2H0HA

Crystal structure of dsbg k113e mutant
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
229
structure length
229
Chain Sequence
ELPAPVKAIEKQGITIIKTFDAPGGMKGYLGKYQDMGVTIYLTPDGKHAISGYMYNEKGENLSNTLIEKEIYAPAGREMWQRMEQSHWLLDGKKDAPVIVYVFADPFCPYCEQFWQQARPWVDSGKVQLRTLLVGVIKPESPATAAAILASKDPAKTWQQYEASGGKLKLNVPANVSTEQMKVLSDNEKLMDDLGANVTPAIYYMSKENTLQQAVGLPDQKTLNIIMGN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Thiol:disulfide interchange protein dsbG
publication title Short-circuiting divergent evolution: laboratory evolution of one disulfide isomerase to resemble another
rcsb
source organism Escherichia coli
molecule tags Isomerase
total genus 67
structure length 229
sequence length 229
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-05-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13098 Thioredoxin_2 Thioredoxin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.70 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Disulphide bond isomerase, DsbC/G, N-terminal 2h0hA01
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 2h0hA02
1SL2B 3H79A 1JFUA 4TXVA 2H1DA 3EVIA 4DSQA 3MAKA 4K1FA 4BL7A 3Q18A 5FHIA 4HJ2A 2IFQA 1OC8A 3A5WA 1TKDB 2E7PA 2OKAA 4QL9A 5ECHB 3TRXA 1G6YA 6GSSA 1KEBA 1G6WA 1XOAA 4Q5RA 3TRQA 2PU9C 2OE3A 2GTUA 2K6VA 1T1VA 4BVYA 4GF0A 4N0ZA 4HUAA 3OR5A 4X1UA 4WETA 4EO3A 5H5RA 1NHYA 3KJYA 4RI6A 4KDUA 4OO5A 1SK2A 5DJMA 1B8XA 3APOA 5C00A 2R5GA 1E2YA 3D4MA 5IMFA 1O7UA 2QC7A 4OCFA 2VD1A 4ZB6A 2LKUA 5DALB 1TU7A 2JADA 2N5FA 1OC9B 4Z7XA 1WRYA 1OE7A 4WEYA 4GSNA 5J3RA 2CT6A 3WGXA 1EV9A 1HNCA 3QMXA 4O92A 2EIQA 4F82A 4ZILA 1FB6A 3IV4A 2MMZA 3FR3A 3F6DA 4ZB9A 2QGVA 2JU5A 1E6BA 1H75A 4EUYA 4H86A 4EE0A 3QAVA 2KP2A 1OAZA 4IBPA 4TR1B 4IVFA 2L59A 2YZHA 4TN8A 3SBCA 1LBKA 3I43A 2WDUA 5F05A 3FRCA 5FWGA 3GX0A 3LG6A 4V1Ap 4CDOA 4XTSA 3UOMA 2LQOA 2YN1A 3FZAA 3HXSA 2J23A 1DE2A 3TJGA 2AJQB 1FB0A 4ML6A 2PWJA 3O3TA 4JE1A 1MDIA 2K18A 3DD3A 5ELGA 2V2GA 2IPAA 2H75A 4OO4A 5D9XA 2QKEA 4OFNA 2WB9A 2ALBA 3KXOA 1K0CA 3TKSA 1GSUA 2GLRA 1O81A 2AAWA 1GTUA 5D9TA 5DJLA 1OC3A 1XWCA 1PD21 2H0HA 1WE0A 3IBHA 4ZXGA 1M9AA 1USBA 5DALA 1SL1B 1GUHA 4HEA2 5DDLA 1OC9A 1TTZA 1GULA 3LYKA 1AIUA 2B5EA 2JACA 2FWHA 1QFNA 3KP8A 3VLNA 5JCWA 2IWTA 1XOBA 1Z6NA 3EMXA 1UVZA 2GSSA 4KB3A 1X9WB 1NSWA 3JCML 3FK8A 2HSHA 3CXGA 1TRUA 1XFLA 2K9FA 2H1AA 4TR1A 3US3A 1EOGA 2DLXA 2O8VB 3G9BA 1YZXA 1WP0A 5B7CA 4EC0A 2X8GA 3UARA 3VI7A 1SYXA 4V1Ag 3HCZA 4NWYA 4LLRA 1XW9A 3ZTLA 1SJZA 1Y25A 4ZBDA 4MZBA 2HI7A 2OA7A 4OFMA 4MPGA 1A2MA 4TKYA 5G5FA 2CA8A 3DMLA 4NAXA 5IMAA 5D93A 2VCVA 3F4SA 1DE1A 4AGSA 2L5LA 1V58A 4F9ZA 3GUSA 1FW1A 1THXA 4KA0A 1U3IA 4DSRA 3H1NA 1GLPA 4POKA 3TJBA 2FY6A 5ECQB 3UAPA 1U87A 2MMOA 1TI1A 4ZL9A 2GQLA 3ERGA 4YH2A 4O5RA 3MDKA 5HQPA 1SKRB 1SKWB 3LWAA 2AB6A 4TW5A 5INYA 1YEXA 5AGYA 1K0NA 2VO4A 5FT3A 3TUEA 7GSSA 3D5JA 1X5CA 3ZLPA 1H4OA 4JR4A 3KZQA 2DJ1A 1XWGA 1ZMAA 3WYWA 2P0GA 3ZMKA 2VLUA 1BJXA 1ZGNA 1NW2A 1TP9A 4MCUA 3VPQA 5J9BA 1KTEA 1BG5A 1F2EA 3GURA 3ZIVA 2FA4A 2DMLA 3EMPA 3FZ9A 3LXTA 2P5QA 4WR4A 2E2GA 1SU9A 5A4VA 4HU9A 2CVBA 1T7PB 5LCZA 6GSUA 3IOSA 4G19A 5H5SA 3QAGA 1A2JA 5CRWA 5D9WA 2EC4A 2YCDA 4FO5A 3CRTA 4L0UA 2VIMA 1Z3EA 2FD3A 3EU4A 5CRHA 2VM1A 4MH2A 5F8BA 3GKKA 5GZZB 2B5YA 3TJJA 6GSTA 5IQYA 4IQ1A 3LORA 5C04A 2EIOA 3WT1A 2LSTA 1HD2A 4K0NA 1B9XC 4JR6A 1SD8A 3LGCA 1A23A 2PVQA 3VWUA 2LNSA 2H71A 5B8AA 3GMFA 4IP6A 3R2QA 4AF2A 4JZQA 3G7JA 3GRXA 1OKTA 1Z5YE 2OJLA 2K8SA 1XVQA 4MK3A 1S3DA 4I8BA 1AQVA 2C0GA 4WF4A 3S9FA 3D4TA 1K0DA 2MMNA 4O7HA 5JWRB 3GFKA 3KP9A 4BA7A 4OCEA 3LXZA 5AISA 1PSQA 4ECCA 5JCUA 3QFBC 3DGQA 2BTOT 2YOIA 1ACVA 4EL1A 1YDKA 2OE1A 1TU8A 4XRDA 4WXTA 5D8IA 1Z6MA 1Y6EA 5ECLB 4QL7A 2F8FA 1XWBA 3HVVA 2NPBA 4KGIA 4POMA 4IQAA 1A0FA 3TKSE 5ECNB 2IL3A 3LFLA 4K0GA 1NHOA 5IO0A 3IHQA 1M2DA 14GSA 2H70A 3LYPA 2X64A 4BWSA 13GSA 3D21A 2ZNMA 2YWOA 5E4WA 2C8UA 3E3EA 1PN9A 1T8EB 1PQNA 3GKNA 4ILFA 3MSZA 2B6MA 2YV7A 11GSA 3BD2A 4NHZA 5ECKB 2VM2A 1AAZA 1TW9A 2JZSA 3FW2A 2GVPA 5LD0A 4EDZA 4G9HA 2NTOA 4KW6A 3IXRA 2IYJA 2DSAA 1GTIA 1TK8B 1F9MA 3FR9A 1MDKA 4YQVA 2H6XA 4K7NA 2E0QA 1F37A 4LMWA 1B9YC 1Q4JA 3EU3A 1ZYQB 3C8EA 5GSSA 5A4UA 3ZFLA 5J41A 2DJ2A 3G7IA 5ECOB 2F8AA 4AJ8A 3VFIA 4E8EA 3HJMA 1U88A 3VI5A 4CW9A 2L6CA 3F63A 3O76A 4L8EA 3BBYA 4XS1A 3M1GA 3HKRA 2WS2A 1RK4A 3KEBA 6GSWA 3GL3A 2V6KA 3KM6A 4EVMA 4IJIA 4V2MA 4NXIA 5J4UA 4EXJA 1FVKA 2WULA 3WT2A 4HS1A 4IKHA 3RPNA 2WGRA 3GNJA 1FG4A 1JZOA 5KN2A 5EY6A 2WFCA 1NM3A 2VLTA 2GZPA 2YP6A 2AV4A 5CYYA 2GQKA 3J7Yk 1XWKA 3UBKA 4Q5NA 2V41A 3RHCA 2PGTA 3EYTA 2B1KA 1PL1A 1HNAA 5ECSA 3F8UA 1CQHA 1PRXA 1VRSD 2KUCA 2WRTA 3GV1A 5E59A 3GA4A 3DEXA 4KX4A 1TJDA 2PMTA 5HFKA 1S3CA 3TKRA 1V9WA 4LL1B 4QQ7A 3N5OA 2IY2A 2C0FA 3U5RE 3W8SA 1RW1A 1JZRA 1N2AA 2H8LA 1VGLA 2MZCA 2REMA 4GTUA 4ZIJA 2RM6A 3FEUA 2IMIA 1BEDA 19GSA 2LRCA 4HQZA 1AW9A 4HI7A 2JZTA 3ZYWA 1FHEA 1V40A 1PA3A 1M99A 4KSOA 1MD4A 4LL4B 1EGOA 3LEFA 3GKXA 4RQXA 2IIYA 5GSTA 4F0BA 4PX1A 2N5AA 2YJ7A 4MMMA 3ERFA 2OACA 1PGTA 5G1KA 4O32A 4F03A 2LQQA 1YF0A 1K0AA 2IMEA 1TK5B 1X0RA 4MJBA 2H0GA 4TXOB 2O89A 1IYIA 3EE2A 3TKSC 4N30A 3APSA 2C1YA 1DBYA 1GUKA 3UMAA 5HR2A 4KAEA 2I4AA 3F3QA 3G7YA 3U6VA 1GSSA 3GX8A 2HYXA 1YY7A 1UN2A 2GGTA 1VF3A 4K9ZA 2R2JA 2O85A 1QXHA 2RIIA 3GYKA 4GRFA 2IMKA 2CX4A 1TK0B 3A2WA 3HZ8A 5G1LA 3A3TA 4OD7A 2D2ZA 2Z9SA 3N9JA 5ECRB 5H5QA 2HZEB 3QFAC 2H72A 2CVKA 3PGTA 3KTBA 2KP1A 3C7MA 2OADA 1ST9A 2GSQA 2GS3A 3KIJA 1GWCA 3HVSA 1TRWA 2VAFA 3IR4A 2TRXA 4YAVA 3PINA 3CSHA 2A4VA 2XPDA 3VURA 2NDOA 4PQIA 4ULXA 2V32A 3W6GA 4DSSB 1WJKA 3HY2A 2ON7A 1YQ1A 1HNBA 3CBUA 1TXXA 1B4QA 3D0ZA 4J56E 3CTGA 2F3MA 4MZCA 3KMNA 2VCZA 1O6JA 3EWLA 5GAND 3C73A 3QDNA 2HXKA 3HYPA 4N0VA 5COHA 3FKFA 5CO3A 2LJAA 4KNDA 5CAXA 2AYTA 2YWNA 3UVTA 2DJKA 2AUVA 4ECIA 2I1UA 4EF0A 4HZ4A 3BCIA 2FNOA 3KTLA 1IYHA 5AIXA 4TXOA 3GH6A 4XS4A 1R7HA 2XHFA 1JLWA 4MJAA 9GSSA 3E0UA 2C0EA 2P31A 1YF1A 3PR8A 1AXDA 1W89A 2IMFA 1EP7A 3TKQA 4PURA 1X5DA 4GCIA 2H6ZA 12GSA 4TRXA 3O6TA 4IP1A 2KLXA 2DC5A 4Q5FA 3ED3A 3IC4A 3ZVJD 1MD3A 2I3YA 1A8LA 1M7TA 3QCPA 5DCHA 1K3OA 2DJ0A 2OE0A 3A2VA 4I5QA 1XIYA 1F6MC 3QD9A 1W4VA 2HZEA 2L57A 2GZYA 5IIZA 5D9VA 2CZ2A 5JWQB 3UIWA 3DVXA 3D22A 3VWWA 4HDEA 2MBSA 1I5GA 4LMVA 3RAZA 3M0FA 4RUVA 4FYUA 2LV3A 4AJ6A 1OYJA 3TRPA 5ABRA 2G2QA 6GSVA 3Q74A 4DSSA 1TRVA 4WF5A 1GNWA 5CP1A 4IJ3A 3FZ5A 1GL8A 3I69A 3TOUA 3F9UA 2FWGA 2VL2A 2HT9A 5GAPD 1XCCA 3GHAA 2WZ9A 2VL2C 1T00A 1THOA 2HRFA 2LJRA 2LJKA 3GH9A 1F3AA 4ID0A 4MABA 2M46A 5IO2A 2L4CA 2B7JA 3C1RA 1M2AA 5EVOA 3VWVA 2V6OA 3KH7A 3MWHA 1V57A 6GSXA 2QSIA 4MPFA 4K8MA 2XC2A 1Z7RA 2RM5A 1MTCA 1J9BA 4ZBBA 1O8XA 2C0DA 5CNWA 2L5OA 1PKZA 1EGRA 1G7OA 4L5LA 2F51A 4XRAA 5IPGA 4MF5A 4WKWA 4BVXA 2X8HA 1XPVA 4F2IA 4JBBA 4HU7A 1MDJA 1KNGA 5G30A 3UEMA 4KDXA 2HRNA 4YQMA 3P90A 3WGEA 4N10A 4I6XA 3ZITA 4V2LA 2VLVA 3C1SA 1EEMA 2E2MA 2CZ3A 1O85A 2VL9A 5CRGA 1TOFA 3VPTA 4EKZA 3WGDA 1GRXA 2PN8A 4ZBAA 2JSZA 1WOUA 3L9VA 2FWEA 5G31A 2YJHA 2XBQA 2FLSA 3NIVA 3SWLA 3L4NA 2FUG2 1XW6A 4XIHA 1ERVA 3FHKA 16GSA 2ZCTA 3ME8A 3CSJA 3TOTA 1SJIA 3ZREA 3F0IA 3A2XA 2XPEA 2JSYA 3ZIJA 1FAAA 4TR4A 3MNGA 3CSIA 4ML1A 4XCSA 2HZFA 1WIKA 3GN3A 1YJ6A 2P5RA 3TCOA 1Z9HA 2FGXA 3KGKA 1WPIA 4MA9A 4GSTA 2LS5A 4X0XA 5HR1A 4MZWA 1J08A 2IJYA 3GSTA 1SKSB 1EOHA 1YKAA 5J5NA 1GSDA 3VK9A 4YQUA 2NVLA 2B5XA 1FOVA 4POBA 2B1LA 4IELA 4HJMA 2IMDA 1M0UA 2WJUA 4PUFC 2MMAA 5F07A 5JWOB 2WCIA 1K3YA 1GP1A 1A24A 1QMVA 1ZYEA 3HVXA 1ABAA 1ILOA 1URMA 1Z7PA 4YAPA 2B7KA 2FWFA 2HSYA 4WBRD 4PUAA 1UA5A 3HHVA 1X9SB 1ZCPA 1TRSA 4NV2A 4GWRA 3GIXA 4BWQA 1BQ7A 1R5PA 1QK8A 1OVNA 2YWIA 4E8HA 3RBTA 2JZRA 3J7Yb 4PNFA 1K0MA 3H93A 5HR3A 3CRUA 1A2LA 1A8YA 4FYBA 4NV5A 2JL4A 1FO5A 3RDWA 5J9CA 5IOXA 2AHEA 3QAWA 5ECPB 3ZZXA 2C3TA 4ZL8A 5A5KA 6GSYA 5L71A 3IAS2 1XBSA 3KD0A 4POLA 1EZKA 3DKSA 4HQSA 3TKPA 1ZOFA 3TDGA 8GSSA 2RUEA 4FYCA 3C71A 2DJJA 2LRNA 1T3BA 4Q5QA 2GDRA 1PX7A 4KH7A 2LRTA 4OFTA 4IGJA 3PH9A 2CV4A 1S3AA 2PVOC 2RUFA 2YANA 2OBKA 2R37A 1EP8A 1CQGA 4D73B 3I6AA 5IMVA 2PUKC 17GSA 3KH9A 3HDCA 4K7IA 2GT5A 3IK7A 2CQ9A 5ELAA 1ZZYA 3CTFA 2GT6A 1K3LA 5KEJA 1DSBA 1QUWA 2CX3A 2HLSA 5ENUA 3BJ5A 1PMTA 4NPBA 3VWXA 2L4QA 2G0FA 3BCKA 4IN0A 2LUSA 1FVJA 2H30A 2VL3A 5HFIA 2VCQA 4AJ7A 1GSYA 4X43A 4K7OA 1LJRA 4MP4A 2YZUA 3LJRA 1JHBA 5G5EA 4XHMA 4XS4B 2VUPA 1QGVA 1OKDA 1T4ZA 1XWAA 1ERTA 2DJ3A 4ACSA 3RHBA 1ON4A 1X9MB 5EPFA 1RQMA 3IAM2 4K2DA 5IMZA 1EEJA 3ZVJA 1AUCA 3DIEA 1TI3A 4PGTA 4N11A 1X5EA 4IW9A 3HA9A 1R5AA 3LQ7A 5DBQA 2K8VA 1JZWA 2KOKA 4GLTA 5JCGA 2NBSA 1EV4A 4RQRA 5ECMB 1AC1A 2IN3A 4PNGA 5KN1A 3EINA 1V2AA 2VOCA 3E9JB 4L0WA 3GSSA 3V1WA 2R3XA 3M8NA 3P2AA 5A4WA 2C3QA 5F0GA 2HE3A 1R26A 2C4JA 5ID2B 3IPZA 3L9UA 2O7KA 3RPPA 2L6DA 1G7EA 2ES7A 2PPTA 1M2BA 2H73A 3UL3A 1DUGA 4D73A 2BJXA 1M9BA 2B3SA 4V2NA 2LNTA 3CYNA 5IPHA 4HOJA 3ZL5A 3F4TA 3TJFA 1GTBA 2N5BA 5DQSA 2C3NA 1AQWA 4LA1A 1BX9A 4EDYA 3DYRA 1HQOA 1QQ2A 3BOAA 3IA1A 2KHPA 1G0TA 2H01A 4P3YB 2PERA 1GSFA 4HZ2A 2X8CA 3TJKA 3QOUA 3UVHA 4IHUA 2TIRA 5KN3A 1GUMA 3ME7A 4MJEA 4I2TA 4GXZA 1JZDA 2DIYA 3FYGA 3AY8A 3WD6A 4TOPA 3UJ1A 2DBCA 4RI7A 2R4VA 1F3BA 1WWJA 2I9HA 2OBIA 2H1BA 1KBNA 2DMMA 2M80A 4MF7A 1AQXA 5DQYA 4KSMA 2CAQA 3H8QA 3W8JA 2H0IA 3APQA 3FY7A 4JEDA 2XBIA 4WBJA 5EL8A 4I2UA 3DXBA 3HJOA 4MJCA 2VCWA 20GSA 3CMIA 3HZ4A 5DAKB 1YEPA 5AIVA 4OMVA 1VF1A 3ERWA 1GLQA 3K8NA 2LEGA 3F3RA 3IE3A 3GTUB 5ID2A 2VD0A 1ERWA 4KCAA 1XZOA 3TGZA 4NMUA 2CVDA 1V98A 1GH2A 1VF4A 2CAIA 5IM9A 4I97A 1T4YA 3KMOA 3L9SA 1R4WA 1PL2A 3UBLA 1VF2A 5DVBA 4BPYA 1SJ6A 1XVWA 4G10A 2HNLA 4GQCA 1WMJA 5LNKe 2C80A 2FCHA 3Q19A 1BAYA 2YNXA 1O8WA 1GSQA 3I9V2 5D96A 1N8JA 2V1MA 5B6MA 1LU4A 3EC3A 4KDYA 3F4RA 1MEKA 5CRDA 4MF6A 1HYUA 2J9HA 1XXUA 4FH8A 2O87A 3HJPA 2PBJA 4DVCA 5HR0A 2VCXA 2X99A 3ZRDA 4K6XA 2ON5A 5G2ZA 1PX6A 1GSEA 1I9DA 1GNEA 4IS0A 4TVEA 2MBTA 3D6IA 3GKMA 2YPMA 4XS6A 2H76A 3DWVA 2H6YA 3F6FA 4TR0A 1SK1A 4ISDA 3QPMA 4ECJA 1TDIA 5IMDA 4NHWA 1B48A 3IDVA 2VCTA 1PKWA 2A2SA 4CHSA 4PXOA 3TB2A 1YKCA 3IK9A 3EURA 1GTAA 2I81A 1ML6A 3L78A 2RLIA 5D73A 3GL5A 5AN1A 3DRNA 4ECBA 1SYRA 18GSA 2H1GA 5IMCA 1JLVA 2FA8A 2YWMA 3ZFBA 1SD9A 2M72A 1SL0B 2IFQB 1Q98A 3M9JA 2FHEA 4JU5A 5KN0A 1SK0A 10GSA 5DAKA 4GSSA 3P7XA 4G2EA 2GZZA 4GQFA 1O73A 1SENA 2H74A 3GTUA 3M3MA 3FZ4A 1C72A 3Q6OA 3NOFA 1U3AA 2MYGA 3P8WA 1UC7A 2GQMA 2YV9A 2LTKA 4TR3A 4ZL7A 3QR6A 4KCEA 4WR5A 3H4KA 5B6NA 3KCMA 5DCGA 1BYEA 3ISOA 2R6KA 2TRCP 4OWYA 2BMXA 1J0FA 1B4PA 3M9KA 1ERUA 3DVWA 4MLYA 4F0CA 1A0RP 1K0BA 2H19A 1ZL9A 2F9SA 5HFGA 3ZMLA 2H66A 2GSRA 2A2RA 4ZB8A 4KUNA 3LSZA 2GSTA 3NZNA 5IOWA 1K0OA 4J57E 5F06A 4PQHA 1XW5A 1OE8A 2HFDA 4JRRA 22GSA 3L0HA 4KE3A 5CREA 1EWXA 2DIZA 4DEJA 1U6TA 2EIRA 5B8BA 4PQ1A 4MDCA 3FR6A 2ZUPA 4L5OA 3HD5A 5ECIB 4MH3A 4J2FA 4FIWA 3IRAA
chains in the Genus database with same CATH superfamily
1SL2B 5IF6A 3H79A 1JFUA 4TXVA 2H1DA 3EVIA 1B27A 4DSQA 3MAKA 4K1FA 4BL7A 3Q18A 3I0YA 5FHIA 1X1YA 1ROVA 4HJ2A 3H3HA 2IFQA 1OC8A 3A5WA 1TKDB 2E7PA 2OKAA 2HMOB 1Z1SA 4QL9A 2BMQB 2OWPA 5ECHB 3TRXA 1G6YA 6GSSA 1KEBA 8CHOA 1G6WA 1XOAA 4Q5RA 3TRQA 2PU9C 2OE3A 2XH9A 2GTUA 2K6VA 1T1VA 4BVYA 4GF0A 4N0ZA 2M7OA 2R41A 4HUAA 3OR5A 4K5RA 1DVCA 4HM1B 4X1UA 5LC6A 4WETA 4EO3A 1CH0A 5H5RA 1NHYA 3KJYA 4RI6A 4KDUA 4OO5A 1B2UA 1SK2A 1B8XA 3APOA 5DJMA 1RCLA 3CME3 5C00A 3HOHA 2R5GA 3NXJA 1Q9EA 1E2YA 4XBTA 3D4MA 5IMFA 1O7UA 2QC7A 2PZVA 4OCFA 2VD1A 4ZB6A 2LKUA 5DALB 2XRXB 1TU7A 2JADA 2N5FA 1IVUA 3A76A 1IU7A 1BNSA 1OC9B 4Z7XA 1WRYA 1OE7A 1K734 5IG4A 4WEYA 4GSNA 5J3RA 1IVWA 2CT6A 3NBJA 3WGXA 2BHMA 3X3YA 1EV9A 3CCM3 3T0UA 1HNCA 1W6CA 3QMXA 4O92A 2EIQA 1QVG2 4F82A 4ZILA 1OACA 1FB6A 3IV4A 3ECFA 2MMZA 3FR3A 3CCQ3 2OTJ3 3F6DA 4ZB9A 1RKYA 2QGVA 1IV9A 4Z2TA 1LNIA 2JU5A 1E6BA 6STDA 4Z2RA 1H75A 4EUYA 4H86A 4EE0A 3QAVA 2CHCA 2KP2A 1OAZA 4IBPA 4TR1B 4IVFA 2L59A 1UGHI 2YZHA 4TN8A 3SBCA 3GZBA 2D42A 1LBKA 3I43A 2WDUA 5BU4A 5F05A 3QK9A 3FRCA 1MOLA 2GBXB 5JBSA 3LTCA 3KFQC 3EX9A 5FWGA 3GX0A 3LG6A 4WFOA 4V1Ap 1SIIA 4CDOA 4XTSA 3UOMA 2LQOA 1RJOA 1Q40A 1QJGA 2YN1A 3FZAA 3HXSA 2J23A 1DE2A 3AGNA 4EW5A 3MPHA 3F8HA 3TJGA 2AJQB 1FB0A 4ML6A 2PWJA 3O3TA 1VQ93 4JE1A 1MDIA 1BRKA 2K18A 3GSPA 2KRTA 3X42A 1W2B2 3DD3A 5AEUB 5ELGA 2OOVA 9RNTA 2IPAA 2V2GA 1IQYA 3EBTA 2H75A 3DZLA 4OO4A 5D9XA 2MC8A 3SXXA 4RNTA 3JUNA 3WHOA 3G4S3 2QKEA 1ZYNA 2OOVC 4OFNA 1OPYA 2WB9A 2ALBA 1IT7A 1EA2A 2KAAA 3V99A 1FA3A 3KXOA 1K0CA 1TTOA 3TKSA 1W4NA 2BU4A 1GSUA 2GLRA 1O81A 1TU5A 2AAWA 2XFSA 3V98A 1JV2B 1GTUA 5D9TA 5DJLA 1N8QA 1OC3A 1PD21 1XWCA 2H0HA 1BNRA 1V74A 1WE0A 4A5PA 2DKIA 3IBHA 4ZXGA 2XF3A 1M9AA 1USBA 1CYVA 5DALA 1TRPA 1SL1B 1F8NA 1GUHA 2CFDA 4HEA2 5DDLA 1OC9A 1TTZA 1GULA 1A2KA 4NREA 3LYKA 1AIUA 2XGLA 4K90B 2B5EA 2JACA 3WOEB 2FWHA 2JDIH 1QFNA 3KP8A 5STDA 3DGMA 3VLNA 5JCWA 3CNMA 2CFLA 2IWTA 1XOBA 1GMRA 5CLKA 1YVBI 2E2VA 1Z6NA 3D4AA 4DKIA 3EMXA 3JUOA 1UVZA 2GSSA 4KB3A 6RNTA 1X9WB 1CYUA 2W56A 5M19A 1NSWA 3JCML 3FK8A 3S29A 3MG1A 2HSHA 3CXGA 1TRUA 4R4KA 1XFLA 2K9FA 1BSCA 1HKXA 1RMSA 1BSAA 2H1AA 1BVIA 4TR1A 3US3A 1EOGA 3ER7A 2DLXA 2O8VB 1FOHA 3G9BA 2F5MA 1YZXA 1WP0A 4X2HA 5B7CA 4EC0A 3HIGA 2X8GA 3UARA 2MF7A 2A2PA 1SYXA 4V1Ag 3VI7A 3HCZA 4X2OA 1B20A 5HOHA 1I0VA 1S3RA 4NWYA 4LLRA 3PPUA 4FCJA 4FR9A 1XW9A 3ZTLA 1SJZA 1Y25A 4ZBDA 2PNCA 2O9UX 4MZBA 2HI7A 2OA7A 4OFMA 4MPGA 1S723 1A2MA 4TKYA 5G5FA 2L1SA 2XEPA 2CA8A 3DMLA 3DH2A 4NAXA 3CQFA 4LGQA 5IMAA 5D93A 2VCVA 1GOUA 3F4SA 5RNTA 1RGCA 1DE1A 4AGSA 1W6YA 2Z6BA 2L5LA 5HGRA 3IC8A 1V58A 3MSOA 4F9ZA 4K1UA 3GUSA 1FW1A 1THXA 4KA0A 2CKFB 2F5WA 1DYUA 1U3IA 4DSRA 3EF8A 1IDPA 3H1NA 1JBTA 1GLPA 4POKA 3TJBA 2FY6A 3DGLA 5G2GA 5ECQB 1BSEA 3UAPA 1U87A 2MMOA 1TI1A 1Q814 4KF9A 2SBLA 4ZL9A 3IHGA 2GQLA 3ERGA 4YH2A 4O5RA 4K61A 3MDKA 1QALA 3KSED 5IG3A 5HQPA 1SKRB 1SKWB 1KD14 2KF6A 3LWAA 2XSHB 2AB6A 4TW5A 5INYA 1YEXA 5AGYA 1K0NA 2VO4A 5FT3A 3TUEA 7GSSA 3D5JA 3DGYA 1X5CA 3ZLPA 2W2CA 2AAEA 1H4OA 4JR4A 3KZQA 2DJ1A 1XWGA 3F40A 5EQLA 1RN1A 1ZMAA 3SVAA 1HZ1A 4HM4B 5A0OB 3WYWA 2P0GA 3ZMKA 2VLUA 3EE1A 1BJXA 1ZGNA 3D9RA 1NW2A 1TP9A 4MCUA 3VPQA 5J9BA 2RSXA 1KTEA 2B1XB 1BG5A 1F2EA 2YFLB 3BB9A 3GURA 2FA4A 3ZIVA 2DMLA 3PZWA 3EMPA 3FZ9A 3LXTA 2P5QA 1N8R4 4WR4A 2E2GA 1A67A 1SU9A 1Q824 5A4VA 4HU9A 2CVBA 1T7PB 3WA3A 5LCZA 6GSUA 3IOSA 3PCSA 4G19A 5H5SA 4MMZB 3NBRA 3QAGA 1WMNA 1A2JA 5CRWA 5D9WA 2EC4A 2YCDA 4FO5A 1YHQ3 3CRTA 4L0UA 2VIMA 4RNYA 1Z3EA 2FD3A 3EU4A 5CRHA 2VM1A 4MH2A 5F8BA 4IT7A 3Q3FA 3GKKA 5GZZB 2B5YA 4LEHA 3TJJA 4TX4A 6GSTA 1B2SA 4HM7B 3K0ZA 5IQYA 4IQ1A 3LORA 1NU3A 5C04A 2EIOA 1FGMA 3WT1A 2LSTA 1HD2A 4ZM8A 1BNJA 4K0NA 1B9XC 4JR6A 1SD8A 4O5QA 3URPA 3LGCA 4BIKA 1A23A 2PVQA 3VWUA 3D5GA 1RLSA 1LOWA 2LNSA 2H71A 2P05A 2HRKA 5B8AA 2ZHXB 4FCZA 3GMFA 3X41A 4IP6A 1L5GB 1LXEA 4WYKB 3R2QA 4AF2A 1GY5A 4JZQA 3G7JA 3GRXA 1OKTA 1Z5YE 2OJLA 2K8SA 1XVQA 4MK3A 1S3DA 4I8BA 2XFTA 1AQVA 1AV4A 2C0GA 1B2MA 4WF4A 2FXTA 3S9FA 3D4TA 1K0DA 2MMNA 3AGOA 1JB2A 4O7HA 5JWRB 1YGWA 1B21A 3GFKA 3KP9A 4BA7A 1IYYA 1VQ83 2GU1A 4K2XA 4OCEA 3LXZA 5AISA 2CFKA 1BSDA 1PSQA 1UCKA 2X4AA 2Z77A 4KFDA 4ECCA 3FGYA 5JCUA 2L4VA 3QFBC 1BOXA 3DGQA 2BTOT 1JBRA 2YOIA 1ACVA 4EL1A 3ROBA 1YDKA 5AI1A 2OE1A 1TU8A 3K7CA 1QMAA 4XRDA 4WXTA 1RRLA 5D8IA 4HOHA 1Z6MA 5FGOA 1Y6EA 5ECLB 4QL7A 1OGXA 1RGKA 2RGQA 2F8FA 1BRSA 4R80A 1XWBA 3HVVA 2NPBA 1IQXA 1UI8A 4KGIA 4POMA 4IQAA 1B2XA 1A0FA 3TKSE 2IL3A 3LFLA 5ECNB 1NHOA 5IG5A 4K0GA 3IHQA 5IO0A 3NBBA 1M2DA 2ML6A 2H70A 3LYPA 2X64A 4BWSA 14GSA 3RDEA 5DREA 1PU4A 3LMLA 13GSA 3D21A 1OCVA 2ZNMA 2YWOA 5E4WA 2C8UA 1M3IA 3E3EA 4HSCX 3FF0A 1PN9A 3LTDA 4USSA 4HZ9B 1T8EB 1PQNA 4GSPA 3FMWA 3GKNA 4ILFA 3MSZA 2B6MA 5LC7A 3FSDA 4L7KA 2YV7A 11GSA 2D1WA 3BD2A 4NHZA 1Q7HA 5ECKB 2VM2A 5CF1A 2P38A 3EPTA 1LQMB 1AAZA 1TW9A 3Q90A 2JZSA 3FW2A 2GVPA 1RGHA 5KP1A 4FQUA 4WWUC 5LD0A 4QWTA 4EDZA 4G9HA 2NTOA 3HX8A 4KW6A 3IXRA 2IYJA 2DSAA 1GTIA 1TK8B 3LYGA 1F9MA 3FR9A 4HM2B 2GBWB 1J2BA 1MDKA 4YQVA 1R4YA 2H6XA 4K7NA 1B2ZA 2E0QA 1F37A 3HI7A 4LMWA 1B9YC 1E3RA 4WYKA 1Q4JA 2R0GA 5FW5A 3EU3A 1ZYQB 1UCJA 3C8EA 2HMKB 5GSSA 5A4UA 3WMDA 3NHXA 3ZFLA 3RGAA 5J41A 2DJ2A 3G7IA 5ECOB 2F8AA 1GOVA 3PXMA 4AJ8A 3VFIA 4XM4A 1WNHA 4E8EA 3HJMA 3WR2A 4RNZA 1U88A 3NUVA 3VI5A 4CW9A 2L6CA 1ZX2A 1SARA 3F63A 4N6TA 3O76A 4HM5B 4J5KA 1QAFA 4L8EA 1D6UA 3BBYA 4G0IA 4XS1A 1I3IA 3M1GA 5IEOA 3NM7A 4NHFA 4N6UA 1GYBA 3HKRA 1GMPA 3KKGA 5EEOA 2WS2A 1RK4A 1FW7A 3KEBA 1ASKA 6GSWA 2CX0A 3X40A 1OUNA 3GL3A 2V6KA 1UUVB 3PGBA 1ZO2A 3MYTA 3KM6A 4EVMA 4IJIA 4V2MA 4NXIA 5J4UA 4EXJA 1FVKA 2WULA 3WT2A 3KIIA 1VQ53 4HS1A 1GD3A 4IKHA 3RPNA 2WGRA 3GNJA 1FG4A 1JZOA 2UZ8A 5EY6A 1YJN3 5KN2A 4HM6B 3FKAA 2WFCA 1HYFA 1NM3A 2VLTA 3QRDA 2GZPA 3L0RA 2YP6A 2AV4A 5CYYA 2GQKA 3J7Yk 1XWKA 1GSPA 4Q5NA 3UBKA 2V41A 3RHCA 2PGTA 3EYTA 4O2HA 2B1KA 4GHOA 1HNAA 1PL1A 5ECSA 2IA7A 3F8UA 3U1WA 1CQHA 4EBGA 1PRXA 1VRSD 3X3XA 2KUCA 2WRTA 3GV1A 5E59A 2C10A 3GA4A 1BNGA 2CH9A 2W56B 3DEXA 4KX4A 1TJDA 2ZA4A 5AIGA 3CCL3 4HM0B 3KE7A 2PMTA 5HFKA 4MJDA 1X1XA 1S3CA 3TKRA 1V9WA 4LL1B 3NQZA 2QIYA 4QQ7A 3N5OA 2IY2A 2C0FA 1WMPA 3JUPA 4BU4A 3U5RE 3W8SA 2CX1A 3FLJA 1RW1A 2OCTA 3LZAA 1JZRA 1N2AA 2H8LA 4YKFA 1VGLA 1C7HA 4N6NB 2MZCA 2F4YA 2REMA 2HMMB 1Q864 4GTUA 4ZIJA 2RM6A 3FEUA 3EN8A 2HSMA 1BEDA 2IMIA 19GSA 2LRCA 4HQZA 1AW9A 1WMOA 2WO0A 2STDA 3UB1A 4XBXA 2BMRB 1DMMA 2CC3A 4HI7A 2JZTA 2CK3H 3ZYWA 1N5PA 4G1MB 3NM2A 1FHEA 2KF5A 2I9WA 1V40A 1PA3A 1M99A 4KSOA 1FYSA 1MD4A 2XR8B 4LL4B 3BNEA 1EGOA 3LEFA 2A4HA 1DE3A 3GKXA 3BIRA 1IQ8A 4EIQA 4RQXA 5I97A 4XBYA 1K41A 2YFIB 3PS8A 2IIYA 3A5EA 5GSTA 4F0BA 4PX1A 2C4BA 2N5AA 2YJ7A 4MMMA 3ERFA 2OACA 1PGTA 4KT3B 5G1KA 3OWSA 4O32A 4F03A 3N8BA 2LQQA 1YF0A 3JUQA 2W9PA 1K0AA 1G96A 2IMEA 1TK5B 1X0RA 2JQ5A 4MJBA 2CIUA 2H0GA 1KWIA 4TXOB 2O89A 1IYIA 2KF3A 3EE2A 3TKSC 4N30A 3APSA 3NV0B 2C1YA 1DBYA 1GUKA 3UMAA 1D6ZA 5HR2A 1SPUA 4KAEA 2I4AA 1MGRA 4HM3B 4BL3A 3F3QA 2DKHA 3G7YA 1I70A 3U6VA 1GSSA 1K28A 1CQSA 1VQK3 2CW9A 3GX8A 3EHCA 5DRVA 1I0XA 1W7CA 2HYXA 1DMQA 1YY7A 1UN2A 4O8SA 2GGTA 1VF3A 4AEQA 4K9ZA 2R2JA 2O85A 2GU3A 1QXHA 2RIIA 1TIJA 3GYKA 4GRFA 2IMKA 2CX4A 5KOXA 2OQEA 3VSYA 1TK0B 3A2WA 3HZ8A 5G1LA 3A3TA 4OD7A 3G8ZA 2D2ZA 2OQEC 3AMOB 2Z9SA 1OHOA 3N9JA 3MWZA 5ECRB 2W03A 5H5QA 2HZEB 2CFGA 3QFAC 2H72A 2CVKA 2BO9B 3PGTA 1KC84 3KTBA 2X49A 2KP1A 3C7MA 2OADA 2WGQA 1ST9A 2GSQA 2GS3A 3KIJA 2YX9A 1GWCA 3HVSA 1TRWA 1M1K4 2VAFA 4KFEA 3IR4A 2TRXA 1IK3A 4YAVA 2QA2A 3PINA 4KZ1A 3DY5A 2RFRA 3CSHA 4J5GA 2A4VA 5CF2A 2XPDA 1ULIB 3VURA 2NDOA 4PQIA 2W04A 3DXOA 4ULXA 2V32A 3W6GA 2E2TA 4DSSB 2GSPA 1WJKA 3HY2A 2ON7A 1BNEA 2BNGA 3HK4A 4GL6A 4HYZA 4KVHA 1RN4A 1YJW3 1YQ1A 1HNBA 3MKIA 2F98A 4HAAA 3CBUA 3GZRA 1TXXA 3STDA 1B4QA 4HVNA 3D0ZA 4J56E 3CTGA 2F3MA 1N9EA 3KMNA 2VCZA 1O6JA 3EWLA 4MZCA 3C73A 3QDNA 5GAND 2HXKA 3HYPA 3BNDA 3PCRA 4O5UA 4N0VA 4MMXB 5COHA 3HZPA 3LH4A 3FKFA 4J8TA 3CC23 5CO3A 1TFOA 2LJAA 4KNDA 4JF8A 1YNVX 3IPTA 4WHAA 2K0MA 3SYUA 2AYTA 3ZG5A 1B3SA 5CAXA 3D5IA 2HRAA 2YWNA 3UVTA 2DJKA 2AUVA 4ECIA 3SOYA 3LT9A 2I1UA 3J7Yd 1BNIA 4EF0A 4HZ4A 1S5AA 1QAKA 2FNOA 3BCIA 3KTLA 1IYHA 4X4JA 5AIXA 4TXOA 2WOFA 3GH6A 4XS4A 1R7HA 3SLUA 2XHFA 3NV0A 1KQS2 1JLWA 4MJAA 4LZIA 2WOHA 9GSSA 3E0UA 2C0EA 3VF1A 2P31A 4YKGA 1IV7A 1FUTA 4BVXB 1YF1A 3PR8A 1AXDA 3CCE3 1W89A 4H61A 1T2HA 2IMFA 1I2EA 1DETA 1EP7A 3TKQA 4PURA 1X5DA 4GCIA 2H6ZA 12GSA 3S67A 3VGNA 3RGRA 2CFWA 4CCVA 4TRXA 3O6TA 4IP1A 5IEPA 2KLXA 1GD4A 3DGOA 2DC5A 4R9KA 4Q5FA 2ZDJA 2QA1A 3ED3A 3IC4A 3ZVJD 1MD3A 1BUQA 2I3YA 2CWTA 1A8LA 1M7TA 3QCPA 5DCHA 1K3OA 2DJ0A 2BMOB 1RGAA 1PY3A 1LVNA 2OE0A 1TRQA 3A2VA 3Q1CA 4I5QA 1XIYA 1F6MC 1E97A 3A5IA 3AMOA 1K8A4 1W4VA 5AYSC 3QD9A 2HZEA 1ROAA 3GRDA 2OTL3 2L57A 2GZYA 2ML5A 5TGNA 5IIZA 1VQM3 5KOWA 5D9VA 2CZ2A 5JWQB 3UIWA 1BAOA 3DVXA 3D22A 4BTYA 3VWWA 4HDEA 2MBSA 1I5GA 4LMVA 4KFFA 2HMJB 3RAZA 3M0FA 4RUVA 4FYUA 1MGWA 1BRNL 1IVXA 2LV3A 4AJ6A 1OYJA 3TRPA 5ABRA 1MNLA 2G2QA 6GSVA 3Q74A 4DSSA 1TRVA 4WF5A 4IIAA 1GNWA 5GSPA 5CP1A 5ELUA 4IJ3A 1AQZA 3FZ5A 1GL8A 3I69A 3TOUA 3F9UA 2FWGA 2VL2A 1BSBA 2HT9A 5GAPD 1XCCA 1O7HB 6GSPA 3GHAA 2WZ9A 2VL2C 1T00A 3EQQB 1THOA 2YFJB 5IW9A 2LYXA 2HRFA 3IJEB 2LJRA 2LJKA 1T5YA 3GH9A 1F3AA 4ID0A 5M1AA 3CCS3 4MABA 1GY7A 3S27A 3T8UA 2M46A 3CCR3 5IO2A 2K54A 2L4CA 1FUWA 2B7JA 2WGOA 1M2AA 3C1RA 5EVOA 3VWVA 2V6OA 3KH7A 3MWHA 1K9M4 1V57A 6GSXA 4O02B 2QSIA 2XGNA 1U5OA 3G713 3KN4A 3N9HA 4MPFA 3ZFZA 4K8MA 2XC2A 1XG8A 1Z7RA 2RM5A 2GEYA 3WOFB 3I563 1MTCA 1FGRA 1J9BA 4ZBBA 1O8XA 2C0DA 5CNWA 1JBSA 1ZGXA 2L5OA 1PKZA 1EGRA 1G7OA 3SX1A 4L5LA 2F51A 1EKMA 1EG9B 4XRAA 5IPGA 1BUJA 4MF5A 4WKWA 4BVXA 4WP5A 2X8HA 2KXGA 3D3LA 5AIFA 3GZXB 4J9AA 5KP3A 1XPVA 4F2IA 4JBBA 4HU7A 1MDJA 1KNGA 5G30A 3UEMA 1MWRA 1Q42A 1BIRA 4KDXA 2HRNA 4YQMA 3P90A 3WGEA 4N10A 4I6XA 1W2ZA 3ZITA 1FGOA 3T8NA 3B4PA 3FF2A 4V2LA 2VLVA 3CNXA 3C1SA 1EEMA 2E2MA 2CZ3A 1O85A 1W02A 3F8XA 2VL9A 4EIPA 5CRGA 1TOFA 3VPTA 4STDA 4EKZA 3WGDA 1GRXA 2PN8A 3DM8A 4MMYB 4ZBAA 2JSZA 1WOUA 3L9VA 2FWEA 1IT8A 1RRHA 5G31A 2YJHA 2XBQA 2FLSA 3NIVA 3SWLA 2LQVA 3Q2PA 3L4NA 4FCMA 3WDGB 4CPKA 2FUG2 1XW6A 4XIHA 1ERVA 3FHKA 2RNTA 16GSA 4N6MA 2ZCTA 4N6LA 3ME8A 3CSJA 3TOTA 1SJIA 3ZREA 1UUWB 3F0IA 3A2XA 2XPEA 2JSYA 3ZIJA 1FAAA 4TR4A 3MNGA 3CSIA 4ML1A 4XCSA 4K5SA 4LYLB 1BNFA 3UJMA 7RNTA 2HZFA 1WIKA 1M1XB 1RNBA 3GN3A 1YJ6A 2P5RA 4EV5A 4HKVB 1Z9HA 2FGXA 3KGKA 1WPIA 3TCOA 3E99A 2CWUA 1T2IA 4MA9A 4GSTA 2LS5A 4X0XA 5HR1A 1LNHA 4G0KA 4MZWA 1J08A 3F9SA 2IJYA 3GSTA 2Z7AA 1SKSB 1EOHA 1GY6A 1YKAA 5J5NA 4OUQA 1ULJB 1GSDA 3VK9A 3LW9A 4YQUA 2NVLA 2B5XA 1FOVA 4POBA 1BU4A 2B1LA 4IELA 1I3FA 4HJMA 2IMDA 1M0UA 3H51A 2WJUA 4BL2A 4PUFC 4Z2UA 3CCU3 1JKGB 1O7WB 3BLZA 2R4IA 2MMAA 1DMNA 2Y73A 5F07A 5JWOB 2GXFA 2WCIA 1LOVA 2CWVA 3EN1B 1K3YA 3BU4A 1GP1A 1UCIA 1A24A 1QMVA 4RBNA 2BT3A 5JPPA 1ZYEA 3HVXA 1ABAA 1ILOA 1IVVA 1URMA 1Z7PA 1A2PA 1UGIA 4EC6A 4PEJA 4YAPA 2B7KA 2FWFA 1LOYA 2HSYA 2CG0A 4WBRD 4O3VA 1WQLB 4PUAA 1UA5A 3KSPA 3HHVA 1X9SB 3HIIA 1ZCPA 1TRSA 4NV2A 4GWRA 1W01A 3GIXA 1STDA 3ALAA 7STDA 4XDWA 3OV4A 3CD63 4BWQA 1RSNA 3UL5A 1BQ7A 1R5PA 1QK8A 2P09A 1OH0A 1VQP3 4IPBA 1OVNA 2YWIA 4E8HA 3RBTA 1RNTA 2UX0A 2JZRA 4PNFA 3J7Yb 1K0MA 3H93A 5HR3A 3CRUA 1A2LA 1A8YA 4FYBA 2V1LA 4NV5A 2JL4A 1FO5A 3RDWA 5J9CA 1CEWI 5IOXA 1O7NB 3K5TA 1BRIA 2AHEA 2AADA 3QAWA 2O3OA 5ECPB 3ZZXA 2C3TA 4ZL8A 5A5KA 6GSYA 5L71A 1RGGA 3IAS2 1N5HA 1XBSA 3KD0A 3CPW2 4POLA 3FG1A 3OXAA 1FZUA 1EZKA 3OWYA 3DKSA 4HQSA 1RTUA 3TKPA 1ZOFA 1UI7A 3B8LA 3NX0A 3TDGA 5AYRB 8GSSA 2RUEA 4FYCA 3UL6A 1NO3A 3C71A 2DJJA 2LRNA 1T3BA 4Q5QA 2GDRA 4R1KA 3MHEA 1PX7A 4KH7A 1D6YA 2LRTA 4OFTA 5EVHA 4IGJA 4CY8A 3PH9A 3ZG0A 2CV4A 4AKZA 1S3AA 4CY6A 2PVOC 4G0LA 3IMAB 3DMCA 2RUFA 2YANA 2OBKA 1VZZA 2R37A 1BRGA 2IUKA 1EP8A 1CQGA 2B24B 4D73B 3I6AA 5IMVA 1O7PB 2PUKC 1JB5A 17GSA 3KH9A 3HDCA 2A15A 4K7IA 8RNTA 3DUKA 2GT5A 3IK7A 2CQ9A 2UGIA 1JJ22 5ELAA 1ZZYA 3CTFA 3CXC2 1JKGA 2GT6A 1K3LA 5KEJA 1EQKA 1RGFA 1RGLA 1DSBA 1QUWA 1X1UA 2CX3A 3CU3A 2HLSA 3HVNA 2Q07A 5ENUA 2F86B 1NJI4 1OHPA 3BJ5A 1OHSA 1PMTA 4NPBA 3VWXA 1RHLA 3DGNA 3F7XA 3R3EA 3OWUA 2L4QA 2G0FA 4EXRA 3BCKA 4IN0A 1KSIA 2LUSA 1NDOB 1PFPA 1FVJA 2H30A 3WODG 5BVBA 3MYDA 2KCDA 2VL3A 5HFIA 4OK0A 2VCQA 4AJ7A 4JRFA 1G02A 1GSYA 1HU9A 4X43A 4K7OA 1GS3A 2XSOB 1RCKA 1LJRA 3FG4A 4MP4A 2YZUA 1O7MB 2F99A 3LJRA 1JHBA 5G5EA 4XHMA 4XS4B 2VUPA 1LQGC 1QGVA 1OKDA 5BXQA 4RZMA 1T4ZA 1XWAA 1ERTA 2DJ3A 4ACSA 3RHBA 1VQ43 1ON4A 1X9MB 1SJWA 1RQMA 5EPFA 3IAM2 2FNQA 1SQWA 4K2DA 5IMZA 1EEJA 3LT8A 3ZVJA 1AUCA 3DIEA 1BRJA 1TI3A 4N3VA 4PGTA 4N11A 1X5EA 1M904 4IW9A 3HA9A 2W6JH 1R5AA 3LQ7A 5DBQA 2K8VA 1JZWA 2KOKA 1ZS7A 4GLTA 5JCGA 2NBSA 3V92A 3LXUX 1NNVA 1MWUA 1EV4A 4CDLA 4RQRA 5ECMB 1AC1A 2IN3A 3GZYB 4PNGA 3X3ZA 3CCJ3 5KN1A 3EINA 5D81A 1V2AA 4CJNA 4LSOA 2VOCA 3E9JB 3GAXA 4L0WA 3N54B 3GSSA 3V1WA 2R3XA 3M8NA 3P2AA 2Y74A 1EUIC 2C3QA 5A4WA 5F0GA 2HE3A 1R26A 2C4JA 5ID2B 5IG0A 3IPZA 1YIT3 3L9UA 2O7KA 3RPPA 3AHSA 2L6DA 1G7EA 1NB5I 2RCDA 2ES7A 2PPTA 1M2BA 2H73A 3UL3A 2J8XB 1DUGA 4D73A 2BJXA 5D83A 1M9BA 2B3SA 4V2NA 2LNTA 1JNQA 3CYNA 2W9QA 5IPHA 4HOJA 1STFI 2CG1A 3ZL5A 1W5ZA 3F4TA 3TJFA 1GTBA 2N5BA 1U8CB 5DQSA 5KP4A 1Y4KA 2C3NA 7GSPA 2RBIA 1AQWA 4LA1A 1BX9A 4EDYA 1JB4A 1TFKA 1W00A 3DYRA 1HQOA 3KCHA 1QQ2A 3BOAA 3IA1A 1JN5B 2GEXA 1I8VA 2KHPA 2QGUA 1G0TA 4XDVA 1FUSA 3B4OA 4FMCA 2H01A 4P3YB 3FG3A 2PERA 1AVLA 4HM8B 1NB3I 4R9LA 1GSFA 4HZ2A 2X8CA 1LRAA 5AIHA 4EYCA 4FMAA 3I553 2INXA 3QOUA 3TJKA 4IHUA 3UVHA 1YVSA 2TIRA 1BRHA 3UNLA 5KN3A 1GUMA 3ME7A 1FGQA 4MJEA 4I2TA 2ZL8A 4GXZA 1JZDA 2DIYA 3FYGA 3AY8A 3WD6A 3JVCA 2R0PA 4TOPA 1RN7A 3MIXA 5AIIA 3S28A 3UJ1A 2DBCA 4RI7A 4HBRA 3OX9A 2R4VA 1F3BA 5AEWB 1WWJA 2I9HA 2OBIA 2H1BA 4L8OA 1KBNA 3EJVA 2DMMA 2M80A 3K9MC 4MF7A 1ISKA 1AQXA 5DQYA 4KSMA 2CAQA 3H8QA 3W8JA 2H0IA 3APQA 1VQL3 3FY7A 4JEDA 3G16A 2XBIA 1VQO3 4WBJA 5EL8A 1VQ63 4I2UA 3BNBA 3DXBA 1UDII 1BGSA 3HJOA 4MJCA 2VCWA 4BTWA 3MG2A 20GSA 3CMIA 3SOAA 1SIHA 3HZ4A 5DAKB 3CC43 1YEPA 5AIVA 1RDSA 4AKYA 4OMVA 1YI23 1VF1A 1WTHA 3ERWA 1GLQA 3K8NA 2LEGA 5BIRA 3F3RA 1E3VA 3IE3A 5BMUA 3FH1A 3GTUB 5ID2A 2VD0A 1ERWA 4N6OB 4KCAA 4H3UA 1XZOA 3TGZA 4NMUA 1TUHA 2HOHA 2CVDA 3PYJA 3NQYA 1W6GA 1V98A 1GH2A 1VF4A 1N9JA 2CAIA 5IM9A 4I97A 3M8CA 1T4YA 3KMOA 3CCV3 3L9SA 1R4WA 1PL2A 3UBLA 1VF2A 1TP6A 5DVBA 1OF5B 3EB8A 4BPYA 1SJ6A 5JPUA 1XVWA 4G10A 2HNLA 3S5CA 1WMJA 4GQCA 5LNKe 3CPOA 3U97A 2C80A 2FCHA 3Q19A 1BAYA 2YNXA 1O8WA 1GSQA 3I9V2 2IMJA 2SARA 5D96A 1N8JA 2V1MA 5B6MA 1LU4A 3EC3A 4KDYA 3EBYA 3F4RA 4L8PA 1MEKA 5CRDA 1M9GA 3K63A 1ZYPA 4PTSA 4MF6A 1FGTA 1HYUA 1JN5A 2J9HA 1XXUA 4FH8A 2O87A 3HJPA 3O8YA 2PBJA 4DVCA 1GMQA 5HR0A 2VCXA 2X99A 3ZRDA 4XB5A 4K6XA 2ON5A 5G2ZA 1PX6A 1GSEA 2QA43 1I9DA 2P0XA 5CK6A 1GNEA 4IS0A 4TVEA 1LOXA 2MBTA 4BIRA 4OVMA 3D6IA 1AR0A 3WA2X 1MWTA 3AHWA 1AY7A 2YPMA 3GKMA 2H76A 3DWVA 2H6YA 4XS6A 4FMDA 3F6FA 2KF4A 4TR0A 1NWWA 1SK1A 4ISDA 2F56A 3MG3A 3QPMA 1OGZA 3FZWA 4ECJA 1TDIA 4ICYA 5IMDA 1YGEA 4NHWA 1PYLA 1B48A 3IDVA 2E2UA 5D82A 2VCTA 4Q53A 1PKWA 2A2SA 2BIRA 1UCLA 4CHSA 1VQN3 1M3JA 4PXOA 3TB2A 1YKCA 3IK9A 3EURA 1GTAA 2I81A 1ML6A 3L78A 2RLIA 1QVF2 1I2FA 5D73A 3GL5A 5AN1A 3DRNA 4ECBA 5IERA 2Z76A 1I2GA 3BNCA 3B7CA 5ELJA 1SYRA 4N6V0 18GSA 1JRQA 4U13A 4BL7B 5CXOA 2H1GA 5IMCA 1JLVA 2FA8A 3G0KA 4HJLB 2YWMA 3ZFBA 1SD9A 3G6E3 3GWRA 2M72A 2FGTA 1YJ93 1SL0B 2IFQB 1Q98A 3M9JA 3CC73 2FHEA 4JU5A 4ORLA 1PN0A 5KN0A 1SK0A 10GSA 5DAKA 4GSSA 3P7XA 2W0QA 2HMNB 4G2EA 4BTXA 2GZZA 4BVYB 4GQFA 2C11A 1O73A 1SENA 2H74A 4I4KA 3GTUA 3F14A 3M3MA 3OW22 3FZ4A 1C72A 3Q6OA 3LTBA 1C54A 4MNNA 3NOFA 1U3AA 2QEX3 2MYGA 3P8WA 1UC7A 2GQMA 2YV9A 1R4CA 2LTKA 2HMLB 1MWSA 1RGEA 4TR3A 2IUJA 1OF5A 4ZL7A 3QR6A 3RNTA 1PFOA 4KCEA 3JUMA 4WR5A 3H4KA 4EV2A 5B6NA 3KCMA 5DCGA 1BYEA 3ISOA 5BRTA 2R6KA 2TRCP 4OWYA 2BMXA 3FCSB 1J0FA 1B4PA 3SEDA 4K1VA 3M9KA 2K3DA 5IENA 1ERUA 3DVWA 4MLYA 4F0CA 3F7SA 1A0RP 1K0BA 1VQQA 2H19A 1ZL9A 1US1A 2F9SA 5HFGA 3ZMLA 3CMA3 1VQ73 2H66A 1BANA 2GSRA 1DVDA 2A2RA 4KUNA 3LSZA 2GSTA 4ZB8A 3LOYA 4LMIA 3NZNA 2UUGC 5IOWA 1A2VA 4FMBA 1K0OA 4J57E 5F06A 4PQHA 1XW5A 1OE8A 2HFDA 2R0CA 4JRRA 22GSA 3L0HA 1GOYA 4GB5A 4HZBB 4KE3A 1AVKA 5CREA 3LTAA 1EWXA 4MEIA 2DIZA 3D79A 4DEJA 1U6TA 1O7GB 2EIRA 3EC9A 4PQ1A 5B8BA 5M18A 4MDCA 1A90A 1UW1A 3FR6A 2ZUPA 4L5OA 3HD5A 5ECIB 1Q7Y4 1X1WA 4MH3A 1YIJ3 4J2FA 2P0MA 1Q40B 4FIWA 3IRAA 1UUGB 3KZTA
chains in the Genus database with same CATH topology
1SL2B 3H79A 1JFUA 4TXVA 2H1DA 3EVIA 4DSQA 3MAKA 4K1FA 4BL7A 3Q18A 5FHIA 4HJ2A 2IFQA 1OC8A 3A5WA 1TKDB 2E7PA 2OKAA 4QL9A 5ECHB 3TRXA 1G6YA 6GSSA 1KEBA 1G6WA 1XOAA 4Q5RA 3TRQA 2PU9C 2OE3A 2GTUA 2K6VA 1T1VA 4BVYA 4GF0A 4N0ZA 4HUAA 3OR5A 4K5RA 4X1UA 4WETA 4EO3A 5H5RA 1NHYA 3KJYA 4RI6A 4KDUA 4OO5A 1SK2A 5DJMA 1B8XA 3APOA 5C00A 2R5GA 1E2YA 3D4MA 5IMFA 1O7UA 2QC7A 4OCFA 2VD1A 4ZB6A 2LKUA 5DALB 1TU7A 2JADA 2N5FA 1OC9B 4Z7XA 1WRYA 1OE7A 4WEYA 4GSNA 5J3RA 2CT6A 3WGXA 1EV9A 1HNCA 3QMXA 4O92A 2EIQA 4F82A 4ZILA 1FB6A 3IV4A 2MMZA 3FR3A 3F6DA 4ZB9A 2QGVA 4Z2TA 2JU5A 1E6BA 4Z2RA 1H75A 4EUYA 4H86A 4EE0A 3QAVA 2KP2A 1OAZA 4IBPA 4TR1B 4IVFA 2L59A 2YZHA 4TN8A 3SBCA 1LBKA 3I43A 2WDUA 5F05A 3FRCA 5FWGA 3GX0A 3LG6A 4V1Ap 4CDOA 4XTSA 3UOMA 2LQOA 2YN1A 3FZAA 3HXSA 2J23A 1DE2A 3TJGA 2AJQB 1FB0A 4ML6A 2PWJA 3O3TA 4JE1A 1MDIA 2K18A 3DD3A 5ELGA 2V2GA 2IPAA 2H75A 4OO4A 5D9XA 2QKEA 1ZYNA 4OFNA 2WB9A 2ALBA 3KXOA 1K0CA 3TKSA 1GSUA 2GLRA 1O81A 2AAWA 1GTUA 5D9TA 5DJLA 1OC3A 1PD21 1XWCA 2H0HA 1WE0A 4A5PA 2DKIA 3IBHA 4ZXGA 1M9AA 1USBA 5DALA 1SL1B 1GUHA 4HEA2 5DDLA 1OC9A 1TTZA 1GULA 3LYKA 1AIUA 2B5EA 2JACA 2FWHA 1QFNA 3KP8A 3VLNA 5JCWA 2IWTA 1XOBA 1Z6NA 3EMXA 1UVZA 2GSSA 4KB3A 1X9WB 1NSWA 3JCML 3FK8A 2HSHA 3CXGA 1TRUA 1XFLA 2K9FA 2H1AA 4TR1A 3US3A 1EOGA 2DLXA 2O8VB 1FOHA 3G9BA 1YZXA 1WP0A 5B7CA 4EC0A 2X8GA 3UARA 2A2PA 3VI7A 1SYXA 4V1Ag 3HCZA 4NWYA 4LLRA 3PPUA 1XW9A 3ZTLA 1SJZA 1Y25A 4ZBDA 4MZBA 2HI7A 2OA7A 4OFMA 4MPGA 1A2MA 4TKYA 5G5FA 2CA8A 3DMLA 4NAXA 5IMAA 5D93A 2VCVA 3F4SA 1DE1A 4AGSA 2L5LA 3IC8A 1V58A 4F9ZA 3GUSA 1FW1A 1THXA 4KA0A 1U3IA 4DSRA 3H1NA 1GLPA 4POKA 3TJBA 2FY6A 5ECQB 3UAPA 1U87A 2MMOA 1TI1A 4KF9A 4ZL9A 3IHGA 2GQLA 3ERGA 4YH2A 4O5RA 3MDKA 5HQPA 1SKRB 1SKWB 3LWAA 2AB6A 4TW5A 5INYA 1YEXA 5AGYA 1K0NA 2VO4A 5FT3A 3TUEA 7GSSA 3D5JA 1X5CA 3ZLPA 1H4OA 4JR4A 3KZQA 2DJ1A 1XWGA 1ZMAA 3WYWA 2P0GA 3ZMKA 2VLUA 1BJXA 1ZGNA 1NW2A 1TP9A 4MCUA 3VPQA 5J9BA 1KTEA 1BG5A 1F2EA 3GURA 3ZIVA 2FA4A 2DMLA 3EMPA 3FZ9A 3LXTA 2P5QA 4WR4A 2E2GA 1SU9A 5A4VA 4HU9A 2CVBA 1T7PB 5LCZA 6GSUA 3IOSA 4G19A 5H5SA 3QAGA 1A2JA 5CRWA 5D9WA 2EC4A 2YCDA 4FO5A 3CRTA 4L0UA 2VIMA 1Z3EA 2FD3A 3EU4A 5CRHA 2VM1A 4MH2A 5F8BA 3GKKA 5GZZB 2B5YA 3TJJA 6GSTA 5IQYA 4IQ1A 3LORA 5C04A 2EIOA 3WT1A 2LSTA 1HD2A 4K0NA 1B9XC 4JR6A 1SD8A 4O5QA 3LGCA 1A23A 2PVQA 3VWUA 2LNSA 2H71A 2HRKA 5B8AA 3GMFA 4IP6A 3R2QA 4AF2A 4JZQA 3G7JA 3GRXA 1OKTA 1Z5YE 2OJLA 2K8SA 1XVQA 4MK3A 1S3DA 4I8BA 1AQVA 2C0GA 4WF4A 3S9FA 3D4TA 1K0DA 2MMNA 4O7HA 5JWRB 3GFKA 3KP9A 4BA7A 4K2XA 4OCEA 3LXZA 5AISA 1PSQA 2X4AA 4ECCA 5JCUA 3QFBC 3DGQA 2BTOT 2YOIA 1ACVA 4EL1A 1YDKA 2OE1A 1TU8A 4XRDA 4WXTA 5D8IA 1Z6MA 1Y6EA 5ECLB 4QL7A 2F8FA 1XWBA 3HVVA 2NPBA 4KGIA 4POMA 4IQAA 1A0FA 3TKSE 2IL3A 3LFLA 5ECNB 4K0GA 1NHOA 5IO0A 3IHQA 1M2DA 14GSA 2H70A 3LYPA 2X64A 4BWSA 13GSA 3D21A 2ZNMA 2YWOA 5E4WA 2C8UA 3E3EA 1PN9A 4USSA 1T8EB 1PQNA 3GKNA 3FMWA 4ILFA 3MSZA 2B6MA 2YV7A 11GSA 3BD2A 4NHZA 5ECKB 2VM2A 3EPTA 1AAZA 1TW9A 2JZSA 3FW2A 2GVPA 4FQUA 5LD0A 4EDZA 4G9HA 2NTOA 4KW6A 3IXRA 2IYJA 2DSAA 1GTIA 1TK8B 1F9MA 3FR9A 1MDKA 4YQVA 2H6XA 4K7NA 2E0QA 1F37A 4LMWA 1B9YC 1Q4JA 2R0GA 3EU3A 1ZYQB 3C8EA 5GSSA 5A4UA 3ZFLA 5J41A 2DJ2A 3G7IA 5ECOB 2F8AA 4AJ8A 3VFIA 4E8EA 3HJMA 1U88A 3VI5A 4CW9A 2L6CA 3F63A 3O76A 4L8EA 3BBYA 4G0IA 4XS1A 3M1GA 3HKRA 2WS2A 1RK4A 3KEBA 6GSWA 3GL3A 2V6KA 3KM6A 4EVMA 4IJIA 4V2MA 4NXIA 5J4UA 4EXJA 1FVKA 2WULA 3WT2A 4HS1A 4IKHA 3RPNA 2WGRA 3GNJA 1FG4A 1JZOA 2UZ8A 5EY6A 5KN2A 2WFCA 1NM3A 2VLTA 2GZPA 2YP6A 2AV4A 5CYYA 2GQKA 3J7Yk 1XWKA 3UBKA 4Q5NA 2V41A 3RHCA 2PGTA 3EYTA 2B1KA 1PL1A 1HNAA 5ECSA 3F8UA 1CQHA 1PRXA 1VRSD 2KUCA 2WRTA 3GV1A 5E59A 3GA4A 3DEXA 4KX4A 1TJDA 2PMTA 5HFKA 1S3CA 3TKRA 1V9WA 4LL1B 4QQ7A 3N5OA 2IY2A 2C0FA 3U5RE 3W8SA 1RW1A 1JZRA 1N2AA 2H8LA 4YKFA 1VGLA 2MZCA 2REMA 4GTUA 4ZIJA 2RM6A 3FEUA 2HSMA 2IMIA 1BEDA 19GSA 2LRCA 4HQZA 1AW9A 4HI7A 2JZTA 3ZYWA 1FHEA 1V40A 1PA3A 1M99A 4KSOA 1MD4A 4LL4B 1EGOA 3LEFA 2A4HA 3GKXA 4EIQA 4RQXA 2IIYA 5GSTA 4F0BA 4PX1A 2N5AA 2YJ7A 4MMMA 3ERFA 2OACA 1PGTA 5G1KA 4O32A 4F03A 2LQQA 1YF0A 1K0AA 2IMEA 1TK5B 1X0RA 4MJBA 2H0GA 4TXOB 2O89A 1IYIA 3EE2A 3TKSC 4N30A 3APSA 2C1YA 1DBYA 1GUKA 3UMAA 5HR2A 4KAEA 2I4AA 3F3QA 2DKHA 3G7YA 3U6VA 1GSSA 3GX8A 2HYXA 1YY7A 1UN2A 2GGTA 1VF3A 4K9ZA 2R2JA 2O85A 1QXHA 2RIIA 3GYKA 4GRFA 2IMKA 2CX4A 5KOXA 1TK0B 3A2WA 3HZ8A 5G1LA 3A3TA 4OD7A 2D2ZA 2Z9SA 3N9JA 5ECRB 5H5QA 2HZEB 3QFAC 2H72A 2CVKA 3PGTA 3KTBA 2X49A 2KP1A 3C7MA 2OADA 1ST9A 2GSQA 2GS3A 3KIJA 1GWCA 3HVSA 1TRWA 2VAFA 3IR4A 2TRXA 4YAVA 2QA2A 3PINA 3CSHA 2A4VA 2XPDA 3VURA 2NDOA 4PQIA 4ULXA 2V32A 3W6GA 4DSSB 1WJKA 3HY2A 2ON7A 1YQ1A 1HNBA 3CBUA 1TXXA 1B4QA 3D0ZA 4J56E 3CTGA 2F3MA 4MZCA 3KMNA 2VCZA 1O6JA 3EWLA 5GAND 3C73A 3QDNA 2HXKA 3HYPA 4O5UA 4N0VA 5COHA 3FKFA 5CO3A 2LJAA 4KNDA 5CAXA 2AYTA 2HRAA 2YWNA 3UVTA 2DJKA 2AUVA 4ECIA 2I1UA 4EF0A 4HZ4A 3BCIA 2FNOA 3KTLA 1IYHA 4X4JA 5AIXA 4TXOA 3GH6A 4XS4A 1R7HA 2XHFA 1JLWA 4MJAA 9GSSA 3E0UA 2C0EA 2P31A 4YKGA 4BVXB 1YF1A 3PR8A 1AXDA 1W89A 2IMFA 1EP7A 3TKQA 4PURA 1X5DA 4GCIA 2H6ZA 12GSA 4TRXA 3O6TA 4IP1A 2KLXA 2DC5A 4Q5FA 3ED3A 2QA1A 3IC4A 3ZVJD 1MD3A 2I3YA 1A8LA 1M7TA 3QCPA 5DCHA 1K3OA 2DJ0A 2OE0A 3A2VA 4I5QA 1XIYA 1F6MC 3A5IA 3QD9A 1W4VA 2HZEA 2L57A 2GZYA 5IIZA 5KOWA 5D9VA 2CZ2A 5JWQB 3UIWA 3DVXA 3D22A 3VWWA 4HDEA 2MBSA 1I5GA 4LMVA 3RAZA 3M0FA 4RUVA 4FYUA 2LV3A 4AJ6A 1OYJA 3TRPA 5ABRA 2G2QA 6GSVA 3Q74A 4DSSA 1TRVA 4WF5A 1GNWA 5CP1A 4IJ3A 3FZ5A 1GL8A 3I69A 3TOUA 3F9UA 2FWGA 2VL2A 2HT9A 5GAPD 1XCCA 3GHAA 2WZ9A 2VL2C 1T00A 1THOA 2HRFA 2LJRA 2LJKA 3GH9A 1F3AA 4ID0A 4MABA 2M46A 5IO2A 2L4CA 2B7JA 3C1RA 1M2AA 5EVOA 3VWVA 2V6OA 3KH7A 3MWHA 1V57A 6GSXA 2QSIA 4MPFA 4K8MA 2XC2A 1Z7RA 2RM5A 1MTCA 1J9BA 4ZBBA 1O8XA 2C0DA 5CNWA 2L5OA 1PKZA 1EGRA 1G7OA 4L5LA 2F51A 4XRAA 5IPGA 4MF5A 4WKWA 4BVXA 2X8HA 1XPVA 4F2IA 4JBBA 4HU7A 1MDJA 1KNGA 5G30A 3UEMA 4KDXA 2HRNA 4YQMA 3P90A 3WGEA 4N10A 4I6XA 3ZITA 4V2LA 2VLVA 3C1SA 1EEMA 2E2MA 2CZ3A 1O85A 2VL9A 4EIPA 5CRGA 1TOFA 3VPTA 4EKZA 3WGDA 1GRXA 2PN8A 4ZBAA 2JSZA 1WOUA 3L9VA 2FWEA 5G31A 2YJHA 2XBQA 2FLSA 3NIVA 3SWLA 3L4NA 2FUG2 1XW6A 4XIHA 1ERVA 3FHKA 16GSA 2ZCTA 3ME8A 3CSJA 3TOTA 1SJIA 3ZREA 3F0IA 3A2XA 2XPEA 2JSYA 3ZIJA 1FAAA 4TR4A 3MNGA 3CSIA 4ML1A 4XCSA 4K5SA 2HZFA 1WIKA 3GN3A 1YJ6A 2P5RA 3TCOA 1Z9HA 2FGXA 3KGKA 1WPIA 4MA9A 4GSTA 2LS5A 4X0XA 5HR1A 4G0KA 4MZWA 1J08A 2IJYA 3GSTA 1SKSB 1EOHA 1YKAA 5J5NA 1GSDA 3VK9A 3LW9A 4YQUA 2NVLA 2B5XA 1FOVA 4POBA 2B1LA 4IELA 4HJMA 2IMDA 1M0UA 2WJUA 4PUFC 4Z2UA 2MMAA 5F07A 5JWOB 2WCIA 1K3YA 1GP1A 1A24A 1QMVA 1ZYEA 3HVXA 1ABAA 1ILOA 1URMA 1Z7PA 4YAPA 2B7KA 2FWFA 2HSYA 4WBRD 4PUAA 1UA5A 3HHVA 1X9SB 1ZCPA 1TRSA 4NV2A 4GWRA 3GIXA 4BWQA 1BQ7A 1R5PA 1QK8A 1OVNA 2YWIA 4E8HA 3RBTA 2JZRA 3J7Yb 4PNFA 1K0MA 3H93A 5HR3A 3CRUA 1A2LA 1A8YA 4FYBA 4NV5A 2JL4A 1FO5A 3RDWA 5J9CA 5IOXA 2AHEA 3QAWA 5ECPB 3ZZXA 2C3TA 4ZL8A 5A5KA 6GSYA 5L71A 3IAS2 1XBSA 3KD0A 4POLA 1EZKA 3DKSA 4HQSA 3TKPA 1ZOFA 3TDGA 8GSSA 2RUEA 4FYCA 3C71A 2DJJA 2LRNA 1T3BA 4Q5QA 2GDRA 1PX7A 4KH7A 2LRTA 4OFTA 4IGJA 4CY8A 3PH9A 2CV4A 1S3AA 4CY6A 2PVOC 4G0LA 2RUFA 2YANA 2OBKA 2R37A 1EP8A 1CQGA 4D73B 3I6AA 5IMVA 2PUKC 17GSA 3KH9A 3HDCA 4K7IA 2GT5A 3IK7A 2CQ9A 5ELAA 1ZZYA 3CTFA 2GT6A 1K3LA 5KEJA 1DSBA 1QUWA 2CX3A 2HLSA 5ENUA 3BJ5A 1PMTA 4NPBA 3VWXA 3R3EA 2L4QA 2G0FA 3BCKA 4IN0A 2LUSA 1FVJA 2H30A 3MYDA 2VL3A 5HFIA 2VCQA 4AJ7A 1GSYA 4X43A 4K7OA 1LJRA 4MP4A 2YZUA 3LJRA 1JHBA 5G5EA 4XHMA 4XS4B 2VUPA 1QGVA 1OKDA 1T4ZA 1XWAA 1ERTA 2DJ3A 4ACSA 3RHBA 1ON4A 1X9MB 5EPFA 1RQMA 3IAM2 4K2DA 5IMZA 1EEJA 3ZVJA 1AUCA 3DIEA 1TI3A 4PGTA 4N11A 1X5EA 4IW9A 3HA9A 1R5AA 3LQ7A 5DBQA 2K8VA 1JZWA 2KOKA 4GLTA 5JCGA 2NBSA 1EV4A 4RQRA 5ECMB 1AC1A 2IN3A 4PNGA 5KN1A 3EINA 1V2AA 2VOCA 3E9JB 4L0WA 3GSSA 3V1WA 2R3XA 3M8NA 3P2AA 5A4WA 2C3QA 5F0GA 2HE3A 1R26A 2C4JA 5ID2B 3IPZA 3L9UA 2O7KA 3RPPA 2L6DA 1G7EA 2ES7A 2PPTA 1M2BA 2H73A 3UL3A 1DUGA 4D73A 2BJXA 1M9BA 2B3SA 4V2NA 2LNTA 3CYNA 5IPHA 4HOJA 3ZL5A 3F4TA 3TJFA 1GTBA 2N5BA 5DQSA 2C3NA 1AQWA 4LA1A 1BX9A 4EDYA 3DYRA 1HQOA 1QQ2A 3BOAA 3IA1A 2KHPA 1G0TA 2H01A 4P3YB 2PERA 1GSFA 4HZ2A 2X8CA 3TJKA 3QOUA 3UVHA 4IHUA 2TIRA 5KN3A 1GUMA 3ME7A 4MJEA 4I2TA 4GXZA 1JZDA 2DIYA 3FYGA 3AY8A 3WD6A 2R0PA 4TOPA 3MIXA 3UJ1A 2DBCA 4RI7A 2R4VA 1F3BA 1WWJA 2I9HA 2OBIA 2H1BA 1KBNA 2DMMA 2M80A 4MF7A 1AQXA 5DQYA 4KSMA 2CAQA 3H8QA 3W8JA 2H0IA 3APQA 3FY7A 4JEDA 2XBIA 4WBJA 5EL8A 4I2UA 3DXBA 3HJOA 4MJCA 2VCWA 20GSA 3CMIA 3HZ4A 5DAKB 1YEPA 5AIVA 4OMVA 1VF1A 3ERWA 1GLQA 3K8NA 2LEGA 3F3RA 3IE3A 5BMUA 3GTUB 5ID2A 2VD0A 1ERWA 4KCAA 1XZOA 3TGZA 4NMUA 2CVDA 1V98A 1GH2A 1VF4A 2CAIA 5IM9A 4I97A 1T4YA 3KMOA 3L9SA 1R4WA 1PL2A 3UBLA 1VF2A 5DVBA 4BPYA 1SJ6A 1XVWA 4G10A 2HNLA 4GQCA 1WMJA 5LNKe 2C80A 2FCHA 3Q19A 1BAYA 2YNXA 1O8WA 1GSQA 3I9V2 5D96A 1N8JA 2V1MA 5B6MA 1LU4A 3EC3A 4KDYA 3F4RA 1MEKA 5CRDA 4PTSA 1ZYPA 4MF6A 1HYUA 2J9HA 1XXUA 4FH8A 2O87A 3HJPA 2PBJA 4DVCA 5HR0A 2VCXA 2X99A 3ZRDA 4K6XA 2ON5A 5G2ZA 1PX6A 1GSEA 1I9DA 1GNEA 4IS0A 4TVEA 2MBTA 3D6IA 3GKMA 2YPMA 4XS6A 2H76A 3DWVA 2H6YA 3F6FA 4TR0A 1SK1A 4ISDA 3QPMA 4ECJA 1TDIA 4ICYA 5IMDA 4NHWA 1B48A 3IDVA 2VCTA 1PKWA 2A2SA 4CHSA 4PXOA 3TB2A 1YKCA 3IK9A 3EURA 1GTAA 2I81A 1ML6A 3L78A 2RLIA 5D73A 3GL5A 5AN1A 3DRNA 4ECBA 1SYRA 18GSA 4BL7B 2H1GA 5IMCA 1JLVA 2FA8A 2YWMA 3ZFBA 1SD9A 2M72A 1SL0B 2IFQB 1Q98A 3M9JA 2FHEA 4JU5A 1PN0A 5KN0A 1SK0A 10GSA 5DAKA 4GSSA 3P7XA 4G2EA 2GZZA 4BVYB 4GQFA 1O73A 1SENA 2H74A 3GTUA 3M3MA 3FZ4A 1C72A 3Q6OA 4MNNA 3NOFA 1U3AA 2MYGA 3P8WA 1UC7A 2GQMA 2YV9A 2LTKA 4TR3A 4ZL7A 3QR6A 4KCEA 4WR5A 3H4KA 5B6NA 3KCMA 5DCGA 1BYEA 3ISOA 5BRTA 2R6KA 2TRCP 4OWYA 2BMXA 1J0FA 1B4PA 3M9KA 1ERUA 3DVWA 4MLYA 4F0CA 1A0RP 1K0BA 2H19A 1ZL9A 2F9SA 5HFGA 3ZMLA 2H66A 2GSRA 2A2RA 4ZB8A 4KUNA 3LSZA 2GSTA 3NZNA 5IOWA 1K0OA 4J57E 5F06A 4PQHA 1XW5A 1OE8A 2HFDA 2R0CA 4JRRA 22GSA 3L0HA 4KE3A 5CREA 1EWXA 2DIZA 4DEJA 1U6TA 2EIRA 5B8BA 4PQ1A 4MDCA 3FR6A 2ZUPA 4L5OA 3HD5A 5ECIB 4MH3A 4J2FA 4FIWA 3IRAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1SL2 B;  3H79 A;  1JFU A;  4TXV A;  2H1D A;  3EVI A;  4DSQ A;  3MAK A;  4K1F A;  4BL7 A;  3Q18 A;  5FHI A;  4HJ2 A;  2IFQ A;  1OC8 A;  3A5W A;  1TKD B;  2E7P A;  2OKA A;  4QL9 A;  5ECH B;  3TRX A;  1G6Y A;  6GSS A;  1KEB A;  1G6W A;  1XOA A;  4Q5R A;  3TRQ A;  2PU9 C;  2OE3 A;  2GTU A;  2K6V A;  1T1V A;  4BVY A;  4GF0 A;  4N0Z A;  4HUA A;  3OR5 A;  4X1U A;  4WET A;  4EO3 A;  5H5R A;  1NHY A;  3KJY A;  4RI6 A;  4KDU A;  4OO5 A;  1SK2 A;  5DJM A;  1B8X A;  3APO A;  5C00 A;  2R5G A;  1E2Y A;  3D4M A;  5IMF A;  1O7U A;  2QC7 A;  4OCF A;  2VD1 A;  4ZB6 A;  2LKU A;  5DAL B;  1TU7 A;  2JAD A;  2N5F A;  1OC9 B;  4Z7X A;  1WRY A;  1OE7 A;  4WEY A;  4GSN A;  5J3R A;  2CT6 A;  3WGX A;  1EV9 A;  1HNC A;  3QMX A;  4O92 A;  2EIQ A;  4F82 A;  4ZIL A;  1FB6 A;  3IV4 A;  2MMZ A;  3FR3 A;  3F6D A;  4ZB9 A;  2QGV A;  2JU5 A;  1E6B A;  1H75 A;  4EUY A;  4H86 A;  4EE0 A;  3QAV A;  2KP2 A;  1OAZ A;  4IBP A;  4TR1 B;  4IVF A;  2L59 A;  2YZH A;  4TN8 A;  3SBC A;  1LBK A;  3I43 A;  2WDU A;  5F05 A;  3FRC A;  5FWG A;  3GX0 A;  3LG6 A;  4V1A p;  4CDO A;  4XTS A;  3UOM A;  2LQO A;  2YN1 A;  3FZA A;  3HXS A;  2J23 A;  1DE2 A;  3TJG A;  2AJQ B;  1FB0 A;  4ML6 A;  2PWJ A;  3O3T A;  4JE1 A;  1MDI A;  2K18 A;  3DD3 A;  5ELG A;  2V2G A;  2IPA A;  2H75 A;  4OO4 A;  5D9X A;  2QKE A;  4OFN A;  2WB9 A;  2ALB A;  3KXO A;  1K0C A;  3TKS A;  1GSU A;  2GLR A;  1O81 A;  2AAW A;  1GTU A;  5D9T A;  5DJL A;  1OC3 A;  1XWC A;  1PD2 1;  2H0H A;  1WE0 A;  3IBH A;  4ZXG A;  1M9A A;  1USB A;  5DAL A;  1SL1 B;  1GUH A;  4HEA 2;  5DDL A;  1OC9 A;  1TTZ A;  1GUL A;  3LYK A;  1AIU A;  2B5E A;  2JAC A;  2FWH A;  1QFN A;  3KP8 A;  3VLN A;  5JCW A;  2IWT A;  1XOB A;  1Z6N A;  3EMX A;  1UVZ A;  2GSS A;  4KB3 A;  1X9W B;  1NSW A;  3JCM L;  3FK8 A;  2HSH A;  3CXG A;  1TRU A;  1XFL A;  2K9F A;  2H1A A;  4TR1 A;  3US3 A;  1EOG A;  2DLX A;  2O8V B;  3G9B A;  1YZX A;  1WP0 A;  5B7C A;  4EC0 A;  2X8G A;  3UAR A;  3VI7 A;  1SYX A;  4V1A g;  3HCZ A;  4NWY A;  4LLR A;  1XW9 A;  3ZTL A;  1SJZ A;  1Y25 A;  4ZBD A;  4MZB A;  2HI7 A;  2OA7 A;  4OFM A;  4MPG A;  1A2M A;  4TKY A;  5G5F A;  2CA8 A;  3DML A;  4NAX A;  5IMA A;  5D93 A;  2VCV A;  3F4S A;  1DE1 A;  4AGS A;  2L5L A;  1V58 A;  4F9Z A;  3GUS A;  1FW1 A;  1THX A;  4KA0 A;  1U3I A;  4DSR A;  3H1N A;  1GLP A;  4POK A;  3TJB A;  2FY6 A;  5ECQ B;  3UAP A;  1U87 A;  2MMO A;  1TI1 A;  4ZL9 A;  2GQL A;  3ERG A;  4YH2 A;  4O5R A;  3MDK A;  5HQP A;  1SKR B;  1SKW B;  3LWA A;  2AB6 A;  4TW5 A;  5INY A;  1YEX A;  5AGY A;  1K0N A;  2VO4 A;  5FT3 A;  3TUE A;  7GSS A;  3D5J A;  1X5C A;  3ZLP A;  1H4O A;  4JR4 A;  3KZQ A;  2DJ1 A;  1XWG A;  1ZMA A;  3WYW A;  2P0G A;  3ZMK A;  2VLU A;  1BJX A;  1ZGN A;  1NW2 A;  1TP9 A;  4MCU A;  3VPQ A;  5J9B A;  1KTE A;  1BG5 A;  1F2E A;  3GUR A;  3ZIV A;  2FA4 A;  2DML A;  3EMP A;  3FZ9 A;  3LXT A;  2P5Q A;  4WR4 A;  2E2G A;  1SU9 A;  5A4V A;  4HU9 A;  2CVB A;  1T7P B;  5LCZ A;  6GSU A;  3IOS A;  4G19 A;  5H5S A;  3QAG A;  1A2J A;  5CRW A;  5D9W A;  2EC4 A;  2YCD A;  4FO5 A;  3CRT A;  4L0U A;  2VIM A;  1Z3E A;  2FD3 A;  3EU4 A;  5CRH A;  2VM1 A;  4MH2 A;  5F8B A;  3GKK A;  5GZZ B;  2B5Y A;  3TJJ A;  6GST A;  5IQY A;  4IQ1 A;  3LOR A;  5C04 A;  2EIO A;  3WT1 A;  2LST A;  1HD2 A;  4K0N A;  1B9X C;  4JR6 A;  1SD8 A;  3LGC A;  1A23 A;  2PVQ A;  3VWU A;  2LNS A;  2H71 A;  5B8A A;  3GMF A;  4IP6 A;  3R2Q A;  4AF2 A;  4JZQ A;  3G7J A;  3GRX A;  1OKT A;  1Z5Y E;  2OJL A;  2K8S A;  1XVQ A;  4MK3 A;  1S3D A;  4I8B A;  1AQV A;  2C0G A;  4WF4 A;  3S9F A;  3D4T A;  1K0D A;  2MMN A;  4O7H A;  5JWR B;  3GFK A;  3KP9 A;  4BA7 A;  4OCE A;  3LXZ A;  5AIS A;  1PSQ A;  4ECC A;  5JCU A;  3QFB C;  3DGQ A;  2BTO T;  2YOI A;  1ACV A;  4EL1 A;  1YDK A;  2OE1 A;  1TU8 A;  4XRD A;  4WXT A;  5D8I A;  1Z6M A;  1Y6E A;  5ECL B;  4QL7 A;  2F8F A;  1XWB A;  3HVV A;  2NPB A;  4KGI A;  4POM A;  4IQA A;  1A0F A;  3TKS E;  5ECN B;  2IL3 A;  3LFL A;  4K0G A;  1NHO A;  5IO0 A;  3IHQ A;  1M2D A;  14GS A;  2H70 A;  3LYP A;  2X64 A;  4BWS A;  13GS A;  3D21 A;  2ZNM A;  2YWO A;  5E4W A;  2C8U A;  3E3E A;  1PN9 A;  1T8E B;  1PQN A;  3GKN A;  4ILF A;  3MSZ A;  2B6M A;  2YV7 A;  11GS A;  3BD2 A;  4NHZ A;  5ECK B;  2VM2 A;  1AAZ A;  1TW9 A;  2JZS A;  3FW2 A;  2GVP A;  5LD0 A;  4EDZ A;  4G9H A;  2NTO A;  4KW6 A;  3IXR A;  2IYJ A;  2DSA A;  1GTI A;  1TK8 B;  1F9M A;  3FR9 A;  1MDK A;  4YQV A;  2H6X A;  4K7N A;  2E0Q A;  1F37 A;  4LMW A;  1B9Y C;  1Q4J A;  3EU3 A;  1ZYQ B;  3C8E A;  5GSS A;  5A4U A;  3ZFL A;  5J41 A;  2DJ2 A;  3G7I A;  5ECO B;  2F8A A;  4AJ8 A;  3VFI A;  4E8E A;  3HJM A;  1U88 A;  3VI5 A;  4CW9 A;  2L6C A;  3F63 A;  3O76 A;  4L8E A;  3BBY A;  4XS1 A;  3M1G A;  3HKR A;  2WS2 A;  1RK4 A;  3KEB A;  6GSW A;  3GL3 A;  2V6K A;  3KM6 A;  4EVM A;  4IJI A;  4V2M A;  4NXI A;  5J4U A;  4EXJ A;  1FVK A;  2WUL A;  3WT2 A;  4HS1 A;  4IKH A;  3RPN A;  2WGR A;  3GNJ A;  1FG4 A;  1JZO A;  5KN2 A;  5EY6 A;  2WFC A;  1NM3 A;  2VLT A;  2GZP A;  2YP6 A;  2AV4 A;  5CYY A;  2GQK A;  3J7Y k;  1XWK A;  3UBK A;  4Q5N A;  2V41 A;  3RHC A;  2PGT A;  3EYT A;  2B1K A;  1PL1 A;  1HNA A;  5ECS A;  3F8U A;  1CQH A;  1PRX A;  1VRS D;  2KUC A;  2WRT A;  3GV1 A;  5E59 A;  3GA4 A;  3DEX A;  4KX4 A;  1TJD A;  2PMT A;  5HFK A;  1S3C A;  3TKR A;  1V9W A;  4LL1 B;  4QQ7 A;  3N5O A;  2IY2 A;  2C0F A;  3U5R E;  3W8S A;  1RW1 A;  1JZR A;  1N2A A;  2H8L A;  1VGL A;  2MZC A;  2REM A;  4GTU A;  4ZIJ A;  2RM6 A;  3FEU A;  2IMI A;  1BED A;  19GS A;  2LRC A;  4HQZ A;  1AW9 A;  4HI7 A;  2JZT A;  3ZYW A;  1FHE A;  1V40 A;  1PA3 A;  1M99 A;  4KSO A;  1MD4 A;  4LL4 B;  1EGO A;  3LEF A;  3GKX A;  4RQX A;  2IIY A;  5GST A;  4F0B A;  4PX1 A;  2N5A A;  2YJ7 A;  4MMM A;  3ERF A;  2OAC A;  1PGT A;  5G1K A;  4O32 A;  4F03 A;  2LQQ A;  1YF0 A;  1K0A A;  2IME A;  1TK5 B;  1X0R A;  4MJB A;  2H0G A;  4TXO B;  2O89 A;  1IYI A;  3EE2 A;  3TKS C;  4N30 A;  3APS A;  2C1Y A;  1DBY A;  1GUK A;  3UMA A;  5HR2 A;  4KAE A;  2I4A A;  3F3Q A;  3G7Y A;  3U6V A;  1GSS A;  3GX8 A;  2HYX A;  1YY7 A;  1UN2 A;  2GGT A;  1VF3 A;  4K9Z A;  2R2J A;  2O85 A;  1QXH A;  2RII A;  3GYK A;  4GRF A;  2IMK A;  2CX4 A;  1TK0 B;  3A2W A;  3HZ8 A;  5G1L A;  3A3T A;  4OD7 A;  2D2Z A;  2Z9S A;  3N9J A;  5ECR B;  5H5Q A;  2HZE B;  3QFA C;  2H72 A;  2CVK A;  3PGT A;  3KTB A;  2KP1 A;  3C7M A;  2OAD A;  1ST9 A;  2GSQ A;  2GS3 A;  3KIJ A;  1GWC A;  3HVS A;  1TRW A;  2VAF A;  3IR4 A;  2TRX A;  4YAV A;  3PIN A;  3CSH A;  2A4V A;  2XPD A;  3VUR A;  2NDO A;  4PQI A;  4ULX A;  2V32 A;  3W6G A;  4DSS B;  1WJK A;  3HY2 A;  2ON7 A;  1YQ1 A;  1HNB A;  3CBU A;  1TXX A;  1B4Q A;  3D0Z A;  4J56 E;  3CTG A;  2F3M A;  4MZC A;  3KMN A;  2VCZ A;  1O6J A;  3EWL A;  5GAN D;  3C73 A;  3QDN A;  2HXK A;  3HYP A;  4N0V A;  5COH A;  3FKF A;  5CO3 A;  2LJA A;  4KND A;  5CAX A;  2AYT A;  2YWN A;  3UVT A;  2DJK A;  2AUV A;  4ECI A;  2I1U A;  4EF0 A;  4HZ4 A;  3BCI A;  2FNO A;  3KTL A;  1IYH A;  5AIX A;  4TXO A;  3GH6 A;  4XS4 A;  1R7H A;  2XHF A;  1JLW A;  4MJA A;  9GSS A;  3E0U A;  2C0E A;  2P31 A;  1YF1 A;  3PR8 A;  1AXD A;  1W89 A;  2IMF A;  1EP7 A;  3TKQ A;  4PUR A;  1X5D A;  4GCI A;  2H6Z A;  12GS A;  4TRX A;  3O6T A;  4IP1 A;  2KLX A;  2DC5 A;  4Q5F A;  3ED3 A;  3IC4 A;  3ZVJ D;  1MD3 A;  2I3Y A;  1A8L A;  1M7T A;  3QCP A;  5DCH A;  1K3O A;  2DJ0 A;  2OE0 A;  3A2V A;  4I5Q A;  1XIY A;  1F6M C;  3QD9 A;  1W4V A;  2HZE A;  2L57 A;  2GZY A;  5IIZ A;  5D9V A;  2CZ2 A;  5JWQ B;  3UIW A;  3DVX A;  3D22 A;  3VWW A;  4HDE A;  2MBS A;  1I5G A;  4LMV A;  3RAZ A;  3M0F A;  4RUV A;  4FYU A;  2LV3 A;  4AJ6 A;  1OYJ A;  3TRP A;  5ABR A;  2G2Q A;  6GSV A;  3Q74 A;  4DSS A;  1TRV A;  4WF5 A;  1GNW A;  5CP1 A;  4IJ3 A;  3FZ5 A;  1GL8 A;  3I69 A;  3TOU A;  3F9U A;  2FWG A;  2VL2 A;  2HT9 A;  5GAP D;  1XCC A;  3GHA A;  2WZ9 A;  2VL2 C;  1T00 A;  1THO A;  2HRF A;  2LJR A;  2LJK A;  3GH9 A;  1F3A A;  4ID0 A;  4MAB A;  2M46 A;  5IO2 A;  2L4C A;  2B7J A;  3C1R A;  1M2A A;  5EVO A;  3VWV A;  2V6O A;  3KH7 A;  3MWH A;  1V57 A;  6GSX A;  2QSI A;  4MPF A;  4K8M A;  2XC2 A;  1Z7R A;  2RM5 A;  1MTC A;  1J9B A;  4ZBB A;  1O8X A;  2C0D A;  5CNW A;  2L5O A;  1PKZ A;  1EGR A;  1G7O A;  4L5L A;  2F51 A;  4XRA A;  5IPG A;  4MF5 A;  4WKW A;  4BVX A;  2X8H A;  1XPV A;  4F2I A;  4JBB A;  4HU7 A;  1MDJ A;  1KNG A;  5G30 A;  3UEM A;  4KDX A;  2HRN A;  4YQM A;  3P90 A;  3WGE A;  4N10 A;  4I6X A;  3ZIT A;  4V2L A;  2VLV A;  3C1S A;  1EEM A;  2E2M A;  2CZ3 A;  1O85 A;  2VL9 A;  5CRG A;  1TOF A;  3VPT A;  4EKZ A;  3WGD A;  1GRX A;  2PN8 A;  4ZBA A;  2JSZ A;  1WOU A;  3L9V A;  2FWE A;  5G31 A;  2YJH A;  2XBQ A;  2FLS A;  3NIV A;  3SWL A;  3L4N A;  2FUG 2;  1XW6 A;  4XIH A;  1ERV A;  3FHK A;  16GS A;  2ZCT A;  3ME8 A;  3CSJ A;  3TOT A;  1SJI A;  3ZRE A;  3F0I A;  3A2X A;  2XPE A;  2JSY A;  3ZIJ A;  1FAA A;  4TR4 A;  3MNG A;  3CSI A;  4ML1 A;  4XCS A;  2HZF A;  1WIK A;  3GN3 A;  1YJ6 A;  2P5R A;  3TCO A;  1Z9H A;  2FGX A;  3KGK A;  1WPI A;  4MA9 A;  4GST A;  2LS5 A;  4X0X A;  5HR1 A;  4MZW A;  1J08 A;  2IJY A;  3GST A;  1SKS B;  1EOH A;  1YKA A;  5J5N A;  1GSD A;  3VK9 A;  4YQU A;  2NVL A;  2B5X A;  1FOV A;  4POB A;  2B1L A;  4IEL A;  4HJM A;  2IMD A;  1M0U A;  2WJU A;  4PUF C;  2MMA A;  5F07 A;  5JWO B;  2WCI A;  1K3Y A;  1GP1 A;  1A24 A;  1QMV A;  1ZYE A;  3HVX A;  1ABA A;  1ILO A;  1URM A;  1Z7P A;  4YAP A;  2B7K A;  2FWF A;  2HSY A;  4WBR D;  4PUA A;  1UA5 A;  3HHV A;  1X9S B;  1ZCP A;  1TRS A;  4NV2 A;  4GWR A;  3GIX A;  4BWQ A;  1BQ7 A;  1R5P A;  1QK8 A;  1OVN A;  2YWI A;  4E8H A;  3RBT A;  2JZR A;  3J7Y b;  4PNF A;  1K0M A;  3H93 A;  5HR3 A;  3CRU A;  1A2L A;  1A8Y A;  4FYB A;  4NV5 A;  2JL4 A;  1FO5 A;  3RDW A;  5J9C A;  5IOX A;  2AHE A;  3QAW A;  5ECP B;  3ZZX A;  2C3T A;  4ZL8 A;  5A5K A;  6GSY A;  5L71 A;  3IAS 2;  1XBS A;  3KD0 A;  4POL A;  1EZK A;  3DKS A;  4HQS A;  3TKP A;  1ZOF A;  3TDG A;  8GSS A;  2RUE A;  4FYC A;  3C71 A;  2DJJ A;  2LRN A;  1T3B A;  4Q5Q A;  2GDR A;  1PX7 A;  4KH7 A;  2LRT A;  4OFT A;  4IGJ A;  3PH9 A;  2CV4 A;  1S3A A;  2PVO C;  2RUF A;  2YAN A;  2OBK A;  2R37 A;  1EP8 A;  1CQG A;  4D73 B;  3I6A A;  5IMV A;  2PUK C;  17GS A;  3KH9 A;  3HDC A;  4K7I A;  2GT5 A;  3IK7 A;  2CQ9 A;  5ELA A;  1ZZY A;  3CTF A;  2GT6 A;  1K3L A;  5KEJ A;  1DSB A;  1QUW A;  2CX3 A;  2HLS A;  5ENU A;  3BJ5 A;  1PMT A;  4NPB A;  3VWX A;  2L4Q A;  2G0F A;  3BCK A;  4IN0 A;  2LUS A;  1FVJ A;  2H30 A;  2VL3 A;  5HFI A;  2VCQ A;  4AJ7 A;  1GSY A;  4X43 A;  4K7O A;  1LJR A;  4MP4 A;  2YZU A;  3LJR A;  1JHB A;  5G5E A;  4XHM A;  4XS4 B;  2VUP A;  1QGV A;  1OKD A;  1T4Z A;  1XWA A;  1ERT A;  2DJ3 A;  4ACS A;  3RHB A;  1ON4 A;  1X9M B;  5EPF A;  1RQM A;  3IAM 2;  4K2D A;  5IMZ A;  1EEJ A;  3ZVJ A;  1AUC A;  3DIE A;  1TI3 A;  4PGT A;  4N11 A;  1X5E A;  4IW9 A;  3HA9 A;  1R5A A;  3LQ7 A;  5DBQ A;  2K8V A;  1JZW A;  2KOK A;  4GLT A;  5JCG A;  2NBS A;  1EV4 A;  4RQR A;  5ECM B;  1AC1 A;  2IN3 A;  4PNG A;  5KN1 A;  3EIN A;  1V2A A;  2VOC A;  3E9J B;  4L0W A;  3GSS A;  3V1W A;  2R3X A;  3M8N A;  3P2A A;  5A4W A;  2C3Q A;  5F0G A;  2HE3 A;  1R26 A;  2C4J A;  5ID2 B;  3IPZ A;  3L9U A;  2O7K A;  3RPP A;  2L6D A;  1G7E A;  2ES7 A;  2PPT A;  1M2B A;  2H73 A;  3UL3 A;  1DUG A;  4D73 A;  2BJX A;  1M9B A;  2B3S A;  4V2N A;  2LNT A;  3CYN A;  5IPH A;  4HOJ A;  3ZL5 A;  3F4T A;  3TJF A;  1GTB A;  2N5B A;  5DQS A;  2C3N A;  1AQW A;  4LA1 A;  1BX9 A;  4EDY A;  3DYR A;  1HQO A;  1QQ2 A;  3BOA A;  3IA1 A;  2KHP A;  1G0T A;  2H01 A;  4P3Y B;  2PER A;  1GSF A;  4HZ2 A;  2X8C A;  3TJK A;  3QOU A;  3UVH A;  4IHU A;  2TIR A;  5KN3 A;  1GUM A;  3ME7 A;  4MJE A;  4I2T A;  4GXZ A;  1JZD A;  2DIY A;  3FYG A;  3AY8 A;  3WD6 A;  4TOP A;  3UJ1 A;  2DBC A;  4RI7 A;  2R4V A;  1F3B A;  1WWJ A;  2I9H A;  2OBI A;  2H1B A;  1KBN A;  2DMM A;  2M80 A;  4MF7 A;  1AQX A;  5DQY A;  4KSM A;  2CAQ A;  3H8Q A;  3W8J A;  2H0I A;  3APQ A;  3FY7 A;  4JED A;  2XBI A;  4WBJ A;  5EL8 A;  4I2U A;  3DXB A;  3HJO A;  4MJC A;  2VCW A;  20GS A;  3CMI A;  3HZ4 A;  5DAK B;  1YEP A;  5AIV A;  4OMV A;  1VF1 A;  3ERW A;  1GLQ A;  3K8N A;  2LEG A;  3F3R A;  3IE3 A;  3GTU B;  5ID2 A;  2VD0 A;  1ERW A;  4KCA A;  1XZO A;  3TGZ A;  4NMU A;  2CVD A;  1V98 A;  1GH2 A;  1VF4 A;  2CAI A;  5IM9 A;  4I97 A;  1T4Y A;  3KMO A;  3L9S A;  1R4W A;  1PL2 A;  3UBL A;  1VF2 A;  5DVB A;  4BPY A;  1SJ6 A;  1XVW A;  4G10 A;  2HNL A;  4GQC A;  1WMJ A;  5LNK e;  2C80 A;  2FCH A;  3Q19 A;  1BAY A;  2YNX A;  1O8W A;  1GSQ A;  3I9V 2;  5D96 A;  1N8J A;  2V1M A;  5B6M A;  1LU4 A;  3EC3 A;  4KDY A;  3F4R A;  1MEK A;  5CRD A;  4MF6 A;  1HYU A;  2J9H A;  1XXU A;  4FH8 A;  2O87 A;  3HJP A;  2PBJ A;  4DVC A;  5HR0 A;  2VCX A;  2X99 A;  3ZRD A;  4K6X A;  2ON5 A;  5G2Z A;  1PX6 A;  1GSE A;  1I9D A;  1GNE A;  4IS0 A;  4TVE A;  2MBT A;  3D6I A;  3GKM A;  2YPM A;  4XS6 A;  2H76 A;  3DWV A;  2H6Y A;  3F6F A;  4TR0 A;  1SK1 A;  4ISD A;  3QPM A;  4ECJ A;  1TDI A;  5IMD A;  4NHW A;  1B48 A;  3IDV A;  2VCT A;  1PKW A;  2A2S A;  4CHS A;  4PXO A;  3TB2 A;  1YKC A;  3IK9 A;  3EUR A;  1GTA A;  2I81 A;  1ML6 A;  3L78 A;  2RLI A;  5D73 A;  3GL5 A;  5AN1 A;  3DRN A;  4ECB A;  1SYR A;  18GS A;  2H1G A;  5IMC A;  1JLV A;  2FA8 A;  2YWM A;  3ZFB A;  1SD9 A;  2M72 A;  1SL0 B;  2IFQ B;  1Q98 A;  3M9J A;  2FHE A;  4JU5 A;  5KN0 A;  1SK0 A;  10GS A;  5DAK A;  4GSS A;  3P7X A;  4G2E A;  2GZZ A;  4GQF A;  1O73 A;  1SEN A;  2H74 A;  3GTU A;  3M3M A;  3FZ4 A;  1C72 A;  3Q6O A;  3NOF A;  1U3A A;  2MYG A;  3P8W A;  1UC7 A;  2GQM A;  2YV9 A;  2LTK A;  4TR3 A;  4ZL7 A;  3QR6 A;  4KCE A;  4WR5 A;  3H4K A;  5B6N A;  3KCM A;  5DCG A;  1BYE A;  3ISO A;  2R6K A;  2TRC P;  4OWY A;  2BMX A;  1J0F A;  1B4P A;  3M9K A;  1ERU A;  3DVW A;  4MLY A;  4F0C A;  1A0R P;  1K0B A;  2H19 A;  1ZL9 A;  2F9S A;  5HFG A;  3ZML A;  2H66 A;  2GSR A;  2A2R A;  4ZB8 A;  4KUN A;  3LSZ A;  2GST A;  3NZN A;  5IOW A;  1K0O A;  4J57 E;  5F06 A;  4PQH A;  1XW5 A;  1OE8 A;  2HFD A;  4JRR A;  22GS A;  3L0H A;  4KE3 A;  5CRE A;  1EWX A;  2DIZ A;  4DEJ A;  1U6T A;  2EIR A;  5B8B A;  4PQ1 A;  4MDC A;  3FR6 A;  2ZUP A;  4L5O A;  3HD5 A;  5ECI B;  4MH3 A;  4J2F A;  4FIW A;  3IRA A; 
#chains in the Genus database with same CATH topology
 1SL2 B;  5IF6 A;  3H79 A;  1JFU A;  4TXV A;  2H1D A;  3EVI A;  1B27 A;  4DSQ A;  3MAK A;  4K1F A;  4BL7 A;  3Q18 A;  3I0Y A;  5FHI A;  1X1Y A;  1ROV A;  4HJ2 A;  3H3H A;  2IFQ A;  1OC8 A;  3A5W A;  1TKD B;  2E7P A;  2OKA A;  2HMO B;  1Z1S A;  4QL9 A;  2BMQ B;  2OWP A;  5ECH B;  3TRX A;  1G6Y A;  6GSS A;  1KEB A;  8CHO A;  1G6W A;  1XOA A;  4Q5R A;  3TRQ A;  2PU9 C;  2OE3 A;  2XH9 A;  2GTU A;  2K6V A;  1T1V A;  4BVY A;  4GF0 A;  4N0Z A;  2M7O A;  2R41 A;  4HUA A;  3OR5 A;  4K5R A;  1DVC A;  4HM1 B;  4X1U A;  5LC6 A;  4WET A;  4EO3 A;  1CH0 A;  5H5R A;  1NHY A;  3KJY A;  4RI6 A;  4KDU A;  4OO5 A;  1B2U A;  1SK2 A;  1B8X A;  3APO A;  5DJM A;  1RCL A;  3CME 3;  5C00 A;  3HOH A;  2R5G A;  3NXJ A;  1Q9E A;  1E2Y A;  4XBT A;  3D4M A;  5IMF A;  1O7U A;  2QC7 A;  2PZV A;  4OCF A;  2VD1 A;  4ZB6 A;  2LKU A;  5DAL B;  2XRX B;  1TU7 A;  2JAD A;  2N5F A;  1IVU A;  3A76 A;  1IU7 A;  1BNS A;  1OC9 B;  4Z7X A;  1WRY A;  1OE7 A;  1K73 4;  5IG4 A;  4WEY A;  4GSN A;  5J3R A;  1IVW A;  2CT6 A;  3NBJ A;  3WGX A;  2BHM A;  3X3Y A;  1EV9 A;  3CCM 3;  3T0U A;  1HNC A;  1W6C A;  3QMX A;  4O92 A;  2EIQ A;  1QVG 2;  4F82 A;  4ZIL A;  1OAC A;  1FB6 A;  3IV4 A;  3ECF A;  2MMZ A;  3FR3 A;  3CCQ 3;  2OTJ 3;  3F6D A;  4ZB9 A;  1RKY A;  2QGV A;  1IV9 A;  4Z2T A;  1LNI A;  2JU5 A;  1E6B A;  6STD A;  4Z2R A;  1H75 A;  4EUY A;  4H86 A;  4EE0 A;  3QAV A;  2CHC A;  2KP2 A;  1OAZ A;  4IBP A;  4TR1 B;  4IVF A;  2L59 A;  1UGH I;  2YZH A;  4TN8 A;  3SBC A;  3GZB A;  2D42 A;  1LBK A;  3I43 A;  2WDU A;  5BU4 A;  5F05 A;  3QK9 A;  3FRC A;  1MOL A;  2GBX B;  5JBS A;  3LTC A;  3KFQ C;  3EX9 A;  5FWG A;  3GX0 A;  3LG6 A;  4WFO A;  4V1A p;  1SII A;  4CDO A;  4XTS A;  3UOM A;  2LQO A;  1RJO A;  1Q40 A;  1QJG A;  2YN1 A;  3FZA A;  3HXS A;  2J23 A;  1DE2 A;  3AGN A;  4EW5 A;  3MPH A;  3F8H A;  3TJG A;  2AJQ B;  1FB0 A;  4ML6 A;  2PWJ A;  3O3T A;  1VQ9 3;  4JE1 A;  1MDI A;  1BRK A;  2K18 A;  3GSP A;  2KRT A;  3X42 A;  1W2B 2;  3DD3 A;  5AEU B;  5ELG A;  2OOV A;  9RNT A;  2IPA A;  2V2G A;  1IQY A;  3EBT A;  2H75 A;  3DZL A;  4OO4 A;  5D9X A;  2MC8 A;  3SXX A;  4RNT A;  3JUN A;  3WHO A;  3G4S 3;  2QKE A;  1ZYN A;  2OOV C;  4OFN A;  1OPY A;  2WB9 A;  2ALB A;  1IT7 A;  1EA2 A;  2KAA A;  3V99 A;  1FA3 A;  3KXO A;  1K0C A;  1TTO A;  3TKS A;  1W4N A;  2BU4 A;  1GSU A;  2GLR A;  1O81 A;  1TU5 A;  2AAW A;  2XFS A;  3V98 A;  1JV2 B;  1GTU A;  5D9T A;  5DJL A;  1N8Q A;  1OC3 A;  1PD2 1;  1XWC A;  2H0H A;  1BNR A;  1V74 A;  1WE0 A;  4A5P A;  2DKI A;  3IBH A;  4ZXG A;  2XF3 A;  1M9A A;  1USB A;  1CYV A;  5DAL A;  1TRP A;  1SL1 B;  1F8N A;  1GUH A;  2CFD A;  4HEA 2;  5DDL A;  1OC9 A;  1TTZ A;  1GUL A;  1A2K A;  4NRE A;  3LYK A;  1AIU A;  2XGL A;  4K90 B;  2B5E A;  2JAC A;  3WOE B;  2FWH A;  2JDI H;  1QFN A;  3KP8 A;  5STD A;  3DGM A;  3VLN A;  5JCW A;  3CNM A;  2CFL A;  2IWT A;  1XOB A;  1GMR A;  5CLK A;  1YVB I;  2E2V A;  1Z6N A;  3D4A A;  4DKI A;  3EMX A;  3JUO A;  1UVZ A;  2GSS A;  4KB3 A;  6RNT A;  1X9W B;  1CYU A;  2W56 A;  5M19 A;  1NSW A;  3JCM L;  3FK8 A;  3S29 A;  3MG1 A;  2HSH A;  3CXG A;  1TRU A;  4R4K A;  1XFL A;  2K9F A;  1BSC A;  1HKX A;  1RMS A;  1BSA A;  2H1A A;  1BVI A;  4TR1 A;  3US3 A;  1EOG A;  3ER7 A;  2DLX A;  2O8V B;  1FOH A;  3G9B A;  2F5M A;  1YZX A;  1WP0 A;  4X2H A;  5B7C A;  4EC0 A;  3HIG A;  2X8G A;  3UAR A;  2MF7 A;  2A2P A;  1SYX A;  4V1A g;  3VI7 A;  3HCZ A;  4X2O A;  1B20 A;  5HOH A;  1I0V A;  1S3R A;  4NWY A;  4LLR A;  3PPU A;  4FCJ A;  4FR9 A;  1XW9 A;  3ZTL A;  1SJZ A;  1Y25 A;  4ZBD A;  2PNC A;  2O9U X;  4MZB A;  2HI7 A;  2OA7 A;  4OFM A;  4MPG A;  1S72 3;  1A2M A;  4TKY A;  5G5F A;  2L1S A;  2XEP A;  2CA8 A;  3DML A;  3DH2 A;  4NAX A;  3CQF A;  4LGQ A;  5IMA A;  5D93 A;  2VCV A;  1GOU A;  3F4S A;  5RNT A;  1RGC A;  1DE1 A;  4AGS A;  1W6Y A;  2Z6B A;  2L5L A;  5HGR A;  3IC8 A;  1V58 A;  3MSO A;  4F9Z A;  4K1U A;  3GUS A;  1FW1 A;  1THX A;  4KA0 A;  2CKF B;  2F5W A;  1DYU A;  1U3I A;  4DSR A;  3EF8 A;  1IDP A;  3H1N A;  1JBT A;  1GLP A;  4POK A;  3TJB A;  2FY6 A;  3DGL A;  5G2G A;  5ECQ B;  1BSE A;  3UAP A;  1U87 A;  2MMO A;  1TI1 A;  1Q81 4;  4KF9 A;  2SBL A;  4ZL9 A;  3IHG A;  2GQL A;  3ERG A;  4YH2 A;  4O5R A;  4K61 A;  3MDK A;  1QAL A;  3KSE D;  5IG3 A;  5HQP A;  1SKR B;  1SKW B;  1KD1 4;  2KF6 A;  3LWA A;  2XSH B;  2AB6 A;  4TW5 A;  5INY A;  1YEX A;  5AGY A;  1K0N A;  2VO4 A;  5FT3 A;  3TUE A;  7GSS A;  3D5J A;  3DGY A;  1X5C A;  3ZLP A;  2W2C A;  2AAE A;  1H4O A;  4JR4 A;  3KZQ A;  2DJ1 A;  1XWG A;  3F40 A;  5EQL A;  1RN1 A;  1ZMA A;  3SVA A;  1HZ1 A;  4HM4 B;  5A0O B;  3WYW A;  2P0G A;  3ZMK A;  2VLU A;  3EE1 A;  1BJX A;  1ZGN A;  3D9R A;  1NW2 A;  1TP9 A;  4MCU A;  3VPQ A;  5J9B A;  2RSX A;  1KTE A;  2B1X B;  1BG5 A;  1F2E A;  2YFL B;  3BB9 A;  3GUR A;  2FA4 A;  3ZIV A;  2DML A;  3PZW A;  3EMP A;  3FZ9 A;  3LXT A;  2P5Q A;  1N8R 4;  4WR4 A;  2E2G A;  1A67 A;  1SU9 A;  1Q82 4;  5A4V A;  4HU9 A;  2CVB A;  1T7P B;  3WA3 A;  5LCZ A;  6GSU A;  3IOS A;  3PCS A;  4G19 A;  5H5S A;  4MMZ B;  3NBR A;  3QAG A;  1WMN A;  1A2J A;  5CRW A;  5D9W A;  2EC4 A;  2YCD A;  4FO5 A;  1YHQ 3;  3CRT A;  4L0U A;  2VIM A;  4RNY A;  1Z3E A;  2FD3 A;  3EU4 A;  5CRH A;  2VM1 A;  4MH2 A;  5F8B A;  4IT7 A;  3Q3F A;  3GKK A;  5GZZ B;  2B5Y A;  4LEH A;  3TJJ A;  4TX4 A;  6GST A;  1B2S A;  4HM7 B;  3K0Z A;  5IQY A;  4IQ1 A;  3LOR A;  1NU3 A;  5C04 A;  2EIO A;  1FGM A;  3WT1 A;  2LST A;  1HD2 A;  4ZM8 A;  1BNJ A;  4K0N A;  1B9X C;  4JR6 A;  1SD8 A;  4O5Q A;  3URP A;  3LGC A;  4BIK A;  1A23 A;  2PVQ A;  3VWU A;  3D5G A;  1RLS A;  1LOW A;  2LNS A;  2H71 A;  2P05 A;  2HRK A;  5B8A A;  2ZHX B;  4FCZ A;  3GMF A;  3X41 A;  4IP6 A;  1L5G B;  1LXE A;  4WYK B;  3R2Q A;  4AF2 A;  1GY5 A;  4JZQ A;  3G7J A;  3GRX A;  1OKT A;  1Z5Y E;  2OJL A;  2K8S A;  1XVQ A;  4MK3 A;  1S3D A;  4I8B A;  2XFT A;  1AQV A;  1AV4 A;  2C0G A;  1B2M A;  4WF4 A;  2FXT A;  3S9F A;  3D4T A;  1K0D A;  2MMN A;  3AGO A;  1JB2 A;  4O7H A;  5JWR B;  1YGW A;  1B21 A;  3GFK A;  3KP9 A;  4BA7 A;  1IYY A;  1VQ8 3;  2GU1 A;  4K2X A;  4OCE A;  3LXZ A;  5AIS A;  2CFK A;  1BSD A;  1PSQ A;  1UCK A;  2X4A A;  2Z77 A;  4KFD A;  4ECC A;  3FGY A;  5JCU A;  2L4V A;  3QFB C;  1BOX A;  3DGQ A;  2BTO T;  1JBR A;  2YOI A;  1ACV A;  4EL1 A;  3ROB A;  1YDK A;  5AI1 A;  2OE1 A;  1TU8 A;  3K7C A;  1QMA A;  4XRD A;  4WXT A;  1RRL A;  5D8I A;  4HOH A;  1Z6M A;  5FGO A;  1Y6E A;  5ECL B;  4QL7 A;  1OGX A;  1RGK A;  2RGQ A;  2F8F A;  1BRS A;  4R80 A;  1XWB A;  3HVV A;  2NPB A;  1IQX A;  1UI8 A;  4KGI A;  4POM A;  4IQA A;  1B2X A;  1A0F A;  3TKS E;  2IL3 A;  3LFL A;  5ECN B;  1NHO A;  5IG5 A;  4K0G A;  3IHQ A;  5IO0 A;  3NBB A;  1M2D A;  2ML6 A;  2H70 A;  3LYP A;  2X64 A;  4BWS A;  14GS A;  3RDE A;  5DRE A;  1PU4 A;  3LML A;  13GS A;  3D21 A;  1OCV A;  2ZNM A;  2YWO A;  5E4W A;  2C8U A;  1M3I A;  3E3E A;  4HSC X;  3FF0 A;  1PN9 A;  3LTD A;  4USS A;  4HZ9 B;  1T8E B;  1PQN A;  4GSP A;  3FMW A;  3GKN A;  4ILF A;  3MSZ A;  2B6M A;  5LC7 A;  3FSD A;  4L7K A;  2YV7 A;  11GS A;  2D1W A;  3BD2 A;  4NHZ A;  1Q7H A;  5ECK B;  2VM2 A;  5CF1 A;  2P38 A;  3EPT A;  1LQM B;  1AAZ A;  1TW9 A;  3Q90 A;  2JZS A;  3FW2 A;  2GVP A;  1RGH A;  5KP1 A;  4FQU A;  4WWU C;  5LD0 A;  4QWT A;  4EDZ A;  4G9H A;  2NTO A;  3HX8 A;  4KW6 A;  3IXR A;  2IYJ A;  2DSA A;  1GTI A;  1TK8 B;  3LYG A;  1F9M A;  3FR9 A;  4HM2 B;  2GBW B;  1J2B A;  1MDK A;  4YQV A;  1R4Y A;  2H6X A;  4K7N A;  1B2Z A;  2E0Q A;  1F37 A;  3HI7 A;  4LMW A;  1B9Y C;  1E3R A;  4WYK A;  1Q4J A;  2R0G A;  5FW5 A;  3EU3 A;  1ZYQ B;  1UCJ A;  3C8E A;  2HMK B;  5GSS A;  5A4U A;  3WMD A;  3NHX A;  3ZFL A;  3RGA A;  5J41 A;  2DJ2 A;  3G7I A;  5ECO B;  2F8A A;  1GOV A;  3PXM A;  4AJ8 A;  3VFI A;  4XM4 A;  1WNH A;  4E8E A;  3HJM A;  3WR2 A;  4RNZ A;  1U88 A;  3NUV A;  3VI5 A;  4CW9 A;  2L6C A;  1ZX2 A;  1SAR A;  3F63 A;  4N6T A;  3O76 A;  4HM5 B;  4J5K A;  1QAF A;  4L8E A;  1D6U A;  3BBY A;  4G0I A;  4XS1 A;  1I3I A;  3M1G A;  5IEO A;  3NM7 A;  4NHF A;  4N6U A;  1GYB A;  3HKR A;  1GMP A;  3KKG A;  5EEO A;  2WS2 A;  1RK4 A;  1FW7 A;  3KEB A;  1ASK A;  6GSW A;  2CX0 A;  3X40 A;  1OUN A;  3GL3 A;  2V6K A;  1UUV B;  3PGB A;  1ZO2 A;  3MYT A;  3KM6 A;  4EVM A;  4IJI A;  4V2M A;  4NXI A;  5J4U A;  4EXJ A;  1FVK A;  2WUL A;  3WT2 A;  3KII A;  1VQ5 3;  4HS1 A;  1GD3 A;  4IKH A;  3RPN A;  2WGR A;  3GNJ A;  1FG4 A;  1JZO A;  2UZ8 A;  5EY6 A;  1YJN 3;  5KN2 A;  4HM6 B;  3FKA A;  2WFC A;  1HYF A;  1NM3 A;  2VLT A;  3QRD A;  2GZP A;  3L0R A;  2YP6 A;  2AV4 A;  5CYY A;  2GQK A;  3J7Y k;  1XWK A;  1GSP A;  4Q5N A;  3UBK A;  2V41 A;  3RHC A;  2PGT A;  3EYT A;  4O2H A;  2B1K A;  4GHO A;  1HNA A;  1PL1 A;  5ECS A;  2IA7 A;  3F8U A;  3U1W A;  1CQH A;  4EBG A;  1PRX A;  1VRS D;  3X3X A;  2KUC A;  2WRT A;  3GV1 A;  5E59 A;  2C10 A;  3GA4 A;  1BNG A;  2CH9 A;  2W56 B;  3DEX A;  4KX4 A;  1TJD A;  2ZA4 A;  5AIG A;  3CCL 3;  4HM0 B;  3KE7 A;  2PMT A;  5HFK A;  4MJD A;  1X1X A;  1S3C A;  3TKR A;  1V9W A;  4LL1 B;  3NQZ A;  2QIY A;  4QQ7 A;  3N5O A;  2IY2 A;  2C0F A;  1WMP A;  3JUP A;  4BU4 A;  3U5R E;  3W8S A;  2CX1 A;  3FLJ A;  1RW1 A;  2OCT A;  3LZA A;  1JZR A;  1N2A A;  2H8L A;  4YKF A;  1VGL A;  1C7H A;  4N6N B;  2MZC A;  2F4Y A;  2REM A;  2HMM B;  1Q86 4;  4GTU A;  4ZIJ A;  2RM6 A;  3FEU A;  3EN8 A;  2HSM A;  1BED A;  2IMI A;  19GS A;  2LRC A;  4HQZ A;  1AW9 A;  1WMO A;  2WO0 A;  2STD A;  3UB1 A;  4XBX A;  2BMR B;  1DMM A;  2CC3 A;  4HI7 A;  2JZT A;  2CK3 H;  3ZYW A;  1N5P A;  4G1M B;  3NM2 A;  1FHE A;  2KF5 A;  2I9W A;  1V40 A;  1PA3 A;  1M99 A;  4KSO A;  1FYS A;  1MD4 A;  2XR8 B;  4LL4 B;  3BNE A;  1EGO A;  3LEF A;  2A4H A;  1DE3 A;  3GKX A;  3BIR A;  1IQ8 A;  4EIQ A;  4RQX A;  5I97 A;  4XBY A;  1K41 A;  2YFI B;  3PS8 A;  2IIY A;  3A5E A;  5GST A;  4F0B A;  4PX1 A;  2C4B A;  2N5A A;  2YJ7 A;  4MMM A;  3ERF A;  2OAC A;  1PGT A;  4KT3 B;  5G1K A;  3OWS A;  4O32 A;  4F03 A;  3N8B A;  2LQQ A;  1YF0 A;  3JUQ A;  2W9P A;  1K0A A;  1G96 A;  2IME A;  1TK5 B;  1X0R A;  2JQ5 A;  4MJB A;  2CIU A;  2H0G A;  1KWI A;  4TXO B;  2O89 A;  1IYI A;  2KF3 A;  3EE2 A;  3TKS C;  4N30 A;  3APS A;  3NV0 B;  2C1Y A;  1DBY A;  1GUK A;  3UMA A;  1D6Z A;  5HR2 A;  1SPU A;  4KAE A;  2I4A A;  1MGR A;  4HM3 B;  4BL3 A;  3F3Q A;  2DKH A;  3G7Y A;  1I70 A;  3U6V A;  1GSS A;  1K28 A;  1CQS A;  1VQK 3;  2CW9 A;  3GX8 A;  3EHC A;  5DRV A;  1I0X A;  1W7C A;  2HYX A;  1DMQ A;  1YY7 A;  1UN2 A;  4O8S A;  2GGT A;  1VF3 A;  4AEQ A;  4K9Z A;  2R2J A;  2O85 A;  2GU3 A;  1QXH A;  2RII A;  1TIJ A;  3GYK A;  4GRF A;  2IMK A;  2CX4 A;  5KOX A;  2OQE A;  3VSY A;  1TK0 B;  3A2W A;  3HZ8 A;  5G1L A;  3A3T A;  4OD7 A;  3G8Z A;  2D2Z A;  2OQE C;  3AMO B;  2Z9S A;  1OHO A;  3N9J A;  3MWZ A;  5ECR B;  2W03 A;  5H5Q A;  2HZE B;  2CFG A;  3QFA C;  2H72 A;  2CVK A;  2BO9 B;  3PGT A;  1KC8 4;  3KTB A;  2X49 A;  2KP1 A;  3C7M A;  2OAD A;  2WGQ A;  1ST9 A;  2GSQ A;  2GS3 A;  3KIJ A;  2YX9 A;  1GWC A;  3HVS A;  1TRW A;  1M1K 4;  2VAF A;  4KFE A;  3IR4 A;  2TRX A;  1IK3 A;  4YAV A;  2QA2 A;  3PIN A;  4KZ1 A;  3DY5 A;  2RFR A;  3CSH A;  4J5G A;  2A4V A;  5CF2 A;  2XPD A;  1ULI B;  3VUR A;  2NDO A;  4PQI A;  2W04 A;  3DXO A;  4ULX A;  2V32 A;  3W6G A;  2E2T A;  4DSS B;  2GSP A;  1WJK A;  3HY2 A;  2ON7 A;  1BNE A;  2BNG A;  3HK4 A;  4GL6 A;  4HYZ A;  4KVH A;  1RN4 A;  1YJW 3;  1YQ1 A;  1HNB A;  3MKI A;  2F98 A;  4HAA A;  3CBU A;  3GZR A;  1TXX A;  3STD A;  1B4Q A;  4HVN A;  3D0Z A;  4J56 E;  3CTG A;  2F3M A;  1N9E A;  3KMN A;  2VCZ A;  1O6J A;  3EWL A;  4MZC A;  3C73 A;  3QDN A;  5GAN D;  2HXK A;  3HYP A;  3BND A;  3PCR A;  4O5U A;  4N0V A;  4MMX B;  5COH A;  3HZP A;  3LH4 A;  3FKF A;  4J8T A;  3CC2 3;  5CO3 A;  1TFO A;  2LJA A;  4KND A;  4JF8 A;  1YNV X;  3IPT A;  4WHA A;  2K0M A;  3SYU A;  2AYT A;  3ZG5 A;  1B3S A;  5CAX A;  3D5I A;  2HRA A;  2YWN A;  3UVT A;  2DJK A;  2AUV A;  4ECI A;  3SOY A;  3LT9 A;  2I1U A;  3J7Y d;  1BNI A;  4EF0 A;  4HZ4 A;  1S5A A;  1QAK A;  2FNO A;  3BCI A;  3KTL A;  1IYH A;  4X4J A;  5AIX A;  4TXO A;  2WOF A;  3GH6 A;  4XS4 A;  1R7H A;  3SLU A;  2XHF A;  3NV0 A;  1KQS 2;  1JLW A;  4MJA A;  4LZI A;  2WOH A;  9GSS A;  3E0U A;  2C0E A;  3VF1 A;  2P31 A;  4YKG A;  1IV7 A;  1FUT A;  4BVX B;  1YF1 A;  3PR8 A;  1AXD A;  3CCE 3;  1W89 A;  4H61 A;  1T2H A;  2IMF A;  1I2E A;  1DET A;  1EP7 A;  3TKQ A;  4PUR A;  1X5D A;  4GCI A;  2H6Z A;  12GS A;  3S67 A;  3VGN A;  3RGR A;  2CFW A;  4CCV A;  4TRX A;  3O6T A;  4IP1 A;  5IEP A;  2KLX A;  1GD4 A;  3DGO A;  2DC5 A;  4R9K A;  4Q5F A;  2ZDJ A;  2QA1 A;  3ED3 A;  3IC4 A;  3ZVJ D;  1MD3 A;  1BUQ A;  2I3Y A;  2CWT A;  1A8L A;  1M7T A;  3QCP A;  5DCH A;  1K3O A;  2DJ0 A;  2BMO B;  1RGA A;  1PY3 A;  1LVN A;  2OE0 A;  1TRQ A;  3A2V A;  3Q1C A;  4I5Q A;  1XIY A;  1F6M C;  1E97 A;  3A5I A;  3AMO A;  1K8A 4;  1W4V A;  5AYS C;  3QD9 A;  2HZE A;  1ROA A;  3GRD A;  2OTL 3;  2L57 A;  2GZY A;  2ML5 A;  5TGN A;  5IIZ A;  1VQM 3;  5KOW A;  5D9V A;  2CZ2 A;  5JWQ B;  3UIW A;  1BAO A;  3DVX A;  3D22 A;  4BTY A;  3VWW A;  4HDE A;  2MBS A;  1I5G A;  4LMV A;  4KFF A;  2HMJ B;  3RAZ A;  3M0F A;  4RUV A;  4FYU A;  1MGW A;  1BRN L;  1IVX A;  2LV3 A;  4AJ6 A;  1OYJ A;  3TRP A;  5ABR A;  1MNL A;  2G2Q A;  6GSV A;  3Q74 A;  4DSS A;  1TRV A;  4WF5 A;  4IIA A;  1GNW A;  5GSP A;  5CP1 A;  5ELU A;  4IJ3 A;  1AQZ A;  3FZ5 A;  1GL8 A;  3I69 A;  3TOU A;  3F9U A;  2FWG A;  2VL2 A;  1BSB A;  2HT9 A;  5GAP D;  1XCC A;  1O7H B;  6GSP A;  3GHA A;  2WZ9 A;  2VL2 C;  1T00 A;  3EQQ B;  1THO A;  2YFJ B;  5IW9 A;  2LYX A;  2HRF A;  3IJE B;  2LJR A;  2LJK A;  1T5Y A;  3GH9 A;  1F3A A;  4ID0 A;  5M1A A;  3CCS 3;  4MAB A;  1GY7 A;  3S27 A;  3T8U A;  2M46 A;  3CCR 3;  5IO2 A;  2K54 A;  2L4C A;  1FUW A;  2B7J A;  2WGO A;  1M2A A;  3C1R A;  5EVO A;  3VWV A;  2V6O A;  3KH7 A;  3MWH A;  1K9M 4;  1V57 A;  6GSX A;  4O02 B;  2QSI A;  2XGN A;  1U5O A;  3G71 3;  3KN4 A;  3N9H A;  4MPF A;  3ZFZ A;  4K8M A;  2XC2 A;  1XG8 A;  1Z7R A;  2RM5 A;  2GEY A;  3WOF B;  3I56 3;  1MTC A;  1FGR A;  1J9B A;  4ZBB A;  1O8X A;  2C0D A;  5CNW A;  1JBS A;  1ZGX A;  2L5O A;  1PKZ A;  1EGR A;  1G7O A;  3SX1 A;  4L5L A;  2F51 A;  1EKM A;  1EG9 B;  4XRA A;  5IPG A;  1BUJ A;  4MF5 A;  4WKW A;  4BVX A;  4WP5 A;  2X8H A;  2KXG A;  3D3L A;  5AIF A;  3GZX B;  4J9A A;  5KP3 A;  1XPV A;  4F2I A;  4JBB A;  4HU7 A;  1MDJ A;  1KNG A;  5G30 A;  3UEM A;  1MWR A;  1Q42 A;  1BIR A;  4KDX A;  2HRN A;  4YQM A;  3P90 A;  3WGE A;  4N10 A;  4I6X A;  1W2Z A;  3ZIT A;  1FGO A;  3T8N A;  3B4P A;  3FF2 A;  4V2L A;  2VLV A;  3CNX A;  3C1S A;  1EEM A;  2E2M A;  2CZ3 A;  1O85 A;  1W02 A;  3F8X A;  2VL9 A;  4EIP A;  5CRG A;  1TOF A;  3VPT A;  4STD A;  4EKZ A;  3WGD A;  1GRX A;  2PN8 A;  3DM8 A;  4MMY B;  4ZBA A;  2JSZ A;  1WOU A;  3L9V A;  2FWE A;  1IT8 A;  1RRH A;  5G31 A;  2YJH A;  2XBQ A;  2FLS A;  3NIV A;  3SWL A;  2LQV A;  3Q2P A;  3L4N A;  4FCM A;  3WDG B;  4CPK A;  2FUG 2;  1XW6 A;  4XIH A;  1ERV A;  3FHK A;  2RNT A;  16GS A;  4N6M A;  2ZCT A;  4N6L A;  3ME8 A;  3CSJ A;  3TOT A;  1SJI A;  3ZRE A;  1UUW B;  3F0I A;  3A2X A;  2XPE A;  2JSY A;  3ZIJ A;  1FAA A;  4TR4 A;  3MNG A;  3CSI A;  4ML1 A;  4XCS A;  4K5S A;  4LYL B;  1BNF A;  3UJM A;  7RNT A;  2HZF A;  1WIK A;  1M1X B;  1RNB A;  3GN3 A;  1YJ6 A;  2P5R A;  4EV5 A;  4HKV B;  1Z9H A;  2FGX A;  3KGK A;  1WPI A;  3TCO A;  3E99 A;  2CWU A;  1T2I A;  4MA9 A;  4GST A;  2LS5 A;  4X0X A;  5HR1 A;  1LNH A;  4G0K A;  4MZW A;  1J08 A;  3F9S A;  2IJY A;  3GST A;  2Z7A A;  1SKS B;  1EOH A;  1GY6 A;  1YKA A;  5J5N A;  4OUQ A;  1ULJ B;  1GSD A;  3VK9 A;  3LW9 A;  4YQU A;  2NVL A;  2B5X A;  1FOV A;  4POB A;  1BU4 A;  2B1L A;  4IEL A;  1I3F A;  4HJM A;  2IMD A;  1M0U A;  3H51 A;  2WJU A;  4BL2 A;  4PUF C;  4Z2U A;  3CCU 3;  1JKG B;  1O7W B;  3BLZ A;  2R4I A;  2MMA A;  1DMN A;  2Y73 A;  5F07 A;  5JWO B;  2GXF A;  2WCI A;  1LOV A;  2CWV A;  3EN1 B;  1K3Y A;  3BU4 A;  1GP1 A;  1UCI A;  1A24 A;  1QMV A;  4RBN A;  2BT3 A;  5JPP A;  1ZYE A;  3HVX A;  1ABA A;  1ILO A;  1IVV A;  1URM A;  1Z7P A;  1A2P A;  1UGI A;  4EC6 A;  4PEJ A;  4YAP A;  2B7K A;  2FWF A;  1LOY A;  2HSY A;  2CG0 A;  4WBR D;  4O3V A;  1WQL B;  4PUA A;  1UA5 A;  3KSP A;  3HHV A;  1X9S B;  3HII A;  1ZCP A;  1TRS A;  4NV2 A;  4GWR A;  1W01 A;  3GIX A;  1STD A;  3ALA A;  7STD A;  4XDW A;  3OV4 A;  3CD6 3;  4BWQ A;  1RSN A;  3UL5 A;  1BQ7 A;  1R5P A;  1QK8 A;  2P09 A;  1OH0 A;  1VQP 3;  4IPB A;  1OVN A;  2YWI A;  4E8H A;  3RBT A;  1RNT A;  2UX0 A;  2JZR A;  4PNF A;  3J7Y b;  1K0M A;  3H93 A;  5HR3 A;  3CRU A;  1A2L A;  1A8Y A;  4FYB A;  2V1L A;  4NV5 A;  2JL4 A;  1FO5 A;  3RDW A;  5J9C A;  1CEW I;  5IOX A;  1O7N B;  3K5T A;  1BRI A;  2AHE A;  2AAD A;  3QAW A;  2O3O A;  5ECP B;  3ZZX A;  2C3T A;  4ZL8 A;  5A5K A;  6GSY A;  5L71 A;  1RGG A;  3IAS 2;  1N5H A;  1XBS A;  3KD0 A;  3CPW 2;  4POL A;  3FG1 A;  3OXA A;  1FZU A;  1EZK A;  3OWY A;  3DKS A;  4HQS A;  1RTU A;  3TKP A;  1ZOF A;  1UI7 A;  3B8L A;  3NX0 A;  3TDG A;  5AYR B;  8GSS A;  2RUE A;  4FYC A;  3UL6 A;  1NO3 A;  3C71 A;  2DJJ A;  2LRN A;  1T3B A;  4Q5Q A;  2GDR A;  4R1K A;  3MHE A;  1PX7 A;  4KH7 A;  1D6Y A;  2LRT A;  4OFT A;  5EVH A;  4IGJ A;  4CY8 A;  3PH9 A;  3ZG0 A;  2CV4 A;  4AKZ A;  1S3A A;  4CY6 A;  2PVO C;  4G0L A;  3IMA B;  3DMC A;  2RUF A;  2YAN A;  2OBK A;  1VZZ A;  2R37 A;  1BRG A;  2IUK A;  1EP8 A;  1CQG A;  2B24 B;  4D73 B;  3I6A A;  5IMV A;  1O7P B;  2PUK C;  1JB5 A;  17GS A;  3KH9 A;  3HDC A;  2A15 A;  4K7I A;  8RNT A;  3DUK A;  2GT5 A;  3IK7 A;  2CQ9 A;  2UGI A;  1JJ2 2;  5ELA A;  1ZZY A;  3CTF A;  3CXC 2;  1JKG A;  2GT6 A;  1K3L A;  5KEJ A;  1EQK A;  1RGF A;  1RGL A;  1DSB A;  1QUW A;  1X1U A;  2CX3 A;  3CU3 A;  2HLS A;  3HVN A;  2Q07 A;  5ENU A;  2F86 B;  1NJI 4;  1OHP A;  3BJ5 A;  1OHS A;  1PMT A;  4NPB A;  3VWX A;  1RHL A;  3DGN A;  3F7X A;  3R3E A;  3OWU A;  2L4Q A;  2G0F A;  4EXR A;  3BCK A;  4IN0 A;  1KSI A;  2LUS A;  1NDO B;  1PFP A;  1FVJ A;  2H30 A;  3WOD G;  5BVB A;  3MYD A;  2KCD A;  2VL3 A;  5HFI A;  4OK0 A;  2VCQ A;  4AJ7 A;  4JRF A;  1G02 A;  1GSY A;  1HU9 A;  4X43 A;  4K7O A;  1GS3 A;  2XSO B;  1RCK A;  1LJR A;  3FG4 A;  4MP4 A;  2YZU A;  1O7M B;  2F99 A;  3LJR A;  1JHB A;  5G5E A;  4XHM A;  4XS4 B;  2VUP A;  1LQG C;  1QGV A;  1OKD A;  5BXQ A;  4RZM A;  1T4Z A;  1XWA A;  1ERT A;  2DJ3 A;  4ACS A;  3RHB A;  1VQ4 3;  1ON4 A;  1X9M B;  1SJW A;  1RQM A;  5EPF A;  3IAM 2;  2FNQ A;  1SQW A;  4K2D A;  5IMZ A;  1EEJ A;  3LT8 A;  3ZVJ A;  1AUC A;  3DIE A;  1BRJ A;  1TI3 A;  4N3V A;  4PGT A;  4N11 A;  1X5E A;  1M90 4;  4IW9 A;  3HA9 A;  2W6J H;  1R5A A;  3LQ7 A;  5DBQ A;  2K8V A;  1JZW A;  2KOK A;  1ZS7 A;  4GLT A;  5JCG A;  2NBS A;  3V92 A;  3LXU X;  1NNV A;  1MWU A;  1EV4 A;  4CDL A;  4RQR A;  5ECM B;  1AC1 A;  2IN3 A;  3GZY B;  4PNG A;  3X3Z A;  3CCJ 3;  5KN1 A;  3EIN A;  5D81 A;  1V2A A;  4CJN A;  4LSO A;  2VOC A;  3E9J B;  3GAX A;  4L0W A;  3N54 B;  3GSS A;  3V1W A;  2R3X A;  3M8N A;  3P2A A;  2Y74 A;  1EUI C;  2C3Q A;  5A4W A;  5F0G A;  2HE3 A;  1R26 A;  2C4J A;  5ID2 B;  5IG0 A;  3IPZ A;  1YIT 3;  3L9U A;  2O7K A;  3RPP A;  3AHS A;  2L6D A;  1G7E A;  1NB5 I;  2RCD A;  2ES7 A;  2PPT A;  1M2B A;  2H73 A;  3UL3 A;  2J8X B;  1DUG A;  4D73 A;  2BJX A;  5D83 A;  1M9B A;  2B3S A;  4V2N A;  2LNT A;  1JNQ A;  3CYN A;  2W9Q A;  5IPH A;  4HOJ A;  1STF I;  2CG1 A;  3ZL5 A;  1W5Z A;  3F4T A;  3TJF A;  1GTB A;  2N5B A;  1U8C B;  5DQS A;  5KP4 A;  1Y4K A;  2C3N A;  7GSP A;  2RBI A;  1AQW A;  4LA1 A;  1BX9 A;  4EDY A;  1JB4 A;  1TFK A;  1W00 A;  3DYR A;  1HQO A;  3KCH A;  1QQ2 A;  3BOA A;  3IA1 A;  1JN5 B;  2GEX A;  1I8V A;  2KHP A;  2QGU A;  1G0T A;  4XDV A;  1FUS A;  3B4O A;  4FMC A;  2H01 A;  4P3Y B;  3FG3 A;  2PER A;  1AVL A;  4HM8 B;  1NB3 I;  4R9L A;  1GSF A;  4HZ2 A;  2X8C A;  1LRA A;  5AIH A;  4EYC A;  4FMA A;  3I55 3;  2INX A;  3QOU A;  3TJK A;  4IHU A;  3UVH A;  1YVS A;  2TIR A;  1BRH A;  3UNL A;  5KN3 A;  1GUM A;  3ME7 A;  1FGQ A;  4MJE A;  4I2T A;  2ZL8 A;  4GXZ A;  1JZD A;  2DIY A;  3FYG A;  3AY8 A;  3WD6 A;  3JVC A;  2R0P A;  4TOP A;  1RN7 A;  3MIX A;  5AII A;  3S28 A;  3UJ1 A;  2DBC A;  4RI7 A;  4HBR A;  3OX9 A;  2R4V A;  1F3B A;  5AEW B;  1WWJ A;  2I9H A;  2OBI A;  2H1B A;  4L8O A;  1KBN A;  3EJV A;  2DMM A;  2M80 A;  3K9M C;  4MF7 A;  1ISK A;  1AQX A;  5DQY A;  4KSM A;  2CAQ A;  3H8Q A;  3W8J A;  2H0I A;  3APQ A;  1VQL 3;  3FY7 A;  4JED A;  3G16 A;  2XBI A;  1VQO 3;  4WBJ A;  5EL8 A;  1VQ6 3;  4I2U A;  3BNB A;  3DXB A;  1UDI I;  1BGS A;  3HJO A;  4MJC A;  2VCW A;  4BTW A;  3MG2 A;  20GS A;  3CMI A;  3SOA A;  1SIH A;  3HZ4 A;  5DAK B;  3CC4 3;  1YEP A;  5AIV A;  1RDS A;  4AKY A;  4OMV A;  1YI2 3;  1VF1 A;  1WTH A;  3ERW A;  1GLQ A;  3K8N A;  2LEG A;  5BIR A;  3F3R A;  1E3V A;  3IE3 A;  5BMU A;  3FH1 A;  3GTU B;  5ID2 A;  2VD0 A;  1ERW A;  4N6O B;  4KCA A;  4H3U A;  1XZO A;  3TGZ A;  4NMU A;  1TUH A;  2HOH A;  2CVD A;  3PYJ A;  3NQY A;  1W6G A;  1V98 A;  1GH2 A;  1VF4 A;  1N9J A;  2CAI A;  5IM9 A;  4I97 A;  3M8C A;  1T4Y A;  3KMO A;  3CCV 3;  3L9S A;  1R4W A;  1PL2 A;  3UBL A;  1VF2 A;  1TP6 A;  5DVB A;  1OF5 B;  3EB8 A;  4BPY A;  1SJ6 A;  5JPU A;  1XVW A;  4G10 A;  2HNL A;  3S5C A;  1WMJ A;  4GQC A;  5LNK e;  3CPO A;  3U97 A;  2C80 A;  2FCH A;  3Q19 A;  1BAY A;  2YNX A;  1O8W A;  1GSQ A;  3I9V 2;  2IMJ A;  2SAR A;  5D96 A;  1N8J A;  2V1M A;  5B6M A;  1LU4 A;  3EC3 A;  4KDY A;  3EBY A;  3F4R A;  4L8P A;  1MEK A;  5CRD A;  1M9G A;  3K63 A;  1ZYP A;  4PTS A;  4MF6 A;  1FGT A;  1HYU A;  1JN5 A;  2J9H A;  1XXU A;  4FH8 A;  2O87 A;  3HJP A;  3O8Y A;  2PBJ A;  4DVC A;  1GMQ A;  5HR0 A;  2VCX A;  2X99 A;  3ZRD A;  4XB5 A;  4K6X A;  2ON5 A;  5G2Z A;  1PX6 A;  1GSE A;  2QA4 3;  1I9D A;  2P0X A;  5CK6 A;  1GNE A;  4IS0 A;  4TVE A;  1LOX A;  2MBT A;  4BIR A;  4OVM A;  3D6I A;  1AR0 A;  3WA2 X;  1MWT A;  3AHW A;  1AY7 A;  2YPM A;  3GKM A;  2H76 A;  3DWV A;  2H6Y A;  4XS6 A;  4FMD A;  3F6F A;  2KF4 A;  4TR0 A;  1NWW A;  1SK1 A;  4ISD A;  2F56 A;  3MG3 A;  3QPM A;  1OGZ A;  3FZW A;  4ECJ A;  1TDI A;  4ICY A;  5IMD A;  1YGE A;  4NHW A;  1PYL A;  1B48 A;  3IDV A;  2E2U A;  5D82 A;  2VCT A;  4Q53 A;  1PKW A;  2A2S A;  2BIR A;  1UCL A;  4CHS A;  1VQN 3;  1M3J A;  4PXO A;  3TB2 A;  1YKC A;  3IK9 A;  3EUR A;  1GTA A;  2I81 A;  1ML6 A;  3L78 A;  2RLI A;  1QVF 2;  1I2F A;  5D73 A;  3GL5 A;  5AN1 A;  3DRN A;  4ECB A;  5IER A;  2Z76 A;  1I2G A;  3BNC A;  3B7C A;  5ELJ A;  1SYR A;  4N6V 0;  18GS A;  1JRQ A;  4U13 A;  4BL7 B;  5CXO A;  2H1G A;  5IMC A;  1JLV A;  2FA8 A;  3G0K A;  4HJL B;  2YWM A;  3ZFB A;  1SD9 A;  3G6E 3;  3GWR A;  2M72 A;  2FGT A;  1YJ9 3;  1SL0 B;  2IFQ B;  1Q98 A;  3M9J A;  3CC7 3;  2FHE A;  4JU5 A;  4ORL A;  1PN0 A;  5KN0 A;  1SK0 A;  10GS A;  5DAK A;  4GSS A;  3P7X A;  2W0Q A;  2HMN B;  4G2E A;  4BTX A;  2GZZ A;  4BVY B;  4GQF A;  2C11 A;  1O73 A;  1SEN A;  2H74 A;  4I4K A;  3GTU A;  3F14 A;  3M3M A;  3OW2 2;  3FZ4 A;  1C72 A;  3Q6O A;  3LTB A;  1C54 A;  4MNN A;  3NOF A;  1U3A A;  2QEX 3;  2MYG A;  3P8W A;  1UC7 A;  2GQM A;  2YV9 A;  1R4C A;  2LTK A;  2HML B;  1MWS A;  1RGE A;  4TR3 A;  2IUJ A;  1OF5 A;  4ZL7 A;  3QR6 A;  3RNT A;  1PFO A;  4KCE A;  3JUM A;  4WR5 A;  3H4K A;  4EV2 A;  5B6N A;  3KCM A;  5DCG A;  1BYE A;  3ISO A;  5BRT A;  2R6K A;  2TRC P;  4OWY A;  2BMX A;  3FCS B;  1J0F A;  1B4P A;  3SED A;  4K1V A;  3M9K A;  2K3D A;  5IEN A;  1ERU A;  3DVW A;  4MLY A;  4F0C A;  3F7S A;  1A0R P;  1K0B A;  1VQQ A;  2H19 A;  1ZL9 A;  1US1 A;  2F9S A;  5HFG A;  3ZML A;  3CMA 3;  1VQ7 3;  2H66 A;  1BAN A;  2GSR A;  1DVD A;  2A2R A;  4KUN A;  3LSZ A;  2GST A;  4ZB8 A;  3LOY A;  4LMI A;  3NZN A;  2UUG C;  5IOW A;  1A2V A;  4FMB A;  1K0O A;  4J57 E;  5F06 A;  4PQH A;  1XW5 A;  1OE8 A;  2HFD A;  2R0C A;  4JRR A;  22GS A;  3L0H A;  1GOY A;  4GB5 A;  4HZB B;  4KE3 A;  1AVK A;  5CRE A;  3LTA A;  1EWX A;  4MEI A;  2DIZ A;  3D79 A;  4DEJ A;  1U6T A;  1O7G B;  2EIR A;  3EC9 A;  4PQ1 A;  5B8B A;  5M18 A;  4MDC A;  1A90 A;  1UW1 A;  3FR6 A;  2ZUP A;  4L5O A;  3HD5 A;  5ECI B;  1Q7Y 4;  1X1W A;  4MH3 A;  1YIJ 3;  4J2F A;  2P0M A;  1Q40 B;  4FIW A;  3IRA A;  1UUG B;  3KZT A; 
#chains in the Genus database with same CATH homology
 1SL2 B;  3H79 A;  1JFU A;  4TXV A;  2H1D A;  3EVI A;  4DSQ A;  3MAK A;  4K1F A;  4BL7 A;  3Q18 A;  5FHI A;  4HJ2 A;  2IFQ A;  1OC8 A;  3A5W A;  1TKD B;  2E7P A;  2OKA A;  4QL9 A;  5ECH B;  3TRX A;  1G6Y A;  6GSS A;  1KEB A;  1G6W A;  1XOA A;  4Q5R A;  3TRQ A;  2PU9 C;  2OE3 A;  2GTU A;  2K6V A;  1T1V A;  4BVY A;  4GF0 A;  4N0Z A;  4HUA A;  3OR5 A;  4K5R A;  4X1U A;  4WET A;  4EO3 A;  5H5R A;  1NHY A;  3KJY A;  4RI6 A;  4KDU A;  4OO5 A;  1SK2 A;  5DJM A;  1B8X A;  3APO A;  5C00 A;  2R5G A;  1E2Y A;  3D4M A;  5IMF A;  1O7U A;  2QC7 A;  4OCF A;  2VD1 A;  4ZB6 A;  2LKU A;  5DAL B;  1TU7 A;  2JAD A;  2N5F A;  1OC9 B;  4Z7X A;  1WRY A;  1OE7 A;  4WEY A;  4GSN A;  5J3R A;  2CT6 A;  3WGX A;  1EV9 A;  1HNC A;  3QMX A;  4O92 A;  2EIQ A;  4F82 A;  4ZIL A;  1FB6 A;  3IV4 A;  2MMZ A;  3FR3 A;  3F6D A;  4ZB9 A;  2QGV A;  4Z2T A;  2JU5 A;  1E6B A;  4Z2R A;  1H75 A;  4EUY A;  4H86 A;  4EE0 A;  3QAV A;  2KP2 A;  1OAZ A;  4IBP A;  4TR1 B;  4IVF A;  2L59 A;  2YZH A;  4TN8 A;  3SBC A;  1LBK A;  3I43 A;  2WDU A;  5F05 A;  3FRC A;  5FWG A;  3GX0 A;  3LG6 A;  4V1A p;  4CDO A;  4XTS A;  3UOM A;  2LQO A;  2YN1 A;  3FZA A;  3HXS A;  2J23 A;  1DE2 A;  3TJG A;  2AJQ B;  1FB0 A;  4ML6 A;  2PWJ A;  3O3T A;  4JE1 A;  1MDI A;  2K18 A;  3DD3 A;  5ELG A;  2V2G A;  2IPA A;  2H75 A;  4OO4 A;  5D9X A;  2QKE A;  1ZYN A;  4OFN A;  2WB9 A;  2ALB A;  3KXO A;  1K0C A;  3TKS A;  1GSU A;  2GLR A;  1O81 A;  2AAW A;  1GTU A;  5D9T A;  5DJL A;  1OC3 A;  1PD2 1;  1XWC A;  2H0H A;  1WE0 A;  4A5P A;  2DKI A;  3IBH A;  4ZXG A;  1M9A A;  1USB A;  5DAL A;  1SL1 B;  1GUH A;  4HEA 2;  5DDL A;  1OC9 A;  1TTZ A;  1GUL A;  3LYK A;  1AIU A;  2B5E A;  2JAC A;  2FWH A;  1QFN A;  3KP8 A;  3VLN A;  5JCW A;  2IWT A;  1XOB A;  1Z6N A;  3EMX A;  1UVZ A;  2GSS A;  4KB3 A;  1X9W B;  1NSW A;  3JCM L;  3FK8 A;  2HSH A;  3CXG A;  1TRU A;  1XFL A;  2K9F A;  2H1A A;  4TR1 A;  3US3 A;  1EOG A;  2DLX A;  2O8V B;  1FOH A;  3G9B A;  1YZX A;  1WP0 A;  5B7C A;  4EC0 A;  2X8G A;  3UAR A;  2A2P A;  3VI7 A;  1SYX A;  4V1A g;  3HCZ A;  4NWY A;  4LLR A;  3PPU A;  1XW9 A;  3ZTL A;  1SJZ A;  1Y25 A;  4ZBD A;  4MZB A;  2HI7 A;  2OA7 A;  4OFM A;  4MPG A;  1A2M A;  4TKY A;  5G5F A;  2CA8 A;  3DML A;  4NAX A;  5IMA A;  5D93 A;  2VCV A;  3F4S A;  1DE1 A;  4AGS A;  2L5L A;  3IC8 A;  1V58 A;  4F9Z A;  3GUS A;  1FW1 A;  1THX A;  4KA0 A;  1U3I A;  4DSR A;  3H1N A;  1GLP A;  4POK A;  3TJB A;  2FY6 A;  5ECQ B;  3UAP A;  1U87 A;  2MMO A;  1TI1 A;  4KF9 A;  4ZL9 A;  3IHG A;  2GQL A;  3ERG A;  4YH2 A;  4O5R A;  3MDK A;  5HQP A;  1SKR B;  1SKW B;  3LWA A;  2AB6 A;  4TW5 A;  5INY A;  1YEX A;  5AGY A;  1K0N A;  2VO4 A;  5FT3 A;  3TUE A;  7GSS A;  3D5J A;  1X5C A;  3ZLP A;  1H4O A;  4JR4 A;  3KZQ A;  2DJ1 A;  1XWG A;  1ZMA A;  3WYW A;  2P0G A;  3ZMK A;  2VLU A;  1BJX A;  1ZGN A;  1NW2 A;  1TP9 A;  4MCU A;  3VPQ A;  5J9B A;  1KTE A;  1BG5 A;  1F2E A;  3GUR A;  3ZIV A;  2FA4 A;  2DML A;  3EMP A;  3FZ9 A;  3LXT A;  2P5Q A;  4WR4 A;  2E2G A;  1SU9 A;  5A4V A;  4HU9 A;  2CVB A;  1T7P B;  5LCZ A;  6GSU A;  3IOS A;  4G19 A;  5H5S A;  3QAG A;  1A2J A;  5CRW A;  5D9W A;  2EC4 A;  2YCD A;  4FO5 A;  3CRT A;  4L0U A;  2VIM A;  1Z3E A;  2FD3 A;  3EU4 A;  5CRH A;  2VM1 A;  4MH2 A;  5F8B A;  3GKK A;  5GZZ B;  2B5Y A;  3TJJ A;  6GST A;  5IQY A;  4IQ1 A;  3LOR A;  5C04 A;  2EIO A;  3WT1 A;  2LST A;  1HD2 A;  4K0N A;  1B9X C;  4JR6 A;  1SD8 A;  4O5Q A;  3LGC A;  1A23 A;  2PVQ A;  3VWU A;  2LNS A;  2H71 A;  2HRK A;  5B8A A;  3GMF A;  4IP6 A;  3R2Q A;  4AF2 A;  4JZQ A;  3G7J A;  3GRX A;  1OKT A;  1Z5Y E;  2OJL A;  2K8S A;  1XVQ A;  4MK3 A;  1S3D A;  4I8B A;  1AQV A;  2C0G A;  4WF4 A;  3S9F A;  3D4T A;  1K0D A;  2MMN A;  4O7H A;  5JWR B;  3GFK A;  3KP9 A;  4BA7 A;  4K2X A;  4OCE A;  3LXZ A;  5AIS A;  1PSQ A;  2X4A A;  4ECC A;  5JCU A;  3QFB C;  3DGQ A;  2BTO T;  2YOI A;  1ACV A;  4EL1 A;  1YDK A;  2OE1 A;  1TU8 A;  4XRD A;  4WXT A;  5D8I A;  1Z6M A;  1Y6E A;  5ECL B;  4QL7 A;  2F8F A;  1XWB A;  3HVV A;  2NPB A;  4KGI A;  4POM A;  4IQA A;  1A0F A;  3TKS E;  2IL3 A;  3LFL A;  5ECN B;  4K0G A;  1NHO A;  5IO0 A;  3IHQ A;  1M2D A;  14GS A;  2H70 A;  3LYP A;  2X64 A;  4BWS A;  13GS A;  3D21 A;  2ZNM A;  2YWO A;  5E4W A;  2C8U A;  3E3E A;  1PN9 A;  4USS A;  1T8E B;  1PQN A;  3GKN A;  3FMW A;  4ILF A;  3MSZ A;  2B6M A;  2YV7 A;  11GS A;  3BD2 A;  4NHZ A;  5ECK B;  2VM2 A;  3EPT A;  1AAZ A;  1TW9 A;  2JZS A;  3FW2 A;  2GVP A;  4FQU A;  5LD0 A;  4EDZ A;  4G9H A;  2NTO A;  4KW6 A;  3IXR A;  2IYJ A;  2DSA A;  1GTI A;  1TK8 B;  1F9M A;  3FR9 A;  1MDK A;  4YQV A;  2H6X A;  4K7N A;  2E0Q A;  1F37 A;  4LMW A;  1B9Y C;  1Q4J A;  2R0G A;  3EU3 A;  1ZYQ B;  3C8E A;  5GSS A;  5A4U A;  3ZFL A;  5J41 A;  2DJ2 A;  3G7I A;  5ECO B;  2F8A A;  4AJ8 A;  3VFI A;  4E8E A;  3HJM A;  1U88 A;  3VI5 A;  4CW9 A;  2L6C A;  3F63 A;  3O76 A;  4L8E A;  3BBY A;  4G0I A;  4XS1 A;  3M1G A;  3HKR A;  2WS2 A;  1RK4 A;  3KEB A;  6GSW A;  3GL3 A;  2V6K A;  3KM6 A;  4EVM A;  4IJI A;  4V2M A;  4NXI A;  5J4U A;  4EXJ A;  1FVK A;  2WUL A;  3WT2 A;  4HS1 A;  4IKH A;  3RPN A;  2WGR A;  3GNJ A;  1FG4 A;  1JZO A;  2UZ8 A;  5EY6 A;  5KN2 A;  2WFC A;  1NM3 A;  2VLT A;  2GZP A;  2YP6 A;  2AV4 A;  5CYY A;  2GQK A;  3J7Y k;  1XWK A;  3UBK A;  4Q5N A;  2V41 A;  3RHC A;  2PGT A;  3EYT A;  2B1K A;  1PL1 A;  1HNA A;  5ECS A;  3F8U A;  1CQH A;  1PRX A;  1VRS D;  2KUC A;  2WRT A;  3GV1 A;  5E59 A;  3GA4 A;  3DEX A;  4KX4 A;  1TJD A;  2PMT A;  5HFK A;  1S3C A;  3TKR A;  1V9W A;  4LL1 B;  4QQ7 A;  3N5O A;  2IY2 A;  2C0F A;  3U5R E;  3W8S A;  1RW1 A;  1JZR A;  1N2A A;  2H8L A;  4YKF A;  1VGL A;  2MZC A;  2REM A;  4GTU A;  4ZIJ A;  2RM6 A;  3FEU A;  2HSM A;  2IMI A;  1BED A;  19GS A;  2LRC A;  4HQZ A;  1AW9 A;  4HI7 A;  2JZT A;  3ZYW A;  1FHE A;  1V40 A;  1PA3 A;  1M99 A;  4KSO A;  1MD4 A;  4LL4 B;  1EGO A;  3LEF A;  2A4H A;  3GKX A;  4EIQ A;  4RQX A;  2IIY A;  5GST A;  4F0B A;  4PX1 A;  2N5A A;  2YJ7 A;  4MMM A;  3ERF A;  2OAC A;  1PGT A;  5G1K A;  4O32 A;  4F03 A;  2LQQ A;  1YF0 A;  1K0A A;  2IME A;  1TK5 B;  1X0R A;  4MJB A;  2H0G A;  4TXO B;  2O89 A;  1IYI A;  3EE2 A;  3TKS C;  4N30 A;  3APS A;  2C1Y A;  1DBY A;  1GUK A;  3UMA A;  5HR2 A;  4KAE A;  2I4A A;  3F3Q A;  2DKH A;  3G7Y A;  3U6V A;  1GSS A;  3GX8 A;  2HYX A;  1YY7 A;  1UN2 A;  2GGT A;  1VF3 A;  4K9Z A;  2R2J A;  2O85 A;  1QXH A;  2RII A;  3GYK A;  4GRF A;  2IMK A;  2CX4 A;  5KOX A;  1TK0 B;  3A2W A;  3HZ8 A;  5G1L A;  3A3T A;  4OD7 A;  2D2Z A;  2Z9S A;  3N9J A;  5ECR B;  5H5Q A;  2HZE B;  3QFA C;  2H72 A;  2CVK A;  3PGT A;  3KTB A;  2X49 A;  2KP1 A;  3C7M A;  2OAD A;  1ST9 A;  2GSQ A;  2GS3 A;  3KIJ A;  1GWC A;  3HVS A;  1TRW A;  2VAF A;  3IR4 A;  2TRX A;  4YAV A;  2QA2 A;  3PIN A;  3CSH A;  2A4V A;  2XPD A;  3VUR A;  2NDO A;  4PQI A;  4ULX A;  2V32 A;  3W6G A;  4DSS B;  1WJK A;  3HY2 A;  2ON7 A;  1YQ1 A;  1HNB A;  3CBU A;  1TXX A;  1B4Q A;  3D0Z A;  4J56 E;  3CTG A;  2F3M A;  4MZC A;  3KMN A;  2VCZ A;  1O6J A;  3EWL A;  5GAN D;  3C73 A;  3QDN A;  2HXK A;  3HYP A;  4O5U A;  4N0V A;  5COH A;  3FKF A;  5CO3 A;  2LJA A;  4KND A;  5CAX A;  2AYT A;  2HRA A;  2YWN A;  3UVT A;  2DJK A;  2AUV A;  4ECI A;  2I1U A;  4EF0 A;  4HZ4 A;  3BCI A;  2FNO A;  3KTL A;  1IYH A;  4X4J A;  5AIX A;  4TXO A;  3GH6 A;  4XS4 A;  1R7H A;  2XHF A;  1JLW A;  4MJA A;  9GSS A;  3E0U A;  2C0E A;  2P31 A;  4YKG A;  4BVX B;  1YF1 A;  3PR8 A;  1AXD A;  1W89 A;  2IMF A;  1EP7 A;  3TKQ A;  4PUR A;  1X5D A;  4GCI A;  2H6Z A;  12GS A;  4TRX A;  3O6T A;  4IP1 A;  2KLX A;  2DC5 A;  4Q5F A;  3ED3 A;  2QA1 A;  3IC4 A;  3ZVJ D;  1MD3 A;  2I3Y A;  1A8L A;  1M7T A;  3QCP A;  5DCH A;  1K3O A;  2DJ0 A;  2OE0 A;  3A2V A;  4I5Q A;  1XIY A;  1F6M C;  3A5I A;  3QD9 A;  1W4V A;  2HZE A;  2L57 A;  2GZY A;  5IIZ A;  5KOW A;  5D9V A;  2CZ2 A;  5JWQ B;  3UIW A;  3DVX A;  3D22 A;  3VWW A;  4HDE A;  2MBS A;  1I5G A;  4LMV A;  3RAZ A;  3M0F A;  4RUV A;  4FYU A;  2LV3 A;  4AJ6 A;  1OYJ A;  3TRP A;  5ABR A;  2G2Q A;  6GSV A;  3Q74 A;  4DSS A;  1TRV A;  4WF5 A;  1GNW A;  5CP1 A;  4IJ3 A;  3FZ5 A;  1GL8 A;  3I69 A;  3TOU A;  3F9U A;  2FWG A;  2VL2 A;  2HT9 A;  5GAP D;  1XCC A;  3GHA A;  2WZ9 A;  2VL2 C;  1T00 A;  1THO A;  2HRF A;  2LJR A;  2LJK A;  3GH9 A;  1F3A A;  4ID0 A;  4MAB A;  2M46 A;  5IO2 A;  2L4C A;  2B7J A;  3C1R A;  1M2A A;  5EVO A;  3VWV A;  2V6O A;  3KH7 A;  3MWH A;  1V57 A;  6GSX A;  2QSI A;  4MPF A;  4K8M A;  2XC2 A;  1Z7R A;  2RM5 A;  1MTC A;  1J9B A;  4ZBB A;  1O8X A;  2C0D A;  5CNW A;  2L5O A;  1PKZ A;  1EGR A;  1G7O A;  4L5L A;  2F51 A;  4XRA A;  5IPG A;  4MF5 A;  4WKW A;  4BVX A;  2X8H A;  1XPV A;  4F2I A;  4JBB A;  4HU7 A;  1MDJ A;  1KNG A;  5G30 A;  3UEM A;  4KDX A;  2HRN A;  4YQM A;  3P90 A;  3WGE A;  4N10 A;  4I6X A;  3ZIT A;  4V2L A;  2VLV A;  3C1S A;  1EEM A;  2E2M A;  2CZ3 A;  1O85 A;  2VL9 A;  4EIP A;  5CRG A;  1TOF A;  3VPT A;  4EKZ A;  3WGD A;  1GRX A;  2PN8 A;  4ZBA A;  2JSZ A;  1WOU A;  3L9V A;  2FWE A;  5G31 A;  2YJH A;  2XBQ A;  2FLS A;  3NIV A;  3SWL A;  3L4N A;  2FUG 2;  1XW6 A;  4XIH A;  1ERV A;  3FHK A;  16GS A;  2ZCT A;  3ME8 A;  3CSJ A;  3TOT A;  1SJI A;  3ZRE A;  3F0I A;  3A2X A;  2XPE A;  2JSY A;  3ZIJ A;  1FAA A;  4TR4 A;  3MNG A;  3CSI A;  4ML1 A;  4XCS A;  4K5S A;  2HZF A;  1WIK A;  3GN3 A;  1YJ6 A;  2P5R A;  3TCO A;  1Z9H A;  2FGX A;  3KGK A;  1WPI A;  4MA9 A;  4GST A;  2LS5 A;  4X0X A;  5HR1 A;  4G0K A;  4MZW A;  1J08 A;  2IJY A;  3GST A;  1SKS B;  1EOH A;  1YKA A;  5J5N A;  1GSD A;  3VK9 A;  3LW9 A;  4YQU A;  2NVL A;  2B5X A;  1FOV A;  4POB A;  2B1L A;  4IEL A;  4HJM A;  2IMD A;  1M0U A;  2WJU A;  4PUF C;  4Z2U A;  2MMA A;  5F07 A;  5JWO B;  2WCI A;  1K3Y A;  1GP1 A;  1A24 A;  1QMV A;  1ZYE A;  3HVX A;  1ABA A;  1ILO A;  1URM A;  1Z7P A;  4YAP A;  2B7K A;  2FWF A;  2HSY A;  4WBR D;  4PUA A;  1UA5 A;  3HHV A;  1X9S B;  1ZCP A;  1TRS A;  4NV2 A;  4GWR A;  3GIX A;  4BWQ A;  1BQ7 A;  1R5P A;  1QK8 A;  1OVN A;  2YWI A;  4E8H A;  3RBT A;  2JZR A;  3J7Y b;  4PNF A;  1K0M A;  3H93 A;  5HR3 A;  3CRU A;  1A2L A;  1A8Y A;  4FYB A;  4NV5 A;  2JL4 A;  1FO5 A;  3RDW A;  5J9C A;  5IOX A;  2AHE A;  3QAW A;  5ECP B;  3ZZX A;  2C3T A;  4ZL8 A;  5A5K A;  6GSY A;  5L71 A;  3IAS 2;  1XBS A;  3KD0 A;  4POL A;  1EZK A;  3DKS A;  4HQS A;  3TKP A;  1ZOF A;  3TDG A;  8GSS A;  2RUE A;  4FYC A;  3C71 A;  2DJJ A;  2LRN A;  1T3B A;  4Q5Q A;  2GDR A;  1PX7 A;  4KH7 A;  2LRT A;  4OFT A;  4IGJ A;  4CY8 A;  3PH9 A;  2CV4 A;  1S3A A;  4CY6 A;  2PVO C;  4G0L A;  2RUF A;  2YAN A;  2OBK A;  2R37 A;  1EP8 A;  1CQG A;  4D73 B;  3I6A A;  5IMV A;  2PUK C;  17GS A;  3KH9 A;  3HDC A;  4K7I A;  2GT5 A;  3IK7 A;  2CQ9 A;  5ELA A;  1ZZY A;  3CTF A;  2GT6 A;  1K3L A;  5KEJ A;  1DSB A;  1QUW A;  2CX3 A;  2HLS A;  5ENU A;  3BJ5 A;  1PMT A;  4NPB A;  3VWX A;  3R3E A;  2L4Q A;  2G0F A;  3BCK A;  4IN0 A;  2LUS A;  1FVJ A;  2H30 A;  3MYD A;  2VL3 A;  5HFI A;  2VCQ A;  4AJ7 A;  1GSY A;  4X43 A;  4K7O A;  1LJR A;  4MP4 A;  2YZU A;  3LJR A;  1JHB A;  5G5E A;  4XHM A;  4XS4 B;  2VUP A;  1QGV A;  1OKD A;  1T4Z A;  1XWA A;  1ERT A;  2DJ3 A;  4ACS A;  3RHB A;  1ON4 A;  1X9M B;  5EPF A;  1RQM A;  3IAM 2;  4K2D A;  5IMZ A;  1EEJ A;  3ZVJ A;  1AUC A;  3DIE A;  1TI3 A;  4PGT A;  4N11 A;  1X5E A;  4IW9 A;  3HA9 A;  1R5A A;  3LQ7 A;  5DBQ A;  2K8V A;  1JZW A;  2KOK A;  4GLT A;  5JCG A;  2NBS A;  1EV4 A;  4RQR A;  5ECM B;  1AC1 A;  2IN3 A;  4PNG A;  5KN1 A;  3EIN A;  1V2A A;  2VOC A;  3E9J B;  4L0W A;  3GSS A;  3V1W A;  2R3X A;  3M8N A;  3P2A A;  5A4W A;  2C3Q A;  5F0G A;  2HE3 A;  1R26 A;  2C4J A;  5ID2 B;  3IPZ A;  3L9U A;  2O7K A;  3RPP A;  2L6D A;  1G7E A;  2ES7 A;  2PPT A;  1M2B A;  2H73 A;  3UL3 A;  1DUG A;  4D73 A;  2BJX A;  1M9B A;  2B3S A;  4V2N A;  2LNT A;  3CYN A;  5IPH A;  4HOJ A;  3ZL5 A;  3F4T A;  3TJF A;  1GTB A;  2N5B A;  5DQS A;  2C3N A;  1AQW A;  4LA1 A;  1BX9 A;  4EDY A;  3DYR A;  1HQO A;  1QQ2 A;  3BOA A;  3IA1 A;  2KHP A;  1G0T A;  2H01 A;  4P3Y B;  2PER A;  1GSF A;  4HZ2 A;  2X8C A;  3TJK A;  3QOU A;  3UVH A;  4IHU A;  2TIR A;  5KN3 A;  1GUM A;  3ME7 A;  4MJE A;  4I2T A;  4GXZ A;  1JZD A;  2DIY A;  3FYG A;  3AY8 A;  3WD6 A;  2R0P A;  4TOP A;  3MIX A;  3UJ1 A;  2DBC A;  4RI7 A;  2R4V A;  1F3B A;  1WWJ A;  2I9H A;  2OBI A;  2H1B A;  1KBN A;  2DMM A;  2M80 A;  4MF7 A;  1AQX A;  5DQY A;  4KSM A;  2CAQ A;  3H8Q A;  3W8J A;  2H0I A;  3APQ A;  3FY7 A;  4JED A;  2XBI A;  4WBJ A;  5EL8 A;  4I2U A;  3DXB A;  3HJO A;  4MJC A;  2VCW A;  20GS A;  3CMI A;  3HZ4 A;  5DAK B;  1YEP A;  5AIV A;  4OMV A;  1VF1 A;  3ERW A;  1GLQ A;  3K8N A;  2LEG A;  3F3R A;  3IE3 A;  5BMU A;  3GTU B;  5ID2 A;  2VD0 A;  1ERW A;  4KCA A;  1XZO A;  3TGZ A;  4NMU A;  2CVD A;  1V98 A;  1GH2 A;  1VF4 A;  2CAI A;  5IM9 A;  4I97 A;  1T4Y A;  3KMO A;  3L9S A;  1R4W A;  1PL2 A;  3UBL A;  1VF2 A;  5DVB A;  4BPY A;  1SJ6 A;  1XVW A;  4G10 A;  2HNL A;  4GQC A;  1WMJ A;  5LNK e;  2C80 A;  2FCH A;  3Q19 A;  1BAY A;  2YNX A;  1O8W A;  1GSQ A;  3I9V 2;  5D96 A;  1N8J A;  2V1M A;  5B6M A;  1LU4 A;  3EC3 A;  4KDY A;  3F4R A;  1MEK A;  5CRD A;  4PTS A;  1ZYP A;  4MF6 A;  1HYU A;  2J9H A;  1XXU A;  4FH8 A;  2O87 A;  3HJP A;  2PBJ A;  4DVC A;  5HR0 A;  2VCX A;  2X99 A;  3ZRD A;  4K6X A;  2ON5 A;  5G2Z A;  1PX6 A;  1GSE A;  1I9D A;  1GNE A;  4IS0 A;  4TVE A;  2MBT A;  3D6I A;  3GKM A;  2YPM A;  4XS6 A;  2H76 A;  3DWV A;  2H6Y A;  3F6F A;  4TR0 A;  1SK1 A;  4ISD A;  3QPM A;  4ECJ A;  1TDI A;  4ICY A;  5IMD A;  4NHW A;  1B48 A;  3IDV A;  2VCT A;  1PKW A;  2A2S A;  4CHS A;  4PXO A;  3TB2 A;  1YKC A;  3IK9 A;  3EUR A;  1GTA A;  2I81 A;  1ML6 A;  3L78 A;  2RLI A;  5D73 A;  3GL5 A;  5AN1 A;  3DRN A;  4ECB A;  1SYR A;  18GS A;  4BL7 B;  2H1G A;  5IMC A;  1JLV A;  2FA8 A;  2YWM A;  3ZFB A;  1SD9 A;  2M72 A;  1SL0 B;  2IFQ B;  1Q98 A;  3M9J A;  2FHE A;  4JU5 A;  1PN0 A;  5KN0 A;  1SK0 A;  10GS A;  5DAK A;  4GSS A;  3P7X A;  4G2E A;  2GZZ A;  4BVY B;  4GQF A;  1O73 A;  1SEN A;  2H74 A;  3GTU A;  3M3M A;  3FZ4 A;  1C72 A;  3Q6O A;  4MNN A;  3NOF A;  1U3A A;  2MYG A;  3P8W A;  1UC7 A;  2GQM A;  2YV9 A;  2LTK A;  4TR3 A;  4ZL7 A;  3QR6 A;  4KCE A;  4WR5 A;  3H4K A;  5B6N A;  3KCM A;  5DCG A;  1BYE A;  3ISO A;  5BRT A;  2R6K A;  2TRC P;  4OWY A;  2BMX A;  1J0F A;  1B4P A;  3M9K A;  1ERU A;  3DVW A;  4MLY A;  4F0C A;  1A0R P;  1K0B A;  2H19 A;  1ZL9 A;  2F9S A;  5HFG A;  3ZML A;  2H66 A;  2GSR A;  2A2R A;  4ZB8 A;  4KUN A;  3LSZ A;  2GST A;  3NZN A;  5IOW A;  1K0O A;  4J57 E;  5F06 A;  4PQH A;  1XW5 A;  1OE8 A;  2HFD A;  2R0C A;  4JRR A;  22GS A;  3L0H A;  4KE3 A;  5CRE A;  1EWX A;  2DIZ A;  4DEJ A;  1U6T A;  2EIR A;  5B8B A;  4PQ1 A;  4MDC A;  3FR6 A;  2ZUP A;  4L5O A;  3HD5 A;  5ECI B;  4MH3 A;  4J2F A;  4FIW A;  3IRA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...