A;  4MZW A;  3GHA A;  1G6Y A;  1K0A A;  1YZX A;  2FNO A;  2VOC A;  2DBC A;  2GZZ A;  5AGY A;  2H8L A;  2E2M A;  4TR4 A;  1YKA A;  3H79 A;  3MYD A;  4KF9 A;  4PUA A;  1F3B A;  1A8Y A;  3PR8 A;  2QSI A;  5E4W A;  1H75 A;  2HI7 A;  4I6X A;  1HQO A;  4LA1 A;  1A2M A;  3KXO A;  4X43 A;  3KEB A;  2OAD A;  2D2Z A;  3MAK A;  1U6T A;  2X8H A;  2WB9 A;  2IME A;  3ZL5 A;  2LQQ A;  5D9V A;  2B1L A;  3C7M A;  2ES7 A;  3QCP A;  1SKS B;  1JLW A;  2GTU A;  4WEY A;  1OAZ A;  5C04 A;  4IQA A;  2OAC A;  4E8H A;  1QGV A;  4ZB8 A;  4HJM A;  1CQG A;  4JZQ A;  2LEG A;  1V2A A;  2FA8 A;  1URM A;  2RUE A;  1UVZ A;  5F05 A;  5DQY A;  4USS A;  1GP1 A;  5BRT A;  3UVT A;  2OKA A;  5DCH A;  4I2T A;  5B8B A;  3W8S A;  1MDJ A;  1V98 A;  2YP6 A;  2IN3 A;  3TRQ A;  3CMI A;  2HT9 A;  1B48 A;  1ZYE A;  1F37 A;  3IOS A;  3F9U A;  3QAW A;  4KDX A;  1DSB A;  1X5C A;  4FYC A;  4O7H A;  2H1B A;  5IO2 A;  1Y6E A;  3MWH A;  1Y25 A;  1G7O A;  4G19 A;  1ILO A;  2I9H A;  5KOW A;  1JZD A;  1DE2 A;  1GSY A;  2B1K A;  2GZP A;  4PQI A;  2DJ2 A;  3TJB A;  3RDW A;  3UJ1 A;  4GTU A;  4V1A p;  2GQL A;  5IMV A;  4DVC A;  3PGT A;  1EP7 A;  3VK9 A;  4K2D A;  4ECC A;  2DIY A;  3IC4 A;  3A5W A;  3WGX A;  3DEX A;  1LU4 A;  1AQX A;  2ON7 A;  4EVM A;  5KN2 A;  2C0D A;  2C3N A;  3A2V A;  2PER A;  2GQK A;  3GKX A;  2HYX A;  2EIR A;  4Z2U A;  1JZW A;  4TRX A;  5LCZ A;  4O5Q A;  3HCZ A;  3LWA A;  1UC7 A;  5DQS A;  3VFI A;  3M0F A;  3KCM A;  4NHZ A;  3ME7 A;  5ECH B;  3HXS A;  2VLU A;  4DSS B;  4XRA A;  3DWV A;  1TJD A;  2R3X A;  2KLX A;  1BG5 A;  1CQH A;  3VWV A;  3IR4 A;  4JE1 A;  4WF4 A;  2J9H A;  4IJ3 A;  4NMU A;  5ECR B;  4L5O A;  2MMZ A;  4X4J A;  2GT5 A;  2HZE A;  4WXT A;  3UIW A;  5L71 A;  4TW5 A;  1A24 A;  2GSR A;  2A2R A;  2X4A A;  1RW1 A;  2LQO A;  3DKS A;  2E7P A;  2X49 A;  3IHG A;  4RQR A;  3UEM A;  2K6V A;  2C1Y A;  3E9J B;  2K18 A;  1XIY A;  2LKU A;  2PU9 C;  3HVS A;  2PVO C;  4TN8 A;  3ZIJ A;  3Q18 A;  4MJE A;  3GRX A;  2YV9 A;  1UN2 A;  4JBB A;  1V57 A;  2YJH A;  4I97 A;  3DXB A;  2OBK A;  1M2A A;  2VIM A;  5IMF A;  3F63 A;  4EO3 A;  2CZ2 A;  2WS2 A;  4CY8 A;  1O81 A;  5INY A;  2O8V B;  8GSS A;  6GSU A;  2FHE A;  4OO5 A;  1X9S B;  2C3T A;  5JCU A;  2VAF A;  4IKH A;  3HZ8 A;  4BVX B;  4HDE A;  2L6C A;  2I81 A;  4J2F A;  2LUS A;  3P7X A;  3ZFB A;  2RUF A;  4HZ4 A;  1B9Y C;  4NXI A;  2HRN A;  4CY6 A;  2EC4 A;  2V41 A;  1M2D A;  4MH2 A;  3M1G A;  4ZIL A;  2CX4 A;  1FB6 A;  3TJG A;  1O8W A;  4L8E A;  4TVE A;  1TK5 B;  1XVQ A;  4EIQ A;  3GFK A;  1ACV A;  3GYK A;  4J57 E;  2DMM A;  2WJU A;  4GF0 A;  3PH9 A;  4JR6 A;  4NV2 A;  2ALB A;  4O5R A;  4GXZ A;  4FYU A;  1R5P A;  4OD7 A;  2R4V A;  2OE3 A;  1U3A A;  4MZC A;  3ZTL A;  3QFA C;  4I8B A;  2P31 A;  3ERW A;  2H6X A;  3Q6O A;  2FUG 2;  3F8U A;  3TOT A;  6GSX A;  5EY6 A;  3LJR A;  5KN0 A;  1SYX A;  5D96 A;  1JZR A;  1BJX A;  4PNG A;  3KD0 A;  2GS3 A;  3HKR A;  5HQP A;  4ULX A;  1YDK A;  5DDL A;  1HNB A;  2TRX A;  3UBK A;  3L9V A;  1GSU A;  3TKS E;  3A3T A;  2IFQ A;  2G2Q A;  4PUR A;  1B4P A;  2FWF A;  13GS A;  4I5Q A;  2VCV A;  5CNW A;  4CHS A;  2PWJ A;  1PX6 A;  3PPU A;  3ED3 A;  5ELG A;  3GH9 A;  4K0G A;  4N11 A;  2LRN A;  1TI1 A;  2IIY A;  3FZ9 A;  4X1U A;  4IN0 A;  3KMN A;  4ZBA A;  4EE0 A;  1ZYQ B;  2YV7 A;  1ZMA A;  2CX3 A;  5DAK B;  4KDU A;  2REM A;  3CRT A;  4MAB A;  4QL7 A;  1GTU A;  4Z2T A;  4NAX A;  3FR3 A;  2R0C A;  2CT6 A;  4MP4 A;  1GTI A;  1ML6 A;  6GSW A;  2B7J A;  2K8V A;  3EIN A;  5ECS A;  3S9F A;  1XXU A;  5EL8 A;  4GSS A;  3U5R E;  4HUA A;  3EPT A;  3TKP A;  2C4J A;  4MMM A;  3APS A;  4HEA 2;  4PQ1 A;  3LFL A;  1XW5 A;  5JCG A;  2FLS A;  4K5R A;  4D73 B;  16GS A;  4FH8 A;  3TJF A;  3W6G A;  1IYI A;  3LYK A;  4IGJ A;  2H0H A;  1B4Q A;  3F6D A;  4WR4 A;  1TKD B;  5H5S A;  2IJY A;  3GIX A;  3ZVJ A;  4IBP A;  4AJ7 A;  2O85 A;  3L4N A;  4KB3 A;  2H1G A;  1GLP A;  4TR1 B;  3TGZ A;  3FZA A;  1TDI A;  5DBQ A;  2VCW A;  5H5Q A;  3F3Q A;  2R5G A;  1WIK A;  3CTG A;  2WRT A;  3G7Y A;  2YWM A;  4N30 A;  4JU5 A;  5A4V A;  2PMT A;  3P90 A;  1TRW A;  4IJI A;  3APQ A;  3FY7 A;  4BWQ A;  3GSS A;  1WE0 A;  5DJL A;  5CP1 A;  1J0F A;  2MBS A;  1Z7P A;  4YAP A;  1QMV A;  4MK3 A;  3K8N A;  3WYW A;  1PRX A;  3A2W A;  1GSD A;  2V6K A;  2N5F A;  1RQM A;  4KND A;  3TRP A;  4ZL8 A;  1ZZY A;  4PTS A;  2KOK A;  4WBJ A;  3GX8 A;  1H4O A;  2A2P A;  4FIW A;  3WGD A;  4AJ6 A;  5J4U A;  2HRK A;  1XWG A;  4K8M A;  2BJX A;  2M46 A;  4GWR A;  1XWA A;  4EDY A;  2E0Q A;  2HSH A;  3FW2 A;  2LJR A;  3VPQ A;  1SL1 B;  1K0M A;  2X8C A;  4DEJ A;  4HU9 A;  3O76 A;  2HE3 A;  4MCU A;  2FD3 A;  4MDC A;  2P0G A;  2R2J A;  1YKC A;  2H01 A;  2YNX A;  3IV4 A;  1THX A;  4GCI A;  3NOF A;  3R2Q A;  1AW9 A;  1TI3 A;  5HR3 A;  3FYG A;  5IMZ A;  2XHF A;  4LL1 B;  1U3I A;  2DJK A;  2H6Y A;  3GMF A;  3V1W A;  4EUY A;  20GS A;  4YQM A;  5G2Z A;  4LMV A;  1SJ6 A;  4IW9 A;  3VWW A;  1GH2 A;  5KN1 A;  2QA1 A;  3QAV A;  3SWL A;  2IMF A;  4JED A;  2KP1 A;  1TK8 B;  4KUN A;  4OWY A;  3TOU A;  3UAP A;  2MMN A;  1JLV A;  1XWK A;  4GRF A;  4BWS A;  4ZXG A;  2CVK A;  1ZYP A;  5IMC A;  2C0G A;  1F6M C;  3ZZX A;  1A8L A;  2H30 A;  4KA0 A;  3H1N A;  4ECI A;  1O85 A;  5ECN B;  3WGE A;  3MDK A;  1PN0 A;  5DVB A;  4WF5 A;  1TK0 B;  3TDG A;  3DGQ A;  1MEK A;  5JWQ B;  4F9Z A;  1WRY A;  4H86 A;  1V58 A;  5D93 A;  1V40 A;  1SKR B;  1PL1 A;  3LEF A;  1FW1 A;  2JU5 A;  3KZQ A;  2CZ3 A;  5E59 A;  5FT3 A;  3ZRE A;  9GSS A;  1ON4 A;  4WR5 A;  1SYR A;  2YJ7 A;  5CRE A;  2CVB A;  2QGV A;  5G31 A;  1M99 A;  1JZO A;  4MLY A;  3BJ5 A;  4ZL9 A;  1GUM A;  1Q98 A;  1T00 A;  1ABA A;  5J3R A;  3EUR A;  2VCT A;  5FWG A;  2IYJ A;  3M9K A;  3H4K A;  3I69 A;  1TRS A;  3GX0 A;  2K9F A;  3EWL A;  1EGR A;  3FZ5 A;  3WD6 A;  3DVW A;  1OC9 B;  4YKG A;  4KAE A;  2GQM A;  2FWH A;  3F0I A;  2X8G A;  4G2E A;  3MIX A;  3FKF A;  1M2B A;  4EDZ A;  1M9B A;  1SL0 B;  1S3D A;  5KEJ A;  2WUL A;  4HQS A;  4HZ2 A;  1ERV A;  1XOA A;  19GS A;  2X99 A;  3M3M A;  2NVL A;  5F07 A;  3L0H A;  2VL2 A;  4MZB A;  3QOU A;  3LSZ A;  1RK4 A;  3EVI A;  3HHV A;  3ZIV A;  5IO0 A;  2H75 A;  4YQV A;  5AIS A;  4ZL7 A;  1GSS A;  2YOI A;  5HFG A;  3NIV A;  1EOG A;  2VD0 A;  4FQU A;  1J08 A;  2C3Q A;  1K0C A;  2VCQ A;  4F82 A;  1MTC A;  1EGO A;  4MPF A;  2F51 A;  3UBL A;  2ZCT A;  3GTU B;  3GH6 A;  2VLT A;  2H71 A;  10GS A;  1S3A A;  1B8X A;  2HXK A;  3ERG A;  4IQ1 A;  2V6O A;  1T4Y A;  3KP9 A;  2CV4 A;  4RQX A;  3TUE A;  18GS A;  2AJQ B;  1A0F A;  4XS6 A;  2A2S A;  5DAK A;  4N0V A;  5FHI A;  1FG4 A;  1QFN A;  2NPB A;  2LJK A;  2WFC A;  4YAV A;  1T3B A;  2C0F A;  3C1R A;  1Z9H A;  2DJ0 A;  4CW9 A;  3P8W A;  1OYJ A;  3IK7 A;  1Z7R A;  3NZN A;  1KTE A;  5CO3 A;  4JRR A;  3F4R A;  3EU4 A;  2HLS A;  1VRS D;  4MA9 A;  2VL2 C;  1VF3 A;  5IM9 A;  4OFT A;  4XS1 A;  2H66 A;  3HY2 A;  1Z3E A;  2BMX A;  2QKE A;  4ID0 A;  5IOX A;  4HQZ A;  1ZOF A;  3L78 A;  3N9J A;  1GNE A;  2H76 A;  3RHB A;  4K7N A;  11GS A;  4ILF A;  3UOM A;  4ECJ A;  2OBI A;  5HFK A;  4OCE A;  2NDO A;  2Z9S A;  3C8E A;  4BPY A;  3UL3 A;  5AN1 A;  5CRD A;  5D73 A;  3KH7 A;  3C1S A;  1GNW A;  2B5Y A;  4V2M A;  1M9A A;  4N10 A;  1HNA A;  1R26 A;  1WJK A;  3ZRD A;  3BD2 A;  4Q5F A;  1WPI A;  3D4M A;  3VI7 A;  2GDR A;  4IP1 A;  4XIH A;  3IDV A;  1XWB A;  3CSJ A;  4L5L A;  2H74 A;  2DKI A;  1B9X C;  3WT2 A;  2AV4 A;  2O89 A;  4KX4 A;  1OE7 A;  1FB0 A;  2FWE A;  4K1F A;  1TOF A;  4MJB A;  1MDK A;  2DC5 A;  4KH7 A;  4CDO A;  1GUK A;  1K3O A;  3GV1 A;  1X9M B;  3TJK A;  3KM6 A;  2OJL A;  3FR9 A;  4XTS A;  6GST A;  4GST A;  5A4U A;  1X5E A;  4EKZ A;  3IAS 2;  4HJ2 A;  2AB6 A;  4RUV A;  5JCW A;  2VCX A;  3RPN A;  1DBY A;  5G30 A;  1SD8 A;  3DIE A;  3KJY A;  3HDC A;  3RAZ A;  2L5L A;  2HRF A;  2DJJ A;  3IRA A;  4GQC A;  2YWI A;  5ECP B;  2V32 A;  4POB A;  2AHE A;  2MYG A;  4EIP A;  4N0Z A;  4TR3 A;  4BVY A;  3LYP A;  3O6T A;  4IP6 A;  1YY7 A;  2YWO A;  3HA9 A;  4TXO A;  1XOB A;  2F9S A;  1SK0 A;  4P3Y B;  3QAG A;  5GAP D;  4ML6 A;  2PGT A;  2IMI A;  4LMW A;  3D6I A;  2WDU A;  4K5S A;  5CYY A;  2P5Q A;  3HJP A;  5F0G A;  3BCK A;  2H0G A;  1HD2 A;  2HZE B;  1PN9 A;  5B7C A;  1FOV A;  4NPB A;  3GA4 A;  3FRC A;  2VUP A;  5H5R A;  3KTB A;  1TP9 A;  3TJJ A;  1KEB A;  4YQU A;  2XBQ A;  1U88 A;  4DSS A;  1BYE A;  4MH3 A;  1OVN A;  5GAN D;  1OC9 A;  2JL4 A;  2B6M A;  3M9J A;  1AAZ A;  3FEU A;  4V1A g;  4FO5 A;  4BL7 A;  3GKN A;  3KH9 A;  1O8X A;  1SJI A;  2LST A;  3FK8 A;  4YH2 A;  4NHW A;  2FGX A;  4ECB A;  4TKY A;  3QMX A;  2JAC A;  3D21 A;  2YZH A;  2J23 A;  1M0U A;  2JAD A;  2IY2 A;  3W8J A;  5IOW A;  3A5I A;  1BAY A;  4Q5N A;  3DML A;  4YKF A;  5D9W A;  1EEM A;  4EXJ A;  1AUC A;  2M72 A;  1F2E A;  3E0U A;  4OO4 A;  3APO A;  3GN3 A;  1O73 A;  2IMD A;  5G1L A;  2EIQ A;  1JFU A;  2GZY A;  1AQV A;  2KP2 A;  2GSS A;  4FYB A;  4L0U A;  2L57 A;  3TKS A;  1PKZ A;  3HVV A;  2B3S A;  1LJR A;  2HSY A;  3IE3 A;  2H6Z A;  2L4Q A;  4K0N A;  4PNF A;  2TRC P;  2XBI A;  2HRA A;  2EIO A;  1T8E B;  1V9W A;  1VF1 A;  5AIX A;  2VL9 A;  4BVX A;  1FOH A;  5J5N A;  1S3C A;  3GL3 A;  5HR2 A;  3EC3 A;  5IMA A;  3KGK A;  3D4T A;  2MZC A;  1SL2 B;  4WBR D;  5B8A A;  1M7T A;  3ME8 A;  5ECI B;  5CRH A;  2YWN A;  4IHU A;  1MDI A;  1G7E A;  5ABR A;  3F4S A;  4DSQ A;  1XWC A;  2HNL A;  2R0P A;  3WT1 A;  22GS A;  2E2G A;  4RI7 A;  4MPG A;  4OCF A;  3Q19 A;  3C73 A;  4LLR A;  2DLX A;  2JZR A;  3SBC A;  4A5P A;  6GSS A;  3LOR A;  1BQ7 A;  3U6V A;  1ERT A;  5DAL B;  1ERW A;  2H0I A;  3CBU A;  1XPV A;  4O92 A;  3KMO A;  4POK A;  1YJ6 A;  2YN1 A;  4KCE A;  4ML1 A;  3GST A;  1TRU A;  1PSQ A;  4TXV A;  4G9H A;  4I2U A;  4ZIJ A;  4MNN A;  4F2I A;  1YF0 A;  2OA7 A;  4PXO A;  4BA7 A;  3BCI A;  2I4A A;  1HYU A;  5IMD A;  1F3A A;  1WMJ A;  4JR4 A;  2DIZ A;  1FAA A;  3J7Y b;  4K7O A;  1AC1 A;  2P5R A;  2IFQ B;  2XPE A;  5CRW A;  4OFM A;  3TRX A;  4PQH A;  2N5B A;  2CA8 A;  1DUG A;  1PQN A;  1K3Y A;  1DE1 A;  2B5E A;  1W4V A;  4MF6 A;  3R3E A;  4EC0 A;  1O6J A;  3QR6 A;  5COH A;  3ZYW A;  4BL7 B;  1ZL9 A;  1QQ2 A;  1AXD A;  3O3T A;  2LJA A;  5GZZ B;  2GLR A;  3G7J A;  4IVF A;  1WP0 A;  3FHK A;  1X0R A;  3IK9 A;  1GUL A;  2L5O A;  4G10 A;  5IPG A;  3HYP A;  3LQ7 A;  3CSH A;  1WOU A;  1EV4 A;  4ZBB A;  3FR6 A;  5EVO A;  3L9U A;  2OE0 A;  3MNG A;  5J9B A;  3LW9 A;  2B7K A;  1XVW A;  2G0F A;  3DVX A;  3LXT A;  5J41 A;  3ISO A;  2F8F A;  2VL3 A;  5KOX A;  1EWX A;  2N5A A;  5LD0 A;  2R37 A;  1YEX A;  4IS0 A;  2PVQ A;  2FA4 A;  3VLN A;  1USB A;  3Q74 A;  2V1M A;  1X9W B;  3DYR A;  5CAX A;  3LXZ A;  4MJC A;  2WCI A;  2I3Y A;  3GNJ A;  1SEN A;  1PMT A;  2H73 A;  4NWY A;  1THO A;  1Q4J A;  1AIU A;  2AYT A;  5C00 A;  1YF1 A;  2C80 A;  4Q5R A;  1GL8 A;  2QA2 A;  4ZB6 A;  3J7Y k;  1A0R P;  3CRU A;  3IBH A;  3VPT A;  5J9C A;  2DJ3 A;  3IPZ A;  3D0Z A;  3N5O A;  2I1U A;  4NV5 A;  2IL3 A;  2L6D A;  1PL2 A;  1R4W A;  3QDN A;  1IYH A;  1N2A A;  1E2Y A;  5JWR B;  4HOJ A;  3G9B A;  1TRV A;  3ZVJ D;  1NSW A;  3I43 A;  3OR5 A;  4QL9 A;  3LG6 A;  1T1V A;  3HJM A;  1TXX A;  1C72 A;  2R6K A;  1MD4 A;  1BED A;  2L4C A;  1A2J A;  1K0O A;  2H72 A;  1XCC A;  4K6X A;  2H19 A;  1OKT A;  2PPT A;  5GSS A;  4KSM A;  1I9D A;  1PKW A;  1XW9 A;  2GSQ A;  5D9X A;  1BX9 A;  1TW9 A;  4GSN A;  2KUC A;  2X64 A;  1VF2 A;  4KCA A;  5IPH A;  3F4T A;  1R5A A;  2DJ1 A;  1EZK A;  3CYN A;  4TR1 A;  4KDY A;  2UZ8 A;  2O87 A;  1O7U A;  5DCG A;  1SK1 A;  3BBY A;  3KIJ A;  3TCO A;  2NBS A;  3IA1 A;  1QK8 A;  2V2G A;  4HI7 A;  4MF7 A;  1J9B A;  3I9V 2;  2PUK C;  4K2X A;  4OMV A;  3I6A A;  1Z6N A;  1SK2 A;  1R7H A;  5AIV A;  5G5F A;  1PD2 1;  2AUV A;  4PX1 A;  2R0G A;  1LBK A;  4MJA A;  3ZLP A;  3GKM A;  6GSV A;  4K9Z A;  4OFN A;  5GST A;  2DML A;  2H1A A;  4QQ7 A;  3VWU A;  2C0E A;  3KTL A;  5IIZ A;  1SD9 A;  2FWG A;  4GLT A;  5D8I A;  1OKD A;  2A4V A;  5DJM A;  5ECL B;  5D9T A;  4TR0 A;  1TTZ A;  2H1D A;  4Q5Q A;  1I5G A;  1Z5Y E;  4L0W A;  4ICY A;  2YAN A;  3EMP A;  2HZF A;  6GSY A;  4XCS A;  5KN3 A;  1ERU A;  4TOP A;  1VF4 A;  4PGT A;  2PN8 A;  4POL A;  5ID2 B;  2A4H A;  2DSA A;  5G1K A;  1YQ1 A;  3UVH A;  4AGS A;  1TU8 A;  1NW2 A;  4V2N A;  4KE3 A;  3IXR A;  2XC2 A;  3ZIT A;  1K0D A;  3TB2 A;  3TKR A;  2LTK A;  5A4W A;  2K8S A;  1KBN A;  1GTB A;  3EYT A;  1VGL A;  1ZGN A;  3F3R A;  1ZYN A;  1ZCP A;  4BVY B;  1GSF A;  2GVP A;  2OE1 A;  3HJO A;  3US3 A;  4F03 A;  4TXO B;  2MMO A;  1E6B A;  1EV9 A;  3IHQ A;  1GSQ A;  4KW6 A;  2WGR A;  5G5E A;  4ISD A;  2VCZ A;  5BMU A;  1PGT A;  2LRC A;  2MMA A;  3AY8 A;  1GRX A;  4KGI A;  2CQ9 A;  2LNS A;  2CVD A;  3CXG A;  2HFD A;  4F0B A;  1OC3 A;  3H8Q A;  1EP8 A;  2FY6 A;  2JSY A;  3MSZ A;  1SU9 A;  4Z2R A;  4G0I A;  4K7I A;  4J56 E;  2JZT A;  1XZO A;  2TIR A;  1KNG A;  4LL4 B;  1K0N A;  3RPP A;  3EMX A;  3M8N A;  3GUS A;  3ZML A;  4KSO A;  4ZB9 A;  2GGT A;  4AJ8 A;  3EE2 A;  3UMA A;  4PUF C;  2YZU A;  2KHP A;  2QC7 A;  3CTF A;  7GSS A;  4ZBD A;  1SJZ A;  1NM3 A;  1TU7 A;  3TKS C;  2DKH A;  2F8A A;  1PA3 A;  1FVJ A;  3BOA A;  1FO5 A;  5HFI A;  3GL5 A;  2GST A;  4RI6 A;  4XHM A;  3HVX A;  2PBJ A;  4O32 A;  2ON5 A;  1FHE A;  5HR0 A;  2ZUP A;  3F6F A;  5A5K A;  1YEP A;  3QD9 A;  4XS4 A;  2VLV A;  1QXH A;  2O7K A;  3QPM A;  5LNK e;  5ID2 A;  1QUW A;  3D5J A;  2RM5 A;  1HNC A;  3IAM 2;  2ZNM A;  3GUR A;  5F8B A;  1AQW A;  2VD1 A;  2IWT A;  3P2A A;  5CRG A;  3DD3 A;  1OC8 A;  3FZ4 A;  2YPM A;  2LS5 A;  2WZ9 A;  3LGC A;  1FVK A;  1X5D A;  3ERF A;  4POM A;  5EPF A;  3E3E A;  1XFL A;  1W89 A;  2LNT A;  5ECQ B;  3VUR A;  2JSZ A;  1UA5 A;  4O5U A;  5B6M A;  2B5X A;  3C71 A;  5ENU A;  3TKQ A;  5ECM B;  5B6N A;  3JCM L;  17GS A;  2BTO T;  3H93 A;  4XRD A;  3CSI A;  4ACS A;  1GSE A;  3GTU A;  3RBT A;  14GS A;  2AAW A;  1N8J A;  1PX7 A;  1A2L A;  2VO4 A;  1G6W A;  4GQF A;  1WWJ A;  1GLQ A;  1MD3 A;  4G0K A;  3D22 A;  4X0X A;  4F0C A;  3FMW A;  5IQY A;  1GTA A;  4Z7X A;  3KP8 A;  4V2L A;  1T7P B;  2CAI A;  4DSR A;  1SKW B;  3EU3 A;  5ECO B;  3QFB C;  4D73 A;  2FCH A;  1F9M A;  1K0B A;  3HD5 A;  2RII A;  3L9S A;  3HZ4 A;  4AF2 A;  5DAL A;  3VI5 A;  2VM2 A;  5ELA A;  2YCD A;  1OE8 A;  2HSM A;  5JWO B;  3ZMK A;  3DRN A;  5ECK B;  1EEJ A;  4WET A;  2RLI A;  1K3L A;  1T4Z A;  4IEL A;  3GKK A;  5F06 A;  3IC8 A;  1EOH A;  1GWC A;  1Z6M A;  2RM6 A;  1G0T A;  1NHY A;  2H70 A;  2VM1 A;  2IMK A;  2NTO A;  1U87 A;  4XS4 B;  1ST9 A;  3A2X A;  2CAQ A;  1XW6 A;  1A23 A;  2XPD A;  2L59 A;  2JZS A;  4MF5 A;  2C8U A;  5HR1 A;  4EF0 A;  1JHB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...