2H0HA

Crystal structure of dsbg k113e mutant
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
229
structure length
229
Chain Sequence
ELPAPVKAIEKQGITIIKTFDAPGGMKGYLGKYQDMGVTIYLTPDGKHAISGYMYNEKGENLSNTLIEKEIYAPAGREMWQRMEQSHWLLDGKKDAPVIVYVFADPFCPYCEQFWQQARPWVDSGKVQLRTLLVGVIKPESPATAAAILASKDPAKTWQQYEASGGKLKLNVPANVSTEQMKVLSDNEKLMDDLGANVTPAIYYMSKENTLQQAVGLPDQKTLNIIMGN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Short-circuiting divergent evolution: laboratory evolution of one disulfide isomerase to resemble another
rcsb
source organism Escherichia coli
molecule tags Isomerase
molecule keywords Thiol:disulfide interchange protein dsbG
total genus 67
structure length 229
sequence length 229
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-05-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13098 Thioredoxin_2 Thioredoxin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.70 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Disulphide bond isomerase, DsbC/G, N-terminal 2h0hA01
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 2h0hA02
4AJ8A 1Q98A 2TIRA 1PD21 2HRNA 3QCPA 2A4VA 2K8VA 3DD3A 3GX8A 3CMIA 1FHEA 3CBUA 3EU4A 2H1AA 3F3QA 5IQYA 5FWGA 5B7CA 3ZZXA 3WGEA 5CYYA 3GV1A 2GDRA 1J0FA 4HQZA 2V32A 2IMDA 1A24A 2AYTA 4NMUA 4ML1A 3WT1A 4BVYA 1TK0B 1EWXA 4K6XA 3TKRA 1YY7A 1Z7PA 5IO2A 3VFIA 2JZTA 3TB2A 3FZ5A 2C1YA 2YJ7A 3FR3A 1A8LA 2VOCA 1B48A 5A4UA 3ZFBA 5B6MA 3DGQA 1GLQA 3DRNA 2YP6A 1GULA 2AUVA 3TKPA 5GSTA 4FYCA 4OO4A 1KBNA 3CSIA 4L5OA 4I97A 4HQSA 5HR2A 4DSSA 1NSWA 3M0FA 5HR0A 1DBYA 2K8SA 4HZ4A 4KSOA 2WRTA 4EKZA 3GL3A 5A4WA 3HHVA 2IFQA 2NPBA 3RHBA 1M2BA 5CREA 9GSSA 5DBQA 3QPMA 3GRXA 4ULXA 2PBJA 2LJAA 4I5QA 1NHOA 2MBSA 4MJBA 2IYJA 2L57A 4LL1B 17GSA 2IMEA 1A2LA 4TN8A 2JSZA 3UJ1A 2WGRA 2HRFA 3KIJA 4O5RA 1VGLA 3LYPA 3ZITA 3VPTA 3GKMA 5KN3A 1B8XA 2O89A 4WBJA 1SJZA 4GQFA 4HOJA 5AN1A 2GQMA 4XS4B 2ALBA 3ERWA 5ID2A 3E0UA 1BX9A 1T8EB 1OAZA 1A8YA 2PUKC 5DQYA 4KCEA 5AISA 1GP1A 4WR5A 1SKSB 2OKAA 4ECIA 5HR1A 2TRXA 3TGZA 3HKRA 5J4UA 5A5KA 2YJHA 3KTBA 1U3IA 2CA8A 3H8QA 4FO5A 2XC2A 2RM5A 4MDCA 6GSWA 4MCUA 1X9WB 1AXDA 2JZSA 3C1RA 1SKWB 1A0FA 4GWRA 1A2JA 3PGTA 4BL7A 2WFCA 4F2IA 2BMXA 3IAS2 5KN2A 2QGVA 3CYNA 5DDLA 5HFIA 4X1UA 3Q74A 10GSA 2GT6A 1BYEA 1QQ2A 5IMFA 3D22A 2VL2C 3GA4A 2IFQB 5CRGA 1V40A 2X64A 1TK8B 3G9BA 2HZEA 2RIIA 1FB6A 2GZPA 2C0GA 4ZXGA 2LUSA 4MPFA 3PH9A 4GSSA 5COHA 4V2MA 2AJQB 8GSSA 1WRYA 3KM6A 3PR8A 4AJ7A 1QGVA 4P3YB 2IMIA 1ILOA 2HLSA 3ZYWA 4HJ2A 1UVZA 1JLVA 4FIWA 3W8SA 2P5QA 2ON7A 4KH7A 2PWJA 1XIYA 1K0MA 2ON5A 1PL1A 1LJRA 5ELGA 3HA9A 5F05A 5KEJA 4KE3A 5GAPD 5F0GA 1F37A 2HNLA 2K6VA 3KMNA 2KHPA 3C73A 1U88A 1ZGNA 2AAWA 2X8GA 6GSSA 2B5EA 2ES7A 1MDIA 3LXZA 4IP1A 5D96A 3M9KA 2PPTA 3FR9A 2IIYA 2YNXA 5AIVA 5FHIA 5F07A 3MSZA 3GKXA 2J23A 1T4ZA 1GTUA 3H4KA 3GL5A 3TCOA 4NWYA 1AQVA 3L4NA 3AY8A 5DAKB 4L0WA 1SYXA 4MK3A 2GSSA 4XIHA 2FNOA 5F06A 3ZFLA 2LQOA 2WULA 5H5QA 5D73A 1GSYA 1TRUA 4MZWA 1K0BA 3KXOA 1DSBA 2E7PA 3KTLA 2LRCA 3C71A 2TRCP 3LXTA 3HZ8A 2FA4A 2OBIA 4QL9A 3ZMLA 2VD0A 3FZ9A 1PKWA 2JU5A 3ERFA 3UVHA 4Q5NA 1GSFA 3N9JA 4V2NA 4L8EA 3QAWA 3S9FA 2KUCA 4PNFA 4MLYA 5HFGA 2NVLA 3F6FA 2GQKA 5IM9A 2K18A 3UOMA 4ZB9A 2LV3A 4G19A 1MDJA 2P31A 3GTUA 4MJAA 4N0VA 2DIYA 2JACA 5IO0A 1TI3A 4ISDA 2CX3A 2KP2A 3QOUA 2GSQA 1AQWA 4K9ZA 3WT2A 4KW6A 1M9BA 1T7PB 1K0CA 2FCHA 1WOUA 2MMOA 2HXKA 3RPNA 1NW2A 4EDZA 3TRQA 4DSSB 1FO5A 3TKSA 5ELAA 1GNEA 1ZOFA 2DMMA 4PGTA 1WPIA 2QSIA 3F4TA 1GSSA 1JZRA 5CRWA 1XWBA 5FT3A 1EGOA 3GYKA 4OO5A 4PUFC 1A23A 1OC9A 4EF0A 1XOAA 5GSSA 4YH2A 4RUVA 3F63A 4EC0A 4G2EA 2H66A 2CZ2A 3VLNA 1SK2A 4TW5A 3A2VA 1B9XC 2FGXA 3UBLA 1TOFA 5CAXA 2FD3A 2X8HA 1R26A 4QQ7A 2AV4A 1K0NA 1SENA 1FVJA 3C1SA 4OWYA 4ACSA 3HD5A 1T4YA 3ISOA 2FWFA 2LJKA 3EWLA 2IY2A 1E6BA 4KGIA 2HI7A 2H75A 1J9BA 3TJBA 5IOXA 4F9ZA 3GUSA 2F8AA 4N30A 1BG5A 1X9SB 1HNCA 2YV7A 2FWGA 4TR0A 3HYPA 3A5WA 4NPBA 1O8XA 3EMPA 4ZIJA 1ZZYA 2R2JA 1XW9A 1AIUA 4MP4A 2HT9A 2I3YA 2LTKA 3QFAC 1ERWA 4V2LA 2YCDA 2B1KA 5ECNB 1XWKA 1XXUA 1YEPA 3E3EA 3MWHA 1N8JA 3VWXA 2KOKA 3A2XA 4PQHA 1G7OA 1F6MC 2PVQA 2I81A 3CXGA 1S3AA 3L78A 2JSYA 5EVOA 2IMKA 4I2UA 1M9AA 4MMMA 1GH2A 3FY7A 4QL7A 3LORA 3LYKA 1WMJA 3APSA 1O7UA 4XS6A 4KA0A 5ECPB 3ZL5A 4L5LA 3GTUB 2VCQA 4DSQA 5IPGA 3D4TA 1FOVA 1ZMAA 2LJRA 1GWCA 1SL2B 6GSYA 1EGRA 1RK4A 4I6XA 3TJFA 1VF4A 1SD8A 1JZDA 5J5NA 4Z7XA 2GSRA 5DALB 4E8EA 4V1Ag 3A2WA 1X5EA 2XPDA 4IJ3A 4POKA 3P7XA 2FA8A 1F2EA 1GTBA 4N0ZA 4MF5A 4N11A 4JR4A 5D9TA 1H75A 1HNAA 2EC4A 4ECCA 3NIVA 1EEJA 4JBBA 2C0EA 2FWHA 4JR6A 3M1GA 3LSZA 3RPPA 1B4PA 3QR6A 2DJKA 1Z9HA 3WGXA 4NAXA 5LNKe 3GNJA 3US3A 4K7IA 4TR1B 2LRNA 1O85A 4XTSA 3IRAA 1NHYA 3IHQA 2WS2A 1BQ7A 5D9XA 4K7NA 4LLRA 5H5RA 1ON4A 3H1NA 4POMA 1THXA 2H71A 3ME8A 4MH3A 3LGCA 2VO4A 4EE0A 3EC3A 1AW9A 3IK7A 2BJXA 3TJJA 16GSA 3UBKA 2V2GA 4IELA 1TK5B 1M2AA 2GSTA 4ZBBA 4NHZA 3KJYA 4N10A 4AJ6A 2VL9A 1ABAA 5ECSA 4ZBDA 2LNTA 2DLXA 2OE1A 2H6YA 4V1Ap 1GSUA 1Y25A 3FRCA 4YAPA 3WD6A 1XWAA 3IC4A 3ZRDA 1J08A 1URMA 5CRDA 2H74A 3FHKA 2JADA 3VWUA 5DJMA 1YDKA 13GSA 1YF0A 2O7KA 6GSXA 1T1VA 4WEYA 1IYIA 1PN9A 4MJEA 1KTEA 5G31A 3F4RA 2H70A 3O3TA 2LSTA 1EV4A 4CHSA 1TI1A 5G5FA 3FKFA 5C04A 3GIXA 1YKAA 4FH8A 3D0ZA 2YOIA 1QK8A 2GTUA 5CO3A 1V9WA 1GLPA 2A2RA 4GLTA 4LMVA 2MZCA 2VIMA 3EU3A 4AF2A 4TXOB 2MMAA 2V6OA 2YWIA 3UIWA 3HJMA 18GSA 1WE0A 3UAPA 1PRXA 4WKWA 3APQA 1M2DA 3TRXA 2RUEA 3ERGA 5A4VA 4PURA 1MD4A 2I4AA 3VI7A 1EZKA 1F9MA 2EIOA 2L5OA 1EP7A 3M3MA 3ED3A 2B7JA 2PMTA 2L6CA 6GSUA 1S3DA 1XBSA 3IXRA 1FG4A 1XVWA 1UN2A 3KH9A 2LS5A 1YQ1A 1M0UA 2FHEA 2HYXA 2Z9SA 2H8LA 4MZCA 1Q4JA 1TRVA 1SU9A 4K0NA 2N5BA 2E2MA 2OJLA 4TR1A 4CDOA 5ID2B 2M80A 2PU9C 1XW5A 3ZIVA 2D2ZA 3D21A 3ME7A 5IPHA 4EVMA 2H72A 4PUAA 5ECMB 1N2AA 2HSHA 2J9HA 4EO3A 3J7Yb 2GVPA 4ECBA 3RHCA 2H6ZA 1TTZA 2R5GA 3Q6OA 1UA5A 2OACA 2VAFA 4I2TA 2G0FA 4GF0A 4HDEA 3F6DA 5DCGA 2O87A 4TR3A 1DUGA 3LWAA 2BTOT 1G7EA 1MEKA 1MTCA 5IMVA 1OKDA 4ECJA 2FWEA 3TDGA 2L59A 2YWOA 4JU5A 2YN1A 3TOUA 1AC1A 3D6IA 1O8WA 4K1FA 1BAYA 4POBA 1XZOA 4WXTA 1AAZA 1C72A 1K3OA 1ML6A 3TKQA 4D73B 3IR4A 2CX4A 1M7TA 4KAEA 14GSA 2HZEB 1TU8A 1YEXA 3O6TA 5D8IA 5G1KA 3IAM2 3QDNA 2REMA 5ECHB 1SD9A 1KNGA 3WYWA 3ZTLA 4EXJA 5J3RA 1B4QA 4H86A 3TKSE 4DVCA 3BD2A 2GT5A 1GTIA 3LFLA 2ZUPA 5INYA 2EIRA 3G7IA 2GZZA 2WB9A 1EOGA 2LRTA 3IA1A 5ENUA 4XCSA 5DALA 3W6GA 1K0OA 4JZQA 1GTAA 4TOPA 2L4QA 3QMXA 1XFLA 4JEDA 1V98A 1ERUA 2F9SA 3BJ5A 3UARA 4OCEA 1VF2A 2KLXA 2ZNMA 1O6JA 4MZBA 2DJ3A 2HSYA 3FYGA 4GRFA 4HU9A 4X0XA 2K9FA 2V41A 3HVSA 5DCHA 3MNGA 2H76A 5JCGA 2YZUA 3HJPA 4HS1A 3I9V2 1OC9B 1TJDA 3GMFA 4LA1A 3GSSA 5EPFA 4IQ1A 1Z5YE 4K8MA 5C00A 1RW1A 1E2YA 5G2ZA 1U6TA 4KDYA 1T00A 4WETA 2IWTA 22GSA 5KN0A 2R3XA 2C3QA 5CP1A 5G30A 3LEFA 1PSQA 2CQ9A 3L9VA 3EURA 1ST9A 4ML6A 4ZBAA 3GSTA 5ECQB 1CQHA 2DJ0A 4EDYA 2H30A 5AGYA 5ECIB 2C4JA 5ECKB 4KUNA 5HQPA 2LEGA 3KP8A 3DMLA 3NOFA 3G7YA 1K0AA 1R5PA 3KGKA 2KP1A 2VCVA 5IIZA 1FW1A 3FZ4A 4KB3A 4IHUA 1V58A 1FB0A 5LCZA 2MBTA 3H79A 2H0HA 3EE2A 3DYRA 4TXOA 4ZILA 1EP8A 4IN0A 3IDVA 1UC7A 1IYHA 2OA7A 2B3SA 3TJKA 1EEMA 3KP9A 3UMAA 4NV2A 2F3MA 1TRSA 3ZVJD 1QUWA 2YZHA 3F8UA 5B8BA 5G1LA 2C8UA 4IBPA 2X8CA 2OE0A 3I6AA 3BOAA 1R4WA 3CRUA 4MH2A 3WGDA 5D9VA 2CT6A 4PNGA 3JCML 1AQXA 4WF4A 2I1UA 1GSEA 5ECLB 3QAGA 2CV4A 3V1WA 2IL3A 4NHWA 4IP6A 5DJLA 2ZCTA 4OFTA 4I8BA 1I5GA 2GZYA 3FW2A 4XRDA 3BCIA 2HZFA 3GFKA 2NTOA 3F3RA 1GNWA 2VCZA 1TW9A 5JCUA 1DE2A 4PQ1A 1XPVA 11GSA 2HFDA 4FYUA 4RI6A 2H6XA 2EIQA 3ZREA 3F4SA 4NV5A 3HY2A 2C0FA 2VM1A 2B5YA 2C3TA 2IN3A 1B9YC 2PERA 2N5AA 2PVOC 1TRWA 3DWVA 4G9HA 3EINA 4BPYA 2YWMA 1JZOA 4BWSA 4K7OA 2YPMA 2L6DA 4F0CA 5E4WA 2GQLA 2E0QA 2XPEA 1ERVA 4IKHA 3DIEA 4RQRA 3CTFA 1TDIA 1G6YA 1SK1A 2NBSA 2AB6A 2PGTA 3OR5A 1WJKA 1WWJA 4ZL8A 1MD3A 2AHEA 2H73A 1GSQA 4X43A 1OC8A 4F03A 3L0HA 4L0UA 5LD0A 2H01A 4TKYA 4ID0A 1S3CA 2YWNA 2PN8A 2IMFA 4KSMA 1FVKA 2F51A 1M99A 1PX6A 4DSRA 4ILFA 2H1GA 3F0IA 4AGSA 1GSDA 5CNWA 4YQUA 1TXXA 4CW9A 1BJXA 1Z6NA 4MABA 3HVVA 2VLUA 3TUEA 1F3AA 5AIXA 1ZYEA 4OCFA 2B1LA 3CSHA 2CVBA 4IQAA 4E8HA 3GX0A 3FEUA 3FZAA 2NDOA 4Q5QA 2MMZA 3CSJA 5E59A 2C80A 2WZ9A 1GUMA 1Z3EA 1X9MB 4J57E 1WP0A 2B6MA 3PINA 2JZRA 3UVTA 3M8NA 1OE8A 2B5XA 2DBCA 3ZVJA 4PXOA 2WJUA 1JFUA 2DMLA 1RQMA 1A2MA 2GS3A 1HYUA 4PX1A 3J7Yk 5CRHA 3P90A 2H1BA 3KD0A 1AUCA 1VF3A 3U6VA 6GSVA 1F3BA 2B7KA 5IMCA 3W8JA 2R6KA 2FY6A 2VCTA 2XBIA 2XBQA 3IE3A 3VPQA 1R7HA 4D73A 3I69A 1SYRA 4KDUA 4EUYA 2H1DA 2QC7A 1Z7RA 2XHFA 3EMXA 1THOA 1ERTA 4GQCA 1MDKA 1X0RA 4POLA 3BCKA 2P0GA 4IVFA 4MF6A 4IS0A 3RAZA 1V57A 4J2FA 1OKTA 1K3YA 2CVDA 2MMNA 5IMZA 1HNBA 3ZLPA 2RLIA 1TKDB 4BA7A 3IV4A 3EYTA 2RM6A 3C8EA 2OADA 2VUPA 5EL8A 4RI7A 2HE3A 1SJIA 2L4CA 3GH6A 3VWVA 4BWQA 2DSAA 3P8WA 4ZB8A 4LL4B 3L9SA 4J56E 1BEDA 4RQXA 4OMVA 5ABRA 5EY6A 5DAKA 2RUFA 4JRRA 1GUHA 3EVIA 4IW9A 3IOSA 1HD2A 3IK9A 20GSA 4O32A 1KEBA 3D4MA 5ECOB 1G0TA 4HEA2 3TOTA 1EV9A 1VF1A 3TKSC 1XCCA 3QD9A 1U3AA 3GKKA 4IJIA 1YJ6A 3LG6A 1JHBA 3BBYA 1SL1B 3ZIJA 2WDUA 2DJ2A 2M72A 4KX4A 3FR6A 3LQ7A 2C3NA 4F0BA 2OE3A 1OYJA 3HVXA 3HJOA 7GSSA 2VL3A 5DVBA 2WCIA 3VI5A 1YZXA 5IMAA 2CVKA 5JWOB 4GSTA 2E2GA 1QXHA 2GLRA 1XWGA 3MAKA 4ZL9A 5B6NA 1WIKA 2FUG2 2O8VB 3G7JA 4KDXA 3GURA 1XWCA 4MA9A 1GL8A 4GCIA 2QKEA 5B8AA 3FK8A 3HCZA 5GZZB 5J9CA 1YF1A 5D9WA 3VWWA 3K8NA 2R37A 3E9JB 1JZWA 1OVNA 2VM2A 1W4VA 1T3BA 5L71A 2VLTA 4TR4A 4O7HA 1Y6EA 2A2SA 2IJYA 3IBHA 1NM3A 5DQSA 4XS4A 4MPGA 2V6KA 1ZCPA 2G2QA 3HZ4A 2P5RA 3DVXA 3VURA 2VCXA 4Q5FA 2LKUA 4IGJA 2DC5A 1K3LA 4ZL7A 1YKCA 3GN3A 3QAVA 4OFNA 2YANA 2O85A 4MF7A 4K2DA 5GAND 1TU7A 2H0IA 1O73A 4WBRD 3Q19A 4G10A 4GTUA 5HR3A 6GSTA 3C7MA 4TRXA 5D93A 4MJCA 1JLWA 4FYBA 3ZMKA 2LQQA 4OD7A 3DVWA 1X5DA 1A0RP 2DJJA 4YAVA 4BVXA 2CZ3A 2VLVA 3SWLA 4YQVA 3HDCA 4Q5RA 5F8BA 1SKRB 2VL2A 3A3TA 3NZNA 1SK0A 1XVQA 3Q18A 1HQOA 3KCMA 4PQIA 2JL4A 3R2QA 4LMWA 1XW6A 3RDWA 3L9UA 3RBTA 3DKSA 1K0DA 5G5EA 1PX7A 3UL3A 3GHAA 3KEBA 1G6WA 1ZL9A 3U5RE 3KMOA 1V2AA 2LNSA 2N5FA 1LU4A 4DEJA 2MYGA 2X99A 4O92A 1USBA 1PL2A 5JWQB 1ZYQB 1EOHA 1VRSD 3F9UA 1ACVA 1PA3A 1OC3A 1QMVA 2H19A 1GUKA 1PKZA 4WR4A 3DEXA 4HZ2A 1I9DA 4NXIA 2DIZA 3MDKA 1DE1A 2VD1A 1X5CA 3P2AA 4K0GA 4GXZA 4GSNA 2I9HA 1H4OA 5KN1A 3GKNA 1SL0B 5HFKA 2R4VA 4TVEA 2H0GA 3TRPA 1W89A 4JE1A 1LBKA 3UEMA 5ECRB 5J9BA 3VK9A 2GGTA 3QFBC 2F8FA 2L5LA 2CAQA 4HU7A 3KH7A 3TJGA 4XS1A 4EL1A 3DXBA 4KCAA 4HI7A 4XHMA 2CAIA 1U87A 5JCWA 4XRAA 2C0DA 5JWRB 3D5JA 2FLSA 12GSA 3N5OA 4YQMA 4KNDA 3I43A 2VCWA 3M9JA 2IPAA 4ZB6A 4F82A 2V1MA 3HXSA 2M46A 1O81A 1Z6MA 3KZQA 4HUAA 19GSA 1TP9A 5IOWA 3GH9A 1FAAA 1PQNA 5H5SA 4OFMA 3CTGA 1QFNA 4TXVA 3SBCA 2DJ1A 1CQGA 3H93A 3IPZA 1R5AA 4HJMA 1OE7A 1PMTA 5IMDA 3APOA 5J41A 3CRTA 1GRXA 4WF5A 2YV9A 3LJRA 3O76A 1SJ6A 2OBKA 1XOBA 1PGTA
chains in the Genus database with same CATH superfamily
4AJ8A 1Q98A 1B2XA 2TIRA 1PD21 5FW5A 2HRNA 3QCPA 1R4YA 1LNIA 3U1WA 4CY8A 2A4VA 1AVKA 2K8VA 3FG3A 3NM7A 4CJNA 3DD3A 3GX8A 3CMIA 1FHEA 2GEXA 1IQ8A 3CBUA 2X4AA 3EU4A 3LH4A 4GSPA 2H1AA 3F3QA 5IQYA 1MGRA 2XH9A 5FWGA 5B7CA 3ZZXA 3WGEA 5CYYA 3GV1A 2GDRA 1J0FA 4HQZA 2V32A 2IMDA 1A24A 1I3IA 2AYTA 2O3OA 1JNQA 4NMUA 4ML1A 1DETA 3WT1A 4BVYA 1TK0B 1EWXA 4K6XA 3TKRA 1YY7A 3OWYA 1Z7PA 4GL6A 5IO2A 3VFIA 3SLUA 2JZTA 3TB2A 1LOXA 4FMBA 2RGQA 3FZ5A 4LSOA 2C1YA 1LOVA 2YJ7A 3FR3A 1A8LA 3PCSA 1TP6A 2VOCA 3I563 1B48A 3HZPA 5A4UA 3RGRA 3ZFBA 3DGQA 5B6MA 4CDLA 1GLQA 1LRAA 3DRNA 4OK0A 3CC73 2YP6A 1GULA 2CFGA 2AUVA 1JN5A 3TKPA 2BMOB 5GSTA 4FYCA 4OO4A 1KBNA 3AGNA 3CSIA 3OWSA 4L5OA 3LT8A 1Q7HA 4I97A 4HQSA 5HR2A 3S67A 4DSSA 1NSWA 3M0FA 5HR0A 1DBYA 2K8SA 4HZ4A 1YIJ3 2XFTA 1EUIC 2P09A 4LYLB 4KSOA 1GOYA 3HX8A 4HZ9B 2WRTA 3GZYB 4EKZA 3GL3A 5A4WA 3HHVA 3LMLA 2IFQA 1W2ZA 1SIHA 1RLSA 2NPBA 3RHBA 1B20A 2W04A 3NV0A 4WP5A 3CCS3 1M2BA 1WTHA 2CW9A 5CREA 9GSSA 5DBQA 1SIIA 3QPMA 3GRXA 1OACA 1BSCA 4MNNA 4ULXA 2PBJA 4ICYA 2LJAA 1US1A 4I5QA 1GMPA 1NHOA 1ROVA 2MBSA 1NNVA 3JUPA 4MJBA 3LYGA 1RNBA 2IYJA 3QRDA 3MWZA 2L57A 4EC6A 4EV2A 4LL1B 17GSA 3OV4A 2IMEA 3NBJA 3CQFA 1A2LA 1J2BA 4TN8A 2JSZA 3UJ1A 2R41A 2WGRA 2HRFA 3KIJA 3DXOA 4O5RA 1VGLA 3LYPA 3ZITA 3VPTA 2ML5A 3GKMA 5KN3A 1JJ22 1B8XA 4IPBA 2O89A 4WBJA 1EKMA 1SJZA 4GQFA 4HOJA 5AN1A 3B7CA 1RCLA 1OF5A 1JRQA 2GQMA 4XS4B 3CCM3 4AKZA 3DUKA 4J8TA 2ALBA 1VQK3 3ERWA 2OQEA 5ID2A 1B27A 3E0UA 1BX9A 1T8EB 1KSIA 2F98A 1OAZA 4MMZB 1A8YA 3CNMA 3LT9A 1M904 2PUKC 3EQQB 5DQYA 4KCEA 5AISA 5AI1A 2GBWB 1UCKA 1O7PB 1GP1A 4WR5A 1SKSB 1BVIA 2OKAA 4ECIA 3KIIA 5HR1A 2TRXA 4G1MB 1JB4A 2Y74A 1RRLA 3TGZA 3HKRA 5J4UA 5A5KA 2YJHA 3KTBA 1U3IA 4O3VA 2Z77A 1YVSA 2CA8A 3H8QA 1K8A4 4FO5A 2XC2A 2RM5A 4MDCA 6GSWA 4MCUA 1X9WB 1QJGA 5AIGA 1C7HA 1OHOA 1AXDA 2JZSA 3C1RA 1SKWB 3NQYA 1A0FA 1IV9A 2YX9A 4GWRA 1IT7A 1A2JA 3PGTA 4N6TA 4BL7A 4K2XA 2WFCA 2MC8A 3WDGB 1X1WA 4F2IA 2BMXA 1O7HB 1N9JA 1RJOA 5D83A 3IAS2 3IMAB 5KN2A 1ZYNA 2QGVA 3CYNA 5DDLA 5HFIA 4X1UA 3Q74A 2ML6A 10GSA 4R80A 3NHXA 2GT6A 6STDA 1BYEA 1QQ2A 3S29A 5IMFA 2RFRA 3D22A 2VL2C 4GB5A 3GA4A 2IFQB 5CRGA 2CIUA 1NB5I 3KKGA 1IYYA 3FZWA 1V40A 2X64A 1TK8B 3G9BA 2HZEA 2RIIA 1FB6A 2GZPA 2V1LA 2C0GA 5IEPA 1YJW3 1OGZA 1M1XB 1TRQA 4ZXGA 4HM7B 4Z2TA 2LUSA 4MPFA 3PH9A 4GSSA 5COHA 1TU5A 4V2MA 3DMCA 2AJQB 8GSSA 3K63A 1WRYA 5JPUA 3LTDA 2D1WA 3KM6A 3MKIA 1XG8A 1GY5A 3PR8A 4AJ7A 1QGVA 4P3YB 2IMIA 2QA1A 3A5EA 3U97A 3BNEA 2HLSA 3ZYWA 1ILOA 4HJ2A 1UVZA 1JLVA 4FIWA 3W8SA 1DMQA 2P5QA 3G0KA 2ON7A 2QIYA 1HU9A 1MWTA 4KH7A 3QK9A 2PWJA 1HZ1A 1RGKA 1TRPA 1XIYA 1K0MA 2ON5A 1JB5A 1PL1A 4LMIA 1LJRA 5ELGA 1LXEA 3HA9A 5F05A 5KEJA 3CD63 4KE3A 5GAPD 5F0GA 2P0XA 1F37A 2KXGA 2HNLA 1VZZA 3NX0A 2K6VA 5AYRB 3KMNA 1RN4A 2KHPA 3C73A 4G0IA 1U88A 1EG9B 4BTXA 1ZGNA 1I2EA 2AAWA 2X8GA 6GSSA 2B5EA 8CHOA 3D79A 2ES7A 1MDIA 3LXZA 5AYSC 4IP1A 3M9KA 5D96A 5LC7A 2PPTA 3F40A 3FR9A 3BU4A 2IIYA 2KCDA 2YNXA 5AIVA 5FHIA 1K9M4 5F07A 3MSZA 3GKXA 1BNEA 1RTUA 1T4ZA 2J23A 4N6OB 3DY5A 1GTUA 3H4KA 3GL5A 3TCOA 4NWYA 1AQVA 3L4NA 3AY8A 5DAKB 4L0WA 1SYXA 3UL6A 2GSSA 4MK3A 3DGYA 3CCV3 4XIHA 2FNOA 5F06A 2BT3A 1SJWA 3ZFLA 3MHEA 2LQOA 4FR9A 2WULA 5H5QA 2ZDJA 1E3VA 2W56B 2F5MA 5D73A 1DVCA 1GSYA 1UUGB 1TRUA 4MZWA 1K0BA 3KXOA 1DSBA 2E7PA 3KTLA 1FW7A 4EIPA 4EW5A 2LRCA 3C71A 1FGOA 2TRCP 3LXTA 3HZ8A 2FA4A 3MYDA 4IIAA 1SQWA 3B8LA 2OBIA 1FUSA 1VQ53 3I553 4QL9A 4N3VA 3ZMLA 2DKIA 1I8VA 2KF4A 2VD0A 3FZ9A 4MEIA 2CG0A 1VQO3 1PKWA 2JU5A 2Y73A 3ERFA 3UVHA 3O8YA 4Q5NA 1GSFA 3N9JA 4V2NA 2WGOA 1O7GB 2W9PA 4L8EA 3QAWA 3S9FA 3F7SA 2KUCA 4PNFA 5JPPA 4MLYA 5HFGA 2NVLA 3F6FA 1FUTA 2GQKA 5IM9A 2K18A 3B4PA 3UOMA 4ZB9A 2LV3A 2ZA4A 5CLKA 3UJMA 4G19A 1MDJA 2P31A 3GTUA 3BNDA 4MJAA 4N0VA 2BMQB 5D82A 2DIYA 2JACA 5IO0A 4HM8B 1TI3A 4ISDA 2CX3A 2KP2A 3DM8A 3QOUA 2GSQA 1AQWA 4K9ZA 3WT2A 4KW6A 1M9BA 1T7PB 1K0CA 1YGWA 2SBLA 2FCHA 1ZX2A 1WOUA 2HSMA 2MMOA 2HXKA 1QVF2 5KP1A 1NW2A 3RPNA 3PXMA 2E2TA 4EDZA 1M3JA 3TRQA 4DSSB 1FO5A 3CCL3 1BNGA 1VQ83 1IDPA 5ELAA 1GNEA 3TKSA 1ZOFA 2DMMA 4PGTA 4H61A 1WPIA 2QSIA 3F4TA 3EE1A 1UUWB 1GSSA 1JZRA 3NXJA 5CRWA 1XWBA 4H3UA 5FT3A 1EGOA 3GYKA 4OO5A 4PUFC 1C54A 4FMDA 1A23A 1VQP3 3FF2A 1OC9A 3EHCA 1BAOA 2GU3A 4BTYA 4J5KA 4EF0A 1XOAA 1I0VA 5GSSA 2W6JH 4YH2A 1RHLA 4RUVA 3F63A 4EC0A 1M3IA 4G2EA 2H66A 2CZ2A 3VLNA 1SK2A 4TW5A 1AV4A 5DREA 3A2VA 2SARA 1B9XC 1JKGA 3X3XA 5HGRA 2W56A 2FGXA 3UBLA 1TOFA 5CAXA 2FD3A 2X8HA 1R26A 4QQ7A 1FZUA 1RRHA 2AV4A 2WO0A 3EN1B 1K0NA 1SENA 1YVBI 1FVJA 3C1SA 4OWYA 1GY7A 4ACSA 3HD5A 3V99A 1T4YA 3ISOA 2FWFA 3PGBA 1E3RA 1BRSA 1N5PA 2LJKA 1RGLA 5IG4A 3EWLA 2IY2A 1E6BA 3CCJ3 4KGIA 2HI7A 2H75A 1J9BA 3TJBA 2A15A 5IOXA 3R3EA 3K7CA 3A5IA 4F9ZA 3GUSA 1MGWA 3MPHA 1Z1SA 4XM4A 2F8AA 3EPTA 4N30A 3HI7A 1BG5A 1X9SB 2PZVA 1GD4A 1HNCA 3V98A 2CG1A 2HOHA 2YV7A 3EBTA 2FWGA 4RZMA 4TR0A 3HYPA 3A5WA 4NPBA 1O8XA 5M19A 3EMPA 1JBRA 4X4JA 4ZIJA 1ZZYA 3DGLA 4I4KA 1XW9A 2R2JA 1AIUA 4MP4A 5ELUA 2HT9A 2I3YA 2LTKA 3QFAC 1ERWA 4V2LA 2YCDA 3CME3 2B1KA 5ECNB 1XWKA 1K734 1XXUA 3GZRA 1YEPA 3E3EA 3MWHA 1N8JA 3VWXA 2KOKA 4BVYB 2P05A 3A2XA 4PQHA 1G7OA 1F6MC 2PVQA 2I81A 3F8HA 4IT7A 3CXGA 1N9EA 1S3AA 3L78A 1M1K4 2A4HA 2JSYA 5EVOA 2IMKA 4I2UA 1M9AA 4MMMA 1GH2A 4R9KA 3FY7A 4QL7A 3LORA 3LYKA 1WMJA 3APSA 1O7UA 4XS6A 4KA0A 5ECPB 1IVVA 1YI23 3ZL5A 4L5LA 1T2IA 3GTUB 1DVDA 2VCQA 3IPTA 3H3HA 4DSQA 5IPGA 3D4TA 1FOVA 4LZIA 1ZMAA 2LJRA 1W6GA 1RNTA 3FG4A 1GWCA 3KN4A 1SL2B 3E99A 6GSYA 4DKIA 5ELJA 1EGRA 3FF0A 1RK4A 4HM4B 3HVNA 3K9MC 3EBYA 4I6XA 1G96A 3KZTA 3TJFA 5IERA 1VF4A 1SD8A 1JZDA 1W5ZA 5J5NA 4Z7XA 2GSRA 3WHOA 5DALB 1QAKA 4E8EA 4V1Ag 3A2WA 1X5EA 2XPDA 1Q824 1HYFA 3NBBA 4IJ3A 5JBSA 4POKA 3P7XA 4N6UA 1SPUA 2F86B 2CKFB 1YGEA 2FA8A 1BSDA 1F2EA 1GTBA 4N0ZA 4MF5A 4N11A 1WMOA 3CCE3 4JR4A 1S3RA 1B2MA 2OQEC 1OPYA 4HZBB 2HMLB 3K5TA 5D9TA 3HOHA 1H75A 1HNAA 1AQZA 2EC4A 4ECCA 3NIVA 1EEJA 2K3DA 4JBBA 2C0EA 2FWHA 4JR6A 3M1GA 3LSZA 3RPPA 4KFFA 1B4PA 1W4NA 3QR6A 2CX1A 1NJI4 3Q3FA 1O7MB 2DJKA 1Z9HA 3WGXA 5D81A 4NAXA 5LNKe 3GNJA 1LNHA 5IG0A 3US3A 4K7IA 4EIQA 7GSPA 1JBTA 4TR1B 6GSPA 2LYXA 2LRNA 4RBNA 1O85A 4XTSA 3IRAA 1NHYA 3IHQA 2R0CA 2WS2A 1I70A 2B1XB 1OUNA 2M7OA 3WOEB 3L0RA 2FGTA 1BQ7A 5D9XA 2P38A 3UB1A 4K7NA 4PTSA 4LLRA 5H5RA 4QWTA 1ON4A 3H1NA 1I2FA 4POMA 1BNFA 1THXA 2H71A 3ME8A 4MH3A 3LGCA 1ZYPA 2VO4A 5BU4A 4EE0A 3EC3A 3HK4A 5IW9A 1AW9A 3IK7A 2BJXA 3TJJA 16GSA 1UUVB 2L1SA 3UBKA 2V2GA 4IELA 1TK5B 1M2AA 2GSTA 4ZBBA 1BRHA 4NHZA 4HKVB 4YKGA 3KJYA 4N10A 4HYZA 4AJ6A 3CC43 2VL9A 1ABAA 5ECSA 4ZBDA 3Q1CA 2LNTA 3LXUX 5BXQA 2DLXA 2OE1A 2H6YA 4V1Ap 1GSUA 1Y25A 3FRCA 4YAPA 3G713 2XRXB 3WD6A 1XWAA 3IC4A 3ZRDA 1J08A 1URMA 5CRDA 3N9HA 2GU1A 4HM1B 2H74A 3FHKA 3NUVA 3SOAA 2JADA 3VWUA 5DJMA 1YDKA 3CCQ3 2CFKA 13GSA 1N8QA 1PYLA 1YF0A 2O7KA 6GSXA 4RNYA 1T1VA 4WEYA 1IYIA 3D4AA 1PN9A 4MJEA 1KTEA 5CF2A 3VSYA 5G31A 3S27A 3F4RA 2H70A 3O3TA 3PS8A 1Q814 2LSTA 1EV4A 4CHSA 4XDVA 1TI1A 5G5FA 4BL3A 1FUWA 1STDA 3FKFA 2WOHA 5I97A 5C04A 3GIXA 1YKAA 4FH8A 3D0ZA 2YOIA 1QK8A 2GTUA 1W7CA 5CO3A 3VF1A 4CY6A 1I3FA 1V9WA 1GLPA 2XGNA 1IK3A 2A2RA 4GLTA 4LMVA 4K1UA 2MZCA 2VIMA 3EU3A 4J9AA 4AF2A 4TXOB 2MMAA 5EEOA 2V6OA 2YWIA 3UIWA 3HJMA 1EQKA 1CEWI 18GSA 5TGNA 1WE0A 3UAPA 1PRXA 1UI7A 4WKWA 1A67A 3APQA 1M2DA 3TRXA 2RUEA 3ERGA 5A4VA 3F8XA 4PURA 3DGMA 4O02B 3CC23 1IVUA 1MD4A 2I4AA 1CYUA 2UUGC 1JN5B 3VI7A 3HIGA 1EZKA 1F9MA 4FMCA 3SVAA 2EIOA 2L5OA 1EP7A 1VQM3 3M3MA 3CXC2 3ED3A 2B7JA 2PMTA 2L6CA 6GSUA 1RCKA 1S3DA 1XBSA 3IXRA 2QGUA 1FG4A 1Q864 1XVWA 2XF3A 1UN2A 3KH9A 2LS5A 1YQ1A 1GS3A 3Q90A 1M0UA 2FHEA 2HYXA 1T2HA 2Z9SA 2H8LA 4MZCA 3CPW2 3LTBA 1Q4JA 1TRVA 1SU9A 2OCTA 2CFWA 3B4OA 4K0NA 1OF5B 3AMOB 2N5BA 3EC9A 3N54B 2KF5A 4RNTA 2E2MA 2OJLA 1QMAA 3T8UA 4TR1A 5GSPA 4CDOA 5ID2B 2M80A 2PU9C 1XW5A 3ZIVA 2D2ZA 3D21A 1E97A 3NBRA 2D42A 3ME7A 3X3ZA 3SEDA 5AIFA 2JDIH 1O7WB 5IPHA 1UW1A 4EVMA 4O2HA 2H72A 4PUAA 5ECMB 2AAEA 1N2AA 2HSHA 2J9HA 4EO3A 3BB9A 3J7Yb 2GVPA 4ECBA 3RHCA 1B2SA 2H6ZA 4HJLB 4WYKB 2R0PA 4Z2UA 3J7Yd 1TTZA 1FOHA 2R5GA 3FH1A 2Q07A 3Q6OA 4G0LA 1BNRA 1UA5A 2OACA 2BMRB 2CFLA 1A2PA 2VAFA 4I2TA 2G0FA 4GF0A 1MWUA 4HDEA 2GBXB 3ECFA 3F6DA 5DCGA 3IJEB 2O87A 4TR3A 1DUGA 3LWAA 1BSEA 2BTOT 1G7EA 3WA3A 3G4S3 1MEKA 1MTCA 1YIT3 2XEPA 3GWRA 5IMVA 1OKDA 2BO9B 1W6YA 3Q2PA 3TDGA 2FWEA 2L59A 4ECJA 2YWOA 1N5HA 4JU5A 3SX1A 2YN1A 3TOUA 1AC1A 4RNZA 3D6IA 1IU7A 1O8WA 4K1FA 1BAYA 4POBA 3MSOA 3URPA 1XZOA 4WXTA 1AAZA 1C72A 1GYBA 5IENA 1K3OA 1ML6A 3TKQA 4D73B 3IR4A 2CX4A 1M7TA 1OCVA 2BIRA 4KAEA 14GSA 2HZEB 1TU8A 3G8ZA 3IC8A 1IQXA 1YEXA 4KFEA 4O8SA 3O6TA 5D8IA 5G1KA 3IAM2 1ROAA 3QDNA 4AKYA 2REMA 5ECHB 1SD9A 1KNGA 3WYWA 3ZTLA 4EXJA 5J3RA 1B4QA 4H86A 1OH0A 3TKSE 3MIXA 2B24B 3BIRA 5M18A 1YJN3 4DVCA 2F4YA 3BD2A 1HKXA 4BL7B 1RGAA 2GT5A 1GTIA 4EYCA 3LFLA 2ZUPA 1RN7A 5INYA 2EIRA 3G7IA 2GZZA 2BNGA 2WB9A 1EOGA 2LRTA 1AVLA 4FMAA 3IA1A 5ENUA 2W2CA 2WGQA 1V74A 4XCSA 5DALA 3W6GA 1K0OA 4JZQA 1GTAA 1RGGA 4TOPA 2L4QA 3F7XA 3OX9A 1BRJA 3QMXA 1WMNA 2CK3H 1GOVA 4HM2B 1XFLA 4JEDA 4XBYA 1PFPA 5STDA 1BRIA 1ERUA 1V98A 2F9SA 3BJ5A 3UARA 4OCEA 1VF2A 2KLXA 2ZNMA 1O6JA 1ZO2A 5BIRA 4MZBA 2DJ3A 2HSYA 3VGNA 4G0KA 2IMJA 3FYGA 4GRFA 4HU9A 4X0XA 4YKFA 2K9FA 1KC84 2V41A 3HVSA 5DCHA 4L8PA 3MNGA 2HRAA 2H76A 5JCGA 2YZUA 3CCR3 3HJPA 4BVXB 4HS1A 3I9V2 4JRFA 3GSPA 1OC9B 1TJDA 3GMFA 4XBXA 3ALAA 4LA1A 3GSSA 2IA7A 3X3YA 1YJ93 1UDII 5EPFA 4MMYB 3S28A 4IQ1A 4Q53A 1Z5YE 4K8MA 5C00A 1RW1A 1E2YA 4J5GA 5G2ZA 1U6TA 5KP4A 1MWRA 3FLJA 4KDYA 6RNTA 3EF8A 1T00A 4WETA 1K28A 22GSA 2IWTA 3M8CA 5KN0A 1RDSA 2R3XA 2C3QA 4O5UA 4LGQA 2J8XB 5CP1A 5G30A 3DGOA 3LEFA 1UCJA 1PSQA 2CQ9A 2F56A 2IUKA 5RNTA 4WYKA 3EURA 3ROBA 1ST9A 3L9VA 4ML6A 4ZBAA 3GSTA 5ECQB 1TFOA 1DMMA 1CQHA 2DJ0A 4GHOA 3D5IA 4EDYA 2H30A 1MNLA 5AGYA 5ECIB 3PZWA 1JKGB 3FSDA 4EBGA 1UCLA 2C4JA 5ECKB 4KUNA 2HMNB 2RBIA 5HQPA 2LEGA 3KP8A 3DMLA 3NOFA 3G7YA 1K0AA 1R5PA 3KGKA 2KP1A 3GZBA 5HOHA 2VCVA 4BIKA 3CPOA 5IIZA 2E2UA 2L4VA 1FW1A 3SYUA 3FZ4A 4IHUA 4HM3B 1V58A 1FB0A 4KB3A 4N6LA 4HSCX 1RMSA 5LCZA 2MBTA 1ULJB 3H79A 1QALA 2H0HA 3EE2A 1GY6A 3DYRA 1SARA 4TXOA 4ZILA 1Y4KA 1MWSA 1FYSA 2GXFA 3G6E3 1EP8A 3ER7A 4IN0A 3IDVA 1UC7A 1IYHA 4FCJA 4CPKA 1BUJA 2OA7A 2B3SA 3OXAA 3TJKA 2Z6BA 1EEMA 3KP9A 3UMAA 1NWWA 4NV2A 2F3MA 4WHAA 1TRSA 3ZVJD 1QUWA 2YZHA 3F8UA 5B8BA 5G1LA 2X49A 1X1XA 2C8UA 4IBPA 9RNTA 1UI8A 2RCDA 2X8CA 2OE0A 2XFSA 3BOAA 1R4WA 3I6AA 1B3SA 3CRUA 1UGHI 1RN1A 4MH2A 3WGDA 5D9VA 2CT6A 4PNGA 4EXRA 3UL5A 1Q40B 3JCML 2DKHA 1FGQA 1AQXA 1NB3I 4WF4A 1RGEA 4O5QA 2I1UA 1GSEA 5ECLB 4K5RA 3QAGA 3NV0B 2CV4A 3DZLA 3V1WA 2IL3A 2I9WA 4NHWA 4IP6A 4WWUC 5DJLA 2ZCTA 4OFTA 1GD3A 4I8BA 1ULIB 1I5GA 2QA2A 2GZYA 3FW2A 4HM6B 1LVNA 2XSHB 4XRDA 2XSOB 3BCIA 2HZFA 3GFKA 2NTOA 3F3RA 1CH0A 2HMOB 1GNWA 2VCZA 1TW9A 5JCUA 1DE2A 3WOFB 4PQ1A 1XPVA 3K0ZA 3OWUA 11GSA 3DGNA 4HVNA 2HFDA 4FYUA 1FGRA 4RI6A 2H6XA 2EIQA 2XGLA 2R0GA 3ZREA 3F4SA 4NV5A 1PN0A 1F8NA 3FCSB 3IHGA 3HY2A 2C0FA 1TUHA 2VM1A 2B5YA 5CXOA 2C3TA 2IN3A 3PPUA 3V92A 1U8CB 1B9YC 2PERA 2N5AA 2PVOC 1TRWA 3DWVA 4G9HA 3EINA 4BPYA 5EVHA 1A90A 3HIIA 2YWMA 1JZOA 4BWSA 4HBRA 4K7OA 2YPMA 2JQ5A 2L6DA 4F0CA 1Q42A 5E4WA 2GQLA 1W02A 1D6YA 2E0QA 3MG1A 2XPEA 1ERVA 4IKHA 3DIEA 4RQRA 2W9QA 2HMJB 1NO3A 3CTFA 1TDIA 2ZHXB 1NU3A 1W2B2 1G6YA 1SK1A 2NBSA 2AB6A 2PGTA 3OR5A 1WJKA 1WWJA 4ZL8A 1MD3A 2MF7A 1I0XA 2AHEA 2H73A 1GSQA 4X43A 1OC8A 4F03A 3L0HA 4L0UA 5LD0A 2H01A 4TKYA 3JVCA 3LOYA 4ID0A 2UZ8A 1S3CA 2YWNA 1UCIA 2PN8A 2GEYA 2IMFA 5AEUB 3LTCA 4KSMA 4CCVA 3X40A 3ZFZA 1FVKA 1M99A 1DMNA 2F51A 4L8OA 1VQ73 1PX6A 4DSRA 3WODG 4ILFA 1IQYA 2H1GA 3F0IA 4AGSA 1GSDA 5CNWA 4YQUA 1I2GA 1TXXA 2E2VA 4CW9A 1BJXA 1Q7Y4 1Z6NA 4MABA 3HVVA 5IG3A 5IG5A 2VLUA 3TUEA 1F3AA 5AIXA 1ASKA 1ZYEA 4OCFA 2B1LA 2AADA 3CSHA 3FMWA 3RGAA 1WQLB 4HOHA 1BNSA 2CVBA 1BUQA 4IQAA 1BRGA 2GSPA 1D6UA 1Q40A 3GX0A 4E8HA 1BNJA 5BVBA 3FEUA 3FZAA 2WOFA 4ORLA 2KRTA 2NDOA 4Q5QA 3D9RA 2MMZA 3CSJA 2HMMB 5E59A 4R4KA 1QVG2 4N6V0 2C80A 2STDA 2WZ9A 1GUMA 1Z3EA 3PCRA 4BL2A 1GSPA 1M9GA 1X9MB 4J57E 1WP0A 2B6MA 3PINA 2JZRA 3UVTA 3UNLA 3M8NA 1OE8A 2KF3A 2O9UX 3KSPA 2B5XA 4OVMA 2DBCA 1ZGXA 3ZVJA 4R1KA 4PXOA 2WJUA 1JFUA 4WFOA 2DMLA 1RQMA 4OUQA 1KD14 1A2MA 2GS3A 1HYUA 2OTJ3 4PX1A 3J7Yk 5CRHA 3P90A 2H1BA 3KD0A 4N6NB 1AUCA 1VF3A 2INXA 2UGIA 5AEWB 3U6VA 1W01A 1LQMB 1F3BA 2B7KA 4EV5A 6GSVA 5IMCA 3W8JA 2R6KA 3A76A 3CU3A 2FY6A 2VCTA 2XBIA 2XBQA 3IE3A 3VPQA 1R7HA 4D73A 3I69A 1SYRA 4KDUA 1TTOA 1K41A 1BIRA 5EQLA 4K1VA 4EUYA 2H1DA 4XB5A 5M1AA 2QC7A 1Z7RA 3BNCA 2XHFA 3FKAA 1UGIA 2F99A 3EMXA 1THOA 4X2OA 4BTWA 1A2VA 1ERTA 4GQCA 1MDKA 1X0RA 1LQGC 4POLA 1BANA 3DH2A 3AMOA 3BCKA 3RNTA 2P0GA 4IVFA 3WA2X 4MF6A 4IS0A 7RNTA 1JB2A 3RAZA 4U13A 1V57A 2LQVA 4J2FA 1OKTA 1K3YA 2CVDA 4X2HA 2MMNA 5IMZA 5AIIA 1HNBA 3ZLPA 2RLIA 1TKDB 4BA7A 4L7KA 2R4IA 3F14A 2FNQA 3IV4A 1TFKA 2RM6A 3EYTA 3C8EA 3CCU3 2OADA 3T0UA 2VUPA 5EL8A 4RI7A 2HE3A 1SJIA 3S5CA 2L4CA 3GH6A 3VWVA 4BWQA 2DSAA 3P8WA 2CWUA 3LW9A 4ZB8A 1WNHA 2PNCA 4LL4B 1YNVX 3L9SA 4J56E 1BEDA 3JUMA 4RQXA 4OMVA 5ABRA 1IVWA 5EY6A 5DAKA 4TX4A 2RUFA 4HAAA 4JRRA 1BGSA 1GUHA 3KFQC 3EVIA 4KT3B 7STDA 2QEX3 4IW9A 3IOSA 1HD2A 3IK9A 20GSA 3WR2A 1PY3A 4O32A 1BOXA 1KEBA 3D4MA 5ECOB 1G0TA 4HEA2 3TOTA 3BLZA 1EV9A 1VF1A 3TKSC 4FCZA 5DRVA 1XCCA 3QD9A 1U3AA 1LOYA 3NM2A 3GKKA 4IJIA 4USSA 2RSXA 1YJ6A 1GOUA 3LG6A 1S723 1JHBA 3G16A 3BBYA 1SL1B 3ZIJA 2WDUA 2DJ2A 2M72A 4LEHA 3SXXA 5BRTA 1Q9EA 4KX4A 3FR6A 3LQ7A 2C3NA 1B2ZA 4F0BA 2OE3A 1OYJA 3HVXA 3HJOA 1CYVA 1NDOB 7GSSA 2VL3A 5DVBA 4MMXB 2WCIA 3VI5A 1YZXA 5IMAA 2UX0A 2CVKA 4R9LA 5JWOB 4GSTA 2E2GA 3I0YA 1QXHA 2GLRA 1XWGA 4N6MA 3MAKA 4ZL9A 5B6NA 1WIKA 2FUG2 1PFOA 2O8VB 3D5GA 3G7JA 4KDXA 1B21A 2OOVA 3GURA 1XWCA 4MA9A 2ZL8A 4NHFA 1GL8A 4GCIA 2QKEA 1W6CA 5B8AA 3FK8A 3HCZA 3LZAA 5GZZB 4NREA 5J9CA 1YF1A 5D9WA 1VQ63 3VWWA 2XR8B 2OTL3 3K8NA 2R37A 4K61A 3E9JB 1JZWA 4XDWA 2A2PA 5BMUA 1VQL3 1OVNA 1CQSA 5KOWA 2CH9A 1N8R4 1W4VA 2VM2A 1T3BA 5L71A 4MJDA 2VLTA 1RGCA 3BNBA 4TR4A 4O7HA 1Y6EA 2A2SA 2IJYA 3CMA3 4K90B 3IBHA 1NM3A 5DQSA 4XS4A 4MPGA 5CK6A 2V6KA 3ZG0A 1ZCPA 1VQQA 2G2QA 1ZS7A 1VQN3 3HZ4A 2P5RA 3DVXA 3VURA 2VCXA 4Q5FA 2LKUA 2YFLB 4IGJA 2DC5A 1IVXA 1K3LA 4ZL7A 1YKCA 1LOWA 3GN3A 1GMQA 1BSBA 3QAVA 4OFNA 2YANA 1JBSA 2O85A 4MF7A 4AEQA 4K2DA 5GAND 1TU7A 3KSED 2H0IA 2K54A 3MG3A 1O73A 4WBRD 3Q19A 4G10A 3LTAA 4GTUA 1BRKA 2W03A 5HR3A 6GSTA 4HM5B 3C7MA 4TRXA 1S5AA 2C10A 3F9SA 5D93A 3STDA 4MJCA 1JLWA 4FYBA 1G02A 2IUJA 3GAXA 3FGYA 3ZMKA 5KOXA 2LQQA 4OD7A 3DVWA 3EJVA 1X5DA 1A0RP 2DJJA 1BRNL 4YAVA 1MOLA 4BVXA 2CZ3A 1IV7A 2VLVA 3SWLA 4YQVA 3HDCA 4Q5RA 5F8BA 1SKRB 4KF9A 2VL2A 4KVHA 3FG1A 3A3TA 1OHPA 2KF6A 3NZNA 3KE7A 1SK0A 1XVQA 3Q18A 1HQOA 3KCMA 4PQIA 2JL4A 3R2QA 2CX0A 1QAFA 4LMWA 1PU4A 1XW6A 4HM0B 3RDWA 3L9UA 3RBTA 8RNTA 1BNIA 1K0DA 3DKSA 5G5EA 1PX7A 1FGTA 3GHAA 2RNTA 3KEBA 5AIHA 3UL3A 5IF6A 1G6WA 4STDA 3SOYA 1ZL9A 3GRDA 3U5RE 3KMOA 1V2AA 2LNSA 1BSAA 2N5FA 1LU4A 4DEJA 2MYGA 2X99A 1JV2B 4O92A 3X42A 1USBA 1FGMA 1PL2A 5JWQB 1OHSA 1ZYQB 1AY7A 1EOHA 2FXTA 1VRSD 3JUQA 2Z7AA 3F9UA 1ACVA 1PA3A 1OC3A 1QMVA 1AR0A 2H19A 3KCHA 1GUKA 1PKZA 4WR4A 3DEXA 4HZ2A 1I9DA 1R4CA 4NXIA 2DIZA 1YHQ3 3MDKA 4ZM8A 1DE1A 1O7NB 2CC3A 5G2GA 4BIRA 2YFIB 2VD1A 1X5CA 3P2AA 4K0GA 2HRKA 1U5OA 4GXZA 1FA3A 3AHSA 4BU4A 2OOVC 3D3LA 1TIJA 3JUOA 4GSNA 1L5GB 2I9HA 4JF8A 1H4OA 5KN1A 1X1YA 2Z76A 3X41A 3GKNA 2F5WA 1SL0B 3H51A 5CF1A 5HFKA 1W00A 1RGHA 2R4VA 4TVEA 2H0GA 5FGOA 3CNXA 3TRPA 1W89A 2QA43 2P0MA 4JE1A 3PYJA 1KWIA 1LBKA 3UEMA 4Z2RA 2W0QA 1EA2A 5ECRB 5J9BA 3EN8A 3VK9A 3AGOA 2GGTA 3QFBC 2F8FA 1DYUA 2L5LA 2CAQA 3WMDA 4HU7A 2BU4A 3MYTA 3KH7A 1RSNA 3TJGA 4XS1A 4EL1A 1ISKA 2YFJB 3MG2A 3DXBA 4KCAA 4HI7A 1OGXA 4KZ1A 4XHMA 2KAAA 2CAIA 1IT8A 1U87A 4XRAA 5JCWA 1VQ43 2C0DA 3JUNA 5JWRB 3D5JA 4A5PA 2FLSA 12GSA 3N5OA 4YQMA 4KNDA 3EB8A 3I43A 2VCWA 3M9JA 1WMPA 2IPAA 4ZB6A 4F82A 2CHCA 2CWTA 2V1MA 1RGFA 3HXSA 5IEOA 2BHMA 2M46A 1O81A 3AHWA 3GZXB 1DE3A 1GMRA 1Z6MA 3KZQA 2K0MA 4HUAA 19GSA 5LC6A 1TP9A 1RKYA 5IOWA 3GH9A 3RDEA 1FAAA 1PQNA 5H5SA 4OFMA 4XBTA 1D6ZA 1B2UA 2OWPA 4K5SA 1VQ93 5KP3A 3CTGA 1QFNA 2C4BA 3ZG5A 4FCMA 4TXVA 3SBCA 4PEJA 1BU4A 2DJ1A 1CQGA 5A0OB 1STFI 3NQZA 3H93A 3T8NA 3IPZA 1R5AA 4HJMA 3EX9A 1OE7A 1PMTA 4KFDA 3APOA 5IMDA 5J41A 1T5YA 2CFDA 4FQUA 3OW22 1A2KA 3CRTA 1GRXA 4WF5A 2YV9A 2CWVA 1X1UA 2C11A 3LJRA 3O76A 1SJ6A 2HMKB 2OBKA 1XOBA 1PGTA 3N8BA 1KQS2
chains in the Genus database with same CATH topology
4AJ8A 1Q98A 2TIRA 1PD21 2HRNA 3QCPA 4CY8A 2A4VA 2K8VA 3DD3A 3GX8A 3CMIA 1FHEA 3CBUA 2X4AA 3EU4A 2H1AA 3F3QA 5IQYA 5FWGA 5B7CA 3ZZXA 3WGEA 5CYYA 3GV1A 2GDRA 1J0FA 4HQZA 2V32A 2IMDA 1A24A 2AYTA 4NMUA 4ML1A 3WT1A 4BVYA 1TK0B 1EWXA 4K6XA 3TKRA 1YY7A 1Z7PA 5IO2A 3VFIA 2JZTA 3TB2A 3FZ5A 2C1YA 2YJ7A 3FR3A 1A8LA 2VOCA 1B48A 5A4UA 3ZFBA 5B6MA 3DGQA 1GLQA 3DRNA 2YP6A 1GULA 2AUVA 3TKPA 5GSTA 4FYCA 4OO4A 1KBNA 3CSIA 4L5OA 4I97A 4HQSA 5HR2A 4DSSA 1NSWA 3M0FA 5HR0A 1DBYA 2K8SA 4HZ4A 4KSOA 2WRTA 4EKZA 3GL3A 5A4WA 3HHVA 2IFQA 2NPBA 3RHBA 1M2BA 5CREA 9GSSA 5DBQA 3QPMA 3GRXA 4MNNA 4ULXA 2PBJA 4ICYA 2LJAA 4I5QA 1NHOA 2MBSA 4MJBA 2IYJA 2L57A 4LL1B 17GSA 2IMEA 1A2LA 4TN8A 2JSZA 3UJ1A 2WGRA 2HRFA 3KIJA 4O5RA 1VGLA 3LYPA 3ZITA 3VPTA 3GKMA 5KN3A 1B8XA 2O89A 4WBJA 1SJZA 4GQFA 4HOJA 5AN1A 2GQMA 4XS4B 2ALBA 3ERWA 5ID2A 3E0UA 1BX9A 1T8EB 1OAZA 1A8YA 2PUKC 5DQYA 4KCEA 5AISA 1GP1A 4WR5A 1SKSB 2OKAA 4ECIA 5HR1A 2TRXA 3TGZA 3HKRA 5J4UA 5A5KA 2YJHA 3KTBA 1U3IA 2CA8A 3H8QA 4FO5A 2XC2A 2RM5A 4MDCA 6GSWA 4MCUA 1X9WB 1AXDA 2JZSA 3C1RA 1SKWB 1A0FA 4GWRA 1A2JA 3PGTA 4BL7A 4K2XA 2WFCA 4F2IA 2BMXA 3IAS2 5KN2A 1ZYNA 2QGVA 3CYNA 5DDLA 5HFIA 4X1UA 3Q74A 10GSA 2GT6A 1BYEA 1QQ2A 5IMFA 3D22A 2VL2C 3GA4A 2IFQB 5CRGA 1V40A 2X64A 1TK8B 3G9BA 2HZEA 2RIIA 1FB6A 2GZPA 2C0GA 4ZXGA 4Z2TA 2LUSA 4MPFA 3PH9A 4GSSA 5COHA 4V2MA 2AJQB 8GSSA 1WRYA 3KM6A 3PR8A 4AJ7A 1QGVA 4P3YB 2IMIA 2QA1A 1ILOA 2HLSA 3ZYWA 4HJ2A 1UVZA 1JLVA 4FIWA 3W8SA 2P5QA 2ON7A 4KH7A 2PWJA 1XIYA 1K0MA 2ON5A 1PL1A 1LJRA 5ELGA 3HA9A 5F05A 5KEJA 4KE3A 5GAPD 5F0GA 1F37A 2HNLA 2K6VA 3KMNA 2KHPA 3C73A 4G0IA 1U88A 1ZGNA 2AAWA 2X8GA 6GSSA 2B5EA 2ES7A 1MDIA 3LXZA 4IP1A 5D96A 3M9KA 2PPTA 3FR9A 2IIYA 2YNXA 5AIVA 5FHIA 5F07A 3MSZA 3GKXA 2J23A 1T4ZA 1GTUA 3H4KA 3GL5A 3TCOA 4NWYA 1AQVA 3L4NA 3AY8A 5DAKB 4L0WA 1SYXA 4MK3A 2GSSA 4XIHA 2FNOA 5F06A 3ZFLA 2LQOA 2WULA 5H5QA 5D73A 1GSYA 1TRUA 4MZWA 1K0BA 3KXOA 1DSBA 2E7PA 3KTLA 4EIPA 2LRCA 3C71A 2TRCP 3LXTA 3HZ8A 2FA4A 3MYDA 2OBIA 4QL9A 3ZMLA 2DKIA 2VD0A 3FZ9A 1PKWA 2JU5A 3ERFA 3UVHA 4Q5NA 1GSFA 3N9JA 4V2NA 4L8EA 3QAWA 3S9FA 2KUCA 4PNFA 4MLYA 5HFGA 2NVLA 3F6FA 2GQKA 5IM9A 2K18A 3UOMA 4ZB9A 2LV3A 4G19A 1MDJA 2P31A 3GTUA 4MJAA 4N0VA 2DIYA 2JACA 5IO0A 1TI3A 4ISDA 2CX3A 2KP2A 3QOUA 2GSQA 1AQWA 4K9ZA 3WT2A 4KW6A 1M9BA 1T7PB 1K0CA 2FCHA 1WOUA 2HSMA 2MMOA 2HXKA 3RPNA 1NW2A 4EDZA 3TRQA 4DSSB 1FO5A 3TKSA 5ELAA 1GNEA 1ZOFA 2DMMA 4PGTA 1WPIA 2QSIA 3F4TA 1GSSA 1JZRA 5CRWA 1XWBA 5FT3A 1EGOA 3GYKA 4OO5A 4PUFC 1A23A 1OC9A 4EF0A 1XOAA 5GSSA 4YH2A 4RUVA 3F63A 4EC0A 4G2EA 2H66A 2CZ2A 3VLNA 1SK2A 4TW5A 3A2VA 1B9XC 2FGXA 3UBLA 1TOFA 5CAXA 2FD3A 2X8HA 1R26A 4QQ7A 2AV4A 1K0NA 1SENA 1FVJA 3C1SA 4OWYA 4ACSA 3HD5A 1T4YA 3ISOA 2FWFA 2LJKA 3EWLA 2IY2A 1E6BA 4KGIA 2HI7A 2H75A 1J9BA 3TJBA 5IOXA 3R3EA 3A5IA 4F9ZA 3GUSA 2F8AA 3EPTA 4N30A 1BG5A 1X9SB 1HNCA 2YV7A 2FWGA 4TR0A 3HYPA 3A5WA 4NPBA 1O8XA 3EMPA 4X4JA 4ZIJA 1ZZYA 2R2JA 1XW9A 1AIUA 4MP4A 2HT9A 2I3YA 2LTKA 3QFAC 1ERWA 4V2LA 2YCDA 2B1KA 5ECNB 1XWKA 1XXUA 1YEPA 3E3EA 3MWHA 1N8JA 3VWXA 2KOKA 4BVYB 3A2XA 4PQHA 1G7OA 1F6MC 2PVQA 2I81A 3CXGA 1S3AA 3L78A 2A4HA 2JSYA 5EVOA 2IMKA 4I2UA 1M9AA 4MMMA 1GH2A 3FY7A 4QL7A 3LORA 3LYKA 1WMJA 3APSA 1O7UA 4XS6A 4KA0A 5ECPB 3ZL5A 4L5LA 3GTUB 2VCQA 4DSQA 5IPGA 3D4TA 1FOVA 1ZMAA 2LJRA 1GWCA 1SL2B 6GSYA 1EGRA 1RK4A 4I6XA 3TJFA 1VF4A 1SD8A 1JZDA 5J5NA 4Z7XA 2GSRA 5DALB 4E8EA 4V1Ag 3A2WA 1X5EA 2XPDA 4IJ3A 4POKA 3P7XA 2FA8A 1F2EA 1GTBA 4N0ZA 4MF5A 4N11A 4JR4A 5D9TA 1H75A 1HNAA 2EC4A 4ECCA 3NIVA 1EEJA 4JBBA 2C0EA 2FWHA 4JR6A 3M1GA 3LSZA 3RPPA 1B4PA 3QR6A 2DJKA 1Z9HA 3WGXA 4NAXA 5LNKe 3GNJA 3US3A 4K7IA 4EIQA 4TR1B 2LRNA 1O85A 4XTSA 3IRAA 1NHYA 3IHQA 2R0CA 2WS2A 1BQ7A 5D9XA 4K7NA 4PTSA 4LLRA 5H5RA 1ON4A 3H1NA 4POMA 1THXA 2H71A 3ME8A 4MH3A 3LGCA 1ZYPA 2VO4A 4EE0A 3EC3A 1AW9A 3IK7A 2BJXA 3TJJA 16GSA 3UBKA 2V2GA 4IELA 1TK5B 1M2AA 2GSTA 4ZBBA 4NHZA 4YKGA 3KJYA 4N10A 4AJ6A 2VL9A 1ABAA 5ECSA 4ZBDA 2LNTA 2DLXA 2OE1A 2H6YA 4V1Ap 1GSUA 1Y25A 3FRCA 4YAPA 3WD6A 1XWAA 3IC4A 3ZRDA 1J08A 1URMA 5CRDA 2H74A 3FHKA 2JADA 3VWUA 5DJMA 1YDKA 13GSA 1YF0A 2O7KA 6GSXA 1T1VA 4WEYA 1IYIA 1PN9A 4MJEA 1KTEA 5G31A 3F4RA 2H70A 3O3TA 2LSTA 1EV4A 4CHSA 1TI1A 5G5FA 3FKFA 5C04A 3GIXA 1YKAA 4FH8A 3D0ZA 2YOIA 1QK8A 2GTUA 5CO3A 4CY6A 1V9WA 1GLPA 2A2RA 4GLTA 4LMVA 2MZCA 2VIMA 3EU3A 4AF2A 4TXOB 2MMAA 2V6OA 2YWIA 3UIWA 3HJMA 18GSA 1WE0A 3UAPA 1PRXA 4WKWA 3APQA 1M2DA 3TRXA 2RUEA 3ERGA 5A4VA 4PURA 1MD4A 2I4AA 3VI7A 1EZKA 1F9MA 2EIOA 2L5OA 1EP7A 3M3MA 3ED3A 2B7JA 2PMTA 2L6CA 6GSUA 1S3DA 1XBSA 3IXRA 1FG4A 1XVWA 1UN2A 3KH9A 2LS5A 1YQ1A 1M0UA 2FHEA 2HYXA 2Z9SA 2H8LA 4MZCA 1Q4JA 1TRVA 1SU9A 4K0NA 2N5BA 2E2MA 2OJLA 4TR1A 4CDOA 5ID2B 2M80A 2PU9C 1XW5A 3ZIVA 2D2ZA 3D21A 3ME7A 5IPHA 4EVMA 2H72A 4PUAA 5ECMB 1N2AA 2HSHA 2J9HA 4EO3A 3J7Yb 2GVPA 4ECBA 3RHCA 2H6ZA 2R0PA 4Z2UA 1TTZA 1FOHA 2R5GA 3Q6OA 4G0LA 1UA5A 2OACA 2VAFA 4I2TA 2G0FA 4GF0A 4HDEA 3F6DA 5DCGA 2O87A 4TR3A 1DUGA 3LWAA 2BTOT 1G7EA 1MEKA 1MTCA 5IMVA 1OKDA 4ECJA 2FWEA 3TDGA 2L59A 2YWOA 4JU5A 2YN1A 3TOUA 1AC1A 3D6IA 1O8WA 4K1FA 1BAYA 4POBA 1XZOA 4WXTA 1AAZA 1C72A 1K3OA 1ML6A 3TKQA 4D73B 3IR4A 2CX4A 1M7TA 4KAEA 14GSA 2HZEB 1TU8A 3IC8A 1YEXA 3O6TA 5D8IA 5G1KA 3IAM2 3QDNA 2REMA 5ECHB 1SD9A 1KNGA 3WYWA 3ZTLA 4EXJA 5J3RA 1B4QA 4H86A 3TKSE 3MIXA 4DVCA 3BD2A 4BL7B 2GT5A 1GTIA 3LFLA 2ZUPA 5INYA 2EIRA 3G7IA 2GZZA 2WB9A 1EOGA 2LRTA 3IA1A 5ENUA 4XCSA 5DALA 3W6GA 1K0OA 4JZQA 1GTAA 4TOPA 2L4QA 3QMXA 1XFLA 4JEDA 1V98A 1ERUA 2F9SA 3BJ5A 3UARA 4OCEA 1VF2A 2KLXA 2ZNMA 1O6JA 4MZBA 2DJ3A 2HSYA 4G0KA 3FYGA 4GRFA 4HU9A 4X0XA 4YKFA 2K9FA 2V41A 3HVSA 5DCHA 3MNGA 2HRAA 2H76A 5JCGA 2YZUA 3HJPA 4BVXB 4HS1A 3I9V2 1OC9B 1TJDA 3GMFA 4LA1A 3GSSA 5EPFA 4IQ1A 1Z5YE 4K8MA 5C00A 1RW1A 1E2YA 5G2ZA 1U6TA 4KDYA 1T00A 4WETA 2IWTA 22GSA 5KN0A 2R3XA 2C3QA 4O5UA 5CP1A 5G30A 3LEFA 1PSQA 2CQ9A 3L9VA 3EURA 1ST9A 4ML6A 4ZBAA 3GSTA 5ECQB 1CQHA 2DJ0A 4EDYA 2H30A 5AGYA 5ECIB 2C4JA 5ECKB 4KUNA 5HQPA 2LEGA 3KP8A 3DMLA 3NOFA 3G7YA 1K0AA 1R5PA 3KGKA 2KP1A 2VCVA 5IIZA 1FW1A 3FZ4A 4KB3A 4IHUA 1V58A 1FB0A 5LCZA 2MBTA 3H79A 2H0HA 3EE2A 3DYRA 4TXOA 4ZILA 1EP8A 4IN0A 3IDVA 1UC7A 1IYHA 2OA7A 2B3SA 3TJKA 1EEMA 3KP9A 3UMAA 4NV2A 2F3MA 1TRSA 3ZVJD 1QUWA 2YZHA 3F8UA 5B8BA 5G1LA 2X49A 2C8UA 4IBPA 2X8CA 2OE0A 3I6AA 3BOAA 1R4WA 3CRUA 4MH2A 3WGDA 5D9VA 2CT6A 4PNGA 3JCML 2DKHA 1AQXA 4WF4A 4O5QA 2I1UA 1GSEA 5ECLB 4K5RA 3QAGA 2CV4A 3V1WA 2IL3A 4NHWA 4IP6A 5DJLA 2ZCTA 4OFTA 4I8BA 1I5GA 2QA2A 2GZYA 3FW2A 4XRDA 3BCIA 2HZFA 3GFKA 2NTOA 3F3RA 1GNWA 2VCZA 1TW9A 5JCUA 1DE2A 4PQ1A 1XPVA 11GSA 2HFDA 4FYUA 4RI6A 2H6XA 2EIQA 2R0GA 3ZREA 3F4SA 4NV5A 1PN0A 3IHGA 3HY2A 2C0FA 2VM1A 2B5YA 2C3TA 2IN3A 3PPUA 1B9YC 2PERA 2N5AA 2PVOC 1TRWA 3DWVA 4G9HA 3EINA 4BPYA 2YWMA 1JZOA 4BWSA 4K7OA 2YPMA 2L6DA 4F0CA 5E4WA 2GQLA 2E0QA 2XPEA 1ERVA 4IKHA 3DIEA 4RQRA 3CTFA 1TDIA 1G6YA 1SK1A 2NBSA 2AB6A 2PGTA 3OR5A 1WJKA 1WWJA 4ZL8A 1MD3A 2AHEA 2H73A 1GSQA 4X43A 1OC8A 4F03A 3L0HA 4L0UA 5LD0A 2H01A 4TKYA 4ID0A 2UZ8A 1S3CA 2YWNA 2PN8A 2IMFA 4KSMA 1FVKA 2F51A 1M99A 1PX6A 4DSRA 4ILFA 2H1GA 3F0IA 4AGSA 1GSDA 5CNWA 4YQUA 1TXXA 4CW9A 1BJXA 1Z6NA 4MABA 3HVVA 2VLUA 3TUEA 1F3AA 5AIXA 1ZYEA 4OCFA 2B1LA 3CSHA 3FMWA 2CVBA 4IQAA 4E8HA 3GX0A 3FEUA 3FZAA 2NDOA 4Q5QA 2MMZA 3CSJA 5E59A 2C80A 2WZ9A 1GUMA 1Z3EA 1X9MB 4J57E 1WP0A 2B6MA 3PINA 2JZRA 3UVTA 3M8NA 1OE8A 2B5XA 2DBCA 3ZVJA 4PXOA 2WJUA 1JFUA 2DMLA 1RQMA 1A2MA 2GS3A 1HYUA 4PX1A 3J7Yk 5CRHA 3P90A 2H1BA 3KD0A 1AUCA 1VF3A 3U6VA 6GSVA 1F3BA 2B7KA 5IMCA 3W8JA 2R6KA 2FY6A 2VCTA 2XBIA 2XBQA 3IE3A 3VPQA 1R7HA 4D73A 3I69A 1SYRA 4KDUA 4EUYA 2H1DA 2QC7A 1Z7RA 2XHFA 3EMXA 1THOA 1ERTA 4GQCA 1MDKA 1X0RA 4POLA 3BCKA 2P0GA 4IVFA 4MF6A 4IS0A 3RAZA 1V57A 4J2FA 1OKTA 1K3YA 2CVDA 2MMNA 5IMZA 1HNBA 3ZLPA 2RLIA 1TKDB 4BA7A 3IV4A 3EYTA 2RM6A 3C8EA 2OADA 2VUPA 5EL8A 4RI7A 2HE3A 1SJIA 2L4CA 3GH6A 3VWVA 4BWQA 2DSAA 3P8WA 3LW9A 4ZB8A 4LL4B 3L9SA 4J56E 1BEDA 4RQXA 4OMVA 5ABRA 5EY6A 5DAKA 2RUFA 4JRRA 1GUHA 3EVIA 4IW9A 3IOSA 1HD2A 3IK9A 20GSA 4O32A 1KEBA 3D4MA 5ECOB 1G0TA 4HEA2 3TOTA 1EV9A 1VF1A 3TKSC 1XCCA 3QD9A 1U3AA 3GKKA 4IJIA 4USSA 1YJ6A 3LG6A 1JHBA 3BBYA 1SL1B 3ZIJA 2WDUA 2DJ2A 2M72A 5BRTA 4KX4A 3FR6A 3LQ7A 2C3NA 4F0BA 2OE3A 1OYJA 3HVXA 3HJOA 7GSSA 2VL3A 5DVBA 2WCIA 3VI5A 1YZXA 5IMAA 2CVKA 5JWOB 4GSTA 2E2GA 1QXHA 2GLRA 1XWGA 3MAKA 4ZL9A 5B6NA 1WIKA 2FUG2 2O8VB 3G7JA 4KDXA 3GURA 1XWCA 4MA9A 1GL8A 4GCIA 2QKEA 5B8AA 3FK8A 3HCZA 5GZZB 5J9CA 1YF1A 5D9WA 3VWWA 3K8NA 2R37A 3E9JB 1JZWA 2A2PA 5BMUA 1OVNA 5KOWA 2VM2A 1W4VA 1T3BA 5L71A 2VLTA 4TR4A 4O7HA 1Y6EA 2A2SA 2IJYA 3IBHA 1NM3A 5DQSA 4XS4A 4MPGA 2V6KA 1ZCPA 2G2QA 3HZ4A 2P5RA 3DVXA 3VURA 2VCXA 4Q5FA 2LKUA 4IGJA 2DC5A 1K3LA 4ZL7A 1YKCA 3GN3A 3QAVA 4OFNA 2YANA 2O85A 4MF7A 4K2DA 5GAND 1TU7A 2H0IA 1O73A 4WBRD 3Q19A 4G10A 4GTUA 5HR3A 6GSTA 3C7MA 4TRXA 5D93A 4MJCA 1JLWA 4FYBA 3ZMKA 5KOXA 2LQQA 4OD7A 3DVWA 1X5DA 1A0RP 2DJJA 4YAVA 4BVXA 2CZ3A 2VLVA 3SWLA 4YQVA 3HDCA 4Q5RA 5F8BA 1SKRB 4KF9A 2VL2A 3A3TA 3NZNA 1SK0A 1XVQA 3Q18A 1HQOA 3KCMA 4PQIA 2JL4A 3R2QA 4LMWA 1XW6A 3RDWA 3L9UA 3RBTA 3DKSA 1K0DA 5G5EA 1PX7A 3UL3A 3GHAA 3KEBA 1G6WA 1ZL9A 3U5RE 3KMOA 1V2AA 2LNSA 2N5FA 1LU4A 4DEJA 2MYGA 2X99A 4O92A 1USBA 1PL2A 5JWQB 1ZYQB 1EOHA 1VRSD 3F9UA 1ACVA 1PA3A 1OC3A 1QMVA 2H19A 1GUKA 1PKZA 4WR4A 3DEXA 4HZ2A 1I9DA 4NXIA 2DIZA 3MDKA 1DE1A 2VD1A 1X5CA 3P2AA 4K0GA 2HRKA 4GXZA 4GSNA 2I9HA 1H4OA 5KN1A 3GKNA 1SL0B 5HFKA 2R4VA 4TVEA 2H0GA 3TRPA 1W89A 4JE1A 1LBKA 3UEMA 4Z2RA 5ECRB 5J9BA 3VK9A 2GGTA 3QFBC 2F8FA 2L5LA 2CAQA 4HU7A 3KH7A 3TJGA 4XS1A 4EL1A 3DXBA 4KCAA 4HI7A 4XHMA 2CAIA 1U87A 5JCWA 4XRAA 2C0DA 5JWRB 3D5JA 4A5PA 2FLSA 12GSA 3N5OA 4YQMA 4KNDA 3I43A 2VCWA 3M9JA 2IPAA 4ZB6A 4F82A 2V1MA 3HXSA 2M46A 1O81A 1Z6MA 3KZQA 4HUAA 19GSA 1TP9A 5IOWA 3GH9A 1FAAA 1PQNA 5H5SA 4OFMA 4K5SA 3CTGA 1QFNA 4TXVA 3SBCA 2DJ1A 1CQGA 3H93A 3IPZA 1R5AA 4HJMA 1OE7A 1PMTA 5IMDA 3APOA 5J41A 4FQUA 3CRTA 1GRXA 4WF5A 2YV9A 3LJRA 3O76A 1SJ6A 2OBKA 1XOBA 1PGTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4AJ8 A;  1Q98 A;  2TIR A;  1PD2 1;  2HRN A;  3QCP A;  2A4V A;  2K8V A;  3DD3 A;  3GX8 A;  3CMI A;  1FHE A;  3CBU A;  3EU4 A;  2H1A A;  3F3Q A;  5IQY A;  5FWG A;  5B7C A;  3ZZX A;  3WGE A;  5CYY A;  3GV1 A;  2GDR A;  1J0F A;  4HQZ A;  2V32 A;  2IMD A;  1A24 A;  2AYT A;  4NMU A;  4ML1 A;  3WT1 A;  4BVY A;  1TK0 B;  1EWX A;  4K6X A;  3TKR A;  1YY7 A;  1Z7P A;  5IO2 A;  3VFI A;  2JZT A;  3TB2 A;  3FZ5 A;  2C1Y A;  2YJ7 A;  3FR3 A;  1A8L A;  2VOC A;  1B48 A;  5A4U A;  3ZFB A;  5B6M A;  3DGQ A;  1GLQ A;  3DRN A;  2YP6 A;  1GUL A;  2AUV A;  3TKP A;  5GST A;  4FYC A;  4OO4 A;  1KBN A;  3CSI A;  4L5O A;  4I97 A;  4HQS A;  5HR2 A;  4DSS A;  1NSW A;  3M0F A;  5HR0 A;  1DBY A;  2K8S A;  4HZ4 A;  4KSO A;  2WRT A;  4EKZ A;  3GL3 A;  5A4W A;  3HHV A;  2IFQ A;  2NPB A;  3RHB A;  1M2B A;  5CRE A;  9GSS A;  5DBQ A;  3QPM A;  3GRX A;  4ULX A;  2PBJ A;  2LJA A;  4I5Q A;  1NHO A;  2MBS A;  4MJB A;  2IYJ A;  2L57 A;  4LL1 B;  17GS A;  2IME A;  1A2L A;  4TN8 A;  2JSZ A;  3UJ1 A;  2WGR A;  2HRF A;  3KIJ A;  4O5R A;  1VGL A;  3LYP A;  3ZIT A;  3VPT A;  3GKM A;  5KN3 A;  1B8X A;  2O89 A;  4WBJ A;  1SJZ A;  4GQF A;  4HOJ A;  5AN1 A;  2GQM A;  4XS4 B;  2ALB A;  3ERW A;  5ID2 A;  3E0U A;  1BX9 A;  1T8E B;  1OAZ A;  1A8Y A;  2PUK C;  5DQY A;  4KCE A;  5AIS A;  1GP1 A;  4WR5 A;  1SKS B;  2OKA A;  4ECI A;  5HR1 A;  2TRX A;  3TGZ A;  3HKR A;  5J4U A;  5A5K A;  2YJH A;  3KTB A;  1U3I A;  2CA8 A;  3H8Q A;  4FO5 A;  2XC2 A;  2RM5 A;  4MDC A;  6GSW A;  4MCU A;  1X9W B;  1AXD A;  2JZS A;  3C1R A;  1SKW B;  1A0F A;  4GWR A;  1A2J A;  3PGT A;  4BL7 A;  2WFC A;  4F2I A;  2BMX A;  3IAS 2;  5KN2 A;  2QGV A;  3CYN A;  5DDL A;  5HFI A;  4X1U A;  3Q74 A;  10GS A;  2GT6 A;  1BYE A;  1QQ2 A;  5IMF A;  3D22 A;  2VL2 C;  3GA4 A;  2IFQ B;  5CRG A;  1V40 A;  2X64 A;  1TK8 B;  3G9B A;  2HZE A;  2RII A;  1FB6 A;  2GZP A;  2C0G A;  4ZXG A;  2LUS A;  4MPF A;  3PH9 A;  4GSS A;  5COH A;  4V2M A;  2AJQ B;  8GSS A;  1WRY A;  3KM6 A;  3PR8 A;  4AJ7 A;  1QGV A;  4P3Y B;  2IMI A;  1ILO A;  2HLS A;  3ZYW A;  4HJ2 A;  1UVZ A;  1JLV A;  4FIW A;  3W8S A;  2P5Q A;  2ON7 A;  4KH7 A;  2PWJ A;  1XIY A;  1K0M A;  2ON5 A;  1PL1 A;  1LJR A;  5ELG A;  3HA9 A;  5F05 A;  5KEJ A;  4KE3 A;  5GAP D;  5F0G A;  1F37 A;  2HNL A;  2K6V A;  3KMN A;  2KHP A;  3C73 A;  1U88 A;  1ZGN A;  2AAW A;  2X8G A;  6GSS A;  2B5E A;  2ES7 A;  1MDI A;  3LXZ A;  4IP1 A;  5D96 A;  3M9K A;  2PPT A;  3FR9 A;  2IIY A;  2YNX A;  5AIV A;  5FHI A;  5F07 A;  3MSZ A;  3GKX A;  2J23 A;  1T4Z A;  1GTU A;  3H4K A;  3GL5 A;  3TCO A;  4NWY A;  1AQV A;  3L4N A;  3AY8 A;  5DAK B;  4L0W A;  1SYX A;  4MK3 A;  2GSS A;  4XIH A;  2FNO A;  5F06 A;  3ZFL A;  2LQO A;  2WUL A;  5H5Q A;  5D73 A;  1GSY A;  1TRU A;  4MZW A;  1K0B A;  3KXO A;  1DSB A;  2E7P A;  3KTL A;  2LRC A;  3C71 A;  2TRC P;  3LXT A;  3HZ8 A;  2FA4 A;  2OBI A;  4QL9 A;  3ZML A;  2VD0 A;  3FZ9 A;  1PKW A;  2JU5 A;  3ERF A;  3UVH A;  4Q5N A;  1GSF A;  3N9J A;  4V2N A;  4L8E A;  3QAW A;  3S9F A;  2KUC A;  4PNF A;  4MLY A;  5HFG A;  2NVL A;  3F6F A;  2GQK A;  5IM9 A;  2K18 A;  3UOM A;  4ZB9 A;  2LV3 A;  4G19 A;  1MDJ A;  2P31 A;  3GTU A;  4MJA A;  4N0V A;  2DIY A;  2JAC A;  5IO0 A;  1TI3 A;  4ISD A;  2CX3 A;  2KP2 A;  3QOU A;  2GSQ A;  1AQW A;  4K9Z A;  3WT2 A;  4KW6 A;  1M9B A;  1T7P B;  1K0C A;  2FCH A;  1WOU A;  2MMO A;  2HXK A;  3RPN A;  1NW2 A;  4EDZ A;  3TRQ A;  4DSS B;  1FO5 A;  3TKS A;  5ELA A;  1GNE A;  1ZOF A;  2DMM A;  4PGT A;  1WPI A;  2QSI A;  3F4T A;  1GSS A;  1JZR A;  5CRW A;  1XWB A;  5FT3 A;  1EGO A;  3GYK A;  4OO5 A;  4PUF C;  1A23 A;  1OC9 A;  4EF0 A;  1XOA A;  5GSS A;  4YH2 A;  4RUV A;  3F63 A;  4EC0 A;  4G2E A;  2H66 A;  2CZ2 A;  3VLN A;  1SK2 A;  4TW5 A;  3A2V A;  1B9X C;  2FGX A;  3UBL A;  1TOF A;  5CAX A;  2FD3 A;  2X8H A;  1R26 A;  4QQ7 A;  2AV4 A;  1K0N A;  1SEN A;  1FVJ A;  3C1S A;  4OWY A;  4ACS A;  3HD5 A;  1T4Y A;  3ISO A;  2FWF A;  2LJK A;  3EWL A;  2IY2 A;  1E6B A;  4KGI A;  2HI7 A;  2H75 A;  1J9B A;  3TJB A;  5IOX A;  4F9Z A;  3GUS A;  2F8A A;  4N30 A;  1BG5 A;  1X9S B;  1HNC A;  2YV7 A;  2FWG A;  4TR0 A;  3HYP A;  3A5W A;  4NPB A;  1O8X A;  3EMP A;  4ZIJ A;  1ZZY A;  2R2J A;  1XW9 A;  1AIU A;  4MP4 A;  2HT9 A;  2I3Y A;  2LTK A;  3QFA C;  1ERW A;  4V2L A;  2YCD A;  2B1K A;  5ECN B;  1XWK A;  1XXU A;  1YEP A;  3E3E A;  3MWH A;  1N8J A;  3VWX A;  2KOK A;  3A2X A;  4PQH A;  1G7O A;  1F6M C;  2PVQ A;  2I81 A;  3CXG A;  1S3A A;  3L78 A;  2JSY A;  5EVO A;  2IMK A;  4I2U A;  1M9A A;  4MMM A;  1GH2 A;  3FY7 A;  4QL7 A;  3LOR A;  3LYK A;  1WMJ A;  3APS A;  1O7U A;  4XS6 A;  4KA0 A;  5ECP B;  3ZL5 A;  4L5L A;  3GTU B;  2VCQ A;  4DSQ A;  5IPG A;  3D4T A;  1FOV A;  1ZMA A;  2LJR A;  1GWC A;  1SL2 B;  6GSY A;  1EGR A;  1RK4 A;  4I6X A;  3TJF A;  1VF4 A;  1SD8 A;  1JZD A;  5J5N A;  4Z7X A;  2GSR A;  5DAL B;  4E8E A;  4V1A g;  3A2W A;  1X5E A;  2XPD A;  4IJ3 A;  4POK A;  3P7X A;  2FA8 A;  1F2E A;  1GTB A;  4N0Z A;  4MF5 A;  4N11 A;  4JR4 A;  5D9T A;  1H75 A;  1HNA A;  2EC4 A;  4ECC A;  3NIV A;  1EEJ A;  4JBB A;  2C0E A;  2FWH A;  4JR6 A;  3M1G A;  3LSZ A;  3RPP A;  1B4P A;  3QR6 A;  2DJK A;  1Z9H A;  3WGX A;  4NAX A;  5LNK e;  3GNJ A;  3US3 A;  4K7I A;  4TR1 B;  2LRN A;  1O85 A;  4XTS A;  3IRA A;  1NHY A;  3IHQ A;  2WS2 A;  1BQ7 A;  5D9X A;  4K7N A;  4LLR A;  5H5R A;  1ON4 A;  3H1N A;  4POM A;  1THX A;  2H71 A;  3ME8 A;  4MH3 A;  3LGC A;  2VO4 A;  4EE0 A;  3EC3 A;  1AW9 A;  3IK7 A;  2BJX A;  3TJJ A;  16GS A;  3UBK A;  2V2G A;  4IEL A;  1TK5 B;  1M2A A;  2GST A;  4ZBB A;  4NHZ A;  3KJY A;  4N10 A;  4AJ6 A;  2VL9 A;  1ABA A;  5ECS A;  4ZBD A;  2LNT A;  2DLX A;  2OE1 A;  2H6Y A;  4V1A p;  1GSU A;  1Y25 A;  3FRC A;  4YAP A;  3WD6 A;  1XWA A;  3IC4 A;  3ZRD A;  1J08 A;  1URM A;  5CRD A;  2H74 A;  3FHK A;  2JAD A;  3VWU A;  5DJM A;  1YDK A;  13GS A;  1YF0 A;  2O7K A;  6GSX A;  1T1V A;  4WEY A;  1IYI A;  1PN9 A;  4MJE A;  1KTE A;  5G31 A;  3F4R A;  2H70 A;  3O3T A;  2LST A;  1EV4 A;  4CHS A;  1TI1 A;  5G5F A;  3FKF A;  5C04 A;  3GIX A;  1YKA A;  4FH8 A;  3D0Z A;  2YOI A;  1QK8 A;  2GTU A;  5CO3 A;  1V9W A;  1GLP A;  2A2R A;  4GLT A;  4LMV A;  2MZC A;  2VIM A;  3EU3 A;  4AF2 A;  4TXO B;  2MMA A;  2V6O A;  2YWI A;  3UIW A;  3HJM A;  18GS A;  1WE0 A;  3UAP A;  1PRX A;  4WKW A;  3APQ A;  1M2D A;  3TRX A;  2RUE A;  3ERG A;  5A4V A;  4PUR A;  1MD4 A;  2I4A A;  3VI7 A;  1EZK A;  1F9M A;  2EIO A;  2L5O A;  1EP7 A;  3M3M A;  3ED3 A;  2B7J A;  2PMT A;  2L6C A;  6GSU A;  1S3D A;  1XBS A;  3IXR A;  1FG4 A;  1XVW A;  1UN2 A;  3KH9 A;  2LS5 A;  1YQ1 A;  1M0U A;  2FHE A;  2HYX A;  2Z9S A;  2H8L A;  4MZC A;  1Q4J A;  1TRV A;  1SU9 A;  4K0N A;  2N5B A;  2E2M A;  2OJL A;  4TR1 A;  4CDO A;  5ID2 B;  2M80 A;  2PU9 C;  1XW5 A;  3ZIV A;  2D2Z A;  3D21 A;  3ME7 A;  5IPH A;  4EVM A;  2H72 A;  4PUA A;  5ECM B;  1N2A A;  2HSH A;  2J9H A;  4EO3 A;  3J7Y b;  2GVP A;  4ECB A;  3RHC A;  2H6Z A;  1TTZ A;  2R5G A;  3Q6O A;  1UA5 A;  2OAC A;  2VAF A;  4I2T A;  2G0F A;  4GF0 A;  4HDE A;  3F6D A;  5DCG A;  2O87 A;  4TR3 A;  1DUG A;  3LWA A;  2BTO T;  1G7E A;  1MEK A;  1MTC A;  5IMV A;  1OKD A;  4ECJ A;  2FWE A;  3TDG A;  2L59 A;  2YWO A;  4JU5 A;  2YN1 A;  3TOU A;  1AC1 A;  3D6I A;  1O8W A;  4K1F A;  1BAY A;  4POB A;  1XZO A;  4WXT A;  1AAZ A;  1C72 A;  1K3O A;  1ML6 A;  3TKQ A;  4D73 B;  3IR4 A;  2CX4 A;  1M7T A;  4KAE A;  14GS A;  2HZE B;  1TU8 A;  1YEX A;  3O6T A;  5D8I A;  5G1K A;  3IAM 2;  3QDN A;  2REM A;  5ECH B;  1SD9 A;  1KNG A;  3WYW A;  3ZTL A;  4EXJ A;  5J3R A;  1B4Q A;  4H86 A;  3TKS E;  4DVC A;  3BD2 A;  2GT5 A;  1GTI A;  3LFL A;  2ZUP A;  5INY A;  2EIR A;  3G7I A;  2GZZ A;  2WB9 A;  1EOG A;  2LRT A;  3IA1 A;  5ENU A;  4XCS A;  5DAL A;  3W6G A;  1K0O A;  4JZQ A;  1GTA A;  4TOP A;  2L4Q A;  3QMX A;  1XFL A;  4JED A;  1V98 A;  1ERU A;  2F9S A;  3BJ5 A;  3UAR A;  4OCE A;  1VF2 A;  2KLX A;  2ZNM A;  1O6J A;  4MZB A;  2DJ3 A;  2HSY A;  3FYG A;  4GRF A;  4HU9 A;  4X0X A;  2K9F A;  2V41 A;  3HVS A;  5DCH A;  3MNG A;  2H76 A;  5JCG A;  2YZU A;  3HJP A;  4HS1 A;  3I9V 2;  1OC9 B;  1TJD A;  3GMF A;  4LA1 A;  3GSS A;  5EPF A;  4IQ1 A;  1Z5Y E;  4K8M A;  5C00 A;  1RW1 A;  1E2Y A;  5G2Z A;  1U6T A;  4KDY A;  1T00 A;  4WET A;  2IWT A;  22GS A;  5KN0 A;  2R3X A;  2C3Q A;  5CP1 A;  5G30 A;  3LEF A;  1PSQ A;  2CQ9 A;  3L9V A;  3EUR A;  1ST9 A;  4ML6 A;  4ZBA A;  3GST A;  5ECQ B;  1CQH A;  2DJ0 A;  4EDY A;  2H30 A;  5AGY A;  5ECI B;  2C4J A;  5ECK B;  4KUN A;  5HQP A;  2LEG A;  3KP8 A;  3DML A;  3NOF A;  3G7Y A;  1K0A A;  1R5P A;  3KGK A;  2KP1 A;  2VCV A;  5IIZ A;  1FW1 A;  3FZ4 A;  4KB3 A;  4IHU A;  1V58 A;  1FB0 A;  5LCZ A;  2MBT A;  3H79 A;  2H0H A;  3EE2 A;  3DYR A;  4TXO A;  4ZIL A;  1EP8 A;  4IN0 A;  3IDV A;  1UC7 A;  1IYH A;  2OA7 A;  2B3S A;  3TJK A;  1EEM A;  3KP9 A;  3UMA A;  4NV2 A;  2F3M A;  1TRS A;  3ZVJ D;  1QUW A;  2YZH A;  3F8U A;  5B8B A;  5G1L A;  2C8U A;  4IBP A;  2X8C A;  2OE0 A;  3I6A A;  3BOA A;  1R4W A;  3CRU A;  4MH2 A;  3WGD A;  5D9V A;  2CT6 A;  4PNG A;  3JCM L;  1AQX A;  4WF4 A;  2I1U A;  1GSE A;  5ECL B;  3QAG A;  2CV4 A;  3V1W A;  2IL3 A;  4NHW A;  4IP6 A;  5DJL A;  2ZCT A;  4OFT A;  4I8B A;  1I5G A;  2GZY A;  3FW2 A;  4XRD A;  3BCI A;  2HZF A;  3GFK A;  2NTO A;  3F3R A;  1GNW A;  2VCZ A;  1TW9 A;  5JCU A;  1DE2 A;  4PQ1 A;  1XPV A;  11GS A;  2HFD A;  4FYU A;  4RI6 A;  2H6X A;  2EIQ A;  3ZRE A;  3F4S A;  4NV5 A;  3HY2 A;  2C0F A;  2VM1 A;  2B5Y A;  2C3T A;  2IN3 A;  1B9Y C;  2PER A;  2N5A A;  2PVO C;  1TRW A;  3DWV A;  4G9H A;  3EIN A;  4BPY A;  2YWM A;  1JZO A;  4BWS A;  4K7O A;  2YPM A;  2L6D A;  4F0C A;  5E4W A;  2GQL A;  2E0Q A;  2XPE A;  1ERV A;  4IKH A;  3DIE A;  4RQR A;  3CTF A;  1TDI A;  1G6Y A;  1SK1 A;  2NBS A;  2AB6 A;  2PGT A;  3OR5 A;  1WJK A;  1WWJ A;  4ZL8 A;  1MD3 A;  2AHE A;  2H73 A;  1GSQ A;  4X43 A;  1OC8 A;  4F03 A;  3L0H A;  4L0U A;  5LD0 A;  2H01 A;  4TKY A;  4ID0 A;  1S3C A;  2YWN A;  2PN8 A;  2IMF A;  4KSM A;  1FVK A;  2F51 A;  1M99 A;  1PX6 A;  4DSR A;  4ILF A;  2H1G A;  3F0I A;  4AGS A;  1GSD A;  5CNW A;  4YQU A;  1TXX A;  4CW9 A;  1BJX A;  1Z6N A;  4MAB A;  3HVV A;  2VLU A;  3TUE A;  1F3A A;  5AIX A;  1ZYE A;  4OCF A;  2B1L A;  3CSH A;  2CVB A;  4IQA A;  4E8H A;  3GX0 A;  3FEU A;  3FZA A;  2NDO A;  4Q5Q A;  2MMZ A;  3CSJ A;  5E59 A;  2C80 A;  2WZ9 A;  1GUM A;  1Z3E A;  1X9M B;  4J57 E;  1WP0 A;  2B6M A;  3PIN A;  2JZR A;  3UVT A;  3M8N A;  1OE8 A;  2B5X A;  2DBC A;  3ZVJ A;  4PXO A;  2WJU A;  1JFU A;  2DML A;  1RQM A;  1A2M A;  2GS3 A;  1HYU A;  4PX1 A;  3J7Y k;  5CRH A;  3P90 A;  2H1B A;  3KD0 A;  1AUC A;  1VF3 A;  3U6V A;  6GSV A;  1F3B A;  2B7K A;  5IMC A;  3W8J A;  2R6K A;  2FY6 A;  2VCT A;  2XBI A;  2XBQ A;  3IE3 A;  3VPQ A;  1R7H A;  4D73 A;  3I69 A;  1SYR A;  4KDU A;  4EUY A;  2H1D A;  2QC7 A;  1Z7R A;  2XHF A;  3EMX A;  1THO A;  1ERT A;  4GQC A;  1MDK A;  1X0R A;  4POL A;  3BCK A;  2P0G A;  4IVF A;  4MF6 A;  4IS0 A;  3RAZ A;  1V57 A;  4J2F A;  1OKT A;  1K3Y A;  2CVD A;  2MMN A;  5IMZ A;  1HNB A;  3ZLP A;  2RLI A;  1TKD B;  4BA7 A;  3IV4 A;  3EYT A;  2RM6 A;  3C8E A;  2OAD A;  2VUP A;  5EL8 A;  4RI7 A;  2HE3 A;  1SJI A;  2L4C A;  3GH6 A;  3VWV A;  4BWQ A;  2DSA A;  3P8W A;  4ZB8 A;  4LL4 B;  3L9S A;  4J56 E;  1BED A;  4RQX A;  4OMV A;  5ABR A;  5EY6 A;  5DAK A;  2RUF A;  4JRR A;  1GUH A;  3EVI A;  4IW9 A;  3IOS A;  1HD2 A;  3IK9 A;  20GS A;  4O32 A;  1KEB A;  3D4M A;  5ECO B;  1G0T A;  4HEA 2;  3TOT A;  1EV9 A;  1VF1 A;  3TKS C;  1XCC A;  3QD9 A;  1U3A A;  3GKK A;  4IJI A;  1YJ6 A;  3LG6 A;  1JHB A;  3BBY A;  1SL1 B;  3ZIJ A;  2WDU A;  2DJ2 A;  2M72 A;  4KX4 A;  3FR6 A;  3LQ7 A;  2C3N A;  4F0B A;  2OE3 A;  1OYJ A;  3HVX A;  3HJO A;  7GSS A;  2VL3 A;  5DVB A;  2WCI A;  3VI5 A;  1YZX A;  5IMA A;  2CVK A;  5JWO B;  4GST A;  2E2G A;  1QXH A;  2GLR A;  1XWG A;  3MAK A;  4ZL9 A;  5B6N A;  1WIK A;  2FUG 2;  2O8V B;  3G7J A;  4KDX A;  3GUR A;  1XWC A;  4MA9 A;  1GL8 A;  4GCI A;  2QKE A;  5B8A A;  3FK8 A;  3HCZ A;  5GZZ B;  5J9C A;  1YF1 A;  5D9W A;  3VWW A;  3K8N A;  2R37 A;  3E9J B;  1JZW A;  1OVN A;  2VM2 A;  1W4V A;  1T3B A;  5L71 A;  2VLT A;  4TR4 A;  4O7H A;  1Y6E A;  2A2S A;  2IJY A;  3IBH A;  1NM3 A;  5DQS A;  4XS4 A;  4MPG A;  2V6K A;  1ZCP A;  2G2Q A;  3HZ4 A;  2P5R A;  3DVX A;  3VUR A;  2VCX A;  4Q5F A;  2LKU A;  4IGJ A;  2DC5 A;  1K3L A;  4ZL7 A;  1YKC A;  3GN3 A;  3QAV A;  4OFN A;  2YAN A;  2O85 A;  4MF7 A;  4K2D A;  5GAN D;  1TU7 A;  2H0I A;  1O73 A;  4WBR D;  3Q19 A;  4G10 A;  4GTU A;  5HR3 A;  6GST A;  3C7M A;  4TRX A;  5D93 A;  4MJC A;  1JLW A;  4FYB A;  3ZMK A;  2LQQ A;  4OD7 A;  3DVW A;  1X5D A;  1A0R P;  2DJJ A;  4YAV A;  4BVX A;  2CZ3 A;  2VLV A;  3SWL A;  4YQV A;  3HDC A;  4Q5R A;  5F8B A;  1SKR B;  2VL2 A;  3A3T A;  3NZN A;  1SK0 A;  1XVQ A;  3Q18 A;  1HQO A;  3KCM A;  4PQI A;  2JL4 A;  3R2Q A;  4LMW A;  1XW6 A;  3RDW A;  3L9U A;  3RBT A;  3DKS A;  1K0D A;  5G5E A;  1PX7 A;  3UL3 A;  3GHA A;  3KEB A;  1G6W A;  1ZL9 A;  3U5R E;  3KMO A;  1V2A A;  2LNS A;  2N5F A;  1LU4 A;  4DEJ A;  2MYG A;  2X99 A;  4O92 A;  1USB A;  1PL2 A;  5JWQ B;  1ZYQ B;  1EOH A;  1VRS D;  3F9U A;  1ACV A;  1PA3 A;  1OC3 A;  1QMV A;  2H19 A;  1GUK A;  1PKZ A;  4WR4 A;  3DEX A;  4HZ2 A;  1I9D A;  4NXI A;  2DIZ A;  3MDK A;  1DE1 A;  2VD1 A;  1X5C A;  3P2A A;  4K0G A;  4GXZ A;  4GSN A;  2I9H A;  1H4O A;  5KN1 A;  3GKN A;  1SL0 B;  5HFK A;  2R4V A;  4TVE A;  2H0G A;  3TRP A;  1W89 A;  4JE1 A;  1LBK A;  3UEM A;  5ECR B;  5J9B A;  3VK9 A;  2GGT A;  3QFB C;  2F8F A;  2L5L A;  2CAQ A;  4HU7 A;  3KH7 A;  3TJG A;  4XS1 A;  4EL1 A;  3DXB A;  4KCA A;  4HI7 A;  4XHM A;  2CAI A;  1U87 A;  5JCW A;  4XRA A;  2C0D A;  5JWR B;  3D5J A;  2FLS A;  12GS A;  3N5O A;  4YQM A;  4KND A;  3I43 A;  2VCW A;  3M9J A;  2IPA A;  4ZB6 A;  4F82 A;  2V1M A;  3HXS A;  2M46 A;  1O81 A;  1Z6M A;  3KZQ A;  4HUA A;  19GS A;  1TP9 A;  5IOW A;  3GH9 A;  1FAA A;  1PQN A;  5H5S A;  4OFM A;  3CTG A;  1QFN A;  4TXV A;  3SBC A;  2DJ1 A;  1CQG A;  3H93 A;  3IPZ A;  1R5A A;  4HJM A;  1OE7 A;  1PMT A;  5IMD A;  3APO A;  5J41 A;  3CRT A;  1GRX A;  4WF5 A;  2YV9 A;  3LJR A;  3O76 A;  1SJ6 A;  2OBK A;  1XOB A;  1PGT A; 
#chains in the Genus database with same CATH topology
 4AJ8 A;  1Q98 A;  1B2X A;  2TIR A;  1PD2 1;  5FW5 A;  2HRN A;  3QCP A;  1R4Y A;  1LNI A;  3U1W A;  4CY8 A;  2A4V A;  1AVK A;  2K8V A;  3FG3 A;  3NM7 A;  4CJN A;  3DD3 A;  3GX8 A;  3CMI A;  1FHE A;  2GEX A;  1IQ8 A;  3CBU A;  2X4A A;  3EU4 A;  3LH4 A;  4GSP A;  2H1A A;  3F3Q A;  5IQY A;  1MGR A;  2XH9 A;  5FWG A;  5B7C A;  3ZZX A;  3WGE A;  5CYY A;  3GV1 A;  2GDR A;  1J0F A;  4HQZ A;  2V32 A;  2IMD A;  1A24 A;  1I3I A;  2AYT A;  2O3O A;  1JNQ A;  4NMU A;  4ML1 A;  1DET A;  3WT1 A;  4BVY A;  1TK0 B;  1EWX A;  4K6X A;  3TKR A;  1YY7 A;  3OWY A;  1Z7P A;  4GL6 A;  5IO2 A;  3VFI A;  3SLU A;  2JZT A;  3TB2 A;  1LOX A;  4FMB A;  2RGQ A;  3FZ5 A;  4LSO A;  2C1Y A;  1LOV A;  2YJ7 A;  3FR3 A;  1A8L A;  3PCS A;  1TP6 A;  2VOC A;  3I56 3;  1B48 A;  3HZP A;  5A4U A;  3RGR A;  3ZFB A;  3DGQ A;  5B6M A;  4CDL A;  1GLQ A;  1LRA A;  3DRN A;  4OK0 A;  3CC7 3;  2YP6 A;  1GUL A;  2CFG A;  2AUV A;  1JN5 A;  3TKP A;  2BMO B;  5GST A;  4FYC A;  4OO4 A;  1KBN A;  3AGN A;  3CSI A;  3OWS A;  4L5O A;  3LT8 A;  1Q7H A;  4I97 A;  4HQS A;  5HR2 A;  3S67 A;  4DSS A;  1NSW A;  3M0F A;  5HR0 A;  1DBY A;  2K8S A;  4HZ4 A;  1YIJ 3;  2XFT A;  1EUI C;  2P09 A;  4LYL B;  4KSO A;  1GOY A;  3HX8 A;  4HZ9 B;  2WRT A;  3GZY B;  4EKZ A;  3GL3 A;  5A4W A;  3HHV A;  3LML A;  2IFQ A;  1W2Z A;  1SIH A;  1RLS A;  2NPB A;  3RHB A;  1B20 A;  2W04 A;  3NV0 A;  4WP5 A;  3CCS 3;  1M2B A;  1WTH A;  2CW9 A;  5CRE A;  9GSS A;  5DBQ A;  1SII A;  3QPM A;  3GRX A;  1OAC A;  1BSC A;  4MNN A;  4ULX A;  2PBJ A;  4ICY A;  2LJA A;  1US1 A;  4I5Q A;  1GMP A;  1NHO A;  1ROV A;  2MBS A;  1NNV A;  3JUP A;  4MJB A;  3LYG A;  1RNB A;  2IYJ A;  3QRD A;  3MWZ A;  2L57 A;  4EC6 A;  4EV2 A;  4LL1 B;  17GS A;  3OV4 A;  2IME A;  3NBJ A;  3CQF A;  1A2L A;  1J2B A;  4TN8 A;  2JSZ A;  3UJ1 A;  2R41 A;  2WGR A;  2HRF A;  3KIJ A;  3DXO A;  4O5R A;  1VGL A;  3LYP A;  3ZIT A;  3VPT A;  2ML5 A;  3GKM A;  5KN3 A;  1JJ2 2;  1B8X A;  4IPB A;  2O89 A;  4WBJ A;  1EKM A;  1SJZ A;  4GQF A;  4HOJ A;  5AN1 A;  3B7C A;  1RCL A;  1OF5 A;  1JRQ A;  2GQM A;  4XS4 B;  3CCM 3;  4AKZ A;  3DUK A;  4J8T A;  2ALB A;  1VQK 3;  3ERW A;  2OQE A;  5ID2 A;  1B27 A;  3E0U A;  1BX9 A;  1T8E B;  1KSI A;  2F98 A;  1OAZ A;  4MMZ B;  1A8Y A;  3CNM A;  3LT9 A;  1M90 4;  2PUK C;  3EQQ B;  5DQY A;  4KCE A;  5AIS A;  5AI1 A;  2GBW B;  1UCK A;  1O7P B;  1GP1 A;  4WR5 A;  1SKS B;  1BVI A;  2OKA A;  4ECI A;  3KII A;  5HR1 A;  2TRX A;  4G1M B;  1JB4 A;  2Y74 A;  1RRL A;  3TGZ A;  3HKR A;  5J4U A;  5A5K A;  2YJH A;  3KTB A;  1U3I A;  4O3V A;  2Z77 A;  1YVS A;  2CA8 A;  3H8Q A;  1K8A 4;  4FO5 A;  2XC2 A;  2RM5 A;  4MDC A;  6GSW A;  4MCU A;  1X9W B;  1QJG A;  5AIG A;  1C7H A;  1OHO A;  1AXD A;  2JZS A;  3C1R A;  1SKW B;  3NQY A;  1A0F A;  1IV9 A;  2YX9 A;  4GWR A;  1IT7 A;  1A2J A;  3PGT A;  4N6T A;  4BL7 A;  4K2X A;  2WFC A;  2MC8 A;  3WDG B;  1X1W A;  4F2I A;  2BMX A;  1O7H B;  1N9J A;  1RJO A;  5D83 A;  3IAS 2;  3IMA B;  5KN2 A;  1ZYN A;  2QGV A;  3CYN A;  5DDL A;  5HFI A;  4X1U A;  3Q74 A;  2ML6 A;  10GS A;  4R80 A;  3NHX A;  2GT6 A;  6STD A;  1BYE A;  1QQ2 A;  3S29 A;  5IMF A;  2RFR A;  3D22 A;  2VL2 C;  4GB5 A;  3GA4 A;  2IFQ B;  5CRG A;  2CIU A;  1NB5 I;  3KKG A;  1IYY A;  3FZW A;  1V40 A;  2X64 A;  1TK8 B;  3G9B A;  2HZE A;  2RII A;  1FB6 A;  2GZP A;  2V1L A;  2C0G A;  5IEP A;  1YJW 3;  1OGZ A;  1M1X B;  1TRQ A;  4ZXG A;  4HM7 B;  4Z2T A;  2LUS A;  4MPF A;  3PH9 A;  4GSS A;  5COH A;  1TU5 A;  4V2M A;  3DMC A;  2AJQ B;  8GSS A;  3K63 A;  1WRY A;  5JPU A;  3LTD A;  2D1W A;  3KM6 A;  3MKI A;  1XG8 A;  1GY5 A;  3PR8 A;  4AJ7 A;  1QGV A;  4P3Y B;  2IMI A;  2QA1 A;  3A5E A;  3U97 A;  3BNE A;  2HLS A;  3ZYW A;  1ILO A;  4HJ2 A;  1UVZ A;  1JLV A;  4FIW A;  3W8S A;  1DMQ A;  2P5Q A;  3G0K A;  2ON7 A;  2QIY A;  1HU9 A;  1MWT A;  4KH7 A;  3QK9 A;  2PWJ A;  1HZ1 A;  1RGK A;  1TRP A;  1XIY A;  1K0M A;  2ON5 A;  1JB5 A;  1PL1 A;  4LMI A;  1LJR A;  5ELG A;  1LXE A;  3HA9 A;  5F05 A;  5KEJ A;  3CD6 3;  4KE3 A;  5GAP D;  5F0G A;  2P0X A;  1F37 A;  2KXG A;  2HNL A;  1VZZ A;  3NX0 A;  2K6V A;  5AYR B;  3KMN A;  1RN4 A;  2KHP A;  3C73 A;  4G0I A;  1U88 A;  1EG9 B;  4BTX A;  1ZGN A;  1I2E A;  2AAW A;  2X8G A;  6GSS A;  2B5E A;  8CHO A;  3D79 A;  2ES7 A;  1MDI A;  3LXZ A;  5AYS C;  4IP1 A;  3M9K A;  5D96 A;  5LC7 A;  2PPT A;  3F40 A;  3FR9 A;  3BU4 A;  2IIY A;  2KCD A;  2YNX A;  5AIV A;  5FHI A;  1K9M 4;  5F07 A;  3MSZ A;  3GKX A;  1BNE A;  1RTU A;  1T4Z A;  2J23 A;  4N6O B;  3DY5 A;  1GTU A;  3H4K A;  3GL5 A;  3TCO A;  4NWY A;  1AQV A;  3L4N A;  3AY8 A;  5DAK B;  4L0W A;  1SYX A;  3UL6 A;  2GSS A;  4MK3 A;  3DGY A;  3CCV 3;  4XIH A;  2FNO A;  5F06 A;  2BT3 A;  1SJW A;  3ZFL A;  3MHE A;  2LQO A;  4FR9 A;  2WUL A;  5H5Q A;  2ZDJ A;  1E3V A;  2W56 B;  2F5M A;  5D73 A;  1DVC A;  1GSY A;  1UUG B;  1TRU A;  4MZW A;  1K0B A;  3KXO A;  1DSB A;  2E7P A;  3KTL A;  1FW7 A;  4EIP A;  4EW5 A;  2LRC A;  3C71 A;  1FGO A;  2TRC P;  3LXT A;  3HZ8 A;  2FA4 A;  3MYD A;  4IIA A;  1SQW A;  3B8L A;  2OBI A;  1FUS A;  1VQ5 3;  3I55 3;  4QL9 A;  4N3V A;  3ZML A;  2DKI A;  1I8V A;  2KF4 A;  2VD0 A;  3FZ9 A;  4MEI A;  2CG0 A;  1VQO 3;  1PKW A;  2JU5 A;  2Y73 A;  3ERF A;  3UVH A;  3O8Y A;  4Q5N A;  1GSF A;  3N9J A;  4V2N A;  2WGO A;  1O7G B;  2W9P A;  4L8E A;  3QAW A;  3S9F A;  3F7S A;  2KUC A;  4PNF A;  5JPP A;  4MLY A;  5HFG A;  2NVL A;  3F6F A;  1FUT A;  2GQK A;  5IM9 A;  2K18 A;  3B4P A;  3UOM A;  4ZB9 A;  2LV3 A;  2ZA4 A;  5CLK A;  3UJM A;  4G19 A;  1MDJ A;  2P31 A;  3GTU A;  3BND A;  4MJA A;  4N0V A;  2BMQ B;  5D82 A;  2DIY A;  2JAC A;  5IO0 A;  4HM8 B;  1TI3 A;  4ISD A;  2CX3 A;  2KP2 A;  3DM8 A;  3QOU A;  2GSQ A;  1AQW A;  4K9Z A;  3WT2 A;  4KW6 A;  1M9B A;  1T7P B;  1K0C A;  1YGW A;  2SBL A;  2FCH A;  1ZX2 A;  1WOU A;  2HSM A;  2MMO A;  2HXK A;  1QVF 2;  5KP1 A;  1NW2 A;  3RPN A;  3PXM A;  2E2T A;  4EDZ A;  1M3J A;  3TRQ A;  4DSS B;  1FO5 A;  3CCL 3;  1BNG A;  1VQ8 3;  1IDP A;  5ELA A;  1GNE A;  3TKS A;  1ZOF A;  2DMM A;  4PGT A;  4H61 A;  1WPI A;  2QSI A;  3F4T A;  3EE1 A;  1UUW B;  1GSS A;  1JZR A;  3NXJ A;  5CRW A;  1XWB A;  4H3U A;  5FT3 A;  1EGO A;  3GYK A;  4OO5 A;  4PUF C;  1C54 A;  4FMD A;  1A23 A;  1VQP 3;  3FF2 A;  1OC9 A;  3EHC A;  1BAO A;  2GU3 A;  4BTY A;  4J5K A;  4EF0 A;  1XOA A;  1I0V A;  5GSS A;  2W6J H;  4YH2 A;  1RHL A;  4RUV A;  3F63 A;  4EC0 A;  1M3I A;  4G2E A;  2H66 A;  2CZ2 A;  3VLN A;  1SK2 A;  4TW5 A;  1AV4 A;  5DRE A;  3A2V A;  2SAR A;  1B9X C;  1JKG A;  3X3X A;  5HGR A;  2W56 A;  2FGX A;  3UBL A;  1TOF A;  5CAX A;  2FD3 A;  2X8H A;  1R26 A;  4QQ7 A;  1FZU A;  1RRH A;  2AV4 A;  2WO0 A;  3EN1 B;  1K0N A;  1SEN A;  1YVB I;  1FVJ A;  3C1S A;  4OWY A;  1GY7 A;  4ACS A;  3HD5 A;  3V99 A;  1T4Y A;  3ISO A;  2FWF A;  3PGB A;  1E3R A;  1BRS A;  1N5P A;  2LJK A;  1RGL A;  5IG4 A;  3EWL A;  2IY2 A;  1E6B A;  3CCJ 3;  4KGI A;  2HI7 A;  2H75 A;  1J9B A;  3TJB A;  2A15 A;  5IOX A;  3R3E A;  3K7C A;  3A5I A;  4F9Z A;  3GUS A;  1MGW A;  3MPH A;  1Z1S A;  4XM4 A;  2F8A A;  3EPT A;  4N30 A;  3HI7 A;  1BG5 A;  1X9S B;  2PZV A;  1GD4 A;  1HNC A;  3V98 A;  2CG1 A;  2HOH A;  2YV7 A;  3EBT A;  2FWG A;  4RZM A;  4TR0 A;  3HYP A;  3A5W A;  4NPB A;  1O8X A;  5M19 A;  3EMP A;  1JBR A;  4X4J A;  4ZIJ A;  1ZZY A;  3DGL A;  4I4K A;  1XW9 A;  2R2J A;  1AIU A;  4MP4 A;  5ELU A;  2HT9 A;  2I3Y A;  2LTK A;  3QFA C;  1ERW A;  4V2L A;  2YCD A;  3CME 3;  2B1K A;  5ECN B;  1XWK A;  1K73 4;  1XXU A;  3GZR A;  1YEP A;  3E3E A;  3MWH A;  1N8J A;  3VWX A;  2KOK A;  4BVY B;  2P05 A;  3A2X A;  4PQH A;  1G7O A;  1F6M C;  2PVQ A;  2I81 A;  3F8H A;  4IT7 A;  3CXG A;  1N9E A;  1S3A A;  3L78 A;  1M1K 4;  2A4H A;  2JSY A;  5EVO A;  2IMK A;  4I2U A;  1M9A A;  4MMM A;  1GH2 A;  4R9K A;  3FY7 A;  4QL7 A;  3LOR A;  3LYK A;  1WMJ A;  3APS A;  1O7U A;  4XS6 A;  4KA0 A;  5ECP B;  1IVV A;  1YI2 3;  3ZL5 A;  4L5L A;  1T2I A;  3GTU B;  1DVD A;  2VCQ A;  3IPT A;  3H3H A;  4DSQ A;  5IPG A;  3D4T A;  1FOV A;  4LZI A;  1ZMA A;  2LJR A;  1W6G A;  1RNT A;  3FG4 A;  1GWC A;  3KN4 A;  1SL2 B;  3E99 A;  6GSY A;  4DKI A;  5ELJ A;  1EGR A;  3FF0 A;  1RK4 A;  4HM4 B;  3HVN A;  3K9M C;  3EBY A;  4I6X A;  1G96 A;  3KZT A;  3TJF A;  5IER A;  1VF4 A;  1SD8 A;  1JZD A;  1W5Z A;  5J5N A;  4Z7X A;  2GSR A;  3WHO A;  5DAL B;  1QAK A;  4E8E A;  4V1A g;  3A2W A;  1X5E A;  2XPD A;  1Q82 4;  1HYF A;  3NBB A;  4IJ3 A;  5JBS A;  4POK A;  3P7X A;  4N6U A;  1SPU A;  2F86 B;  2CKF B;  1YGE A;  2FA8 A;  1BSD A;  1F2E A;  1GTB A;  4N0Z A;  4MF5 A;  4N11 A;  1WMO A;  3CCE 3;  4JR4 A;  1S3R A;  1B2M A;  2OQE C;  1OPY A;  4HZB B;  2HML B;  3K5T A;  5D9T A;  3HOH A;  1H75 A;  1HNA A;  1AQZ A;  2EC4 A;  4ECC A;  3NIV A;  1EEJ A;  2K3D A;  4JBB A;  2C0E A;  2FWH A;  4JR6 A;  3M1G A;  3LSZ A;  3RPP A;  4KFF A;  1B4P A;  1W4N A;  3QR6 A;  2CX1 A;  1NJI 4;  3Q3F A;  1O7M B;  2DJK A;  1Z9H A;  3WGX A;  5D81 A;  4NAX A;  5LNK e;  3GNJ A;  1LNH A;  5IG0 A;  3US3 A;  4K7I A;  4EIQ A;  7GSP A;  1JBT A;  4TR1 B;  6GSP A;  2LYX A;  2LRN A;  4RBN A;  1O85 A;  4XTS A;  3IRA A;  1NHY A;  3IHQ A;  2R0C A;  2WS2 A;  1I70 A;  2B1X B;  1OUN A;  2M7O A;  3WOE B;  3L0R A;  2FGT A;  1BQ7 A;  5D9X A;  2P38 A;  3UB1 A;  4K7N A;  4PTS A;  4LLR A;  5H5R A;  4QWT A;  1ON4 A;  3H1N A;  1I2F A;  4POM A;  1BNF A;  1THX A;  2H71 A;  3ME8 A;  4MH3 A;  3LGC A;  1ZYP A;  2VO4 A;  5BU4 A;  4EE0 A;  3EC3 A;  3HK4 A;  5IW9 A;  1AW9 A;  3IK7 A;  2BJX A;  3TJJ A;  16GS A;  1UUV B;  2L1S A;  3UBK A;  2V2G A;  4IEL A;  1TK5 B;  1M2A A;  2GST A;  4ZBB A;  1BRH A;  4NHZ A;  4HKV B;  4YKG A;  3KJY A;  4N10 A;  4HYZ A;  4AJ6 A;  3CC4 3;  2VL9 A;  1ABA A;  5ECS A;  4ZBD A;  3Q1C A;  2LNT A;  3LXU X;  5BXQ A;  2DLX A;  2OE1 A;  2H6Y A;  4V1A p;  1GSU A;  1Y25 A;  3FRC A;  4YAP A;  3G71 3;  2XRX B;  3WD6 A;  1XWA A;  3IC4 A;  3ZRD A;  1J08 A;  1URM A;  5CRD A;  3N9H A;  2GU1 A;  4HM1 B;  2H74 A;  3FHK A;  3NUV A;  3SOA A;  2JAD A;  3VWU A;  5DJM A;  1YDK A;  3CCQ 3;  2CFK A;  13GS A;  1N8Q A;  1PYL A;  1YF0 A;  2O7K A;  6GSX A;  4RNY A;  1T1V A;  4WEY A;  1IYI A;  3D4A A;  1PN9 A;  4MJE A;  1KTE A;  5CF2 A;  3VSY A;  5G31 A;  3S27 A;  3F4R A;  2H70 A;  3O3T A;  3PS8 A;  1Q81 4;  2LST A;  1EV4 A;  4CHS A;  4XDV A;  1TI1 A;  5G5F A;  4BL3 A;  1FUW A;  1STD A;  3FKF A;  2WOH A;  5I97 A;  5C04 A;  3GIX A;  1YKA A;  4FH8 A;  3D0Z A;  2YOI A;  1QK8 A;  2GTU A;  1W7C A;  5CO3 A;  3VF1 A;  4CY6 A;  1I3F A;  1V9W A;  1GLP A;  2XGN A;  1IK3 A;  2A2R A;  4GLT A;  4LMV A;  4K1U A;  2MZC A;  2VIM A;  3EU3 A;  4J9A A;  4AF2 A;  4TXO B;  2MMA A;  5EEO A;  2V6O A;  2YWI A;  3UIW A;  3HJM A;  1EQK A;  1CEW I;  18GS A;  5TGN A;  1WE0 A;  3UAP A;  1PRX A;  1UI7 A;  4WKW A;  1A67 A;  3APQ A;  1M2D A;  3TRX A;  2RUE A;  3ERG A;  5A4V A;  3F8X A;  4PUR A;  3DGM A;  4O02 B;  3CC2 3;  1IVU A;  1MD4 A;  2I4A A;  1CYU A;  2UUG C;  1JN5 B;  3VI7 A;  3HIG A;  1EZK A;  1F9M A;  4FMC A;  3SVA A;  2EIO A;  2L5O A;  1EP7 A;  1VQM 3;  3M3M A;  3CXC 2;  3ED3 A;  2B7J A;  2PMT A;  2L6C A;  6GSU A;  1RCK A;  1S3D A;  1XBS A;  3IXR A;  2QGU A;  1FG4 A;  1Q86 4;  1XVW A;  2XF3 A;  1UN2 A;  3KH9 A;  2LS5 A;  1YQ1 A;  1GS3 A;  3Q90 A;  1M0U A;  2FHE A;  2HYX A;  1T2H A;  2Z9S A;  2H8L A;  4MZC A;  3CPW 2;  3LTB A;  1Q4J A;  1TRV A;  1SU9 A;  2OCT A;  2CFW A;  3B4O A;  4K0N A;  1OF5 B;  3AMO B;  2N5B A;  3EC9 A;  3N54 B;  2KF5 A;  4RNT A;  2E2M A;  2OJL A;  1QMA A;  3T8U A;  4TR1 A;  5GSP A;  4CDO A;  5ID2 B;  2M80 A;  2PU9 C;  1XW5 A;  3ZIV A;  2D2Z A;  3D21 A;  1E97 A;  3NBR A;  2D42 A;  3ME7 A;  3X3Z A;  3SED A;  5AIF A;  2JDI H;  1O7W B;  5IPH A;  1UW1 A;  4EVM A;  4O2H A;  2H72 A;  4PUA A;  5ECM B;  2AAE A;  1N2A A;  2HSH A;  2J9H A;  4EO3 A;  3BB9 A;  3J7Y b;  2GVP A;  4ECB A;  3RHC A;  1B2S A;  2H6Z A;  4HJL B;  4WYK B;  2R0P A;  4Z2U A;  3J7Y d;  1TTZ A;  1FOH A;  2R5G A;  3FH1 A;  2Q07 A;  3Q6O A;  4G0L A;  1BNR A;  1UA5 A;  2OAC A;  2BMR B;  2CFL A;  1A2P A;  2VAF A;  4I2T A;  2G0F A;  4GF0 A;  1MWU A;  4HDE A;  2GBX B;  3ECF A;  3F6D A;  5DCG A;  3IJE B;  2O87 A;  4TR3 A;  1DUG A;  3LWA A;  1BSE A;  2BTO T;  1G7E A;  3WA3 A;  3G4S 3;  1MEK A;  1MTC A;  1YIT 3;  2XEP A;  3GWR A;  5IMV A;  1OKD A;  2BO9 B;  1W6Y A;  3Q2P A;  3TDG A;  2FWE A;  2L59 A;  4ECJ A;  2YWO A;  1N5H A;  4JU5 A;  3SX1 A;  2YN1 A;  3TOU A;  1AC1 A;  4RNZ A;  3D6I A;  1IU7 A;  1O8W A;  4K1F A;  1BAY A;  4POB A;  3MSO A;  3URP A;  1XZO A;  4WXT A;  1AAZ A;  1C72 A;  1GYB A;  5IEN A;  1K3O A;  1ML6 A;  3TKQ A;  4D73 B;  3IR4 A;  2CX4 A;  1M7T A;  1OCV A;  2BIR A;  4KAE A;  14GS A;  2HZE B;  1TU8 A;  3G8Z A;  3IC8 A;  1IQX A;  1YEX A;  4KFE A;  4O8S A;  3O6T A;  5D8I A;  5G1K A;  3IAM 2;  1ROA A;  3QDN A;  4AKY A;  2REM A;  5ECH B;  1SD9 A;  1KNG A;  3WYW A;  3ZTL A;  4EXJ A;  5J3R A;  1B4Q A;  4H86 A;  1OH0 A;  3TKS E;  3MIX A;  2B24 B;  3BIR A;  5M18 A;  1YJN 3;  4DVC A;  2F4Y A;  3BD2 A;  1HKX A;  4BL7 B;  1RGA A;  2GT5 A;  1GTI A;  4EYC A;  3LFL A;  2ZUP A;  1RN7 A;  5INY A;  2EIR A;  3G7I A;  2GZZ A;  2BNG A;  2WB9 A;  1EOG A;  2LRT A;  1AVL A;  4FMA A;  3IA1 A;  5ENU A;  2W2C A;  2WGQ A;  1V74 A;  4XCS A;  5DAL A;  3W6G A;  1K0O A;  4JZQ A;  1GTA A;  1RGG A;  4TOP A;  2L4Q A;  3F7X A;  3OX9 A;  1BRJ A;  3QMX A;  1WMN A;  2CK3 H;  1GOV A;  4HM2 B;  1XFL A;  4JED A;  4XBY A;  1PFP A;  5STD A;  1BRI A;  1ERU A;  1V98 A;  2F9S A;  3BJ5 A;  3UAR A;  4OCE A;  1VF2 A;  2KLX A;  2ZNM A;  1O6J A;  1ZO2 A;  5BIR A;  4MZB A;  2DJ3 A;  2HSY A;  3VGN A;  4G0K A;  2IMJ A;  3FYG A;  4GRF A;  4HU9 A;  4X0X A;  4YKF A;  2K9F A;  1KC8 4;  2V41 A;  3HVS A;  5DCH A;  4L8P A;  3MNG A;  2HRA A;  2H76 A;  5JCG A;  2YZU A;  3CCR 3;  3HJP A;  4BVX B;  4HS1 A;  3I9V 2;  4JRF A;  3GSP A;  1OC9 B;  1TJD A;  3GMF A;  4XBX A;  3ALA A;  4LA1 A;  3GSS A;  2IA7 A;  3X3Y A;  1YJ9 3;  1UDI I;  5EPF A;  4MMY B;  3S28 A;  4IQ1 A;  4Q53 A;  1Z5Y E;  4K8M A;  5C00 A;  1RW1 A;  1E2Y A;  4J5G A;  5G2Z A;  1U6T A;  5KP4 A;  1MWR A;  3FLJ A;  4KDY A;  6RNT A;  3EF8 A;  1T00 A;  4WET A;  1K28 A;  22GS A;  2IWT A;  3M8C A;  5KN0 A;  1RDS A;  2R3X A;  2C3Q A;  4O5U A;  4LGQ A;  2J8X B;  5CP1 A;  5G30 A;  3DGO A;  3LEF A;  1UCJ A;  1PSQ A;  2CQ9 A;  2F56 A;  2IUK A;  5RNT A;  4WYK A;  3EUR A;  3ROB A;  1ST9 A;  3L9V A;  4ML6 A;  4ZBA A;  3GST A;  5ECQ B;  1TFO A;  1DMM A;  1CQH A;  2DJ0 A;  4GHO A;  3D5I A;  4EDY A;  2H30 A;  1MNL A;  5AGY A;  5ECI B;  3PZW A;  1JKG B;  3FSD A;  4EBG A;  1UCL A;  2C4J A;  5ECK B;  4KUN A;  2HMN B;  2RBI A;  5HQP A;  2LEG A;  3KP8 A;  3DML A;  3NOF A;  3G7Y A;  1K0A A;  1R5P A;  3KGK A;  2KP1 A;  3GZB A;  5HOH A;  2VCV A;  4BIK A;  3CPO A;  5IIZ A;  2E2U A;  2L4V A;  1FW1 A;  3SYU A;  3FZ4 A;  4IHU A;  4HM3 B;  1V58 A;  1FB0 A;  4KB3 A;  4N6L A;  4HSC X;  1RMS A;  5LCZ A;  2MBT A;  1ULJ B;  3H79 A;  1QAL A;  2H0H A;  3EE2 A;  1GY6 A;  3DYR A;  1SAR A;  4TXO A;  4ZIL A;  1Y4K A;  1MWS A;  1FYS A;  2GXF A;  3G6E 3;  1EP8 A;  3ER7 A;  4IN0 A;  3IDV A;  1UC7 A;  1IYH A;  4FCJ A;  4CPK A;  1BUJ A;  2OA7 A;  2B3S A;  3OXA A;  3TJK A;  2Z6B A;  1EEM A;  3KP9 A;  3UMA A;  1NWW A;  4NV2 A;  2F3M A;  4WHA A;  1TRS A;  3ZVJ D;  1QUW A;  2YZH A;  3F8U A;  5B8B A;  5G1L A;  2X49 A;  1X1X A;  2C8U A;  4IBP A;  9RNT A;  1UI8 A;  2RCD A;  2X8C A;  2OE0 A;  2XFS A;  3BOA A;  1R4W A;  3I6A A;  1B3S A;  3CRU A;  1UGH I;  1RN1 A;  4MH2 A;  3WGD A;  5D9V A;  2CT6 A;  4PNG A;  4EXR A;  3UL5 A;  1Q40 B;  3JCM L;  2DKH A;  1FGQ A;  1AQX A;  1NB3 I;  4WF4 A;  1RGE A;  4O5Q A;  2I1U A;  1GSE A;  5ECL B;  4K5R A;  3QAG A;  3NV0 B;  2CV4 A;  3DZL A;  3V1W A;  2IL3 A;  2I9W A;  4NHW A;  4IP6 A;  4WWU C;  5DJL A;  2ZCT A;  4OFT A;  1GD3 A;  4I8B A;  1ULI B;  1I5G A;  2QA2 A;  2GZY A;  3FW2 A;  4HM6 B;  1LVN A;  2XSH B;  4XRD A;  2XSO B;  3BCI A;  2HZF A;  3GFK A;  2NTO A;  3F3R A;  1CH0 A;  2HMO B;  1GNW A;  2VCZ A;  1TW9 A;  5JCU A;  1DE2 A;  3WOF B;  4PQ1 A;  1XPV A;  3K0Z A;  3OWU A;  11GS A;  3DGN A;  4HVN A;  2HFD A;  4FYU A;  1FGR A;  4RI6 A;  2H6X A;  2EIQ A;  2XGL A;  2R0G A;  3ZRE A;  3F4S A;  4NV5 A;  1PN0 A;  1F8N A;  3FCS B;  3IHG A;  3HY2 A;  2C0F A;  1TUH A;  2VM1 A;  2B5Y A;  5CXO A;  2C3T A;  2IN3 A;  3PPU A;  3V92 A;  1U8C B;  1B9Y C;  2PER A;  2N5A A;  2PVO C;  1TRW A;  3DWV A;  4G9H A;  3EIN A;  4BPY A;  5EVH A;  1A90 A;  3HII A;  2YWM A;  1JZO A;  4BWS A;  4HBR A;  4K7O A;  2YPM A;  2JQ5 A;  2L6D A;  4F0C A;  1Q42 A;  5E4W A;  2GQL A;  1W02 A;  1D6Y A;  2E0Q A;  3MG1 A;  2XPE A;  1ERV A;  4IKH A;  3DIE A;  4RQR A;  2W9Q A;  2HMJ B;  1NO3 A;  3CTF A;  1TDI A;  2ZHX B;  1NU3 A;  1W2B 2;  1G6Y A;  1SK1 A;  2NBS A;  2AB6 A;  2PGT A;  3OR5 A;  1WJK A;  1WWJ A;  4ZL8 A;  1MD3 A;  2MF7 A;  1I0X A;  2AHE A;  2H73 A;  1GSQ A;  4X43 A;  1OC8 A;  4F03 A;  3L0H A;  4L0U A;  5LD0 A;  2H01 A;  4TKY A;  3JVC A;  3LOY A;  4ID0 A;  2UZ8 A;  1S3C A;  2YWN A;  1UCI A;  2PN8 A;  2GEY A;  2IMF A;  5AEU B;  3LTC A;  4KSM A;  4CCV A;  3X40 A;  3ZFZ A;  1FVK A;  1M99 A;  1DMN A;  2F51 A;  4L8O A;  1VQ7 3;  1PX6 A;  4DSR A;  3WOD G;  4ILF A;  1IQY A;  2H1G A;  3F0I A;  4AGS A;  1GSD A;  5CNW A;  4YQU A;  1I2G A;  1TXX A;  2E2V A;  4CW9 A;  1BJX A;  1Q7Y 4;  1Z6N A;  4MAB A;  3HVV A;  5IG3 A;  5IG5 A;  2VLU A;  3TUE A;  1F3A A;  5AIX A;  1ASK A;  1ZYE A;  4OCF A;  2B1L A;  2AAD A;  3CSH A;  3FMW A;  3RGA A;  1WQL B;  4HOH A;  1BNS A;  2CVB A;  1BUQ A;  4IQA A;  1BRG A;  2GSP A;  1D6U A;  1Q40 A;  3GX0 A;  4E8H A;  1BNJ A;  5BVB A;  3FEU A;  3FZA A;  2WOF A;  4ORL A;  2KRT A;  2NDO A;  4Q5Q A;  3D9R A;  2MMZ A;  3CSJ A;  2HMM B;  5E59 A;  4R4K A;  1QVG 2;  4N6V 0;  2C80 A;  2STD A;  2WZ9 A;  1GUM A;  1Z3E A;  3PCR A;  4BL2 A;  1GSP A;  1M9G A;  1X9M B;  4J57 E;  1WP0 A;  2B6M A;  3PIN A;  2JZR A;  3UVT A;  3UNL A;  3M8N A;  1OE8 A;  2KF3 A;  2O9U X;  3KSP A;  2B5X A;  4OVM A;  2DBC A;  1ZGX A;  3ZVJ A;  4R1K A;  4PXO A;  2WJU A;  1JFU A;  4WFO A;  2DML A;  1RQM A;  4OUQ A;  1KD1 4;  1A2M A;  2GS3 A;  1HYU A;  2OTJ 3;  4PX1 A;  3J7Y k;  5CRH A;  3P90 A;  2H1B A;  3KD0 A;  4N6N B;  1AUC A;  1VF3 A;  2INX A;  2UGI A;  5AEW B;  3U6V A;  1W01 A;  1LQM B;  1F3B A;  2B7K A;  4EV5 A;  6GSV A;  5IMC A;  3W8J A;  2R6K A;  3A76 A;  3CU3 A;  2FY6 A;  2VCT A;  2XBI A;  2XBQ A;  3IE3 A;  3VPQ A;  1R7H A;  4D73 A;  3I69 A;  1SYR A;  4KDU A;  1TTO A;  1K41 A;  1BIR A;  5EQL A;  4K1V A;  4EUY A;  2H1D A;  4XB5 A;  5M1A A;  2QC7 A;  1Z7R A;  3BNC A;  2XHF A;  3FKA A;  1UGI A;  2F99 A;  3EMX A;  1THO A;  4X2O A;  4BTW A;  1A2V A;  1ERT A;  4GQC A;  1MDK A;  1X0R A;  1LQG C;  4POL A;  1BAN A;  3DH2 A;  3AMO A;  3BCK A;  3RNT A;  2P0G A;  4IVF A;  3WA2 X;  4MF6 A;  4IS0 A;  7RNT A;  1JB2 A;  3RAZ A;  4U13 A;  1V57 A;  2LQV A;  4J2F A;  1OKT A;  1K3Y A;  2CVD A;  4X2H A;  2MMN A;  5IMZ A;  5AII A;  1HNB A;  3ZLP A;  2RLI A;  1TKD B;  4BA7 A;  4L7K A;  2R4I A;  3F14 A;  2FNQ A;  3IV4 A;  1TFK A;  2RM6 A;  3EYT A;  3C8E A;  3CCU 3;  2OAD A;  3T0U A;  2VUP A;  5EL8 A;  4RI7 A;  2HE3 A;  1SJI A;  3S5C A;  2L4C A;  3GH6 A;  3VWV A;  4BWQ A;  2DSA A;  3P8W A;  2CWU A;  3LW9 A;  4ZB8 A;  1WNH A;  2PNC A;  4LL4 B;  1YNV X;  3L9S A;  4J56 E;  1BED A;  3JUM A;  4RQX A;  4OMV A;  5ABR A;  1IVW A;  5EY6 A;  5DAK A;  4TX4 A;  2RUF A;  4HAA A;  4JRR A;  1BGS A;  1GUH A;  3KFQ C;  3EVI A;  4KT3 B;  7STD A;  2QEX 3;  4IW9 A;  3IOS A;  1HD2 A;  3IK9 A;  20GS A;  3WR2 A;  1PY3 A;  4O32 A;  1BOX A;  1KEB A;  3D4M A;  5ECO B;  1G0T A;  4HEA 2;  3TOT A;  3BLZ A;  1EV9 A;  1VF1 A;  3TKS C;  4FCZ A;  5DRV A;  1XCC A;  3QD9 A;  1U3A A;  1LOY A;  3NM2 A;  3GKK A;  4IJI A;  4USS A;  2RSX A;  1YJ6 A;  1GOU A;  3LG6 A;  1S72 3;  1JHB A;  3G16 A;  3BBY A;  1SL1 B;  3ZIJ A;  2WDU A;  2DJ2 A;  2M72 A;  4LEH A;  3SXX A;  5BRT A;  1Q9E A;  4KX4 A;  3FR6 A;  3LQ7 A;  2C3N A;  1B2Z A;  4F0B A;  2OE3 A;  1OYJ A;  3HVX A;  3HJO A;  1CYV A;  1NDO B;  7GSS A;  2VL3 A;  5DVB A;  4MMX B;  2WCI A;  3VI5 A;  1YZX A;  5IMA A;  2UX0 A;  2CVK A;  4R9L A;  5JWO B;  4GST A;  2E2G A;  3I0Y A;  1QXH A;  2GLR A;  1XWG A;  4N6M A;  3MAK A;  4ZL9 A;  5B6N A;  1WIK A;  2FUG 2;  1PFO A;  2O8V B;  3D5G A;  3G7J A;  4KDX A;  1B21 A;  2OOV A;  3GUR A;  1XWC A;  4MA9 A;  2ZL8 A;  4NHF A;  1GL8 A;  4GCI A;  2QKE A;  1W6C A;  5B8A A;  3FK8 A;  3HCZ A;  3LZA A;  5GZZ B;  4NRE A;  5J9C A;  1YF1 A;  5D9W A;  1VQ6 3;  3VWW A;  2XR8 B;  2OTL 3;  3K8N A;  2R37 A;  4K61 A;  3E9J B;  1JZW A;  4XDW A;  2A2P A;  5BMU A;  1VQL 3;  1OVN A;  1CQS A;  5KOW A;  2CH9 A;  1N8R 4;  1W4V A;  2VM2 A;  1T3B A;  5L71 A;  4MJD A;  2VLT A;  1RGC A;  3BNB A;  4TR4 A;  4O7H A;  1Y6E A;  2A2S A;  2IJY A;  3CMA 3;  4K90 B;  3IBH A;  1NM3 A;  5DQS A;  4XS4 A;  4MPG A;  5CK6 A;  2V6K A;  3ZG0 A;  1ZCP A;  1VQQ A;  2G2Q A;  1ZS7 A;  1VQN 3;  3HZ4 A;  2P5R A;  3DVX A;  3VUR A;  2VCX A;  4Q5F A;  2LKU A;  2YFL B;  4IGJ A;  2DC5 A;  1IVX A;  1K3L A;  4ZL7 A;  1YKC A;  1LOW A;  3GN3 A;  1GMQ A;  1BSB A;  3QAV A;  4OFN A;  2YAN A;  1JBS A;  2O85 A;  4MF7 A;  4AEQ A;  4K2D A;  5GAN D;  1TU7 A;  3KSE D;  2H0I A;  2K54 A;  3MG3 A;  1O73 A;  4WBR D;  3Q19 A;  4G10 A;  3LTA A;  4GTU A;  1BRK A;  2W03 A;  5HR3 A;  6GST A;  4HM5 B;  3C7M A;  4TRX A;  1S5A A;  2C10 A;  3F9S A;  5D93 A;  3STD A;  4MJC A;  1JLW A;  4FYB A;  1G02 A;  2IUJ A;  3GAX A;  3FGY A;  3ZMK A;  5KOX A;  2LQQ A;  4OD7 A;  3DVW A;  3EJV A;  1X5D A;  1A0R P;  2DJJ A;  1BRN L;  4YAV A;  1MOL A;  4BVX A;  2CZ3 A;  1IV7 A;  2VLV A;  3SWL A;  4YQV A;  3HDC A;  4Q5R A;  5F8B A;  1SKR B;  4KF9 A;  2VL2 A;  4KVH A;  3FG1 A;  3A3T A;  1OHP A;  2KF6 A;  3NZN A;  3KE7 A;  1SK0 A;  1XVQ A;  3Q18 A;  1HQO A;  3KCM A;  4PQI A;  2JL4 A;  3R2Q A;  2CX0 A;  1QAF A;  4LMW A;  1PU4 A;  1XW6 A;  4HM0 B;  3RDW A;  3L9U A;  3RBT A;  8RNT A;  1BNI A;  1K0D A;  3DKS A;  5G5E A;  1PX7 A;  1FGT A;  3GHA A;  2RNT A;  3KEB A;  5AIH A;  3UL3 A;  5IF6 A;  1G6W A;  4STD A;  3SOY A;  1ZL9 A;  3GRD A;  3U5R E;  3KMO A;  1V2A A;  2LNS A;  1BSA A;  2N5F A;  1LU4 A;  4DEJ A;  2MYG A;  2X99 A;  1JV2 B;  4O92 A;  3X42 A;  1USB A;  1FGM A;  1PL2 A;  5JWQ B;  1OHS A;  1ZYQ B;  1AY7 A;  1EOH A;  2FXT A;  1VRS D;  3JUQ A;  2Z7A A;  3F9U A;  1ACV A;  1PA3 A;  1OC3 A;  1QMV A;  1AR0 A;  2H19 A;  3KCH A;  1GUK A;  1PKZ A;  4WR4 A;  3DEX A;  4HZ2 A;  1I9D A;  1R4C A;  4NXI A;  2DIZ A;  1YHQ 3;  3MDK A;  4ZM8 A;  1DE1 A;  1O7N B;  2CC3 A;  5G2G A;  4BIR A;  2YFI B;  2VD1 A;  1X5C A;  3P2A A;  4K0G A;  2HRK A;  1U5O A;  4GXZ A;  1FA3 A;  3AHS A;  4BU4 A;  2OOV C;  3D3L A;  1TIJ A;  3JUO A;  4GSN A;  1L5G B;  2I9H A;  4JF8 A;  1H4O A;  5KN1 A;  1X1Y A;  2Z76 A;  3X41 A;  3GKN A;  2F5W A;  1SL0 B;  3H51 A;  5CF1 A;  5HFK A;  1W00 A;  1RGH A;  2R4V A;  4TVE A;  2H0G A;  5FGO A;  3CNX A;  3TRP A;  1W89 A;  2QA4 3;  2P0M A;  4JE1 A;  3PYJ A;  1KWI A;  1LBK A;  3UEM A;  4Z2R A;  2W0Q A;  1EA2 A;  5ECR B;  5J9B A;  3EN8 A;  3VK9 A;  3AGO A;  2GGT A;  3QFB C;  2F8F A;  1DYU A;  2L5L A;  2CAQ A;  3WMD A;  4HU7 A;  2BU4 A;  3MYT A;  3KH7 A;  1RSN A;  3TJG A;  4XS1 A;  4EL1 A;  1ISK A;  2YFJ B;  3MG2 A;  3DXB A;  4KCA A;  4HI7 A;  1OGX A;  4KZ1 A;  4XHM A;  2KAA A;  2CAI A;  1IT8 A;  1U87 A;  4XRA A;  5JCW A;  1VQ4 3;  2C0D A;  3JUN A;  5JWR B;  3D5J A;  4A5P A;  2FLS A;  12GS A;  3N5O A;  4YQM A;  4KND A;  3EB8 A;  3I43 A;  2VCW A;  3M9J A;  1WMP A;  2IPA A;  4ZB6 A;  4F82 A;  2CHC A;  2CWT A;  2V1M A;  1RGF A;  3HXS A;  5IEO A;  2BHM A;  2M46 A;  1O81 A;  3AHW A;  3GZX B;  1DE3 A;  1GMR A;  1Z6M A;  3KZQ A;  2K0M A;  4HUA A;  19GS A;  5LC6 A;  1TP9 A;  1RKY A;  5IOW A;  3GH9 A;  3RDE A;  1FAA A;  1PQN A;  5H5S A;  4OFM A;  4XBT A;  1D6Z A;  1B2U A;  2OWP A;  4K5S A;  1VQ9 3;  5KP3 A;  3CTG A;  1QFN A;  2C4B A;  3ZG5 A;  4FCM A;  4TXV A;  3SBC A;  4PEJ A;  1BU4 A;  2DJ1 A;  1CQG A;  5A0O B;  1STF I;  3NQZ A;  3H93 A;  3T8N A;  3IPZ A;  1R5A A;  4HJM A;  3EX9 A;  1OE7 A;  1PMT A;  4KFD A;  3APO A;  5IMD A;  5J41 A;  1T5Y A;  2CFD A;  4FQU A;  3OW2 2;  1A2K A;  3CRT A;  1GRX A;  4WF5 A;  2YV9 A;  2CWV A;  1X1U A;  2C11 A;  3LJR A;  3O76 A;  1SJ6 A;  2HMK B;  2OBK A;  1XOB A;  1PGT A;  3N8B A;  1KQS 2; 
#chains in the Genus database with same CATH homology
 4AJ8 A;  1Q98 A;  2TIR A;  1PD2 1;  2HRN A;  3QCP A;  4CY8 A;  2A4V A;  2K8V A;  3DD3 A;  3GX8 A;  3CMI A;  1FHE A;  3CBU A;  2X4A A;  3EU4 A;  2H1A A;  3F3Q A;  5IQY A;  5FWG A;  5B7C A;  3ZZX A;  3WGE A;  5CYY A;  3GV1 A;  2GDR A;  1J0F A;  4HQZ A;  2V32 A;  2IMD A;  1A24 A;  2AYT A;  4NMU A;  4ML1 A;  3WT1 A;  4BVY A;  1TK0 B;  1EWX A;  4K6X A;  3TKR A;  1YY7 A;  1Z7P A;  5IO2 A;  3VFI A;  2JZT A;  3TB2 A;  3FZ5 A;  2C1Y A;  2YJ7 A;  3FR3 A;  1A8L A;  2VOC A;  1B48 A;  5A4U A;  3ZFB A;  5B6M A;  3DGQ A;  1GLQ A;  3DRN A;  2YP6 A;  1GUL A;  2AUV A;  3TKP A;  5GST A;  4FYC A;  4OO4 A;  1KBN A;  3CSI A;  4L5O A;  4I97 A;  4HQS A;  5HR2 A;  4DSS A;  1NSW A;  3M0F A;  5HR0 A;  1DBY A;  2K8S A;  4HZ4 A;  4KSO A;  2WRT A;  4EKZ A;  3GL3 A;  5A4W A;  3HHV A;  2IFQ A;  2NPB A;  3RHB A;  1M2B A;  5CRE A;  9GSS A;  5DBQ A;  3QPM A;  3GRX A;  4MNN A;  4ULX A;  2PBJ A;  4ICY A;  2LJA A;  4I5Q A;  1NHO A;  2MBS A;  4MJB A;  2IYJ A;  2L57 A;  4LL1 B;  17GS A;  2IME A;  1A2L A;  4TN8 A;  2JSZ A;  3UJ1 A;  2WGR A;  2HRF A;  3KIJ A;  4O5R A;  1VGL A;  3LYP A;  3ZIT A;  3VPT A;  3GKM A;  5KN3 A;  1B8X A;  2O89 A;  4WBJ A;  1SJZ A;  4GQF A;  4HOJ A;  5AN1 A;  2GQM A;  4XS4 B;  2ALB A;  3ERW A;  5ID2 A;  3E0U A;  1BX9 A;  1T8E B;  1OAZ A;  1A8Y A;  2PUK C;  5DQY A;  4KCE A;  5AIS A;  1GP1 A;  4WR5 A;  1SKS B;  2OKA A;  4ECI A;  5HR1 A;  2TRX A;  3TGZ A;  3HKR A;  5J4U A;  5A5K A;  2YJH A;  3KTB A;  1U3I A;  2CA8 A;  3H8Q A;  4FO5 A;  2XC2 A;  2RM5 A;  4MDC A;  6GSW A;  4MCU A;  1X9W B;  1AXD A;  2JZS A;  3C1R A;  1SKW B;  1A0F A;  4GWR A;  1A2J A;  3PGT A;  4BL7 A;  4K2X A;  2WFC A;  4F2I A;  2BMX A;  3IAS 2;  5KN2 A;  1ZYN A;  2QGV A;  3CYN A;  5DDL A;  5HFI A;  4X1U A;  3Q74 A;  10GS A;  2GT6 A;  1BYE A;  1QQ2 A;  5IMF A;  3D22 A;  2VL2 C;  3GA4 A;  2IFQ B;  5CRG A;  1V40 A;  2X64 A;  1TK8 B;  3G9B A;  2HZE A;  2RII A;  1FB6 A;  2GZP A;  2C0G A;  4ZXG A;  4Z2T A;  2LUS A;  4MPF A;  3PH9 A;  4GSS A;  5COH A;  4V2M A;  2AJQ B;  8GSS A;  1WRY A;  3KM6 A;  3PR8 A;  4AJ7 A;  1QGV A;  4P3Y B;  2IMI A;  2QA1 A;  1ILO A;  2HLS A;  3ZYW A;  4HJ2 A;  1UVZ A;  1JLV A;  4FIW A;  3W8S A;  2P5Q A;  2ON7 A;  4KH7 A;  2PWJ A;  1XIY A;  1K0M A;  2ON5 A;  1PL1 A;  1LJR A;  5ELG A;  3HA9 A;  5F05 A;  5KEJ A;  4KE3 A;  5GAP D;  5F0G A;  1F37 A;  2HNL A;  2K6V A;  3KMN A;  2KHP A;  3C73 A;  4G0I A;  1U88 A;  1ZGN A;  2AAW A;  2X8G A;  6GSS A;  2B5E A;  2ES7 A;  1MDI A;  3LXZ A;  4IP1 A;  5D96 A;  3M9K A;  2PPT A;  3FR9 A;  2IIY A;  2YNX A;  5AIV A;  5FHI A;  5F07 A;  3MSZ A;  3GKX A;  2J23 A;  1T4Z A;  1GTU A;  3H4K A;  3GL5 A;  3TCO A;  4NWY A;  1AQV A;  3L4N A;  3AY8 A;  5DAK B;  4L0W A;  1SYX A;  4MK3 A;  2GSS A;  4XIH A;  2FNO A;  5F06 A;  3ZFL A;  2LQO A;  2WUL A;  5H5Q A;  5D73 A;  1GSY A;  1TRU A;  4MZW A;  1K0B A;  3KXO A;  1DSB A;  2E7P A;  3KTL A;  4EIP A;  2LRC A;  3C71 A;  2TRC P;  3LXT A;  3HZ8 A;  2FA4 A;  3MYD A;  2OBI A;  4QL9 A;  3ZML A;  2DKI A;  2VD0 A;  3FZ9 A;  1PKW A;  2JU5 A;  3ERF A;  3UVH A;  4Q5N A;  1GSF A;  3N9J A;  4V2N A;  4L8E A;  3QAW A;  3S9F A;  2KUC A;  4PNF A;  4MLY A;  5HFG A;  2NVL A;  3F6F A;  2GQK A;  5IM9 A;  2K18 A;  3UOM A;  4ZB9 A;  2LV3 A;  4G19 A;  1MDJ A;  2P31 A;  3GTU A;  4MJA A;  4N0V A;  2DIY A;  2JAC A;  5IO0 A;  1TI3 A;  4ISD A;  2CX3 A;  2KP2 A;  3QOU A;  2GSQ A;  1AQW A;  4K9Z A;  3WT2 A;  4KW6 A;  1M9B A;  1T7P B;  1K0C A;  2FCH A;  1WOU A;  2HSM A;  2MMO A;  2HXK A;  3RPN A;  1NW2 A;  4EDZ A;  3TRQ A;  4DSS B;  1FO5 A;  3TKS A;  5ELA A;  1GNE A;  1ZOF A;  2DMM A;  4PGT A;  1WPI A;  2QSI A;  3F4T A;  1GSS A;  1JZR A;  5CRW A;  1XWB A;  5FT3 A;  1EGO A;  3GYK A;  4OO5 A;  4PUF C;  1A23 A;  1OC9 A;  4EF0 A;  1XOA A;  5GSS A;  4YH2 A;  4RUV A;  3F63 A;  4EC0 A;  4G2E A;  2H66 A;  2CZ2 A;  3VLN A;  1SK2 A;  4TW5 A;  3A2V A;  1B9X C;  2FGX A;  3UBL A;  1TOF A;  5CAX A;  2FD3 A;  2X8H A;  1R26 A;  4QQ7 A;  2AV4 A;  1K0N A;  1SEN A;  1FVJ A;  3C1S A;  4OWY A;  4ACS A;  3HD5 A;  1T4Y A;  3ISO A;  2FWF A;  2LJK A;  3EWL A;  2IY2 A;  1E6B A;  4KGI A;  2HI7 A;  2H75 A;  1J9B A;  3TJB A;  5IOX A;  3R3E A;  3A5I A;  4F9Z A;  3GUS A;  2F8A A;  3EPT A;  4N30 A;  1BG5 A;  1X9S B;  1HNC A;  2YV7 A;  2FWG A;  4TR0 A;  3HYP A;  3A5W A;  4NPB A;  1O8X A;  3EMP A;  4X4J A;  4ZIJ A;  1ZZY A;  2R2J A;  1XW9 A;  1AIU A;  4MP4 A;  2HT9 A;  2I3Y A;  2LTK A;  3QFA C;  1ERW A;  4V2L A;  2YCD A;  2B1K A;  5ECN B;  1XWK A;  1XXU A;  1YEP A;  3E3E A;  3MWH A;  1N8J A;  3VWX A;  2KOK A;  4BVY B;  3A2X A;  4PQH A;  1G7O A;  1F6M C;  2PVQ A;  2I81 A;  3CXG A;  1S3A A;  3L78 A;  2A4H A;  2JSY A;  5EVO A;  2IMK A;  4I2U A;  1M9A A;  4MMM A;  1GH2 A;  3FY7 A;  4QL7 A;  3LOR A;  3LYK A;  1WMJ A;  3APS A;  1O7U A;  4XS6 A;  4KA0 A;  5ECP B;  3ZL5 A;  4L5L A;  3GTU B;  2VCQ A;  4DSQ A;  5IPG A;  3D4T A;  1FOV A;  1ZMA A;  2LJR A;  1GWC A;  1SL2 B;  6GSY A;  1EGR A;  1RK4 A;  4I6X A;  3TJF A;  1VF4 A;  1SD8 A;  1JZD A;  5J5N A;  4Z7X A;  2GSR A;  5DAL B;  4E8E A;  4V1A g;  3A2W A;  1X5E A;  2XPD A;  4IJ3 A;  4POK A;  3P7X A;  2FA8 A;  1F2E A;  1GTB A;  4N0Z A;  4MF5 A;  4N11 A;  4JR4 A;  5D9T A;  1H75 A;  1HNA A;  2EC4 A;  4ECC A;  3NIV A;  1EEJ A;  4JBB A;  2C0E A;  2FWH A;  4JR6 A;  3M1G A;  3LSZ A;  3RPP A;  1B4P A;  3QR6 A;  2DJK A;  1Z9H A;  3WGX A;  4NAX A;  5LNK e;  3GNJ A;  3US3 A;  4K7I A;  4EIQ A;  4TR1 B;  2LRN A;  1O85 A;  4XTS A;  3IRA A;  1NHY A;  3IHQ A;  2R0C A;  2WS2 A;  1BQ7 A;  5D9X A;  4K7N A;  4PTS A;  4LLR A;  5H5R A;  1ON4 A;  3H1N A;  4POM A;  1THX A;  2H71 A;  3ME8 A;  4MH3 A;  3LGC A;  1ZYP A;  2VO4 A;  4EE0 A;  3EC3 A;  1AW9 A;  3IK7 A;  2BJX A;  3TJJ A;  16GS A;  3UBK A;  2V2G A;  4IEL A;  1TK5 B;  1M2A A;  2GST A;  4ZBB A;  4NHZ A;  4YKG A;  3KJY A;  4N10 A;  4AJ6 A;  2VL9 A;  1ABA A;  5ECS A;  4ZBD A;  2LNT A;  2DLX A;  2OE1 A;  2H6Y A;  4V1A p;  1GSU A;  1Y25 A;  3FRC A;  4YAP A;  3WD6 A;  1XWA A;  3IC4 A;  3ZRD A;  1J08 A;  1URM A;  5CRD A;  2H74 A;  3FHK A;  2JAD A;  3VWU A;  5DJM A;  1YDK A;  13GS A;  1YF0 A;  2O7K A;  6GSX A;  1T1V A;  4WEY A;  1IYI A;  1PN9 A;  4MJE A;  1KTE A;  5G31 A;  3F4R A;  2H70 A;  3O3T A;  2LST A;  1EV4 A;  4CHS A;  1TI1 A;  5G5F A;  3FKF A;  5C04 A;  3GIX A;  1YKA A;  4FH8 A;  3D0Z A;  2YOI A;  1QK8 A;  2GTU A;  5CO3 A;  4CY6 A;  1V9W A;  1GLP A;  2A2R A;  4GLT A;  4LMV A;  2MZC A;  2VIM A;  3EU3 A;  4AF2 A;  4TXO B;  2MMA A;  2V6O A;  2YWI A;  3UIW A;  3HJM A;  18GS A;  1WE0 A;  3UAP A;  1PRX A;  4WKW A;  3APQ A;  1M2D A;  3TRX A;  2RUE A;  3ERG A;  5A4V A;  4PUR A;  1MD4 A;  2I4A A;  3VI7 A;  1EZK A;  1F9M A;  2EIO A;  2L5O A;  1EP7 A;  3M3M A;  3ED3 A;  2B7J A;  2PMT A;  2L6C A;  6GSU A;  1S3D A;  1XBS A;  3IXR A;  1FG4 A;  1XVW A;  1UN2 A;  3KH9 A;  2LS5 A;  1YQ1 A;  1M0U A;  2FHE A;  2HYX A;  2Z9S A;  2H8L A;  4MZC A;  1Q4J A;  1TRV A;  1SU9 A;  4K0N A;  2N5B A;  2E2M A;  2OJL A;  4TR1 A;  4CDO A;  5ID2 B;  2M80 A;  2PU9 C;  1XW5 A;  3ZIV A;  2D2Z A;  3D21 A;  3ME7 A;  5IPH A;  4EVM A;  2H72 A;  4PUA A;  5ECM B;  1N2A A;  2HSH A;  2J9H A;  4EO3 A;  3J7Y b;  2GVP A;  4ECB A;  3RHC A;  2H6Z A;  2R0P A;  4Z2U A;  1TTZ A;  1FOH A;  2R5G A;  3Q6O A;  4G0L A;  1UA5 A;  2OAC A;  2VAF A;  4I2T A;  2G0F A;  4GF0 A;  4HDE A;  3F6D A;  5DCG A;  2O87 A;  4TR3 A;  1DUG A;  3LWA A;  2BTO T;  1G7E A;  1MEK A;  1MTC A;  5IMV A;  1OKD A;  4ECJ A;  2FWE A;  3TDG A;  2L59 A;  2YWO A;  4JU5 A;  2YN1 A;  3TOU A;  1AC1 A;  3D6I A;  1O8W A;  4K1F A;  1BAY A;  4POB A;  1XZO A;  4WXT A;  1AAZ A;  1C72 A;  1K3O A;  1ML6 A;  3TKQ A;  4D73 B;  3IR4 A;  2CX4 A;  1M7T A;  4KAE A;  14GS A;  2HZE B;  1TU8 A;  3IC8 A;  1YEX A;  3O6T A;  5D8I A;  5G1K A;  3IAM 2;  3QDN A;  2REM A;  5ECH B;  1SD9 A;  1KNG A;  3WYW A;  3ZTL A;  4EXJ A;  5J3R A;  1B4Q A;  4H86 A;  3TKS E;  3MIX A;  4DVC A;  3BD2 A;  4BL7 B;  2GT5 A;  1GTI A;  3LFL A;  2ZUP A;  5INY A;  2EIR A;  3G7I A;  2GZZ A;  2WB9 A;  1EOG A;  2LRT A;  3IA1 A;  5ENU A;  4XCS A;  5DAL A;  3W6G A;  1K0O A;  4JZQ A;  1GTA A;  4TOP A;  2L4Q A;  3QMX A;  1XFL A;  4JED A;  1V98 A;  1ERU A;  2F9S A;  3BJ5 A;  3UAR A;  4OCE A;  1VF2 A;  2KLX A;  2ZNM A;  1O6J A;  4MZB A;  2DJ3 A;  2HSY A;  4G0K A;  3FYG A;  4GRF A;  4HU9 A;  4X0X A;  4YKF A;  2K9F A;  2V41 A;  3HVS A;  5DCH A;  3MNG A;  2HRA A;  2H76 A;  5JCG A;  2YZU A;  3HJP A;  4BVX B;  4HS1 A;  3I9V 2;  1OC9 B;  1TJD A;  3GMF A;  4LA1 A;  3GSS A;  5EPF A;  4IQ1 A;  1Z5Y E;  4K8M A;  5C00 A;  1RW1 A;  1E2Y A;  5G2Z A;  1U6T A;  4KDY A;  1T00 A;  4WET A;  2IWT A;  22GS A;  5KN0 A;  2R3X A;  2C3Q A;  4O5U A;  5CP1 A;  5G30 A;  3LEF A;  1PSQ A;  2CQ9 A;  3L9V A;  3EUR A;  1ST9 A;  4ML6 A;  4ZBA A;  3GST A;  5ECQ B;  1CQH A;  2DJ0 A;  4EDY A;  2H30 A;  5AGY A;  5ECI B;  2C4J A;  5ECK B;  4KUN A;  5HQP A;  2LEG A;  3KP8 A;  3DML A;  3NOF A;  3G7Y A;  1K0A A;  1R5P A;  3KGK A;  2KP1 A;  2VCV A;  5IIZ A;  1FW1 A;  3FZ4 A;  4KB3 A;  4IHU A;  1V58 A;  1FB0 A;  5LCZ A;  2MBT A;  3H79 A;  2H0H A;  3EE2 A;  3DYR A;  4TXO A;  4ZIL A;  1EP8 A;  4IN0 A;  3IDV A;  1UC7 A;  1IYH A;  2OA7 A;  2B3S A;  3TJK A;  1EEM A;  3KP9 A;  3UMA A;  4NV2 A;  2F3M A;  1TRS A;  3ZVJ D;  1QUW A;  2YZH A;  3F8U A;  5B8B A;  5G1L A;  2X49 A;  2C8U A;  4IBP A;  2X8C A;  2OE0 A;  3I6A A;  3BOA A;  1R4W A;  3CRU A;  4MH2 A;  3WGD A;  5D9V A;  2CT6 A;  4PNG A;  3JCM L;  2DKH A;  1AQX A;  4WF4 A;  4O5Q A;  2I1U A;  1GSE A;  5ECL B;  4K5R A;  3QAG A;  2CV4 A;  3V1W A;  2IL3 A;  4NHW A;  4IP6 A;  5DJL A;  2ZCT A;  4OFT A;  4I8B A;  1I5G A;  2QA2 A;  2GZY A;  3FW2 A;  4XRD A;  3BCI A;  2HZF A;  3GFK A;  2NTO A;  3F3R A;  1GNW A;  2VCZ A;  1TW9 A;  5JCU A;  1DE2 A;  4PQ1 A;  1XPV A;  11GS A;  2HFD A;  4FYU A;  4RI6 A;  2H6X A;  2EIQ A;  2R0G A;  3ZRE A;  3F4S A;  4NV5 A;  1PN0 A;  3IHG A;  3HY2 A;  2C0F A;  2VM1 A;  2B5Y A;  2C3T A;  2IN3 A;  3PPU A;  1B9Y C;  2PER A;  2N5A A;  2PVO C;  1TRW A;  3DWV A;  4G9H A;  3EIN A;  4BPY A;  2YWM A;  1JZO A;  4BWS A;  4K7O A;  2YPM A;  2L6D A;  4F0C A;  5E4W A;  2GQL A;  2E0Q A;  2XPE A;  1ERV A;  4IKH A;  3DIE A;  4RQR A;  3CTF A;  1TDI A;  1G6Y A;  1SK1 A;  2NBS A;  2AB6 A;  2PGT A;  3OR5 A;  1WJK A;  1WWJ A;  4ZL8 A;  1MD3 A;  2AHE A;  2H73 A;  1GSQ A;  4X43 A;  1OC8 A;  4F03 A;  3L0H A;  4L0U A;  5LD0 A;  2H01 A;  4TKY A;  4ID0 A;  2UZ8 A;  1S3C A;  2YWN A;  2PN8 A;  2IMF A;  4KSM A;  1FVK A;  2F51 A;  1M99 A;  1PX6 A;  4DSR A;  4ILF A;  2H1G A;  3F0I A;  4AGS A;  1GSD A;  5CNW A;  4YQU A;  1TXX A;  4CW9 A;  1BJX A;  1Z6N A;  4MAB A;  3HVV A;  2VLU A;  3TUE A;  1F3A A;  5AIX A;  1ZYE A;  4OCF A;  2B1L A;  3CSH A;  3FMW A;  2CVB A;  4IQA A;  4E8H A;  3GX0 A;  3FEU A;  3FZA A;  2NDO A;  4Q5Q A;  2MMZ A;  3CSJ A;  5E59 A;  2C80 A;  2WZ9 A;  1GUM A;  1Z3E A;  1X9M B;  4J57 E;  1WP0 A;  2B6M A;  3PIN A;  2JZR A;  3UVT A;  3M8N A;  1OE8 A;  2B5X A;  2DBC A;  3ZVJ A;  4PXO A;  2WJU A;  1JFU A;  2DML A;  1RQM A;  1A2M A;  2GS3 A;  1HYU A;  4PX1 A;  3J7Y k;  5CRH A;  3P90 A;  2H1B A;  3KD0 A;  1AUC A;  1VF3 A;  3U6V A;  6GSV A;  1F3B A;  2B7K A;  5IMC A;  3W8J A;  2R6K A;  2FY6 A;  2VCT A;  2XBI A;  2XBQ A;  3IE3 A;  3VPQ A;  1R7H A;  4D73 A;  3I69 A;  1SYR A;  4KDU A;  4EUY A;  2H1D A;  2QC7 A;  1Z7R A;  2XHF A;  3EMX A;  1THO A;  1ERT A;  4GQC A;  1MDK A;  1X0R A;  4POL A;  3BCK A;  2P0G A;  4IVF A;  4MF6 A;  4IS0 A;  3RAZ A;  1V57 A;  4J2F A;  1OKT A;  1K3Y A;  2CVD A;  2MMN A;  5IMZ A;  1HNB A;  3ZLP A;  2RLI A;  1TKD B;  4BA7 A;  3IV4 A;  3EYT A;  2RM6 A;  3C8E A;  2OAD A;  2VUP A;  5EL8 A;  4RI7 A;  2HE3 A;  1SJI A;  2L4C A;  3GH6 A;  3VWV A;  4BWQ A;  2DSA A;  3P8W A;  3LW9 A;  4ZB8 A;  4LL4 B;  3L9S A;  4J56 E;  1BED A;  4RQX A;  4OMV A;  5ABR A;  5EY6 A;  5DAK A;  2RUF A;  4JRR A;  1GUH A;  3EVI A;  4IW9 A;  3IOS A;  1HD2 A;  3IK9 A;  20GS A;  4O32 A;  1KEB A;  3D4M A;  5ECO B;  1G0T A;  4HEA 2;  3TOT A;  1EV9 A;  1VF1 A;  3TKS C;  1XCC A;  3QD9 A;  1U3A A;  3GKK A;  4IJI A;  4USS A;  1YJ6 A;  3LG6 A;  1JHB A;  3BBY A;  1SL1 B;  3ZIJ A;  2WDU A;  2DJ2 A;  2M72 A;  5BRT A;  4KX4 A;  3FR6 A;  3LQ7 A;  2C3N A;  4F0B A;  2OE3 A;  1OYJ A;  3HVX A;  3HJO A;  7GSS A;  2VL3 A;  5DVB A;  2WCI A;  3VI5 A;  1YZX A;  5IMA A;  2CVK A;  5JWO B;  4GST A;  2E2G A;  1QXH A;  2GLR A;  1XWG A;  3MAK A;  4ZL9 A;  5B6N A;  1WIK A;  2FUG 2;  2O8V B;  3G7J A;  4KDX A;  3GUR A;  1XWC A;  4MA9 A;  1GL8 A;  4GCI A;  2QKE A;  5B8A A;  3FK8 A;  3HCZ A;  5GZZ B;  5J9C A;  1YF1 A;  5D9W A;  3VWW A;  3K8N A;  2R37 A;  3E9J B;  1JZW A;  2A2P A;  5BMU A;  1OVN A;  5KOW A;  2VM2 A;  1W4V A;  1T3B A;  5L71 A;  2VLT A;  4TR4 A;  4O7H A;  1Y6E A;  2A2S A;  2IJY A;  3IBH A;  1NM3 A;  5DQS A;  4XS4 A;  4MPG A;  2V6K A;  1ZCP A;  2G2Q A;  3HZ4 A;  2P5R A;  3DVX A;  3VUR A;  2VCX A;  4Q5F A;  2LKU A;  4IGJ A;  2DC5 A;  1K3L A;  4ZL7 A;  1YKC A;  3GN3 A;  3QAV A;  4OFN A;  2YAN A;  2O85 A;  4MF7 A;  4K2D A;  5GAN D;  1TU7 A;  2H0I A;  1O73 A;  4WBR D;  3Q19 A;  4G10 A;  4GTU A;  5HR3 A;  6GST A;  3C7M A;  4TRX A;  5D93 A;  4MJC A;  1JLW A;  4FYB A;  3ZMK A;  5KOX A;  2LQQ A;  4OD7 A;  3DVW A;  1X5D A;  1A0R P;  2DJJ A;  4YAV A;  4BVX A;  2CZ3 A;  2VLV A;  3SWL A;  4YQV A;  3HDC A;  4Q5R A;  5F8B A;  1SKR B;  4KF9 A;  2VL2 A;  3A3T A;  3NZN A;  1SK0 A;  1XVQ A;  3Q18 A;  1HQO A;  3KCM A;  4PQI A;  2JL4 A;  3R2Q A;  4LMW A;  1XW6 A;  3RDW A;  3L9U A;  3RBT A;  3DKS A;  1K0D A;  5G5E A;  1PX7 A;  3UL3 A;  3GHA A;  3KEB A;  1G6W A;  1ZL9 A;  3U5R E;  3KMO A;  1V2A A;  2LNS A;  2N5F A;  1LU4 A;  4DEJ A;  2MYG A;  2X99 A;  4O92 A;  1USB A;  1PL2 A;  5JWQ B;  1ZYQ B;  1EOH A;  1VRS D;  3F9U A;  1ACV A;  1PA3 A;  1OC3 A;  1QMV A;  2H19 A;  1GUK A;  1PKZ A;  4WR4 A;  3DEX A;  4HZ2 A;  1I9D A;  4NXI A;  2DIZ A;  3MDK A;  1DE1 A;  2VD1 A;  1X5C A;  3P2A A;  4K0G A;  2HRK A;  4GXZ A;  4GSN A;  2I9H A;  1H4O A;  5KN1 A;  3GKN A;  1SL0 B;  5HFK A;  2R4V A;  4TVE A;  2H0G A;  3TRP A;  1W89 A;  4JE1 A;  1LBK A;  3UEM A;  4Z2R A;  5ECR B;  5J9B A;  3VK9 A;  2GGT A;  3QFB C;  2F8F A;  2L5L A;  2CAQ A;  4HU7 A;  3KH7 A;  3TJG A;  4XS1 A;  4EL1 A;  3DXB A;  4KCA A;  4HI7 A;  4XHM A;  2CAI A;  1U87 A;  5JCW A;  4XRA A;  2C0D A;  5JWR B;  3D5J A;  4A5P A;  2FLS A;  12GS A;  3N5O A;  4YQM A;  4KND A;  3I43 A;  2VCW A;  3M9J A;  2IPA A;  4ZB6 A;  4F82 A;  2V1M A;  3HXS A;  2M46 A;  1O81 A;  1Z6M A;  3KZQ A;  4HUA A;  19GS A;  1TP9 A;  5IOW A;  3GH9 A;  1FAA A;  1PQN A;  5H5S A;  4OFM A;  4K5S A;  3CTG A;  1QFN A;  4TXV A;  3SBC A;  2DJ1 A;  1CQG A;  3H93 A;  3IPZ A;  1R5A A;  4HJM A;  1OE7 A;  1PMT A;  5IMD A;  3APO A;  5J41 A;  4FQU A;  3CRT A;  1GRX A;  4WF5 A;  2YV9 A;  3LJR A;  3O76 A;  1SJ6 A;  2OBK A;  1XOB A;  1PGT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...