2H0HA

Crystal structure of dsbg k113e mutant
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
229
structure length
229
Chain Sequence
ELPAPVKAIEKQGITIIKTFDAPGGMKGYLGKYQDMGVTIYLTPDGKHAISGYMYNEKGENLSNTLIEKEIYAPAGREMWQRMEQSHWLLDGKKDAPVIVYVFADPFCPYCEQFWQQARPWVDSGKVQLRTLLVGVIKPESPATAAAILASKDPAKTWQQYEASGGKLKLNVPANVSTEQMKVLSDNEKLMDDLGANVTPAIYYMSKENTLQQAVGLPDQKTLNIIMGN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Short-circuiting divergent evolution: laboratory evolution of one disulfide isomerase to resemble another
rcsb
source organism Escherichia coli
molecule tags Isomerase
molecule keywords Thiol:disulfide interchange protein dsbG
total genus 67
structure length 229
sequence length 229
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-05-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13098 Thioredoxin_2 Thioredoxin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.70 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Disulphide bond isomerase, DsbC/G, N-terminal 2h0hA01
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 2h0hA02
3F3RA 1XCCA 2M46A 1SL0B 1N2AA 4CW9A 2C3QA 4IVFA 4AJ7A 3Q19A 1M2DA 4FIWA 3VWWA 3EURA 5F8BA 4KDXA 5KN2A 2OADA 4TR1B 2VCQA 2H71A 4HJMA 4GLTA 3TUEA 2A2RA 2GZZA 4YAPA 5KEJA 2WS2A 3L9SA 4PUFC 3CXGA 4LMVA 1V58A 5AISA 1V2AA 2M72A 1J0FA 5G2ZA 3ZYWA 1IYIA 2HZEB 1VF4A 2VL3A 4BVYA 2HRFA 1V98A 3CMIA 4MF5A 3RBTA 1JZWA 2JZSA 1OC3A 2FY6A 2GGTA 2CV4A 1G0TA 1F3BA 4MZBA 3E3EA 2B7JA 5IQYA 4EE0A 1BX9A 2R6KA 5COHA 2C1YA 3QCPA 4HEA2 4BWQA 1XWKA 3FR9A 4V1Ag 2AV4A 5LCZA 1OE8A 4MABA 1S3DA 3CYNA 1S3AA 4OWYA 6GSYA 16GSA 2H66A 3A2WA 1GUHA 1GNWA 2R37A 3VK9A 1MEKA 3DKSA 4NWYA 4KCEA 2MMAA 3BCKA 1PX6A 2H72A 1EV9A 5A4WA 1SYXA 1X9WB 2IL3A 4HS1A 3ZREA 3ERGA 1NSWA 1EEJA 6GSXA 1RQMA 1PQNA 4NXIA 2DC5A 5LD0A 5DDLA 2IY2A 3DIEA 4TR3A 3GURA 1FOVA 2XHFA 1TW9A 1MTCA 4FYCA 4MJAA 2H8LA 2DJ3A 2EIQA 5G1KA 4BPYA 3P2AA 4OFTA 2AYTA 3D4TA 2PPTA 4JEDA 3ERWA 5HFGA 4H86A 1WOUA 4NHZA 3Q18A 4IBPA 4MDCA 1OE7A 3N9JA 1YEXA 5EPFA 1A0RP 2X8HA 2PBJA 3VPQA 1VRSD 3RPPA 5E59A 2OA7A 5D9TA 3KP9A 1AC1A 5ECMB 4MPFA 2K18A 2JZTA 2CX3A 1CQHA 1VF2A 1M2AA 1XW5A 2GZYA 3KH7A 4O92A 5IMCA 1Z5YE 3GTUA 1GH2A 4ZILA 3I9V2 4QQ7A 3FEUA 3TJJA 4XRDA 2PN8A 4WF4A 4MH2A 1YZXA 2V2GA 4D73A 8GSSA 4GQFA 2V1MA 1TI1A 2L57A 5AGYA 1UN2A 2GT6A 1TU7A 4G19A 4PURA 1B9YC 5A5KA 5IMZA 1YEPA 4LLRA 2HSYA 3N5OA 5ECNB 3F0IA 1ERUA 3FHKA 2GQMA 1JHBA 1ILOA 2IN3A 2GSQA 1JFUA 1VF3A 2CA8A 3GKMA 5IPHA 1ERWA 4OFMA 3V1WA 2I3YA 3TJBA 1AUCA 3GA4A 4X1UA 1F3AA 2OBIA 3JCML 3LG6A 4JZQA 2PVOC 3HVVA 5E4WA 1V40A 2LUSA 3TKSC 1RW1A 5KN0A 1EGOA 1DSBA 2WFCA 2L5OA 3F8UA 3APSA 1ERTA 3CTFA 4DEJA 4RI6A 3D4MA 3IDVA 2LJAA 3LXZA 1HD2A 2PMTA 2CVBA 2O85A 5ECSA 3ZZXA 1GLQA 4HOJA 4V2LA 4POKA 1SK0A 3C73A 4ML1A 3FRCA 4MF6A 2CT6A 1SKWB 2YV7A 2V6KA 3QMXA 3RHCA 1GTAA 2D2ZA 3TJKA 1JLWA 2NPBA 4FH8A 1USBA 7GSSA 4GQCA 4NMUA 3RHBA 1R7HA 1EV4A 2JADA 4K7OA 4GSNA 1THXA 1B48A 4TW5A 2K8VA 4XS1A 1E2YA 2I1UA 2DJ0A 3IR4A 2ON5A 3U5RE 3GKKA 1SL2B 2QKEA 3GH9A 3UOMA 5JCUA 2F51A 1AQWA 1WRYA 1K0MA 2P31A 3TB2A 3TOUA 2DLXA 4LL1B 3E0UA 4JE1A 5A4VA 2AHEA 3LEFA 4LMWA 4NPBA 1QXHA 1PA3A 5ECLB 3M9KA 3VWUA 3ZVJA 1K3OA 4EKZA 2JSYA 1M2BA 1PL2A 2LS5A 2O8VB 1GSQA 3G7JA 2H70A 2RLIA 3ZL5A 1G6YA 2PVQA 3EVIA 1SK1A 4WETA 1Z7PA 5IMFA 2IYJA 3GN3A 1T00A 1PGTA 2CQ9A 3QPMA 5B6MA 4O5RA 3ME8A 3LJRA 2RM6A 5IOXA 1BQ7A 3APOA 3VLNA 2IMDA 1KEBA 2E0QA 3F4TA 2EIOA 3QFAC 2KUCA 3GMFA 3KXOA 5CAXA 1V9WA 2LKUA 5F06A 1SENA 4MF7A 3IV4A 4TOPA 2B1LA 1DE2A 5C00A 3D21A 3EE2A 2VLTA 6GSVA 3I6AA 2GSTA 3EINA 1QMVA 4GXZA 1YY7A 1EP8A 3KMNA 4JR4A 2C3NA 1M9AA 1TXXA 1ML6A 4WBJA 4TXOB 5ECQB 3CTGA 1XWGA 4J57E 4EF0A 4GSSA 2MBSA 2YZUA 1TK8B 2KHPA 3KZQA 1GRXA 4L5LA 1O8XA 2B5XA 4KUNA 1OKDA 1FG4A 2IMEA 5J9CA 3ISOA 4V2NA 3IBHA 2KOKA 3UARA 5CNWA 3QR6A 4IGJA 4K2DA 1O7UA 3D6IA 4IP1A 4PGTA 3ZVJD 3ZIVA 2OKAA 2GTUA 4MZWA 3GHAA 2IJYA 2YWMA 1E6BA 4N0VA 4I97A 3L9UA 3GKXA 4EL1A 4I8BA 4MH3A 1GTBA 4POLA 2VD1A 5CYYA 19GSA 2H6XA 2B1KA 1SL1B 4IHUA 2PERA 3C8EA 3H8QA 4BWSA 1XWBA 5KN3A 5CRWA 1FB6A 1ST9A 4KSMA 2R3XA 3U6VA 1QK8A 4GF0A 3KIJA 2KP2A 1B4PA 2L6CA 4HU9A 4IQAA 1EOGA 1XBSA 2B7KA 5JWRB 2YWNA 1JZRA 2V32A 4HUAA 2M80A 1TRUA 2O89A 3D0ZA 4WKWA 1MDJA 4XTSA 4POMA 1Y6EA 2GVPA 2H6ZA 1TJDA 4L0WA 4WBRD 5H5QA 5AIXA 1A24A 2C0DA 5F07A 2DJ2A 3EC3A 1GUKA 3BCIA 3VI7A 5ECIB 3K8NA 1WJKA 3MSZA 1T7PB 1EZKA 5DBQA 2ZNMA 1X5DA 5L71A 2NTOA 4WR5A 1VGLA 3CRUA 3HDCA 2I9HA 2YJHA 4MMMA 4XS6A 3W6GA 3LFLA 2OE3A 2H76A 3QD9A 3GYKA 3A5WA 4JU5A 1G7OA 2P0GA 4KB3A 2MMOA 1TTZA 1AW9A 3EMPA 4QL7A 2C80A 5D73A 1SJZA 2VCVA 3EMXA 2E2MA 1LU4A 4KSOA 2PU9C 5GAPD 4PX1A 2GDRA 1XVQA 5DALB 1PSQA 3TKPA 3MWHA 5IMDA 2HZEA 2GS3A 5B6NA 4GTUA 1TRSA 2F8AA 4KGIA 2WJUA 2REMA 4OCEA 3ZFBA 1Q4JA 1YQ1A 5EY6A 1EGRA 3CSJA 2K6VA 3HCZA 3GTUB 5B8BA 1OVNA 3M8NA 2VLUA 2DIYA 1B4QA 4NHWA 5DVBA 2AB6A 3FK8A 4XRAA 4O7HA 2G0FA 4DSSA 4DSSB 2R2JA 5FWGA 4WEYA 18GSA 2E7PA 1XXUA 2VL2C 4F82A 4J56E 3C7MA 2H19A 1PRXA 3I69A 5LNKe 2DMLA 2DBCA 2QSIA 4CHSA 1U88A 3GL5A 1FB0A 3KD0A 5A4UA 2IWTA 4EDYA 1TK0B 5CRHA 2X99A 2FWFA 2YWOA 3EU3A 4ACSA 3M3MA 1B8XA 2BJXA 3E9JB 4XCSA 3WGEA 2YN1A 4PXOA 2XPEA 5CREA 1U3IA 2ALBA 3VFIA 4G2EA 5DJLA 4MZCA 3ZRDA 1G7EA 2L4CA 4HJ2A 4Q5QA 2VAFA 1RK4A 3DVXA 5HR2A 2WRTA 2FCHA 1XW6A 4ECJA 4I2UA 2B5EA 3ED3A 2L5LA 3HKRA 1FO5A 1XVWA 4MPGA 3IK9A 4HU7A 3FZ4A 5IM9A 4Q5NA 2VM2A 4N30A 2RIIA 1AQVA 5EL8A 2MYGA 2J23A 3F4RA 4L5OA 4YAVA 5DQYA 5G1LA 4ZL8A 1J08A 1XOBA 3DEXA 2X8GA 1SKRB 2VLVA 1PN9A 4ZL7A 2CVKA 4ZL9A 3RAZA 2CAQA 5B8AA 1O6JA 1ZYQB 3VWVA 1WE0A 1R5AA 1T4ZA 3LYPA 1QQ2A 5ECRB 5JWQB 1GLPA 2X64A 4K1FA 1PKWA 2GT5A 4AJ8A 1JZOA 4GSTA 4DSRA 2LSTA 1A8LA 2AJQB 3FKFA 1THOA 1FVJA 5D9VA 1X9SB 1FVKA 2FNOA 3NOFA 4I6XA 2C0EA 5D8IA 4TR1A 4E8HA 3HVSA 4X0XA 2O87A 5D96A 2IMFA 4O32A 1OC9A 1LBKA 1YJ6A 2IMKA 3MAKA 3Q74A 1AXDA 4IELA 1ERVA 2LEGA 5DQSA 2CAIA 3MNGA 4KAEA 4WF5A 5DCHA 1KTEA 2J9HA 4ZB9A 2YOIA 1EWXA 2P5RA 3IRAA 4NAXA 2R5GA 2R4VA 6GSWA 4MK3A 2WCIA 2V41A 2L6DA 3TRPA 3F3QA 5G31A 1GP1A 5G5EA 4GCIA 4ULXA 2X8CA 3HJMA 5ECKB 4I2TA 5AIVA 4N0ZA 6GSTA 1BAYA 4AGSA 1WMJA 5D9WA 2DIZA 4PQ1A 1Z6NA 4IJIA 4PQHA 3C1RA 2B6MA 2WDUA 1BJXA 2ZUPA 4PNGA 2GZPA 2MMNA 2DMMA 2GSRA 3PGTA 4XS4A 3PINA 3QAWA 4NV5A 3W8JA 3P8WA 1XPVA 3GX8A 3MDKA 3IPZA 2YV9A 4K0GA 4YH2A 1K0OA 3F4SA 1FW1A 1HYUA 4MJBA 1XIYA 5GSSA 2HI7A 2HNLA 4K0NA 3M9JA 5ENUA 1PD21 1A2JA 2AAWA 3QAVA 4XS4B 3KM6A 2LJKA 2NVLA 1HNAA 1SD8A 4KE3A 6GSUA 2ES7A 3H79A 4HI7A 1GULA 1A8YA 1Y25A 5CRGA 2JZRA 2PGTA 1ZMAA 4OD7A 2KP1A 3WGDA 1PL1A 1ZGNA 5F05A 2B5YA 1UA5A 2MZCA 3QOUA 5ID2A 2GQLA 2H74A 1G6WA 3J7Yk 2XC2A 4GWRA 4OCFA 3HZ8A 3F9UA 3LXTA 3VPTA 1A2MA 3O76A 3ZTLA 3RPNA 2YNXA 5CRDA 2F9SA 1SJ6A 1MD4A 1W4VA 1OYJA 4TN8A 2FGXA 2G2QA 2BTOT 4IN0A 4K8MA 1NM3A 1H4OA 1TRVA 5HFKA 4IS0A 1T3BA 5FHIA 4CDOA 5G5FA 1XWAA 3OR5A 5JWOB 3VWXA 4RQXA 3GL3A 4KW6A 1F9MA 1VF1A 3EWLA 3DMLA 2JL4A 2BMXA 3FY7A 2LRTA 4JRRA 2LV3A 3D5JA 4F0BA 1GL8A 5ECPB 3DWVA 4JBBA 5IMAA 4XHMA 1EP7A 3ZIJA 3LORA 4G10A 2FWEA 3TDGA 2LRCA 2LJRA 3TRXA 3DD3A 3J7Yb 3ERFA 4TR4A 4F2IA 5DCGA 3D22A 1KNGA 2H6YA 3TKSE 2K8SA 1ZOFA 2VOCA 4RQRA 2IFQB 3TOTA 3GX0A 2E2GA 2V6OA 5HR0A 1QFNA 1CQGA 1NHOA 2WULA 4K9ZA 2VCTA 1R4WA 1O73A 1YKCA 3L0HA 1XFLA 5IO2A 2IMIA 9GSSA 4TRXA 2TRCP 3EU4A 2TIRA 4PUAA 2HRNA 5FT3A 3HD5A 10GSA 1GUMA 3GSSA 2IPAA 1ACVA 12GSA 1F6MC 2YANA 4P3YB 3HA9A 1BEDA 2VL2A 1UVZA 1T8EB 5ELAA 1XW9A 2JU5A 3UEMA 3KJYA 3IE3A 2A2SA 3VI5A 2O7KA 4PNFA 5CP1A 3GV1A 2FD3A 1ABAA 1HNBA 2L59A 2TRXA 3H93A 4KH7A 1TKDB 1TRWA 2ZCTA 1MD3A 4ISDA 2HT9A 1QGVA 3ZMLA 3TJGA 3G7YA 2H73A 3WD6A 17GSA 2EC4A 2VO4A 1PX7A 4MA9A 2JSZA 2FWGA 3UMAA 1HQOA 5H5SA 1OC9B 2HXKA 3QFBC 3KTBA 3O6TA 4EXJA 2H30A 2YPMA 2WZ9A 5IMVA 1NHYA 4IW9A 3UJ1A 2FA8A 3ME7A 1T1VA 2F3MA 5EVOA 2VIMA 1B9XC 1K0CA 1K0AA 4ZBAA 4YQVA 3APQA 3HYPA 1UC7A 3G9BA 4F0CA 2CZ3A 4F03A 2HLSA 4EC0A 5DALA 1GNEA 5C04A 1F2EA 2XBQA 1YF0A 3I43A 1A0FA 5ID2B 1NW2A 5DAKA 4AJ6A 2WGRA 1K0DA 1GSYA 1GTUA 5J41A 4IKHA 3F63A 1X5EA 1WIKA 5HFIA 2LQQA 2FWHA 1N8JA 3US3A 1PKZA 3GH6A 1YDKA 5J5NA 3GNJA 3GKNA 2MMZA 1T4YA 1GTIA 2H75A 3ZFLA 2RUEA 1A23A 1SKSB 3WYWA 2LNTA 4TXOA 2LTKA 3ZITA 1EOHA 3CSIA 3ZMKA 3LSZA 2VL9A 4RUVA 4WR4A 1WWJA 3W8SA 5F0GA 2C8UA 2H1AA 5HR1A 4ZXGA 4ZB8A 11GSA 1X9MB 4I5QA 4V2MA 5CO3A 5AN1A 4QL9A 4Q5FA 4KDYA 2H0GA 2LRNA 4F9ZA 1ZCPA 3IC4A 4DVCA 1SJIA 5IIZA 3CBUA 4TVEA 2QGVA 5ECHB 3FW2A 5B7CA 2IIYA 5H5RA 3NZNA 4WXTA 4X43A 2LQOA 1GSUA 3RDWA 1MDKA 1Q98A 2FLSA 2HYXA 2AUVA 4MP4A 4RI7A 3DVWA 4PQIA 3HY2A 3FZ9A 1X5CA 1K3YA 1XZOA 3Q6OA 4EDZA 3IHQA 2ON7A 3DRNA 2GQKA 3A2XA 3KMOA 3SWLA 4Q5RA 5J9BA 2RM5A 2YWIA 1FAAA 5J4UA 2DJJA 3HHVA 1OC8A 2H0HA 1WP0A 2H0IA 4GRFA 3FZAA 2B3SA 1K0NA 1MDIA 5IPGA 2DJKA 3UVTA 2OJLA 2PWJA 3BJ5A 3TJFA 3GSTA 4J2FA 4MLYA 1OKTA 2HE3A 3UL3A 3LQ7A 1Z7RA 5HQPA 1JLVA 1TP9A 3A3TA 3UIWA 1BYEA 1AIUA 1GSSA 3DGQA 1K3LA 4EVMA 3DYRA 3UAPA 1U6TA 4Z7XA 2HSHA 1XWCA 4OFNA 4HZ2A 1X0RA 2VCXA 3IK7A 3BBYA 3R2QA 2XPDA 3VURA 3S9FA 1W89A 5GZZB 3G7IA 1TDIA 3EYTA 1SYRA 2VD0A 2H1DA 1PMTA 3CRTA 5GSTA 2H01A 4K7NA 6GSSA 3WGXA 4N11A 1M9BA 2H1GA 4AF2A 5GAND 2N5FA 2GSSA 3KH9A 1Z9HA 3NIVA 2C4JA 4IP6A 3FR6A 1K0BA 3BOAA 1JZDA 1TU8A 1TK5B 1M99A 1F37A 4EUYA 3GIXA 4TR0A 2Z9SA 4YQMA 1AAZA 3M1GA 3M0FA 3TKRA 3KP8A 2VM1A 2YCDA 3FYGA 14GSA 3WT2A 1KBNA 3IAS2 3HZ4A 3IA1A 2OBKA 2NDOA 3L4NA 1DE1A 1GWCA 2FUG2 4ECBA 5ECOB 2N5AA 3H4KA 3O3TA 4NV2A 2JACA 5JCGA 3HJPA 3LGCA 1IYHA 2A4VA 3L9VA 1V57A 2I81A 5IOWA 1C72A 1O81A 4OO5A 2OACA 3P90A 1ZYEA 13GSA 4BA7A 2PUKC 3C71A 3F6FA 4K6XA 3FR3A 4G9HA 1FHEA 4MCUA 2CX4A 1O85A 2VCWA 3L78A 2YZHA 4KCAA 5DJMA 1XOAA 1GSDA 2HZFA 1GSFA 4D73B 4OMVA 3AY8A 2HFDA 3KTLA 3HJOA 3TCOA 4ZBBA 3P7XA 2VCZA 1Z6MA 2OE1A 4FYBA 3UBLA 3TGZA 4XIHA 4K7IA 2C0FA 1LJRA 4HDEA 4TKYA 4ILFA 22GSA 3BD2A 3GFKA 2KLXA 1BG5A 1M0UA 2LNSA 4L0UA 4ID0A 2RUFA 5JCWA 3UVHA 5ABRA 5ELGA 1DUGA 4DSQA 3DXBA 4KX4A 1WPIA 4HQZA 3IXRA 1ZZYA 1URMA 1ZL9A 1I5GA 1R26A 4OO4A 3ZLPA 3C1SA 1TOFA 1S3CA 1R5PA 1U87A 2EIRA 1Z3EA 2IFQA 4MJEA 5HR3A 4KDUA 4ECCA 4ECIA 4BL7A 2XBIA 3WT1A 4V1Ap 3LYKA 1O8WA 2FHEA 3IAM2 1SD9A 3H1NA 1I9DA 3PH9A 3SBCA 2WB9A 1YF1A 3IOSA 4E8EA 2QC7A 1A2LA 3HXSA 2F8FA 4ZBDA 2NBSA 2H1BA 3TKQA 4HQSA 4YQUA 2C0GA 2GLRA 5J3RA 2L4QA 1EEMA 1GSEA 1QUWA 3LWAA 1H75A 5G30A 5D9XA 3FZ5A 4EO3A 2K9FA 3PR8A 4LL4B 3GUSA 2VUPA 5KN1A 3GRXA 2I4AA 4IQ1A 2YP6A 4IJ3A 4LA1A 2CVDA 4FYUA 3CSHA 4ZIJA 2YJ7A 1SK2A 4HZ4A 4KA0A 3A2VA 2FA4A 4ZB6A 2P5QA 2N5BA 3TRQA 3QAGA 3KEBA 1ON4A 1YKAA 4BVXA 5IO0A 4KNDA 1M7TA 3HVXA 4FO5A 1DBYA 3QDNA 3KGKA 3KCMA 3TKSA 2DJ1A 2CZ2A 4L8EA 2DSAA 4JR6A 3F6DA 20GSA 4MJCA 1HNCA 4POBA 2OE0A 2MBTA 1U3AA 5INYA 4TXVA 2C3TA 1OAZA 3UBKA 1AQXA 4ML6A 5DAKB 1J9BA 5D93A 1SU9A 1TI3A 4N10A
chains in the Genus database with same CATH superfamily
3F3RA 5IW9A 1XCCA 2M46A 1SL0B 1N2AA 2UX0A 2QIYA 1U8CB 1D6ZA 4KFDA 4CW9A 1E97A 2C3QA 4IVFA 1Q864 3Q19A 4AJ7A 1M2DA 4FIWA 4N6LA 3VWWA 3ECFA 1K734 3EURA 5F8BA 4N6V0 2SBLA 3D79A 4G1MB 4KDXA 5KN2A 2OADA 3CCE3 4TR1B 2VCQA 3NQYA 4O5QA 1NWWA 2H71A 4HJMA 4GLTA 3TUEA 2A2RA 2GZZA 4YAPA 5KEJA 3HOHA 3D9RA 1B2SA 2WS2A 3L9SA 1U5OA 4PUFC 1O7HB 2A15A 3CXGA 3MG1A 1QVG2 4LMVA 3CC73 1V58A 1JB4A 5AISA 5GSPA 1V2AA 2M72A 1VQ93 1J0FA 1IVVA 3LTCA 1IVWA 5G2ZA 3ZYWA 1IYIA 2HZEB 1VF4A 2VL3A 4Z2TA 4BVYA 2HRFA 1V98A 4FMCA 3CMIA 4MF5A 3RBTA 1UUWB 2P05A 1JZWA 3KKGA 4HM0B 4X4JA 2JZSA 1OC3A 9RNTA 2FY6A 2GGTA 2CV4A 4IIAA 3URPA 1QJGA 3EN8A 1G0TA 2D1WA 1F3BA 4MZBA 4BTWA 3E3EA 2B7JA 5IQYA 4EE0A 1BX9A 2R6KA 1JB2A 2OOVA 5COHA 2C1YA 4N6OB 3QCPA 4HEA2 4N6TA 4BWQA 1XWKA 3FR9A 4V1Ag 2W56A 2AV4A 5LCZA 1OE8A 4MABA 1S3DA 3CYNA 1S3AA 4OWYA 6GSYA 1VQ63 16GSA 2H66A 3WR2A 3A2WA 5CF1A 1GUHA 2DKHA 1GNWA 2R37A 3VK9A 1MEKA 1FUSA 3D5IA 5BRTA 3DKSA 2W9QA 4NWYA 4KCEA 2MMAA 3BCKA 1PX6A 3GZYB 3GZRA 3E99A 2H72A 1EV9A 5A4WA 3DMCA 1SYXA 1X9WB 1YVBI 1GOVA 3DGLA 2IL3A 4HS1A 3ZREA 4OUQA 3ERGA 1NSWA 1EEJA 6GSXA 3CXC2 5IG3A 2XSOB 1RQMA 3HVNA 1PQNA 4NXIA 2DC5A 5LD0A 5DDLA 2IY2A 3DIEA 4RZMA 4TR3A 3GURA 1FOVA 1TFOA 3X3YA 2XHFA 3FKAA 1TW9A 1MTCA 1I0VA 2F5WA 2YFLB 3LZAA 4FYCA 3DGNA 4MJAA 1GMRA 1L5GB 1OH0A 4EC6A 2H8LA 2DJ3A 3FG1A 1K8A4 2EIQA 5G1KA 4BPYA 3P2AA 3D4TA 2AYTA 3SEDA 4OFTA 2PPTA 4JEDA 3ERWA 5HFGA 1RN4A 4H86A 1N5HA 1WOUA 2KF5A 4NHZA 3Q18A 4IBPA 4MDCA 1OE7A 2XFSA 3CCQ3 2W6JH 1N9JA 1ROVA 3F8HA 3N9JA 4XDWA 1YEXA 5EPFA 3U1WA 1A0RP 1NDOB 2X8HA 2PBJA 1YGWA 3VPQA 1AVLA 1VRSD 1X1WA 3RPPA 2HMNB 5E59A 1LOVA 3WDGB 4O5UA 3BB9A 2OA7A 1UCKA 2XF3A 5D9TA 3LW9A 1OF5B 1RN1A 1AC1A 3KP9A 5ECMB 1ULJB 5EVHA 4MPFA 2K18A 2JZTA 2CX3A 1CQHA 4HM5B 1VF2A 1M2AA 1XW5A 2GZYA 2HMKB 3KH7A 2R4IA 4O92A 5IMCA 1UUVB 3KN4A 4XBYA 3CPOA 1GH2A 1Z5YE 3GTUA 4ZILA 1SIIA 3I9V2 4QQ7A 4LGQA 2QGUA 3NQZA 1OPYA 3FEUA 3TJJA 4XRDA 2PN8A 5BXQA 4MH2A 4WF4A 3NV0A 3A76A 3EF8A 1YZXA 2V2GA 4D73A 1ZO2A 1BSDA 3OWSA 2PZVA 8GSSA 1GYBA 4GQFA 2V1MA 1TI1A 4STDA 2L57A 5AGYA 1UN2A 2GT6A 1TU7A 5KP3A 3Q90A 4G19A 4PURA 1B9YC 5A5KA 5IMZA 1YEPA 4DKIA 4LLRA 3OWYA 2HSYA 3N5OA 1RDSA 2P0MA 4KFEA 3F0IA 3ZFZA 2E2UA 5ECNB 1ERUA 3FHKA 2GQMA 3MWZA 1SJWA 1G02A 1JHBA 1ILOA 2HMOB 3NX0A 2IN3A 2GSQA 1JFUA 1VF3A 2B1XB 3VGNA 2CA8A 3GKMA 5IPHA 4RNZA 1ERWA 4OFMA 1D6YA 3V1WA 1IK3A 4NHFA 2I3YA 3TJBA 1AUCA 4HM7B 5AEWB 3GA4A 4AKZA 4X1UA 3KZTA 1F3AA 4FMBA 3WODG 2RGQA 2OBIA 2RCDA 1RTUA 2WOHA 3JCML 1O7MB 1JBSA 1CYVA 3LG6A 4JZQA 1OCVA 2PVOC 3HVVA 4PTSA 5E4WA 1V40A 2LUSA 1FGOA 3FF2A 4R80A 1RW1A 3TKSC 5KN0A 1EGOA 1BANA 1DSBA 1DMMA 2WFCA 2L5OA 3PYJA 1BRJA 3APSA 3F8UA 1JN5B 1ERTA 3CTFA 4DEJA 4RI6A 3D4MA 3IDVA 2LJAA 3LXZA 1HD2A 3MPHA 2PMTA 1DYUA 2CVBA 2O85A 1STFI 1F8NA 4RNYA 2BNGA 5ECSA 3ZZXA 1ULIB 3GAXA 2OWPA 4WP5A 1GLQA 4HOJA 2HRAA 4V2LA 1EA2A 4POKA 1SK0A 3NBBA 3C73A 5A0OB 4ML1A 1NU3A 3FRCA 4MF6A 2CT6A 1W6CA 1SKWB 2YV7A 2V6KA 3QMXA 3RHCA 1GTAA 2D2ZA 3FZWA 3CU3A 3TJKA 2CH9A 1JLWA 2NPBA 1GS3A 3PCSA 4FH8A 3HIIA 1USBA 7GSSA 2W03A 4GQCA 4NMUA 3RHBA 5M1AA 1R7HA 1EV4A 2JADA 4K7OA 4GSNA 1IQXA 1THXA 1B48A 5JBSA 4TW5A 3N9HA 2O3OA 1RKYA 2K8VA 3FCSB 4XS1A 1E2YA 2I1UA 2DJ0A 2CWTA 3IR4A 2ON5A 3U5RE 3GKKA 1SL2B 2QKEA 3GH9A 3UOMA 5JCUA 2F51A 1AQWA 3IJEB 1WRYA 1K0MA 2P31A 3TB2A 3A5IA 3TOUA 2DLXA 4N6NB 3E0UA 4JE1A 4LL1B 5A4VA 2AHEA 3LEFA 4LMWA 4NPBA 3I553 1N9EA 1QXHA 1PA3A 5ECLB 5CLKA 3J7Yd 4N3VA 1FW7A 3M9KA 3VWUA 4CY8A 1YHQ3 3ZVJA 1K3OA 2CFLA 4EKZA 2JSYA 1M2BA 1WMPA 1PL2A 1ZYPA 2LS5A 2O8VB 1LXEA 3PPUA 1GSQA 3G7JA 2H70A 3T0UA 2RLIA 1A2VA 1E3VA 3ZL5A 1G6YA 1HU9A 2X49A 2PVQA 3FF0A 3EVIA 1SK1A 2WOFA 4WETA 1Z7PA 4N6MA 5IMFA 1BNFA 2IYJA 3GN3A 1T00A 4EW5A 1HKXA 3GZBA 1PGTA 1N8QA 2CQ9A 3QPMA 5D83A 1BNSA 5B6MA 4O5RA 4ORLA 3ME8A 3LJRA 2RM6A 5IOXA 1BQ7A 3APOA 3VLNA 1A67A 3EC9A 1W02A 1KEBA 5D81A 2IMDA 2E0QA 2F99A 3F4TA 4R4KA 2EIOA 1YJN3 4FR9A 3QFAC 2KUCA 3GMFA 3KXOA 5M18A 5CAXA 3DH2A 1V9WA 2LKUA 5F06A 1SENA 3CNXA 3CC23 3X3XA 2HOHA 3IV4A 4MF7A 4TOPA 1LNHA 2B1LA 4QWTA 4WYKB 1X1YA 1DE2A 2XRXB 5C00A 2X4AA 4FCMA 3D21A 3EE2A 1GMQA 3CMA3 2VLTA 1LNIA 6GSVA 3PS8A 3I6AA 2GSTA 5RNTA 3EINA 1R4YA 1QMVA 5CXOA 1HYFA 4GXZA 1YY7A 1EP8A 3KMNA 4JR4A 2C3NA 4LMIA 1M9AA 1TXXA 1ML6A 4WBJA 4TXOB 5ECQB 5IEPA 1MOLA 3AHSA 3CTGA 1XWGA 4J57E 4EF0A 1RNTA 4GSSA 2MBSA 2YZUA 1TK8B 5IENA 1WTHA 5IG0A 5BVBA 2KHPA 3KZQA 1GRXA 5AI1A 5D82A 4L5LA 1O8XA 4K2XA 2B5XA 2W04A 4KUNA 3AHWA 1OKDA 3DGOA 1FG4A 2IMEA 5J9CA 2Z77A 2BHMA 3ISOA 4GHOA 3WOFB 4V2NA 1SARA 2KCDA 2UGIA 4R9LA 3IBHA 3NHXA 2KOKA 5CNWA 3UARA 3QR6A 4IGJA 1MGRA 3EBTA 4K2DA 3FG4A 1B3SA 2XGNA 1O7UA 1Q7HA 3D6IA 2ZDJA 1BRGA 4IP1A 4PGTA 3ZVJD 3ZIVA 1YIJ3 2OKAA 2GTUA 4MZWA 5AIIA 3GHAA 2IJYA 4FQUA 1W01A 3DGMA 2YWMA 1E6BA 4N0VA 4I97A 3L9UA 3GKXA 4L8OA 4EL1A 4I8BA 1PYLA 4MH3A 3X41A 1GTBA 1BRNL 1OHOA 4POLA 1Z1SA 3MG3A 1Q40B 2STDA 4XM4A 2VD1A 5CYYA 19GSA 2H6XA 2B1KA 1SL1B 4IHUA 2PERA 3CCU3 5JPPA 3C8EA 4K5RA 3STDA 3H8QA 3GWRA 4BWSA 1XWBA 5KN3A 5CRWA 4O2HA 1JNQA 1FB6A 3CCR3 1ST9A 4KSMA 2R3XA 3U6VA 1QK8A 4GF0A 3KIJA 2KP2A 1B4PA 2L6CA 2KF4A 1FGQA 4HU9A 4IQAA 3X42A 1EOGA 1XBSA 2B7KA 5JWRB 5IG4A 1Q7Y4 3B4PA 1T5YA 1IV9A 2YWNA 1JZRA 1ZS7A 1GMPA 2V32A 1JJ22 1JN5A 4HUAA 1J2BA 3JUQA 1BSEA 3ALAA 2M80A 1TRUA 3K0ZA 3QK9A 2O89A 3EB8A 1K9M4 3D0ZA 4WKWA 3MG2A 1MDJA 4XTSA 4G0KA 1TP6A 4POMA 1Y6EA 2GVPA 1BU4A 2H6ZA 3EE1A 1TJDA 1BOXA 4L0WA 4WBRD 5H5QA 5AIXA 1A24A 2C0DA 1W2ZA 5F07A 2DJ2A 3NBJA 3EC3A 1JBRA 1GUKA 3DY5A 1BSBA 3BCIA 3VI7A 5ECIB 3K8NA 8CHOA 1FOHA 1O7PB 2KF3A 1WJKA 3MSZA 2INXA 1T7PB 1RCLA 1JRQA 1EZKA 3OWUA 3VF1A 5DBQA 3GZXB 2ZNMA 1X5DA 5L71A 1EKMA 2NTOA 4WR5A 1VGLA 3CRUA 1R4CA 3HDCA 4R9KA 2UZ8A 2I9HA 2YJHA 4MMMA 1I2EA 4XS6A 3W6GA 3NM2A 3LFLA 2OE3A 2H76A 3QD9A 1BVIA 3GYKA 3A5WA 4JU5A 1G7OA 1K41A 2P0GA 4KB3A 2MMOA 1TTZA 1AW9A 3EMPA 4QL7A 2C80A 2XSHB 1A2PA 5D73A 1SJZA 3BNBA 2VCVA 3EMXA 2E2MA 4K61A 1LU4A 4JF8A 4KSOA 2PU9C 2XFTA 1RRHA 3FSDA 1TTOA 5GAPD 4PX1A 2GDRA 1A2KA 7GSPA 2CFWA 1N8R4 1XVQA 5DALB 1PSQA 3TKPA 3MWHA 5IMDA 2HZEA 2GS3A 5B6NA 4GTUA 1I8VA 1TRSA 2F8AA 4KGIA 4LYLB 2WJUA 2REMA 4OCEA 4YKGA 4GB5A 3ZFBA 1Q4JA 1YQ1A 5EY6A 3KSED 1WMOA 1EGRA 1UCJA 3I0YA 3CSJA 2K6VA 3HCZA 3GTUB 1UI7A 5B8BA 4HKVB 1FGRA 1QALA 2Z76A 1FUTA 2Y74A 1OVNA 3M8NA 2VLUA 1D6UA 2BIRA 2DIYA 1B4QA 4NHWA 1BSAA 2L1SA 1BNEA 5DVBA 2AB6A 3FK8A 2MF7A 4XRAA 1VQ73 4O7HA 5FGOA 3BNEA 2G0FA 3AGNA 4DSSA 4DSSB 2R2JA 5ELUA 5FWGA 4WEYA 3HK4A 5KOWA 18GSA 2E7PA 4J5GA 1XXUA 2VL2C 4F82A 4J56E 3NV0B 3C7MA 4Q53A 2GBXB 3CCM3 1PRXA 2H19A 3I69A 5LNKe 2DMLA 2DBCA 2QSIA 4XDVA 1ZGXA 4CHSA 1U88A 3GL5A 1FB0A 2ZHXB 3KD0A 5A4UA 2IWTA 4EDYA 3LH4A 1TK0B 5CRHA 2X99A 1AV4A 2FWFA 2YWOA 3EU3A 3MKIA 5IEOA 4ACSA 2O9UX 3M3MA 4RBNA 1X1XA 1BUQA 1B8XA 2BJXA 3E9JB 4XCSA 3WGEA 2YN1A 4PXOA 3MHEA 2OCTA 2XPEA 3ER7A 5CREA 1U3IA 2B24B 2E2VA 2ALBA 3VFIA 4G2EA 5DJLA 4MZCA 1S723 3ZRDA 1G7EA 1LOWA 2L4CA 4HJ2A 4Q5QA 3OXAA 2VAFA 3WA3A 2RFRA 4BVXB 2MC8A 1RK4A 3DVXA 5HR2A 3BIRA 2WRTA 3MIXA 4EV2A 2FCHA 3HI7A 4FCJA 1XW6A 4ECJA 5BU4A 2BU4A 4I2UA 2KAAA 2B5EA 3JVCA 3ED3A 5AIGA 2L5LA 3HKRA 4J8TA 4HSCX 1FO5A 1XVWA 4MPGA 3IK9A 3EX9A 4HU7A 3FZ4A 5IM9A 3SOAA 4Q5NA 2VM2A 1FA3A 4N30A 1VQO3 4HBRA 2RIIA 1AQVA 5EL8A 1M904 2MYGA 1W6GA 2J23A 4JRFA 3F8XA 5KP4A 1I2FA 3F4RA 4L5OA 1RGFA 4YAVA 5DQYA 5G1LA 1O7GB 1RJOA 3D4AA 3EQQB 4AKYA 4ZL8A 1J08A 1XG8A 1XOBA 4HOHA 3DEXA 2X8GA 1SKRB 2VLVA 1V74A 1PN9A 5LC7A 4ZL7A 2F98A 2CVKA 4ZL9A 3RAZA 2CAQA 5B8AA 1O6JA 3LT9A 1I3IA 5AYSC 1SIHA 1ZYQB 3VWVA 4GL6A 3IC8A 1WE0A 1R5AA 1T4ZA 3LYPA 4CCVA 1QQ2A 5ECRB 2XGLA 2SARA 5JWQB 1YNVX 2CX0A 1FZUA 3D3LA 1MGWA 3NM7A 1GLPA 2XH9A 3A5EA 3F14A 2P09A 2X64A 4K1FA 1M3IA 1PKWA 2GT5A 4AJ8A 1JZOA 4WWUC 4GSTA 7RNTA 4DSRA 2LSTA 1A8LA 2AJQB 3FKFA 1THOA 4LEHA 1FVJA 5D9VA 1X9SB 1UCLA 5JPUA 1PN0A 1FVKA 4BIKA 2FNOA 3NOFA 4I6XA 2C0EA 3G4S3 5D8IA 3PCRA 2CG1A 3FMWA 3CME3 1FGMA 1VQK3 3FH1A 3LTDA 4TR1A 4E8HA 3HVSA 1M9GA 4X0XA 1NNVA 2O87A 5FW5A 5D96A 2IMFA 4O32A 1FYSA 2GSPA 1OC9A 1LBKA 1YJ6A 2IMKA 3MAKA 3Q74A 1AXDA 4IELA 1ERVA 2LEGA 5DQSA 4N10A 2CAIA 2J9HA 3MNGA 4KAEA 4WF5A 1KTEA 5DCHA 4ZB9A 2YOIA 3HZPA 1EWXA 2AAEA 2W0QA 4PEJA 2P5RA 3IRAA 4NAXA 2R5GA 2R4VA 2CWVA 4MK3A 6GSWA 2WCIA 2ML6A 2OQEC 2V41A 2KF6A 2L6DA 3TRPA 3F3QA 5G31A 3WMDA 1GP1A 1CYUA 1BNRA 3G16A 5G5EA 4GCIA 4ULXA 2X8CA 3HJMA 5ECKB 3NXJA 4I2TA 3OX9A 5AIVA 5M19A 4N0ZA 6GSTA 1PY3A 1BAYA 1OACA 4AGSA 1WMJA 5D9WA 2CG0A 2DIZA 1VZZA 4PQ1A 1Z6NA 4XBXA 1S3RA 4IJIA 4PQHA 2L4VA 1RLSA 3C1RA 3AGOA 2CFKA 2B6MA 2WDUA 2J8XB 1W7CA 1BJXA 3F9SA 2ZUPA 1IVUA 4PNGA 3SVAA 1UW1A 2GZPA 1O7WB 2MMNA 1N5PA 2DMMA 2GSRA 3PGTA 2HMJB 4XS4A 3PINA 3QAWA 2FXTA 4NV5A 4HM1B 3W8JA 3P8WA 1XPVA 3GX8A 3MDKA 3IPZA 3O8YA 2K0MA 1YJW3 4BL7B 1BNGA 2GEYA 6STDA 2YV9A 4O8SA 4K0GA 1W5ZA 4YH2A 1K0OA 3F4SA 4EIQA 1FW1A 1HYUA 3K5TA 4O02B 3ZG0A 4MJBA 5IERA 2GU1A 1XIYA 5GSSA 3GRDA 2HI7A 2HNLA 1YGEA 4K0NA 3KE7A 3M9JA 5ENUA 4J5KA 1PD21 1NB3I 1A2JA 4G0IA 2AAWA 3QAVA 4XS4B 2P0XA 4K90B 3KM6A 1NB5I 1QAFA 2LJKA 4OK0A 2NVLA 1HNAA 1SD8A 4KE3A 1WNHA 3ZG5A 6GSUA 2ZA4A 2ES7A 3H79A 4HI7A 1GULA 1A8YA 1JB5A 3IPTA 1Y25A 5CRGA 2OTL3 2JZRA 3ROBA 2PGTA 2XEPA 1ZMAA 4OD7A 2KP1A 1JBTA 5STDA 3WGDA 1PL1A 1ZGNA 5F05A 2B5YA 1UA5A 3UL5A 2W2CA 1JKGB 1GSPA 2MZCA 3K9MC 3QOUA 5ID2A 2GQLA 2H74A 3CQFA 1G6WA 3J7Yk 2XC2A 3F7SA 4GWRA 4OCFA 3HZ8A 1YJ93 4O3VA 3F9UA 2HRKA 2RNTA 3LXTA 4BTXA 2IMJA 3X40A 3VPTA 1A2MA 2C11A 3O76A 3ZTLA 4K1VA 3RPNA 3F40A 2YNXA 5CRDA 2F9SA 1UUGB 5ELJA 1SJ6A 4ZM8A 1MD4A 1W4VA 1IDPA 3RDEA 1OYJA 4TN8A 2FGXA 3KCHA 2G2QA 2BTOT 1B20A 4HAAA 4IN0A 1RSNA 2HMLB 3RNTA 4K8MA 2RSXA 1Q824 1NM3A 4MMXB 1H4OA 1TRVA 5HFKA 4IS0A 1LRAA 1T3BA 5FHIA 4KZ1A 5G5FA 2R0PA 4CDOA 1XWAA 3OR5A 4MMZB 2OQEA 5JWOB 3VWXA 1IQYA 1AY7A 2Q07A 4RQXA 3GL3A 4BTYA 4KW6A 1I0XA 1QVF2 5G2GA 4EYCA 2K54A 1F9MA 2F5MA 1S5AA 1VF1A 3EWLA 3CC43 3DMLA 3Q3FA 2JL4A 2BMXA 3FY7A 2A2PA 2LRTA 2LV3A 3D5JA 4JRRA 4F0BA 1GL8A 1X1UA 5ECPB 1Q42A 3DWVA 4JBBA 5IMAA 2A4HA 4XHMA 1EP7A 1BRSA 1VQM3 3ZIJA 3LORA 4G10A 2FWEA 3TDGA 1BGSA 2LRCA 3CCL3 1MWSA 1EUIC 4HM8B 2LJRA 3TRXA 3DD3A 1Q814 4Z2UA 1KD14 3J7Yb 3ERFA 4TR4A 1IU7A 1YIT3 4F2IA 3DZLA 5DCGA 3D22A 1KNGA 2H6YA 3TKSE 2K8SA 2CKFB 4X2OA 3LYGA 1ZOFA 1ZYNA 2VOCA 4RQRA 2IFQB 3TOTA 3GX0A 1MNLA 2E2GA 2V6OA 3LTAA 2CX1A 5HR0A 1IV7A 1B2ZA 1QFNA 1CQGA 1NHOA 2WULA 2XR8B 2VCTA 4K9ZA 1R4WA 1O73A 1YKCA 4HZ9B 3L0HA 1XFLA 4FCZA 5IO2A 1M3JA 2IMIA 9GSSA 4TRXA 3H51A 2TRCP 3EU4A 2F86B 4Z2RA 1W2B2 5AEUB 2TIRA 4PUAA 4HZBB 2HRNA 5FT3A 3MYDA 1GY6A 3HD5A 10GSA 1GUMA 4HYZA 3GSSA 2IPAA 1ACVA 1EG9B 12GSA 4K1UA 1F6MC 2HMMB 3L0RA 4BU4A 2YANA 4P3YB 3HA9A 2IUJA 1BEDA 4HM6B 2VL2A 1ZX2A 1UVZA 1VQP3 1T8EB 1W6YA 4XBTA 5ELAA 1XW9A 4N6UA 2JU5A 3UEMA 1ROAA 3S5CA 3KJYA 3IE3A 3G6E3 3S27A 2A2SA 2C4BA 3VI5A 4WFOA 4EBGA 3JUMA 3CCS3 2O7KA 4PNFA 1LQMB 5CP1A 3GV1A 2FD3A 1B2UA 1ABAA 1KC84 1BSCA 1RGHA 1HNBA 1C54A 2L59A 3SLUA 2TRXA 3H93A 1O7NB 4KH7A 1TKDB 1TRWA 2ZCTA 1MD3A 4ISDA 2HT9A 1QGVA 3ZMLA 3TJGA 1OGXA 1HZ1A 3G7YA 2RBIA 1GD3A 5EEOA 2H73A 3WD6A 17GSA 5KP1A 2EC4A 1IVXA 1DETA 2VO4A 1PX7A 4MA9A 4EXRA 2JSZA 2HSMA 3PXMA 2FWGA 3UMAA 1HQOA 5H5SA 1OC9B 2HXKA 3QFBC 3KTBA 3V99A 5CF2A 3O6TA 3WOEB 4EXJA 2H30A 4L7KA 2YPMA 2WZ9A 5IMVA 4FMAA 1NHYA 3PGBA 4IW9A 3UJ1A 2FA8A 1BRIA 3ME7A 1T1VA 2F3MA 5EVOA 2VIMA 1B9XC 1RCKA 4L8PA 1RGGA 1RGLA 2BMOB 1OHPA 1T2IA 1PFPA 1K0CA 3OW22 1K0AA 4BL2A 4ZBAA 3MYTA 2OOVC 4YQVA 3APQA 3HYPA 1UC7A 3NUVA 3G9BA 1UGHI 2CZ3A 4F0CA 4F03A 4BL3A 2HLSA 4EC0A 3PZWA 5DALA 1GNEA 5C04A 4IPBA 3SOYA 2Z6BA 1F2EA 2XBQA 1YF0A 1RMSA 3I43A 1A0FA 1GD4A 1M1XB 3HX8A 6GSPA 5ID2B 1NW2A 1YVSA 5DAKA 1BUJA 4AJ6A 1MWTA 2DKIA 1DVDA 2WGRA 1WMNA 1K0DA 1GSYA 1GTUA 5J41A 2CK3H 2YX9A 4IKHA 3F63A 1X5EA 1LQGC 1WIKA 5HFIA 1VQ53 2LQQA 2FWHA 2M7OA 1BNIA 1N8JA 1PKZA 4LZIA 3US3A 3GH6A 1YDKA 1BIRA 5J5NA 3GNJA 3B7CA 3GKNA 1SPUA 2MMZA 3BNDA 4TX4A 2OTJ3 1T4YA 4BIRA 2ML5A 2FGTA 1GTIA 2H75A 3ZFLA 2RUEA 4CPKA 1A23A 1SKSB 3WYWA 4OVMA 2LNTA 4TXOA 1UI8A 2LTKA 3ZITA 1TRQA 3T8NA 1EOHA 3CSIA 1UGIA 3Q1CA 3ZMKA 3LSZA 2VL9A 4RUVA 4WR4A 1WWJA 3QRDA 1BRKA 3W8SA 5F0GA 2C8UA 2H1AA 4USSA 5HR1A 5EQLA 1IQ8A 4ZXGA 4ZB8A 11GSA 1X9MB 4I5QA 4V2MA 2D42A 3MSOA 3EJVA 2R0GA 1BAOA 5CO3A 5AN1A 4QL9A 3CCJ3 1RGKA 1UCIA 4Q5FA 4KDYA 2H0GA 3EN1B 5AIHA 2LRNA 4F9ZA 1ZCPA 3RGAA 3IC4A 4DVCA 1SJIA 5IIZA 3B8LA 3CBUA 3FLJA 3KSPA 2QGVA 4TVEA 1K28A 5ECHB 2QEX3 2V1LA 3FW2A 1PFOA 5B7CA 2IIYA 5H5RA 5AYRB 1VQ43 3NZNA 4WXTA 4KVHA 4X43A 2LQOA 1GSUA 3RDWA 2W9PA 3Q2PA 1MDKA 1Q98A 2FLSA 2JQ5A 1B27A 1M1K4 2HYXA 2AUVA 5DREA 4MP4A 4RI7A 1RGCA 1AVKA 1RGEA 3DVWA 2FNQA 4PQIA 3SX1A 1T2HA 3FZ9A 3HY2A 1X5CA 1K3YA 1XZOA 3Q6OA 4EDZA 3IHQA 4ICYA 2ON7A 3DRNA 2GQKA 1TIJA 3A2XA 3KMOA 3SWLA 3G713 4Q5RA 5J9BA 2RM5A 2YWIA 3CNMA 1FAAA 5J4UA 2DJJA 3HHVA 1OC8A 1KSIA 1TFKA 1DVCA 2H0HA 3DGYA 1WP0A 2H0IA 4GRFA 3FZAA 2B3SA 2CHCA 1K0NA 1MDIA 5IPGA 2R0CA 2DJKA 3UVTA 3JUPA 2OJLA 2PWJA 3BJ5A 3TJFA 3GSTA 4J2FA 1MWUA 4MLYA 1OKTA 2HE3A 3UL3A 3LQ7A 1Z7RA 5HQPA 3UJMA 1BRHA 2Y73A 3SXXA 1JLVA 1TP9A 3A3TA 3UIWA 2CFGA 3V98A 1LOXA 1YI23 1BYEA 1OGZA 1AIUA 2YFIB 1GSSA 3DGQA 1K3LA 3JUNA 4EVMA 3DYRA 3UAPA 4MMYB 5KOXA 1U6TA 3I563 4Z7XA 2HSHA 1XWCA 3AMOB 4OFNA 4HZ2A 4EIPA 1X0RA 1VQ83 2VCXA 3UL6A 1GY5A 3IK7A 2KXGA 3EHCA 3BBYA 2YFJB 3R2QA 2XPDA 2CWUA 2GBWB 3VURA 3S9FA 1W89A 3DXOA 3G7IA 5GZZB 2IUKA 3BU4A 1TDIA 3EYTA 1SYRA 3BNCA 2VD0A 2AADA 4RNTA 1EQKA 4WYKA 2K3DA 2H1DA 1STDA 1GOUA 1PMTA 3CRTA 1KQS2 2H01A 4HM3B 4K7NA 5GSTA 6GSSA 2KRTA 2UUGC 3WGXA 4N11A 1KWIA 1BNJA 1M9BA 2H1GA 2GEXA 3H3HA 4AF2A 5GAND 2IA7A 1CH0A 2N5FA 2GSSA 3KH9A 1Z9HA 3NIVA 2C4JA 4J9AA 4IP6A 2F56A 3KIIA 3N8BA 3K63A 3HIGA 1K0BA 1JZDA 2GU3A 1TU8A 3BOAA 3FR6A 1TK5B 1M99A 1F37A 4EUYA 3GIXA 3UB1A 4FMDA 1JKGA 4TR0A 3LXUX 1ISKA 2Z9SA 4YQMA 1AAZA 3M1GA 3M0FA 3B4OA 3TKRA 1GOYA 1DMQA 2VM1A 3KP8A 2YCDA 3FYGA 1E3RA 14GSA 3WA2X 3WT2A 1Q9EA 1KBNA 3IAS2 3HZ4A 3IA1A 1UDII 2OBKA 3DM8A 2NDOA 3KFQC 3L4NA 1DE1A 1GWCA 2FUG2 4ECBA 5ECOB 2JDIH 2BT3A 2N5AA 4I4KA 3CPW2 3U97A 1WQLB 2QA1A 3H4KA 3O3TA 4GSPA 4NV2A 2ZL8A 4U13A 2JACA 5JCGA 3HJPA 3LGCA 1IYHA 2A4VA 3L9VA 1V57A 2I81A 5IOWA 1B21A 1C72A 2W56B 1LVNA 1O81A 4OO5A 2OACA 1IYYA 3P90A 1ZYEA 13GSA 1RRLA 2PUKC 4BA7A 5IF6A 4NREA 3N54B 3C71A 3F6FA 1I3FA 4K6XA 3G0KA 3FR3A 4G9HA 1FHEA 4MCUA 2BMQB 2CX4A 1OUNA 5IG5A 1O85A 3SYUA 2VCWA 4A5PA 5TGNA 3L78A 1AR0A 2YZHA 4KCAA 5DJMA 1XOAA 1GSDA 4CJNA 1GSFA 2HZFA 1DMNA 4D73B 4OMVA 1I2GA 3AY8A 2HFDA 3KTLA 1VQL3 4HM2B 3IHGA 5HGRA 3K7CA 3HJOA 2R41A 3TCOA 3LTBA 4ZBBA 1AQZA 3P7XA 2VCZA 1GY7A 1OHSA 1Z6MA 3RGRA 3EPTA 2OE1A 4FYBA 3UBLA 3TGZA 1LOYA 6RNTA 4XIHA 4K7IA 2C0FA 1LJRA 1TRPA 4BVYB 4HDEA 4TKYA 3F7XA 1DE3A 1RGAA 22GSA 3G8ZA 4ILFA 3BLZA 3BD2A 3GFKA 5CK6A 2KLXA 4AEQA 2BO9B 1BG5A 1M0UA 2LNSA 2LQVA 4L0UA 4ID0A 4WHAA 2RUFA 5JCWA 3UVHA 5ABRA 5ELGA 2F4YA 1DUGA 2PNCA 4DSQA 3DXBA 4XB5A 1NO3A 4KX4A 1WPIA 4HQZA 2GXFA 3D5GA 3IXRA 1JV2B 4EV5A 1ZZYA 4HM4B 1URMA 1ZL9A 1I5GA 1R26A 4OO4A 3X3ZA 3ZLPA 3C1SA 1TOFA 1S3CA 1R5PA 1U87A 2EIRA 3LT8A 1Z3EA 2CFDA 4LSOA 3S67A 2IFQA 4MJDA 4MJEA 5HR3A 4KDUA 4ECCA 4ECIA 4K5SA 4BL7A 1Y4KA 2XBIA 3WT1A 4V1Ap 3LYKA 1O8WA 1VQN3 8RNTA 2QA2A 2FHEA 3FG3A 1OF5A 4G0LA 3IAM2 1SD9A 3H1NA 1I9DA 4H3UA 1W00A 3IMAB 3PH9A 3SBCA 2WB9A 5BIRA 1YF1A 3IOSA 7STDA 4E8EA 2QC7A 1A2LA 5AIFA 3HXSA 2F8FA 4ZBDA 2NBSA 2H1BA 3TKQA 4HQSA 4YQUA 1G96A 2C0GA 2GLRA 1TU5A 5J3RA 2L4QA 3JUOA 1EEMA 1GSEA 1IT7A 3V92A 1QUWA 4KF9A 3LWAA 1H75A 5G30A 5D9XA 3OV4A 1B2MA 4MNNA 1SQWA 3AMOA 2QA43 3FZ5A 4EO3A 1ASKA 2K9FA 3PR8A 3GUSA 4LL4B 2VUPA 2E2TA 5KN1A 3GRXA 4H61A 3UNLA 2I4AA 4IQ1A 2YP6A 4KT3B 1RNBA 4YKFA 4IJ3A 1RN7A 2CVDA 4FYUA 4LA1A 1C7HA 3CSHA 4ZIJA 2YJ7A 3S28A 1SK2A 4HZ4A 1I70A 3CD63 3NBRA 2BMRB 4IT7A 4X2HA 4KA0A 3A2VA 1US1A 2WGQA 4MEIA 3DUKA 2FA4A 4ZB6A 3LOYA 2P5QA 1FUWA 3CCV3 4HVNA 3EBYA 3R3EA 2N5BA 2LYXA 2C10A 3TRQA 3QAGA 1TUHA 1PU4A 3KEBA 3GSPA 1ON4A 1YKAA 4BVXA 1RHLA 5IO0A 4KNDA 2CIUA 3M8CA 1M7TA 3HVXA 1IT8A 4FO5A 1DBYA 1Q40A 3QDNA 3KGKA 1CQSA 3KCMA 1FGTA 5I97A 3S29A 3TKSA 2DJ1A 2CZ2A 5LC6A 1A90A 4L8EA 2DSAA 4JR6A 4HJLB 3F6DA 4R1KA 20GSA 1VQQA 1CEWI 4MJCA 1HNCA 4POBA 1QMAA 3T8UA 1MWRA 4KFFA 2OE0A 3WHOA 2Z7AA 2WGOA 2MBTA 1U3AA 3LMLA 5BMUA 2CW9A 4TXVA 5INYA 3FGYA 2CC3A 5DRVA 1OAZA 2C3TA 1AQXA 4ML6A 3UBKA 1B2XA 5DAKB 5HOHA 1W4NA 4CY6A 2I9WA 3VSYA 1J9BA 1QAKA 5D93A 1SU9A 2WO0A 1TI3A 1NJI4 2P38A 4CDLA
chains in the Genus database with same CATH topology
3F3RA 1XCCA 2M46A 1SL0B 1N2AA 4CW9A 2C3QA 4IVFA 4AJ7A 3Q19A 1M2DA 4FIWA 3VWWA 3EURA 5F8BA 4KDXA 5KN2A 2OADA 4TR1B 2VCQA 4O5QA 2H71A 4HJMA 4GLTA 3TUEA 2A2RA 2GZZA 4YAPA 5KEJA 2WS2A 3L9SA 4PUFC 3CXGA 4LMVA 1V58A 5AISA 1V2AA 2M72A 1J0FA 5G2ZA 3ZYWA 1IYIA 2HZEB 1VF4A 2VL3A 4Z2TA 4BVYA 2HRFA 1V98A 3CMIA 4MF5A 3RBTA 1JZWA 4X4JA 2JZSA 1OC3A 2FY6A 2GGTA 2CV4A 1G0TA 1F3BA 4MZBA 3E3EA 2B7JA 5IQYA 4EE0A 1BX9A 2R6KA 5COHA 2C1YA 3QCPA 4HEA2 4BWQA 1XWKA 3FR9A 4V1Ag 2AV4A 5LCZA 1OE8A 4MABA 1S3DA 3CYNA 1S3AA 4OWYA 6GSYA 16GSA 2H66A 3A2WA 1GUHA 2DKHA 1GNWA 2R37A 3VK9A 1MEKA 5BRTA 3DKSA 4NWYA 4KCEA 2MMAA 3BCKA 1PX6A 2H72A 1EV9A 5A4WA 1SYXA 1X9WB 2IL3A 4HS1A 3ZREA 3ERGA 1NSWA 1EEJA 6GSXA 1RQMA 1PQNA 4NXIA 2DC5A 5LD0A 5DDLA 2IY2A 3DIEA 4TR3A 3GURA 1FOVA 2XHFA 1TW9A 1MTCA 4FYCA 4MJAA 2H8LA 2DJ3A 2EIQA 5G1KA 4BPYA 3P2AA 4OFTA 2AYTA 3D4TA 2PPTA 4JEDA 3ERWA 5HFGA 4H86A 1WOUA 4NHZA 3Q18A 4IBPA 4MDCA 1OE7A 3N9JA 1YEXA 5EPFA 1A0RP 2X8HA 2PBJA 3VPQA 1VRSD 3RPPA 5E59A 4O5UA 2OA7A 5D9TA 3LW9A 3KP9A 1AC1A 5ECMB 4MPFA 2K18A 2JZTA 2CX3A 1CQHA 1VF2A 1M2AA 1XW5A 2GZYA 3KH7A 4O92A 5IMCA 1Z5YE 3GTUA 1GH2A 4ZILA 3I9V2 4QQ7A 3FEUA 3TJJA 4XRDA 2PN8A 4WF4A 4MH2A 1YZXA 2V2GA 4D73A 8GSSA 4GQFA 2V1MA 1TI1A 2L57A 5AGYA 1UN2A 2GT6A 1TU7A 4G19A 4PURA 1B9YC 5A5KA 5IMZA 1YEPA 4LLRA 2HSYA 3N5OA 5ECNB 3F0IA 1ERUA 3FHKA 2GQMA 1JHBA 1ILOA 2IN3A 2GSQA 1JFUA 1VF3A 2CA8A 3GKMA 5IPHA 1ERWA 4OFMA 3V1WA 2I3YA 3TJBA 1AUCA 3GA4A 4X1UA 1F3AA 2OBIA 3JCML 3LG6A 4JZQA 2PVOC 3HVVA 4PTSA 5E4WA 1V40A 2LUSA 3TKSC 1RW1A 5KN0A 1EGOA 1DSBA 2WFCA 2L5OA 3F8UA 3APSA 1ERTA 3CTFA 4DEJA 4RI6A 3D4MA 3IDVA 2LJAA 3LXZA 1HD2A 2PMTA 2CVBA 2O85A 5ECSA 3ZZXA 1GLQA 4HOJA 2HRAA 4V2LA 4POKA 1SK0A 3C73A 4ML1A 3FRCA 4MF6A 2CT6A 1SKWB 2YV7A 2V6KA 3QMXA 3RHCA 1GTAA 2D2ZA 3TJKA 1JLWA 2NPBA 4FH8A 1USBA 7GSSA 4GQCA 4NMUA 3RHBA 1R7HA 1EV4A 2JADA 4K7OA 4GSNA 1THXA 1B48A 4TW5A 2K8VA 4XS1A 1E2YA 2I1UA 2DJ0A 3IR4A 2ON5A 3U5RE 3GKKA 1SL2B 2QKEA 3GH9A 3UOMA 5JCUA 2F51A 1AQWA 1WRYA 1K0MA 2P31A 3TB2A 3A5IA 3TOUA 2DLXA 4LL1B 3E0UA 4JE1A 5A4VA 2AHEA 3LEFA 4LMWA 4NPBA 1QXHA 1PA3A 5ECLB 3M9KA 3VWUA 4CY8A 3ZVJA 1K3OA 4EKZA 2JSYA 1M2BA 1PL2A 1ZYPA 2LS5A 2O8VB 3PPUA 1GSQA 3G7JA 2H70A 2RLIA 3ZL5A 1G6YA 2X49A 2PVQA 3EVIA 1SK1A 4WETA 1Z7PA 5IMFA 2IYJA 3GN3A 1T00A 1PGTA 2CQ9A 3QPMA 5B6MA 4O5RA 3ME8A 3LJRA 2RM6A 5IOXA 1BQ7A 3APOA 3VLNA 2IMDA 1KEBA 2E0QA 3F4TA 2EIOA 3QFAC 2KUCA 3GMFA 3KXOA 5CAXA 1V9WA 2LKUA 5F06A 1SENA 4MF7A 3IV4A 4TOPA 2B1LA 1DE2A 5C00A 2X4AA 3D21A 3EE2A 2VLTA 6GSVA 3I6AA 2GSTA 3EINA 1QMVA 4GXZA 1YY7A 1EP8A 3KMNA 4JR4A 2C3NA 1M9AA 1TXXA 1ML6A 4WBJA 4TXOB 5ECQB 3CTGA 1XWGA 4J57E 4EF0A 4GSSA 2MBSA 2YZUA 1TK8B 2KHPA 3KZQA 1GRXA 4L5LA 1O8XA 4K2XA 2B5XA 4KUNA 1OKDA 1FG4A 2IMEA 5J9CA 3ISOA 4V2NA 3IBHA 2KOKA 3UARA 5CNWA 3QR6A 4IGJA 4K2DA 1O7UA 3D6IA 4IP1A 4PGTA 3ZVJD 3ZIVA 2OKAA 2GTUA 4MZWA 3GHAA 2IJYA 4FQUA 2YWMA 1E6BA 4N0VA 4I97A 3L9UA 3GKXA 4EL1A 4I8BA 4MH3A 1GTBA 4POLA 2VD1A 5CYYA 19GSA 2H6XA 2B1KA 1SL1B 4IHUA 2PERA 3C8EA 4K5RA 3H8QA 4BWSA 1XWBA 5KN3A 5CRWA 1FB6A 1ST9A 4KSMA 2R3XA 3U6VA 1QK8A 4GF0A 3KIJA 2KP2A 1B4PA 2L6CA 4HU9A 4IQAA 1EOGA 1XBSA 2B7KA 5JWRB 2YWNA 1JZRA 2V32A 4HUAA 2M80A 1TRUA 2O89A 3D0ZA 4WKWA 1MDJA 4XTSA 4G0KA 4POMA 1Y6EA 2GVPA 2H6ZA 1TJDA 4L0WA 4WBRD 5H5QA 5AIXA 1A24A 2C0DA 5F07A 2DJ2A 3EC3A 1GUKA 3BCIA 3VI7A 5ECIB 3K8NA 1FOHA 1WJKA 3MSZA 1T7PB 1EZKA 5DBQA 2ZNMA 1X5DA 5L71A 2NTOA 4WR5A 1VGLA 3CRUA 3HDCA 2UZ8A 2I9HA 2YJHA 4MMMA 4XS6A 3W6GA 3LFLA 2OE3A 2H76A 3QD9A 3GYKA 3A5WA 4JU5A 1G7OA 2P0GA 4KB3A 2MMOA 1TTZA 1AW9A 3EMPA 4QL7A 2C80A 5D73A 1SJZA 2VCVA 3EMXA 2E2MA 1LU4A 4KSOA 2PU9C 5GAPD 4PX1A 2GDRA 1XVQA 5DALB 1PSQA 3TKPA 3MWHA 5IMDA 2HZEA 2GS3A 5B6NA 4GTUA 1TRSA 2F8AA 4KGIA 2WJUA 2REMA 4OCEA 4YKGA 3ZFBA 1Q4JA 1YQ1A 5EY6A 1EGRA 3CSJA 2K6VA 3HCZA 3GTUB 5B8BA 1OVNA 3M8NA 2VLUA 2DIYA 1B4QA 4NHWA 5DVBA 2AB6A 3FK8A 4XRAA 4O7HA 2G0FA 4DSSA 4DSSB 2R2JA 5FWGA 4WEYA 5KOWA 18GSA 2E7PA 1XXUA 2VL2C 4F82A 4J56E 3C7MA 2H19A 1PRXA 3I69A 5LNKe 2DMLA 2DBCA 2QSIA 4CHSA 1U88A 3GL5A 1FB0A 3KD0A 5A4UA 2IWTA 4EDYA 1TK0B 5CRHA 2X99A 2FWFA 2YWOA 3EU3A 4ACSA 3M3MA 1B8XA 2BJXA 3E9JB 4XCSA 3WGEA 2YN1A 4PXOA 2XPEA 5CREA 1U3IA 2ALBA 3VFIA 4G2EA 5DJLA 4MZCA 3ZRDA 1G7EA 2L4CA 4HJ2A 4Q5QA 2VAFA 4BVXB 1RK4A 3DVXA 5HR2A 2WRTA 3MIXA 2FCHA 1XW6A 4ECJA 4I2UA 2B5EA 3ED3A 2L5LA 3HKRA 1FO5A 1XVWA 4MPGA 3IK9A 4HU7A 3FZ4A 5IM9A 4Q5NA 2VM2A 4N30A 2RIIA 1AQVA 5EL8A 2MYGA 2J23A 3F4RA 4L5OA 4YAVA 5DQYA 5G1LA 4ZL8A 1J08A 1XOBA 3DEXA 2X8GA 1SKRB 2VLVA 1PN9A 4ZL7A 2CVKA 4ZL9A 3RAZA 2CAQA 5B8AA 1O6JA 1ZYQB 3VWVA 3IC8A 1WE0A 1R5AA 1T4ZA 3LYPA 1QQ2A 5ECRB 5JWQB 1GLPA 2X64A 4K1FA 1PKWA 2GT5A 4AJ8A 1JZOA 4GSTA 4DSRA 2LSTA 1A8LA 2AJQB 3FKFA 1THOA 1FVJA 5D9VA 1X9SB 1PN0A 1FVKA 2FNOA 3NOFA 4I6XA 2C0EA 5D8IA 3FMWA 4TR1A 4E8HA 3HVSA 4X0XA 2O87A 5D96A 2IMFA 4O32A 1OC9A 1LBKA 1YJ6A 2IMKA 3MAKA 3Q74A 1AXDA 4IELA 1ERVA 2LEGA 5DQSA 2CAIA 3MNGA 4KAEA 4WF5A 5DCHA 1KTEA 2J9HA 4ZB9A 2YOIA 1EWXA 2P5RA 3IRAA 4NAXA 2R5GA 2R4VA 6GSWA 4MK3A 2WCIA 2V41A 2L6DA 3TRPA 3F3QA 5G31A 1GP1A 5G5EA 4GCIA 4ULXA 2X8CA 3HJMA 5ECKB 4I2TA 5AIVA 4N0ZA 6GSTA 1BAYA 4AGSA 1WMJA 5D9WA 2DIZA 4PQ1A 1Z6NA 4IJIA 4PQHA 3C1RA 2B6MA 2WDUA 1BJXA 2ZUPA 4PNGA 2GZPA 2MMNA 2DMMA 2GSRA 3PGTA 4XS4A 3PINA 3QAWA 4NV5A 3W8JA 3P8WA 1XPVA 3GX8A 3MDKA 3IPZA 4BL7B 2YV9A 4K0GA 4YH2A 1K0OA 3F4SA 4EIQA 1FW1A 1HYUA 4MJBA 1XIYA 5GSSA 2HI7A 2HNLA 4K0NA 3M9JA 5ENUA 1PD21 1A2JA 4G0IA 2AAWA 3QAVA 4XS4B 3KM6A 2LJKA 2NVLA 1HNAA 1SD8A 4KE3A 6GSUA 2ES7A 3H79A 4HI7A 1GULA 1A8YA 1Y25A 5CRGA 2JZRA 2PGTA 1ZMAA 4OD7A 2KP1A 3WGDA 1PL1A 1ZGNA 5F05A 2B5YA 1UA5A 2MZCA 3QOUA 5ID2A 2GQLA 2H74A 1G6WA 3J7Yk 2XC2A 4GWRA 4OCFA 3HZ8A 3F9UA 2HRKA 3LXTA 3VPTA 1A2MA 3O76A 3ZTLA 3RPNA 2YNXA 5CRDA 2F9SA 1SJ6A 1MD4A 1W4VA 1OYJA 4TN8A 2FGXA 2G2QA 2BTOT 4IN0A 4K8MA 1NM3A 1H4OA 1TRVA 5HFKA 4IS0A 1T3BA 5FHIA 4CDOA 5G5FA 2R0PA 1XWAA 3OR5A 5JWOB 3VWXA 4RQXA 3GL3A 4KW6A 1F9MA 1VF1A 3EWLA 3DMLA 2JL4A 2BMXA 3FY7A 2A2PA 4JRRA 2LRTA 2LV3A 3D5JA 4F0BA 1GL8A 5ECPB 3DWVA 4JBBA 5IMAA 2A4HA 4XHMA 1EP7A 3ZIJA 3LORA 4G10A 2FWEA 3TDGA 2LRCA 2LJRA 3TRXA 3DD3A 4Z2UA 3J7Yb 3ERFA 4TR4A 4F2IA 5DCGA 3D22A 1KNGA 2H6YA 3TKSE 2K8SA 1ZOFA 1ZYNA 2VOCA 4RQRA 2IFQB 3TOTA 3GX0A 2E2GA 2V6OA 5HR0A 1QFNA 1CQGA 1NHOA 2WULA 4K9ZA 2VCTA 1R4WA 1O73A 1YKCA 3L0HA 1XFLA 5IO2A 2IMIA 9GSSA 4TRXA 2TRCP 3EU4A 4Z2RA 2TIRA 4PUAA 2HRNA 5FT3A 3MYDA 3HD5A 10GSA 1GUMA 3GSSA 2IPAA 1ACVA 12GSA 1F6MC 2YANA 4P3YB 3HA9A 1BEDA 2VL2A 1UVZA 1T8EB 5ELAA 1XW9A 2JU5A 3UEMA 3KJYA 3IE3A 2A2SA 3VI5A 2O7KA 4PNFA 5CP1A 3GV1A 2FD3A 1ABAA 1HNBA 2L59A 2TRXA 3H93A 4KH7A 1TKDB 1TRWA 2ZCTA 1MD3A 4ISDA 2HT9A 1QGVA 3ZMLA 3TJGA 3G7YA 2H73A 3WD6A 17GSA 2EC4A 2VO4A 1PX7A 4MA9A 2JSZA 2HSMA 2FWGA 3UMAA 1HQOA 5H5SA 1OC9B 2HXKA 3QFBC 3KTBA 3O6TA 4EXJA 2H30A 2YPMA 2WZ9A 5IMVA 1NHYA 4IW9A 3UJ1A 2FA8A 3ME7A 1T1VA 2F3MA 5EVOA 2VIMA 1B9XC 1K0CA 1K0AA 4ZBAA 4YQVA 3APQA 3HYPA 1UC7A 3G9BA 4F0CA 2CZ3A 4F03A 2HLSA 4EC0A 5DALA 1GNEA 5C04A 1F2EA 2XBQA 1YF0A 3I43A 1A0FA 5ID2B 1NW2A 5DAKA 4AJ6A 2DKIA 2WGRA 1K0DA 1GSYA 1GTUA 5J41A 4IKHA 3F63A 1X5EA 1WIKA 5HFIA 2LQQA 2FWHA 1N8JA 1PKZA 3US3A 3GH6A 1YDKA 5J5NA 3GNJA 3GKNA 2MMZA 1T4YA 1GTIA 2H75A 3ZFLA 2RUEA 1A23A 1SKSB 3WYWA 2LNTA 4TXOA 2LTKA 3ZITA 1EOHA 3CSIA 3ZMKA 3LSZA 2VL9A 4RUVA 4WR4A 1WWJA 3W8SA 5F0GA 2C8UA 2H1AA 4USSA 5HR1A 4ZXGA 4ZB8A 11GSA 1X9MB 4I5QA 4V2MA 2R0GA 5CO3A 5AN1A 4QL9A 4Q5FA 4KDYA 2H0GA 2LRNA 4F9ZA 1ZCPA 3IC4A 4DVCA 1SJIA 5IIZA 3CBUA 4TVEA 2QGVA 5ECHB 3FW2A 5B7CA 2IIYA 5H5RA 3NZNA 4WXTA 4X43A 2LQOA 1GSUA 3RDWA 1MDKA 1Q98A 2FLSA 2HYXA 2AUVA 4MP4A 4RI7A 3DVWA 4PQIA 3HY2A 3FZ9A 1X5CA 1K3YA 1XZOA 3Q6OA 4EDZA 3IHQA 4ICYA 2ON7A 3DRNA 2GQKA 3A2XA 3KMOA 3SWLA 4Q5RA 5J9BA 2RM5A 2YWIA 1FAAA 5J4UA 2DJJA 3HHVA 1OC8A 2H0HA 1WP0A 2H0IA 4GRFA 3FZAA 2B3SA 1K0NA 1MDIA 5IPGA 2R0CA 2DJKA 3UVTA 2OJLA 2PWJA 3BJ5A 3TJFA 3GSTA 4J2FA 4MLYA 1OKTA 2HE3A 3UL3A 3LQ7A 1Z7RA 5HQPA 1JLVA 1TP9A 3A3TA 3UIWA 1BYEA 1AIUA 1GSSA 3DGQA 1K3LA 4EVMA 3DYRA 3UAPA 5KOXA 1U6TA 4Z7XA 2HSHA 1XWCA 4OFNA 4HZ2A 4EIPA 1X0RA 2VCXA 3IK7A 3BBYA 3R2QA 2XPDA 3VURA 3S9FA 1W89A 5GZZB 3G7IA 1TDIA 3EYTA 1SYRA 2VD0A 2H1DA 1PMTA 3CRTA 5GSTA 2H01A 4K7NA 6GSSA 3WGXA 4N11A 1M9BA 2H1GA 4AF2A 5GAND 2N5FA 2GSSA 3KH9A 1Z9HA 3NIVA 2C4JA 4IP6A 3FR6A 1K0BA 3BOAA 1JZDA 1TU8A 1TK5B 1M99A 1F37A 4EUYA 3GIXA 4TR0A 2Z9SA 4YQMA 1AAZA 3M1GA 3M0FA 3TKRA 3KP8A 2VM1A 2YCDA 3FYGA 14GSA 3WT2A 1KBNA 3IAS2 3HZ4A 3IA1A 2OBKA 2NDOA 3L4NA 1DE1A 1GWCA 2FUG2 4ECBA 5ECOB 2N5AA 2QA1A 3H4KA 3O3TA 4NV2A 2JACA 5JCGA 3HJPA 3LGCA 1IYHA 2A4VA 3L9VA 1V57A 2I81A 5IOWA 1C72A 1O81A 4OO5A 2OACA 3P90A 1ZYEA 13GSA 4BA7A 2PUKC 3C71A 3F6FA 4K6XA 3FR3A 4G9HA 1FHEA 4MCUA 2CX4A 1O85A 2VCWA 4A5PA 3L78A 2YZHA 4KCAA 5DJMA 1XOAA 1GSDA 2HZFA 1GSFA 4D73B 4OMVA 3AY8A 2HFDA 3KTLA 3IHGA 3HJOA 3TCOA 4ZBBA 3P7XA 2VCZA 1Z6MA 3EPTA 2OE1A 4FYBA 3UBLA 3TGZA 4XIHA 4K7IA 2C0FA 1LJRA 4BVYB 4HDEA 4TKYA 4ILFA 22GSA 3BD2A 3GFKA 2KLXA 1BG5A 1M0UA 2LNSA 4L0UA 4ID0A 2RUFA 5JCWA 3UVHA 5ABRA 5ELGA 1DUGA 4DSQA 3DXBA 4KX4A 1WPIA 4HQZA 3IXRA 1ZZYA 1URMA 1ZL9A 1I5GA 1R26A 4OO4A 3ZLPA 3C1SA 1TOFA 1S3CA 1R5PA 1U87A 2EIRA 1Z3EA 2IFQA 4MJEA 5HR3A 4KDUA 4ECCA 4ECIA 4K5SA 4BL7A 2XBIA 3WT1A 4V1Ap 3LYKA 1O8WA 2QA2A 2FHEA 4G0LA 3IAM2 1SD9A 3H1NA 1I9DA 3PH9A 3SBCA 2WB9A 1YF1A 3IOSA 4E8EA 2QC7A 1A2LA 3HXSA 2F8FA 4ZBDA 2NBSA 2H1BA 3TKQA 4HQSA 4YQUA 2C0GA 2GLRA 5J3RA 2L4QA 1EEMA 1GSEA 1QUWA 4KF9A 3LWAA 1H75A 5G30A 5D9XA 4MNNA 3FZ5A 4EO3A 2K9FA 3PR8A 4LL4B 3GUSA 2VUPA 5KN1A 3GRXA 2I4AA 4IQ1A 2YP6A 4YKFA 4IJ3A 4LA1A 2CVDA 4FYUA 3CSHA 4ZIJA 2YJ7A 1SK2A 4HZ4A 4KA0A 3A2VA 2FA4A 4ZB6A 2P5QA 3R3EA 2N5BA 3TRQA 3QAGA 3KEBA 1ON4A 1YKAA 4BVXA 5IO0A 4KNDA 1M7TA 3HVXA 4FO5A 1DBYA 3QDNA 3KGKA 3KCMA 3TKSA 2DJ1A 2CZ2A 4L8EA 2DSAA 4JR6A 3F6DA 20GSA 4MJCA 1HNCA 4POBA 2OE0A 2MBTA 1U3AA 5BMUA 5INYA 4TXVA 2C3TA 1OAZA 3UBKA 1AQXA 4ML6A 5DAKB 4CY6A 1J9BA 5D93A 1SU9A 1TI3A 4N10A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3F3R A;  1XCC A;  2M46 A;  1SL0 B;  1N2A A;  4CW9 A;  2C3Q A;  4IVF A;  4AJ7 A;  3Q19 A;  1M2D A;  4FIW A;  3VWW A;  3EUR A;  5F8B A;  4KDX A;  5KN2 A;  2OAD A;  4TR1 B;  2VCQ A;  2H71 A;  4HJM A;  4GLT A;  3TUE A;  2A2R A;  2GZZ A;  4YAP A;  5KEJ A;  2WS2 A;  3L9S A;  4PUF C;  3CXG A;  4LMV A;  1V58 A;  5AIS A;  1V2A A;  2M72 A;  1J0F A;  5G2Z A;  3ZYW A;  1IYI A;  2HZE B;  1VF4 A;  2VL3 A;  4BVY A;  2HRF A;  1V98 A;  3CMI A;  4MF5 A;  3RBT A;  1JZW A;  2JZS A;  1OC3 A;  2FY6 A;  2GGT A;  2CV4 A;  1G0T A;  1F3B A;  4MZB A;  3E3E A;  2B7J A;  5IQY A;  4EE0 A;  1BX9 A;  2R6K A;  5COH A;  2C1Y A;  3QCP A;  4HEA 2;  4BWQ A;  1XWK A;  3FR9 A;  4V1A g;  2AV4 A;  5LCZ A;  1OE8 A;  4MAB A;  1S3D A;  3CYN A;  1S3A A;  4OWY A;  6GSY A;  16GS A;  2H66 A;  3A2W A;  1GUH A;  1GNW A;  2R37 A;  3VK9 A;  1MEK A;  3DKS A;  4NWY A;  4KCE A;  2MMA A;  3BCK A;  1PX6 A;  2H72 A;  1EV9 A;  5A4W A;  1SYX A;  1X9W B;  2IL3 A;  4HS1 A;  3ZRE A;  3ERG A;  1NSW A;  1EEJ A;  6GSX A;  1RQM A;  1PQN A;  4NXI A;  2DC5 A;  5LD0 A;  5DDL A;  2IY2 A;  3DIE A;  4TR3 A;  3GUR A;  1FOV A;  2XHF A;  1TW9 A;  1MTC A;  4FYC A;  4MJA A;  2H8L A;  2DJ3 A;  2EIQ A;  5G1K A;  4BPY A;  3P2A A;  4OFT A;  2AYT A;  3D4T A;  2PPT A;  4JED A;  3ERW A;  5HFG A;  4H86 A;  1WOU A;  4NHZ A;  3Q18 A;  4IBP A;  4MDC A;  1OE7 A;  3N9J A;  1YEX A;  5EPF A;  1A0R P;  2X8H A;  2PBJ A;  3VPQ A;  1VRS D;  3RPP A;  5E59 A;  2OA7 A;  5D9T A;  3KP9 A;  1AC1 A;  5ECM B;  4MPF A;  2K18 A;  2JZT A;  2CX3 A;  1CQH A;  1VF2 A;  1M2A A;  1XW5 A;  2GZY A;  3KH7 A;  4O92 A;  5IMC A;  1Z5Y E;  3GTU A;  1GH2 A;  4ZIL A;  3I9V 2;  4QQ7 A;  3FEU A;  3TJJ A;  4XRD A;  2PN8 A;  4WF4 A;  4MH2 A;  1YZX A;  2V2G A;  4D73 A;  8GSS A;  4GQF A;  2V1M A;  1TI1 A;  2L57 A;  5AGY A;  1UN2 A;  2GT6 A;  1TU7 A;  4G19 A;  4PUR A;  1B9Y C;  5A5K A;  5IMZ A;  1YEP A;  4LLR A;  2HSY A;  3N5O A;  5ECN B;  3F0I A;  1ERU A;  3FHK A;  2GQM A;  1JHB A;  1ILO A;  2IN3 A;  2GSQ A;  1JFU A;  1VF3 A;  2CA8 A;  3GKM A;  5IPH A;  1ERW A;  4OFM A;  3V1W A;  2I3Y A;  3TJB A;  1AUC A;  3GA4 A;  4X1U A;  1F3A A;  2OBI A;  3JCM L;  3LG6 A;  4JZQ A;  2PVO C;  3HVV A;  5E4W A;  1V40 A;  2LUS A;  3TKS C;  1RW1 A;  5KN0 A;  1EGO A;  1DSB A;  2WFC A;  2L5O A;  3F8U A;  3APS A;  1ERT A;  3CTF A;  4DEJ A;  4RI6 A;  3D4M A;  3IDV A;  2LJA A;  3LXZ A;  1HD2 A;  2PMT A;  2CVB A;  2O85 A;  5ECS A;  3ZZX A;  1GLQ A;  4HOJ A;  4V2L A;  4POK A;  1SK0 A;  3C73 A;  4ML1 A;  3FRC A;  4MF6 A;  2CT6 A;  1SKW B;  2YV7 A;  2V6K A;  3QMX A;  3RHC A;  1GTA A;  2D2Z A;  3TJK A;  1JLW A;  2NPB A;  4FH8 A;  1USB A;  7GSS A;  4GQC A;  4NMU A;  3RHB A;  1R7H A;  1EV4 A;  2JAD A;  4K7O A;  4GSN A;  1THX A;  1B48 A;  4TW5 A;  2K8V A;  4XS1 A;  1E2Y A;  2I1U A;  2DJ0 A;  3IR4 A;  2ON5 A;  3U5R E;  3GKK A;  1SL2 B;  2QKE A;  3GH9 A;  3UOM A;  5JCU A;  2F51 A;  1AQW A;  1WRY A;  1K0M A;  2P31 A;  3TB2 A;  3TOU A;  2DLX A;  4LL1 B;  3E0U A;  4JE1 A;  5A4V A;  2AHE A;  3LEF A;  4LMW A;  4NPB A;  1QXH A;  1PA3 A;  5ECL B;  3M9K A;  3VWU A;  3ZVJ A;  1K3O A;  4EKZ A;  2JSY A;  1M2B A;  1PL2 A;  2LS5 A;  2O8V B;  1GSQ A;  3G7J A;  2H70 A;  2RLI A;  3ZL5 A;  1G6Y A;  2PVQ A;  3EVI A;  1SK1 A;  4WET A;  1Z7P A;  5IMF A;  2IYJ A;  3GN3 A;  1T00 A;  1PGT A;  2CQ9 A;  3QPM A;  5B6M A;  4O5R A;  3ME8 A;  3LJR A;  2RM6 A;  5IOX A;  1BQ7 A;  3APO A;  3VLN A;  2IMD A;  1KEB A;  2E0Q A;  3F4T A;  2EIO A;  3QFA C;  2KUC A;  3GMF A;  3KXO A;  5CAX A;  1V9W A;  2LKU A;  5F06 A;  1SEN A;  4MF7 A;  3IV4 A;  4TOP A;  2B1L A;  1DE2 A;  5C00 A;  3D21 A;  3EE2 A;  2VLT A;  6GSV A;  3I6A A;  2GST A;  3EIN A;  1QMV A;  4GXZ A;  1YY7 A;  1EP8 A;  3KMN A;  4JR4 A;  2C3N A;  1M9A A;  1TXX A;  1ML6 A;  4WBJ A;  4TXO B;  5ECQ B;  3CTG A;  1XWG A;  4J57 E;  4EF0 A;  4GSS A;  2MBS A;  2YZU A;  1TK8 B;  2KHP A;  3KZQ A;  1GRX A;  4L5L A;  1O8X A;  2B5X A;  4KUN A;  1OKD A;  1FG4 A;  2IME A;  5J9C A;  3ISO A;  4V2N A;  3IBH A;  2KOK A;  3UAR A;  5CNW A;  3QR6 A;  4IGJ A;  4K2D A;  1O7U A;  3D6I A;  4IP1 A;  4PGT A;  3ZVJ D;  3ZIV A;  2OKA A;  2GTU A;  4MZW A;  3GHA A;  2IJY A;  2YWM A;  1E6B A;  4N0V A;  4I97 A;  3L9U A;  3GKX A;  4EL1 A;  4I8B A;  4MH3 A;  1GTB A;  4POL A;  2VD1 A;  5CYY A;  19GS A;  2H6X A;  2B1K A;  1SL1 B;  4IHU A;  2PER A;  3C8E A;  3H8Q A;  4BWS A;  1XWB A;  5KN3 A;  5CRW A;  1FB6 A;  1ST9 A;  4KSM A;  2R3X A;  3U6V A;  1QK8 A;  4GF0 A;  3KIJ A;  2KP2 A;  1B4P A;  2L6C A;  4HU9 A;  4IQA A;  1EOG A;  1XBS A;  2B7K A;  5JWR B;  2YWN A;  1JZR A;  2V32 A;  4HUA A;  2M80 A;  1TRU A;  2O89 A;  3D0Z A;  4WKW A;  1MDJ A;  4XTS A;  4POM A;  1Y6E A;  2GVP A;  2H6Z A;  1TJD A;  4L0W A;  4WBR D;  5H5Q A;  5AIX A;  1A24 A;  2C0D A;  5F07 A;  2DJ2 A;  3EC3 A;  1GUK A;  3BCI A;  3VI7 A;  5ECI B;  3K8N A;  1WJK A;  3MSZ A;  1T7P B;  1EZK A;  5DBQ A;  2ZNM A;  1X5D A;  5L71 A;  2NTO A;  4WR5 A;  1VGL A;  3CRU A;  3HDC A;  2I9H A;  2YJH A;  4MMM A;  4XS6 A;  3W6G A;  3LFL A;  2OE3 A;  2H76 A;  3QD9 A;  3GYK A;  3A5W A;  4JU5 A;  1G7O A;  2P0G A;  4KB3 A;  2MMO A;  1TTZ A;  1AW9 A;  3EMP A;  4QL7 A;  2C80 A;  5D73 A;  1SJZ A;  2VCV A;  3EMX A;  2E2M A;  1LU4 A;  4KSO A;  2PU9 C;  5GAP D;  4PX1 A;  2GDR A;  1XVQ A;  5DAL B;  1PSQ A;  3TKP A;  3MWH A;  5IMD A;  2HZE A;  2GS3 A;  5B6N A;  4GTU A;  1TRS A;  2F8A A;  4KGI A;  2WJU A;  2REM A;  4OCE A;  3ZFB A;  1Q4J A;  1YQ1 A;  5EY6 A;  1EGR A;  3CSJ A;  2K6V A;  3HCZ A;  3GTU B;  5B8B A;  1OVN A;  3M8N A;  2VLU A;  2DIY A;  1B4Q A;  4NHW A;  5DVB A;  2AB6 A;  3FK8 A;  4XRA A;  4O7H A;  2G0F A;  4DSS A;  4DSS B;  2R2J A;  5FWG A;  4WEY A;  18GS A;  2E7P A;  1XXU A;  2VL2 C;  4F82 A;  4J56 E;  3C7M A;  2H19 A;  1PRX A;  3I69 A;  5LNK e;  2DML A;  2DBC A;  2QSI A;  4CHS A;  1U88 A;  3GL5 A;  1FB0 A;  3KD0 A;  5A4U A;  2IWT A;  4EDY A;  1TK0 B;  5CRH A;  2X99 A;  2FWF A;  2YWO A;  3EU3 A;  4ACS A;  3M3M A;  1B8X A;  2BJX A;  3E9J B;  4XCS A;  3WGE A;  2YN1 A;  4PXO A;  2XPE A;  5CRE A;  1U3I A;  2ALB A;  3VFI A;  4G2E A;  5DJL A;  4MZC A;  3ZRD A;  1G7E A;  2L4C A;  4HJ2 A;  4Q5Q A;  2VAF A;  1RK4 A;  3DVX A;  5HR2 A;  2WRT A;  2FCH A;  1XW6 A;  4ECJ A;  4I2U A;  2B5E A;  3ED3 A;  2L5L A;  3HKR A;  1FO5 A;  1XVW A;  4MPG A;  3IK9 A;  4HU7 A;  3FZ4 A;  5IM9 A;  4Q5N A;  2VM2 A;  4N30 A;  2RII A;  1AQV A;  5EL8 A;  2MYG A;  2J23 A;  3F4R A;  4L5O A;  4YAV A;  5DQY A;  5G1L A;  4ZL8 A;  1J08 A;  1XOB A;  3DEX A;  2X8G A;  1SKR B;  2VLV A;  1PN9 A;  4ZL7 A;  2CVK A;  4ZL9 A;  3RAZ A;  2CAQ A;  5B8A A;  1O6J A;  1ZYQ B;  3VWV A;  1WE0 A;  1R5A A;  1T4Z A;  3LYP A;  1QQ2 A;  5ECR B;  5JWQ B;  1GLP A;  2X64 A;  4K1F A;  1PKW A;  2GT5 A;  4AJ8 A;  1JZO A;  4GST A;  4DSR A;  2LST A;  1A8L A;  2AJQ B;  3FKF A;  1THO A;  1FVJ A;  5D9V A;  1X9S B;  1FVK A;  2FNO A;  3NOF A;  4I6X A;  2C0E A;  5D8I A;  4TR1 A;  4E8H A;  3HVS A;  4X0X A;  2O87 A;  5D96 A;  2IMF A;  4O32 A;  1OC9 A;  1LBK A;  1YJ6 A;  2IMK A;  3MAK A;  3Q74 A;  1AXD A;  4IEL A;  1ERV A;  2LEG A;  5DQS A;  2CAI A;  3MNG A;  4KAE A;  4WF5 A;  5DCH A;  1KTE A;  2J9H A;  4ZB9 A;  2YOI A;  1EWX A;  2P5R A;  3IRA A;  4NAX A;  2R5G A;  2R4V A;  6GSW A;  4MK3 A;  2WCI A;  2V41 A;  2L6D A;  3TRP A;  3F3Q A;  5G31 A;  1GP1 A;  5G5E A;  4GCI A;  4ULX A;  2X8C A;  3HJM A;  5ECK B;  4I2T A;  5AIV A;  4N0Z A;  6GST A;  1BAY A;  4AGS A;  1WMJ A;  5D9W A;  2DIZ A;  4PQ1 A;  1Z6N A;  4IJI A;  4PQH A;  3C1R A;  2B6M A;  2WDU A;  1BJX A;  2ZUP A;  4PNG A;  2GZP A;  2MMN A;  2DMM A;  2GSR A;  3PGT A;  4XS4 A;  3PIN A;  3QAW A;  4NV5 A;  3W8J A;  3P8W A;  1XPV A;  3GX8 A;  3MDK A;  3IPZ A;  2YV9 A;  4K0G A;  4YH2 A;  1K0O A;  3F4S A;  1FW1 A;  1HYU A;  4MJB A;  1XIY A;  5GSS A;  2HI7 A;  2HNL A;  4K0N A;  3M9J A;  5ENU A;  1PD2 1;  1A2J A;  2AAW A;  3QAV A;  4XS4 B;  3KM6 A;  2LJK A;  2NVL A;  1HNA A;  1SD8 A;  4KE3 A;  6GSU A;  2ES7 A;  3H79 A;  4HI7 A;  1GUL A;  1A8Y A;  1Y25 A;  5CRG A;  2JZR A;  2PGT A;  1ZMA A;  4OD7 A;  2KP1 A;  3WGD A;  1PL1 A;  1ZGN A;  5F05 A;  2B5Y A;  1UA5 A;  2MZC A;  3QOU A;  5ID2 A;  2GQL A;  2H74 A;  1G6W A;  3J7Y k;  2XC2 A;  4GWR A;  4OCF A;  3HZ8 A;  3F9U A;  3LXT A;  3VPT A;  1A2M A;  3O76 A;  3ZTL A;  3RPN A;  2YNX A;  5CRD A;  2F9S A;  1SJ6 A;  1MD4 A;  1W4V A;  1OYJ A;  4TN8 A;  2FGX A;  2G2Q A;  2BTO T;  4IN0 A;  4K8M A;  1NM3 A;  1H4O A;  1TRV A;  5HFK A;  4IS0 A;  1T3B A;  5FHI A;  4CDO A;  5G5F A;  1XWA A;  3OR5 A;  5JWO B;  3VWX A;  4RQX A;  3GL3 A;  4KW6 A;  1F9M A;  1VF1 A;  3EWL A;  3DML A;  2JL4 A;  2BMX A;  3FY7 A;  2LRT A;  4JRR A;  2LV3 A;  3D5J A;  4F0B A;  1GL8 A;  5ECP B;  3DWV A;  4JBB A;  5IMA A;  4XHM A;  1EP7 A;  3ZIJ A;  3LOR A;  4G10 A;  2FWE A;  3TDG A;  2LRC A;  2LJR A;  3TRX A;  3DD3 A;  3J7Y b;  3ERF A;  4TR4 A;  4F2I A;  5DCG A;  3D22 A;  1KNG A;  2H6Y A;  3TKS E;  2K8S A;  1ZOF A;  2VOC A;  4RQR A;  2IFQ B;  3TOT A;  3GX0 A;  2E2G A;  2V6O A;  5HR0 A;  1QFN A;  1CQG A;  1NHO A;  2WUL A;  4K9Z A;  2VCT A;  1R4W A;  1O73 A;  1YKC A;  3L0H A;  1XFL A;  5IO2 A;  2IMI A;  9GSS A;  4TRX A;  2TRC P;  3EU4 A;  2TIR A;  4PUA A;  2HRN A;  5FT3 A;  3HD5 A;  10GS A;  1GUM A;  3GSS A;  2IPA A;  1ACV A;  12GS A;  1F6M C;  2YAN A;  4P3Y B;  3HA9 A;  1BED A;  2VL2 A;  1UVZ A;  1T8E B;  5ELA A;  1XW9 A;  2JU5 A;  3UEM A;  3KJY A;  3IE3 A;  2A2S A;  3VI5 A;  2O7K A;  4PNF A;  5CP1 A;  3GV1 A;  2FD3 A;  1ABA A;  1HNB A;  2L59 A;  2TRX A;  3H93 A;  4KH7 A;  1TKD B;  1TRW A;  2ZCT A;  1MD3 A;  4ISD A;  2HT9 A;  1QGV A;  3ZML A;  3TJG A;  3G7Y A;  2H73 A;  3WD6 A;  17GS A;  2EC4 A;  2VO4 A;  1PX7 A;  4MA9 A;  2JSZ A;  2FWG A;  3UMA A;  1HQO A;  5H5S A;  1OC9 B;  2HXK A;  3QFB C;  3KTB A;  3O6T A;  4EXJ A;  2H30 A;  2YPM A;  2WZ9 A;  5IMV A;  1NHY A;  4IW9 A;  3UJ1 A;  2FA8 A;  3ME7 A;  1T1V A;  2F3M A;  5EVO A;  2VIM A;  1B9X C;  1K0C A;  1K0A A;  4ZBA A;  4YQV A;  3APQ A;  3HYP A;  1UC7 A;  3G9B A;  4F0C A;  2CZ3 A;  4F03 A;  2HLS A;  4EC0 A;  5DAL A;  1GNE A;  5C04 A;  1F2E A;  2XBQ A;  1YF0 A;  3I43 A;  1A0F A;  5ID2 B;  1NW2 A;  5DAK A;  4AJ6 A;  2WGR A;  1K0D A;  1GSY A;  1GTU A;  5J41 A;  4IKH A;  3F63 A;  1X5E A;  1WIK A;  5HFI A;  2LQQ A;  2FWH A;  1N8J A;  3US3 A;  1PKZ A;  3GH6 A;  1YDK A;  5J5N A;  3GNJ A;  3GKN A;  2MMZ A;  1T4Y A;  1GTI A;  2H75 A;  3ZFL A;  2RUE A;  1A23 A;  1SKS B;  3WYW A;  2LNT A;  4TXO A;  2LTK A;  3ZIT A;  1EOH A;  3CSI A;  3ZMK A;  3LSZ A;  2VL9 A;  4RUV A;  4WR4 A;  1WWJ A;  3W8S A;  5F0G A;  2C8U A;  2H1A A;  5HR1 A;  4ZXG A;  4ZB8 A;  11GS A;  1X9M B;  4I5Q A;  4V2M A;  5CO3 A;  5AN1 A;  4QL9 A;  4Q5F A;  4KDY A;  2H0G A;  2LRN A;  4F9Z A;  1ZCP A;  3IC4 A;  4DVC A;  1SJI A;  5IIZ A;  3CBU A;  4TVE A;  2QGV A;  5ECH B;  3FW2 A;  5B7C A;  2IIY A;  5H5R A;  3NZN A;  4WXT A;  4X43 A;  2LQO A;  1GSU A;  3RDW A;  1MDK A;  1Q98 A;  2FLS A;  2HYX A;  2AUV A;  4MP4 A;  4RI7 A;  3DVW A;  4PQI A;  3HY2 A;  3FZ9 A;  1X5C A;  1K3Y A;  1XZO A;  3Q6O A;  4EDZ A;  3IHQ A;  2ON7 A;  3DRN A;  2GQK A;  3A2X A;  3KMO A;  3SWL A;  4Q5R A;  5J9B A;  2RM5 A;  2YWI A;  1FAA A;  5J4U A;  2DJJ A;  3HHV A;  1OC8 A;  2H0H A;  1WP0 A;  2H0I A;  4GRF A;  3FZA A;  2B3S A;  1K0N A;  1MDI A;  5IPG A;  2DJK A;  3UVT A;  2OJL A;  2PWJ A;  3BJ5 A;  3TJF A;  3GST A;  4J2F A;  4MLY A;  1OKT A;  2HE3 A;  3UL3 A;  3LQ7 A;  1Z7R A;  5HQP A;  1JLV A;  1TP9 A;  3A3T A;  3UIW A;  1BYE A;  1AIU A;  1GSS A;  3DGQ A;  1K3L A;  4EVM A;  3DYR A;  3UAP A;  1U6T A;  4Z7X A;  2HSH A;  1XWC A;  4OFN A;  4HZ2 A;  1X0R A;  2VCX A;  3IK7 A;  3BBY A;  3R2Q A;  2XPD A;  3VUR A;  3S9F A;  1W89 A;  5GZZ B;  3G7I A;  1TDI A;  3EYT A;  1SYR A;  2VD0 A;  2H1D A;  1PMT A;  3CRT A;  5GST A;  2H01 A;  4K7N A;  6GSS A;  3WGX A;  4N11 A;  1M9B A;  2H1G A;  4AF2 A;  5GAN D;  2N5F A;  2GSS A;  3KH9 A;  1Z9H A;  3NIV A;  2C4J A;  4IP6 A;  3FR6 A;  1K0B A;  3BOA A;  1JZD A;  1TU8 A;  1TK5 B;  1M99 A;  1F37 A;  4EUY A;  3GIX A;  4TR0 A;  2Z9S A;  4YQM A;  1AAZ A;  3M1G A;  3M0F A;  3TKR A;  3KP8 A;  2VM1 A;  2YCD A;  3FYG A;  14GS A;  3WT2 A;  1KBN A;  3IAS 2;  3HZ4 A;  3IA1 A;  2OBK A;  2NDO A;  3L4N A;  1DE1 A;  1GWC A;  2FUG 2;  4ECB A;  5ECO B;  2N5A A;  3H4K A;  3O3T A;  4NV2 A;  2JAC A;  5JCG A;  3HJP A;  3LGC A;  1IYH A;  2A4V A;  3L9V A;  1V57 A;  2I81 A;  5IOW A;  1C72 A;  1O81 A;  4OO5 A;  2OAC A;  3P90 A;  1ZYE A;  13GS A;  4BA7 A;  2PUK C;  3C71 A;  3F6F A;  4K6X A;  3FR3 A;  4G9H A;  1FHE A;  4MCU A;  2CX4 A;  1O85 A;  2VCW A;  3L78 A;  2YZH A;  4KCA A;  5DJM A;  1XOA A;  1GSD A;  2HZF A;  1GSF A;  4D73 B;  4OMV A;  3AY8 A;  2HFD A;  3KTL A;  3HJO A;  3TCO A;  4ZBB A;  3P7X A;  2VCZ A;  1Z6M A;  2OE1 A;  4FYB A;  3UBL A;  3TGZ A;  4XIH A;  4K7I A;  2C0F A;  1LJR A;  4HDE A;  4TKY A;  4ILF A;  22GS A;  3BD2 A;  3GFK A;  2KLX A;  1BG5 A;  1M0U A;  2LNS A;  4L0U A;  4ID0 A;  2RUF A;  5JCW A;  3UVH A;  5ABR A;  5ELG A;  1DUG A;  4DSQ A;  3DXB A;  4KX4 A;  1WPI A;  4HQZ A;  3IXR A;  1ZZY A;  1URM A;  1ZL9 A;  1I5G A;  1R26 A;  4OO4 A;  3ZLP A;  3C1S A;  1TOF A;  1S3C A;  1R5P A;  1U87 A;  2EIR A;  1Z3E A;  2IFQ A;  4MJE A;  5HR3 A;  4KDU A;  4ECC A;  4ECI A;  4BL7 A;  2XBI A;  3WT1 A;  4V1A p;  3LYK A;  1O8W A;  2FHE A;  3IAM 2;  1SD9 A;  3H1N A;  1I9D A;  3PH9 A;  3SBC A;  2WB9 A;  1YF1 A;  3IOS A;  4E8E A;  2QC7 A;  1A2L A;  3HXS A;  2F8F A;  4ZBD A;  2NBS A;  2H1B A;  3TKQ A;  4HQS A;  4YQU A;  2C0G A;  2GLR A;  5J3R A;  2L4Q A;  1EEM A;  1GSE A;  1QUW A;  3LWA A;  1H75 A;  5G30 A;  5D9X A;  3FZ5 A;  4EO3 A;  2K9F A;  3PR8 A;  4LL4 B;  3GUS A;  2VUP A;  5KN1 A;  3GRX A;  2I4A A;  4IQ1 A;  2YP6 A;  4IJ3 A;  4LA1 A;  2CVD A;  4FYU A;  3CSH A;  4ZIJ A;  2YJ7 A;  1SK2 A;  4HZ4 A;  4KA0 A;  3A2V A;  2FA4 A;  4ZB6 A;  2P5Q A;  2N5B A;  3TRQ A;  3QAG A;  3KEB A;  1ON4 A;  1YKA A;  4BVX A;  5IO0 A;  4KND A;  1M7T A;  3HVX A;  4FO5 A;  1DBY A;  3QDN A;  3KGK A;  3KCM A;  3TKS A;  2DJ1 A;  2CZ2 A;  4L8E A;  2DSA A;  4JR6 A;  3F6D A;  20GS A;  4MJC A;  1HNC A;  4POB A;  2OE0 A;  2MBT A;  1U3A A;  5INY A;  4TXV A;  2C3T A;  1OAZ A;  3UBK A;  1AQX A;  4ML6 A;  5DAK B;  1J9B A;  5D93 A;  1SU9 A;  1TI3 A;  4N10 A; 
#chains in the Genus database with same CATH topology
 3F3R A;  5IW9 A;  1XCC A;  2M46 A;  1SL0 B;  1N2A A;  2UX0 A;  2QIY A;  1U8C B;  1D6Z A;  4KFD A;  4CW9 A;  1E97 A;  2C3Q A;  4IVF A;  1Q86 4;  3Q19 A;  4AJ7 A;  1M2D A;  4FIW A;  4N6L A;  3VWW A;  3ECF A;  1K73 4;  3EUR A;  5F8B A;  4N6V 0;  2SBL A;  3D79 A;  4G1M B;  4KDX A;  5KN2 A;  2OAD A;  3CCE 3;  4TR1 B;  2VCQ A;  3NQY A;  4O5Q A;  1NWW A;  2H71 A;  4HJM A;  4GLT A;  3TUE A;  2A2R A;  2GZZ A;  4YAP A;  5KEJ A;  3HOH A;  3D9R A;  1B2S A;  2WS2 A;  3L9S A;  1U5O A;  4PUF C;  1O7H B;  2A15 A;  3CXG A;  3MG1 A;  1QVG 2;  4LMV A;  3CC7 3;  1V58 A;  1JB4 A;  5AIS A;  5GSP A;  1V2A A;  2M72 A;  1VQ9 3;  1J0F A;  1IVV A;  3LTC A;  1IVW A;  5G2Z A;  3ZYW A;  1IYI A;  2HZE B;  1VF4 A;  2VL3 A;  4Z2T A;  4BVY A;  2HRF A;  1V98 A;  4FMC A;  3CMI A;  4MF5 A;  3RBT A;  1UUW B;  2P05 A;  1JZW A;  3KKG A;  4HM0 B;  4X4J A;  2JZS A;  1OC3 A;  9RNT A;  2FY6 A;  2GGT A;  2CV4 A;  4IIA A;  3URP A;  1QJG A;  3EN8 A;  1G0T A;  2D1W A;  1F3B A;  4MZB A;  4BTW A;  3E3E A;  2B7J A;  5IQY A;  4EE0 A;  1BX9 A;  2R6K A;  1JB2 A;  2OOV A;  5COH A;  2C1Y A;  4N6O B;  3QCP A;  4HEA 2;  4N6T A;  4BWQ A;  1XWK A;  3FR9 A;  4V1A g;  2W56 A;  2AV4 A;  5LCZ A;  1OE8 A;  4MAB A;  1S3D A;  3CYN A;  1S3A A;  4OWY A;  6GSY A;  1VQ6 3;  16GS A;  2H66 A;  3WR2 A;  3A2W A;  5CF1 A;  1GUH A;  2DKH A;  1GNW A;  2R37 A;  3VK9 A;  1MEK A;  1FUS A;  3D5I A;  5BRT A;  3DKS A;  2W9Q A;  4NWY A;  4KCE A;  2MMA A;  3BCK A;  1PX6 A;  3GZY B;  3GZR A;  3E99 A;  2H72 A;  1EV9 A;  5A4W A;  3DMC A;  1SYX A;  1X9W B;  1YVB I;  1GOV A;  3DGL A;  2IL3 A;  4HS1 A;  3ZRE A;  4OUQ A;  3ERG A;  1NSW A;  1EEJ A;  6GSX A;  3CXC 2;  5IG3 A;  2XSO B;  1RQM A;  3HVN A;  1PQN A;  4NXI A;  2DC5 A;  5LD0 A;  5DDL A;  2IY2 A;  3DIE A;  4RZM A;  4TR3 A;  3GUR A;  1FOV A;  1TFO A;  3X3Y A;  2XHF A;  3FKA A;  1TW9 A;  1MTC A;  1I0V A;  2F5W A;  2YFL B;  3LZA A;  4FYC A;  3DGN A;  4MJA A;  1GMR A;  1L5G B;  1OH0 A;  4EC6 A;  2H8L A;  2DJ3 A;  3FG1 A;  1K8A 4;  2EIQ A;  5G1K A;  4BPY A;  3P2A A;  3D4T A;  2AYT A;  3SED A;  4OFT A;  2PPT A;  4JED A;  3ERW A;  5HFG A;  1RN4 A;  4H86 A;  1N5H A;  1WOU A;  2KF5 A;  4NHZ A;  3Q18 A;  4IBP A;  4MDC A;  1OE7 A;  2XFS A;  3CCQ 3;  2W6J H;  1N9J A;  1ROV A;  3F8H A;  3N9J A;  4XDW A;  1YEX A;  5EPF A;  3U1W A;  1A0R P;  1NDO B;  2X8H A;  2PBJ A;  1YGW A;  3VPQ A;  1AVL A;  1VRS D;  1X1W A;  3RPP A;  2HMN B;  5E59 A;  1LOV A;  3WDG B;  4O5U A;  3BB9 A;  2OA7 A;  1UCK A;  2XF3 A;  5D9T A;  3LW9 A;  1OF5 B;  1RN1 A;  1AC1 A;  3KP9 A;  5ECM B;  1ULJ B;  5EVH A;  4MPF A;  2K18 A;  2JZT A;  2CX3 A;  1CQH A;  4HM5 B;  1VF2 A;  1M2A A;  1XW5 A;  2GZY A;  2HMK B;  3KH7 A;  2R4I A;  4O92 A;  5IMC A;  1UUV B;  3KN4 A;  4XBY A;  3CPO A;  1GH2 A;  1Z5Y E;  3GTU A;  4ZIL A;  1SII A;  3I9V 2;  4QQ7 A;  4LGQ A;  2QGU A;  3NQZ A;  1OPY A;  3FEU A;  3TJJ A;  4XRD A;  2PN8 A;  5BXQ A;  4MH2 A;  4WF4 A;  3NV0 A;  3A76 A;  3EF8 A;  1YZX A;  2V2G A;  4D73 A;  1ZO2 A;  1BSD A;  3OWS A;  2PZV A;  8GSS A;  1GYB A;  4GQF A;  2V1M A;  1TI1 A;  4STD A;  2L57 A;  5AGY A;  1UN2 A;  2GT6 A;  1TU7 A;  5KP3 A;  3Q90 A;  4G19 A;  4PUR A;  1B9Y C;  5A5K A;  5IMZ A;  1YEP A;  4DKI A;  4LLR A;  3OWY A;  2HSY A;  3N5O A;  1RDS A;  2P0M A;  4KFE A;  3F0I A;  3ZFZ A;  2E2U A;  5ECN B;  1ERU A;  3FHK A;  2GQM A;  3MWZ A;  1SJW A;  1G02 A;  1JHB A;  1ILO A;  2HMO B;  3NX0 A;  2IN3 A;  2GSQ A;  1JFU A;  1VF3 A;  2B1X B;  3VGN A;  2CA8 A;  3GKM A;  5IPH A;  4RNZ A;  1ERW A;  4OFM A;  1D6Y A;  3V1W A;  1IK3 A;  4NHF A;  2I3Y A;  3TJB A;  1AUC A;  4HM7 B;  5AEW B;  3GA4 A;  4AKZ A;  4X1U A;  3KZT A;  1F3A A;  4FMB A;  3WOD G;  2RGQ A;  2OBI A;  2RCD A;  1RTU A;  2WOH A;  3JCM L;  1O7M B;  1JBS A;  1CYV A;  3LG6 A;  4JZQ A;  1OCV A;  2PVO C;  3HVV A;  4PTS A;  5E4W A;  1V40 A;  2LUS A;  1FGO A;  3FF2 A;  4R80 A;  1RW1 A;  3TKS C;  5KN0 A;  1EGO A;  1BAN A;  1DSB A;  1DMM A;  2WFC A;  2L5O A;  3PYJ A;  1BRJ A;  3APS A;  3F8U A;  1JN5 B;  1ERT A;  3CTF A;  4DEJ A;  4RI6 A;  3D4M A;  3IDV A;  2LJA A;  3LXZ A;  1HD2 A;  3MPH A;  2PMT A;  1DYU A;  2CVB A;  2O85 A;  1STF I;  1F8N A;  4RNY A;  2BNG A;  5ECS A;  3ZZX A;  1ULI B;  3GAX A;  2OWP A;  4WP5 A;  1GLQ A;  4HOJ A;  2HRA A;  4V2L A;  1EA2 A;  4POK A;  1SK0 A;  3NBB A;  3C73 A;  5A0O B;  4ML1 A;  1NU3 A;  3FRC A;  4MF6 A;  2CT6 A;  1W6C A;  1SKW B;  2YV7 A;  2V6K A;  3QMX A;  3RHC A;  1GTA A;  2D2Z A;  3FZW A;  3CU3 A;  3TJK A;  2CH9 A;  1JLW A;  2NPB A;  1GS3 A;  3PCS A;  4FH8 A;  3HII A;  1USB A;  7GSS A;  2W03 A;  4GQC A;  4NMU A;  3RHB A;  5M1A A;  1R7H A;  1EV4 A;  2JAD A;  4K7O A;  4GSN A;  1IQX A;  1THX A;  1B48 A;  5JBS A;  4TW5 A;  3N9H A;  2O3O A;  1RKY A;  2K8V A;  3FCS B;  4XS1 A;  1E2Y A;  2I1U A;  2DJ0 A;  2CWT A;  3IR4 A;  2ON5 A;  3U5R E;  3GKK A;  1SL2 B;  2QKE A;  3GH9 A;  3UOM A;  5JCU A;  2F51 A;  1AQW A;  3IJE B;  1WRY A;  1K0M A;  2P31 A;  3TB2 A;  3A5I A;  3TOU A;  2DLX A;  4N6N B;  3E0U A;  4JE1 A;  4LL1 B;  5A4V A;  2AHE A;  3LEF A;  4LMW A;  4NPB A;  3I55 3;  1N9E A;  1QXH A;  1PA3 A;  5ECL B;  5CLK A;  3J7Y d;  4N3V A;  1FW7 A;  3M9K A;  3VWU A;  4CY8 A;  1YHQ 3;  3ZVJ A;  1K3O A;  2CFL A;  4EKZ A;  2JSY A;  1M2B A;  1WMP A;  1PL2 A;  1ZYP A;  2LS5 A;  2O8V B;  1LXE A;  3PPU A;  1GSQ A;  3G7J A;  2H70 A;  3T0U A;  2RLI A;  1A2V A;  1E3V A;  3ZL5 A;  1G6Y A;  1HU9 A;  2X49 A;  2PVQ A;  3FF0 A;  3EVI A;  1SK1 A;  2WOF A;  4WET A;  1Z7P A;  4N6M A;  5IMF A;  1BNF A;  2IYJ A;  3GN3 A;  1T00 A;  4EW5 A;  1HKX A;  3GZB A;  1PGT A;  1N8Q A;  2CQ9 A;  3QPM A;  5D83 A;  1BNS A;  5B6M A;  4O5R A;  4ORL A;  3ME8 A;  3LJR A;  2RM6 A;  5IOX A;  1BQ7 A;  3APO A;  3VLN A;  1A67 A;  3EC9 A;  1W02 A;  1KEB A;  5D81 A;  2IMD A;  2E0Q A;  2F99 A;  3F4T A;  4R4K A;  2EIO A;  1YJN 3;  4FR9 A;  3QFA C;  2KUC A;  3GMF A;  3KXO A;  5M18 A;  5CAX A;  3DH2 A;  1V9W A;  2LKU A;  5F06 A;  1SEN A;  3CNX A;  3CC2 3;  3X3X A;  2HOH A;  3IV4 A;  4MF7 A;  4TOP A;  1LNH A;  2B1L A;  4QWT A;  4WYK B;  1X1Y A;  1DE2 A;  2XRX B;  5C00 A;  2X4A A;  4FCM A;  3D21 A;  3EE2 A;  1GMQ A;  3CMA 3;  2VLT A;  1LNI A;  6GSV A;  3PS8 A;  3I6A A;  2GST A;  5RNT A;  3EIN A;  1R4Y A;  1QMV A;  5CXO A;  1HYF A;  4GXZ A;  1YY7 A;  1EP8 A;  3KMN A;  4JR4 A;  2C3N A;  4LMI A;  1M9A A;  1TXX A;  1ML6 A;  4WBJ A;  4TXO B;  5ECQ B;  5IEP A;  1MOL A;  3AHS A;  3CTG A;  1XWG A;  4J57 E;  4EF0 A;  1RNT A;  4GSS A;  2MBS A;  2YZU A;  1TK8 B;  5IEN A;  1WTH A;  5IG0 A;  5BVB A;  2KHP A;  3KZQ A;  1GRX A;  5AI1 A;  5D82 A;  4L5L A;  1O8X A;  4K2X A;  2B5X A;  2W04 A;  4KUN A;  3AHW A;  1OKD A;  3DGO A;  1FG4 A;  2IME A;  5J9C A;  2Z77 A;  2BHM A;  3ISO A;  4GHO A;  3WOF B;  4V2N A;  1SAR A;  2KCD A;  2UGI A;  4R9L A;  3IBH A;  3NHX A;  2KOK A;  5CNW A;  3UAR A;  3QR6 A;  4IGJ A;  1MGR A;  3EBT A;  4K2D A;  3FG4 A;  1B3S A;  2XGN A;  1O7U A;  1Q7H A;  3D6I A;  2ZDJ A;  1BRG A;  4IP1 A;  4PGT A;  3ZVJ D;  3ZIV A;  1YIJ 3;  2OKA A;  2GTU A;  4MZW A;  5AII A;  3GHA A;  2IJY A;  4FQU A;  1W01 A;  3DGM A;  2YWM A;  1E6B A;  4N0V A;  4I97 A;  3L9U A;  3GKX A;  4L8O A;  4EL1 A;  4I8B A;  1PYL A;  4MH3 A;  3X41 A;  1GTB A;  1BRN L;  1OHO A;  4POL A;  1Z1S A;  3MG3 A;  1Q40 B;  2STD A;  4XM4 A;  2VD1 A;  5CYY A;  19GS A;  2H6X A;  2B1K A;  1SL1 B;  4IHU A;  2PER A;  3CCU 3;  5JPP A;  3C8E A;  4K5R A;  3STD A;  3H8Q A;  3GWR A;  4BWS A;  1XWB A;  5KN3 A;  5CRW A;  4O2H A;  1JNQ A;  1FB6 A;  3CCR 3;  1ST9 A;  4KSM A;  2R3X A;  3U6V A;  1QK8 A;  4GF0 A;  3KIJ A;  2KP2 A;  1B4P A;  2L6C A;  2KF4 A;  1FGQ A;  4HU9 A;  4IQA A;  3X42 A;  1EOG A;  1XBS A;  2B7K A;  5JWR B;  5IG4 A;  1Q7Y 4;  3B4P A;  1T5Y A;  1IV9 A;  2YWN A;  1JZR A;  1ZS7 A;  1GMP A;  2V32 A;  1JJ2 2;  1JN5 A;  4HUA A;  1J2B A;  3JUQ A;  1BSE A;  3ALA A;  2M80 A;  1TRU A;  3K0Z A;  3QK9 A;  2O89 A;  3EB8 A;  1K9M 4;  3D0Z A;  4WKW A;  3MG2 A;  1MDJ A;  4XTS A;  4G0K A;  1TP6 A;  4POM A;  1Y6E A;  2GVP A;  1BU4 A;  2H6Z A;  3EE1 A;  1TJD A;  1BOX A;  4L0W A;  4WBR D;  5H5Q A;  5AIX A;  1A24 A;  2C0D A;  1W2Z A;  5F07 A;  2DJ2 A;  3NBJ A;  3EC3 A;  1JBR A;  1GUK A;  3DY5 A;  1BSB A;  3BCI A;  3VI7 A;  5ECI B;  3K8N A;  8CHO A;  1FOH A;  1O7P B;  2KF3 A;  1WJK A;  3MSZ A;  2INX A;  1T7P B;  1RCL A;  1JRQ A;  1EZK A;  3OWU A;  3VF1 A;  5DBQ A;  3GZX B;  2ZNM A;  1X5D A;  5L71 A;  1EKM A;  2NTO A;  4WR5 A;  1VGL A;  3CRU A;  1R4C A;  3HDC A;  4R9K A;  2UZ8 A;  2I9H A;  2YJH A;  4MMM A;  1I2E A;  4XS6 A;  3W6G A;  3NM2 A;  3LFL A;  2OE3 A;  2H76 A;  3QD9 A;  1BVI A;  3GYK A;  3A5W A;  4JU5 A;  1G7O A;  1K41 A;  2P0G A;  4KB3 A;  2MMO A;  1TTZ A;  1AW9 A;  3EMP A;  4QL7 A;  2C80 A;  2XSH B;  1A2P A;  5D73 A;  1SJZ A;  3BNB A;  2VCV A;  3EMX A;  2E2M A;  4K61 A;  1LU4 A;  4JF8 A;  4KSO A;  2PU9 C;  2XFT A;  1RRH A;  3FSD A;  1TTO A;  5GAP D;  4PX1 A;  2GDR A;  1A2K A;  7GSP A;  2CFW A;  1N8R 4;  1XVQ A;  5DAL B;  1PSQ A;  3TKP A;  3MWH A;  5IMD A;  2HZE A;  2GS3 A;  5B6N A;  4GTU A;  1I8V A;  1TRS A;  2F8A A;  4KGI A;  4LYL B;  2WJU A;  2REM A;  4OCE A;  4YKG A;  4GB5 A;  3ZFB A;  1Q4J A;  1YQ1 A;  5EY6 A;  3KSE D;  1WMO A;  1EGR A;  1UCJ A;  3I0Y A;  3CSJ A;  2K6V A;  3HCZ A;  3GTU B;  1UI7 A;  5B8B A;  4HKV B;  1FGR A;  1QAL A;  2Z76 A;  1FUT A;  2Y74 A;  1OVN A;  3M8N A;  2VLU A;  1D6U A;  2BIR A;  2DIY A;  1B4Q A;  4NHW A;  1BSA A;  2L1S A;  1BNE A;  5DVB A;  2AB6 A;  3FK8 A;  2MF7 A;  4XRA A;  1VQ7 3;  4O7H A;  5FGO A;  3BNE A;  2G0F A;  3AGN A;  4DSS A;  4DSS B;  2R2J A;  5ELU A;  5FWG A;  4WEY A;  3HK4 A;  5KOW A;  18GS A;  2E7P A;  4J5G A;  1XXU A;  2VL2 C;  4F82 A;  4J56 E;  3NV0 B;  3C7M A;  4Q53 A;  2GBX B;  3CCM 3;  1PRX A;  2H19 A;  3I69 A;  5LNK e;  2DML A;  2DBC A;  2QSI A;  4XDV A;  1ZGX A;  4CHS A;  1U88 A;  3GL5 A;  1FB0 A;  2ZHX B;  3KD0 A;  5A4U A;  2IWT A;  4EDY A;  3LH4 A;  1TK0 B;  5CRH A;  2X99 A;  1AV4 A;  2FWF A;  2YWO A;  3EU3 A;  3MKI A;  5IEO A;  4ACS A;  2O9U X;  3M3M A;  4RBN A;  1X1X A;  1BUQ A;  1B8X A;  2BJX A;  3E9J B;  4XCS A;  3WGE A;  2YN1 A;  4PXO A;  3MHE A;  2OCT A;  2XPE A;  3ER7 A;  5CRE A;  1U3I A;  2B24 B;  2E2V A;  2ALB A;  3VFI A;  4G2E A;  5DJL A;  4MZC A;  1S72 3;  3ZRD A;  1G7E A;  1LOW A;  2L4C A;  4HJ2 A;  4Q5Q A;  3OXA A;  2VAF A;  3WA3 A;  2RFR A;  4BVX B;  2MC8 A;  1RK4 A;  3DVX A;  5HR2 A;  3BIR A;  2WRT A;  3MIX A;  4EV2 A;  2FCH A;  3HI7 A;  4FCJ A;  1XW6 A;  4ECJ A;  5BU4 A;  2BU4 A;  4I2U A;  2KAA A;  2B5E A;  3JVC A;  3ED3 A;  5AIG A;  2L5L A;  3HKR A;  4J8T A;  4HSC X;  1FO5 A;  1XVW A;  4MPG A;  3IK9 A;  3EX9 A;  4HU7 A;  3FZ4 A;  5IM9 A;  3SOA A;  4Q5N A;  2VM2 A;  1FA3 A;  4N30 A;  1VQO 3;  4HBR A;  2RII A;  1AQV A;  5EL8 A;  1M90 4;  2MYG A;  1W6G A;  2J23 A;  4JRF A;  3F8X A;  5KP4 A;  1I2F A;  3F4R A;  4L5O A;  1RGF A;  4YAV A;  5DQY A;  5G1L A;  1O7G B;  1RJO A;  3D4A A;  3EQQ B;  4AKY A;  4ZL8 A;  1J08 A;  1XG8 A;  1XOB A;  4HOH A;  3DEX A;  2X8G A;  1SKR B;  2VLV A;  1V74 A;  1PN9 A;  5LC7 A;  4ZL7 A;  2F98 A;  2CVK A;  4ZL9 A;  3RAZ A;  2CAQ A;  5B8A A;  1O6J A;  3LT9 A;  1I3I A;  5AYS C;  1SIH A;  1ZYQ B;  3VWV A;  4GL6 A;  3IC8 A;  1WE0 A;  1R5A A;  1T4Z A;  3LYP A;  4CCV A;  1QQ2 A;  5ECR B;  2XGL A;  2SAR A;  5JWQ B;  1YNV X;  2CX0 A;  1FZU A;  3D3L A;  1MGW A;  3NM7 A;  1GLP A;  2XH9 A;  3A5E A;  3F14 A;  2P09 A;  2X64 A;  4K1F A;  1M3I A;  1PKW A;  2GT5 A;  4AJ8 A;  1JZO A;  4WWU C;  4GST A;  7RNT A;  4DSR A;  2LST A;  1A8L A;  2AJQ B;  3FKF A;  1THO A;  4LEH A;  1FVJ A;  5D9V A;  1X9S B;  1UCL A;  5JPU A;  1PN0 A;  1FVK A;  4BIK A;  2FNO A;  3NOF A;  4I6X A;  2C0E A;  3G4S 3;  5D8I A;  3PCR A;  2CG1 A;  3FMW A;  3CME 3;  1FGM A;  1VQK 3;  3FH1 A;  3LTD A;  4TR1 A;  4E8H A;  3HVS A;  1M9G A;  4X0X A;  1NNV A;  2O87 A;  5FW5 A;  5D96 A;  2IMF A;  4O32 A;  1FYS A;  2GSP A;  1OC9 A;  1LBK A;  1YJ6 A;  2IMK A;  3MAK A;  3Q74 A;  1AXD A;  4IEL A;  1ERV A;  2LEG A;  5DQS A;  4N10 A;  2CAI A;  2J9H A;  3MNG A;  4KAE A;  4WF5 A;  1KTE A;  5DCH A;  4ZB9 A;  2YOI A;  3HZP A;  1EWX A;  2AAE A;  2W0Q A;  4PEJ A;  2P5R A;  3IRA A;  4NAX A;  2R5G A;  2R4V A;  2CWV A;  4MK3 A;  6GSW A;  2WCI A;  2ML6 A;  2OQE C;  2V41 A;  2KF6 A;  2L6D A;  3TRP A;  3F3Q A;  5G31 A;  3WMD A;  1GP1 A;  1CYU A;  1BNR A;  3G16 A;  5G5E A;  4GCI A;  4ULX A;  2X8C A;  3HJM A;  5ECK B;  3NXJ A;  4I2T A;  3OX9 A;  5AIV A;  5M19 A;  4N0Z A;  6GST A;  1PY3 A;  1BAY A;  1OAC A;  4AGS A;  1WMJ A;  5D9W A;  2CG0 A;  2DIZ A;  1VZZ A;  4PQ1 A;  1Z6N A;  4XBX A;  1S3R A;  4IJI A;  4PQH A;  2L4V A;  1RLS A;  3C1R A;  3AGO A;  2CFK A;  2B6M A;  2WDU A;  2J8X B;  1W7C A;  1BJX A;  3F9S A;  2ZUP A;  1IVU A;  4PNG A;  3SVA A;  1UW1 A;  2GZP A;  1O7W B;  2MMN A;  1N5P A;  2DMM A;  2GSR A;  3PGT A;  2HMJ B;  4XS4 A;  3PIN A;  3QAW A;  2FXT A;  4NV5 A;  4HM1 B;  3W8J A;  3P8W A;  1XPV A;  3GX8 A;  3MDK A;  3IPZ A;  3O8Y A;  2K0M A;  1YJW 3;  4BL7 B;  1BNG A;  2GEY A;  6STD A;  2YV9 A;  4O8S A;  4K0G A;  1W5Z A;  4YH2 A;  1K0O A;  3F4S A;  4EIQ A;  1FW1 A;  1HYU A;  3K5T A;  4O02 B;  3ZG0 A;  4MJB A;  5IER A;  2GU1 A;  1XIY A;  5GSS A;  3GRD A;  2HI7 A;  2HNL A;  1YGE A;  4K0N A;  3KE7 A;  3M9J A;  5ENU A;  4J5K A;  1PD2 1;  1NB3 I;  1A2J A;  4G0I A;  2AAW A;  3QAV A;  4XS4 B;  2P0X A;  4K90 B;  3KM6 A;  1NB5 I;  1QAF A;  2LJK A;  4OK0 A;  2NVL A;  1HNA A;  1SD8 A;  4KE3 A;  1WNH A;  3ZG5 A;  6GSU A;  2ZA4 A;  2ES7 A;  3H79 A;  4HI7 A;  1GUL A;  1A8Y A;  1JB5 A;  3IPT A;  1Y25 A;  5CRG A;  2OTL 3;  2JZR A;  3ROB A;  2PGT A;  2XEP A;  1ZMA A;  4OD7 A;  2KP1 A;  1JBT A;  5STD A;  3WGD A;  1PL1 A;  1ZGN A;  5F05 A;  2B5Y A;  1UA5 A;  3UL5 A;  2W2C A;  1JKG B;  1GSP A;  2MZC A;  3K9M C;  3QOU A;  5ID2 A;  2GQL A;  2H74 A;  3CQF A;  1G6W A;  3J7Y k;  2XC2 A;  3F7S A;  4GWR A;  4OCF A;  3HZ8 A;  1YJ9 3;  4O3V A;  3F9U A;  2HRK A;  2RNT A;  3LXT A;  4BTX A;  2IMJ A;  3X40 A;  3VPT A;  1A2M A;  2C11 A;  3O76 A;  3ZTL A;  4K1V A;  3RPN A;  3F40 A;  2YNX A;  5CRD A;  2F9S A;  1UUG B;  5ELJ A;  1SJ6 A;  4ZM8 A;  1MD4 A;  1W4V A;  1IDP A;  3RDE A;  1OYJ A;  4TN8 A;  2FGX A;  3KCH A;  2G2Q A;  2BTO T;  1B20 A;  4HAA A;  4IN0 A;  1RSN A;  2HML B;  3RNT A;  4K8M A;  2RSX A;  1Q82 4;  1NM3 A;  4MMX B;  1H4O A;  1TRV A;  5HFK A;  4IS0 A;  1LRA A;  1T3B A;  5FHI A;  4KZ1 A;  5G5F A;  2R0P A;  4CDO A;  1XWA A;  3OR5 A;  4MMZ B;  2OQE A;  5JWO B;  3VWX A;  1IQY A;  1AY7 A;  2Q07 A;  4RQX A;  3GL3 A;  4BTY A;  4KW6 A;  1I0X A;  1QVF 2;  5G2G A;  4EYC A;  2K54 A;  1F9M A;  2F5M A;  1S5A A;  1VF1 A;  3EWL A;  3CC4 3;  3DML A;  3Q3F A;  2JL4 A;  2BMX A;  3FY7 A;  2A2P A;  2LRT A;  2LV3 A;  3D5J A;  4JRR A;  4F0B A;  1GL8 A;  1X1U A;  5ECP B;  1Q42 A;  3DWV A;  4JBB A;  5IMA A;  2A4H A;  4XHM A;  1EP7 A;  1BRS A;  1VQM 3;  3ZIJ A;  3LOR A;  4G10 A;  2FWE A;  3TDG A;  1BGS A;  2LRC A;  3CCL 3;  1MWS A;  1EUI C;  4HM8 B;  2LJR A;  3TRX A;  3DD3 A;  1Q81 4;  4Z2U A;  1KD1 4;  3J7Y b;  3ERF A;  4TR4 A;  1IU7 A;  1YIT 3;  4F2I A;  3DZL A;  5DCG A;  3D22 A;  1KNG A;  2H6Y A;  3TKS E;  2K8S A;  2CKF B;  4X2O A;  3LYG A;  1ZOF A;  1ZYN A;  2VOC A;  4RQR A;  2IFQ B;  3TOT A;  3GX0 A;  1MNL A;  2E2G A;  2V6O A;  3LTA A;  2CX1 A;  5HR0 A;  1IV7 A;  1B2Z A;  1QFN A;  1CQG A;  1NHO A;  2WUL A;  2XR8 B;  2VCT A;  4K9Z A;  1R4W A;  1O73 A;  1YKC A;  4HZ9 B;  3L0H A;  1XFL A;  4FCZ A;  5IO2 A;  1M3J A;  2IMI A;  9GSS A;  4TRX A;  3H51 A;  2TRC P;  3EU4 A;  2F86 B;  4Z2R A;  1W2B 2;  5AEU B;  2TIR A;  4PUA A;  4HZB B;  2HRN A;  5FT3 A;  3MYD A;  1GY6 A;  3HD5 A;  10GS A;  1GUM A;  4HYZ A;  3GSS A;  2IPA A;  1ACV A;  1EG9 B;  12GS A;  4K1U A;  1F6M C;  2HMM B;  3L0R A;  4BU4 A;  2YAN A;  4P3Y B;  3HA9 A;  2IUJ A;  1BED A;  4HM6 B;  2VL2 A;  1ZX2 A;  1UVZ A;  1VQP 3;  1T8E B;  1W6Y A;  4XBT A;  5ELA A;  1XW9 A;  4N6U A;  2JU5 A;  3UEM A;  1ROA A;  3S5C A;  3KJY A;  3IE3 A;  3G6E 3;  3S27 A;  2A2S A;  2C4B A;  3VI5 A;  4WFO A;  4EBG A;  3JUM A;  3CCS 3;  2O7K A;  4PNF A;  1LQM B;  5CP1 A;  3GV1 A;  2FD3 A;  1B2U A;  1ABA A;  1KC8 4;  1BSC A;  1RGH A;  1HNB A;  1C54 A;  2L59 A;  3SLU A;  2TRX A;  3H93 A;  1O7N B;  4KH7 A;  1TKD B;  1TRW A;  2ZCT A;  1MD3 A;  4ISD A;  2HT9 A;  1QGV A;  3ZML A;  3TJG A;  1OGX A;  1HZ1 A;  3G7Y A;  2RBI A;  1GD3 A;  5EEO A;  2H73 A;  3WD6 A;  17GS A;  5KP1 A;  2EC4 A;  1IVX A;  1DET A;  2VO4 A;  1PX7 A;  4MA9 A;  4EXR A;  2JSZ A;  2HSM A;  3PXM A;  2FWG A;  3UMA A;  1HQO A;  5H5S A;  1OC9 B;  2HXK A;  3QFB C;  3KTB A;  3V99 A;  5CF2 A;  3O6T A;  3WOE B;  4EXJ A;  2H30 A;  4L7K A;  2YPM A;  2WZ9 A;  5IMV A;  4FMA A;  1NHY A;  3PGB A;  4IW9 A;  3UJ1 A;  2FA8 A;  1BRI A;  3ME7 A;  1T1V A;  2F3M A;  5EVO A;  2VIM A;  1B9X C;  1RCK A;  4L8P A;  1RGG A;  1RGL A;  2BMO B;  1OHP A;  1T2I A;  1PFP A;  1K0C A;  3OW2 2;  1K0A A;  4BL2 A;  4ZBA A;  3MYT A;  2OOV C;  4YQV A;  3APQ A;  3HYP A;  1UC7 A;  3NUV A;  3G9B A;  1UGH I;  2CZ3 A;  4F0C A;  4F03 A;  4BL3 A;  2HLS A;  4EC0 A;  3PZW A;  5DAL A;  1GNE A;  5C04 A;  4IPB A;  3SOY A;  2Z6B A;  1F2E A;  2XBQ A;  1YF0 A;  1RMS A;  3I43 A;  1A0F A;  1GD4 A;  1M1X B;  3HX8 A;  6GSP A;  5ID2 B;  1NW2 A;  1YVS A;  5DAK A;  1BUJ A;  4AJ6 A;  1MWT A;  2DKI A;  1DVD A;  2WGR A;  1WMN A;  1K0D A;  1GSY A;  1GTU A;  5J41 A;  2CK3 H;  2YX9 A;  4IKH A;  3F63 A;  1X5E A;  1LQG C;  1WIK A;  5HFI A;  1VQ5 3;  2LQQ A;  2FWH A;  2M7O A;  1BNI A;  1N8J A;  1PKZ A;  4LZI A;  3US3 A;  3GH6 A;  1YDK A;  1BIR A;  5J5N A;  3GNJ A;  3B7C A;  3GKN A;  1SPU A;  2MMZ A;  3BND A;  4TX4 A;  2OTJ 3;  1T4Y A;  4BIR A;  2ML5 A;  2FGT A;  1GTI A;  2H75 A;  3ZFL A;  2RUE A;  4CPK A;  1A23 A;  1SKS B;  3WYW A;  4OVM A;  2LNT A;  4TXO A;  1UI8 A;  2LTK A;  3ZIT A;  1TRQ A;  3T8N A;  1EOH A;  3CSI A;  1UGI A;  3Q1C A;  3ZMK A;  3LSZ A;  2VL9 A;  4RUV A;  4WR4 A;  1WWJ A;  3QRD A;  1BRK A;  3W8S A;  5F0G A;  2C8U A;  2H1A A;  4USS A;  5HR1 A;  5EQL A;  1IQ8 A;  4ZXG A;  4ZB8 A;  11GS A;  1X9M B;  4I5Q A;  4V2M A;  2D42 A;  3MSO A;  3EJV A;  2R0G A;  1BAO A;  5CO3 A;  5AN1 A;  4QL9 A;  3CCJ 3;  1RGK A;  1UCI A;  4Q5F A;  4KDY A;  2H0G A;  3EN1 B;  5AIH A;  2LRN A;  4F9Z A;  1ZCP A;  3RGA A;  3IC4 A;  4DVC A;  1SJI A;  5IIZ A;  3B8L A;  3CBU A;  3FLJ A;  3KSP A;  2QGV A;  4TVE A;  1K28 A;  5ECH B;  2QEX 3;  2V1L A;  3FW2 A;  1PFO A;  5B7C A;  2IIY A;  5H5R A;  5AYR B;  1VQ4 3;  3NZN A;  4WXT A;  4KVH A;  4X43 A;  2LQO A;  1GSU A;  3RDW A;  2W9P A;  3Q2P A;  1MDK A;  1Q98 A;  2FLS A;  2JQ5 A;  1B27 A;  1M1K 4;  2HYX A;  2AUV A;  5DRE A;  4MP4 A;  4RI7 A;  1RGC A;  1AVK A;  1RGE A;  3DVW A;  2FNQ A;  4PQI A;  3SX1 A;  1T2H A;  3FZ9 A;  3HY2 A;  1X5C A;  1K3Y A;  1XZO A;  3Q6O A;  4EDZ A;  3IHQ A;  4ICY A;  2ON7 A;  3DRN A;  2GQK A;  1TIJ A;  3A2X A;  3KMO A;  3SWL A;  3G71 3;  4Q5R A;  5J9B A;  2RM5 A;  2YWI A;  3CNM A;  1FAA A;  5J4U A;  2DJJ A;  3HHV A;  1OC8 A;  1KSI A;  1TFK A;  1DVC A;  2H0H A;  3DGY A;  1WP0 A;  2H0I A;  4GRF A;  3FZA A;  2B3S A;  2CHC A;  1K0N A;  1MDI A;  5IPG A;  2R0C A;  2DJK A;  3UVT A;  3JUP A;  2OJL A;  2PWJ A;  3BJ5 A;  3TJF A;  3GST A;  4J2F A;  1MWU A;  4MLY A;  1OKT A;  2HE3 A;  3UL3 A;  3LQ7 A;  1Z7R A;  5HQP A;  3UJM A;  1BRH A;  2Y73 A;  3SXX A;  1JLV A;  1TP9 A;  3A3T A;  3UIW A;  2CFG A;  3V98 A;  1LOX A;  1YI2 3;  1BYE A;  1OGZ A;  1AIU A;  2YFI B;  1GSS A;  3DGQ A;  1K3L A;  3JUN A;  4EVM A;  3DYR A;  3UAP A;  4MMY B;  5KOX A;  1U6T A;  3I56 3;  4Z7X A;  2HSH A;  1XWC A;  3AMO B;  4OFN A;  4HZ2 A;  4EIP A;  1X0R A;  1VQ8 3;  2VCX A;  3UL6 A;  1GY5 A;  3IK7 A;  2KXG A;  3EHC A;  3BBY A;  2YFJ B;  3R2Q A;  2XPD A;  2CWU A;  2GBW B;  3VUR A;  3S9F A;  1W89 A;  3DXO A;  3G7I A;  5GZZ B;  2IUK A;  3BU4 A;  1TDI A;  3EYT A;  1SYR A;  3BNC A;  2VD0 A;  2AAD A;  4RNT A;  1EQK A;  4WYK A;  2K3D A;  2H1D A;  1STD A;  1GOU A;  1PMT A;  3CRT A;  1KQS 2;  2H01 A;  4HM3 B;  4K7N A;  5GST A;  6GSS A;  2KRT A;  2UUG C;  3WGX A;  4N11 A;  1KWI A;  1BNJ A;  1M9B A;  2H1G A;  2GEX A;  3H3H A;  4AF2 A;  5GAN D;  2IA7 A;  1CH0 A;  2N5F A;  2GSS A;  3KH9 A;  1Z9H A;  3NIV A;  2C4J A;  4J9A A;  4IP6 A;  2F56 A;  3KII A;  3N8B A;  3K63 A;  3HIG A;  1K0B A;  1JZD A;  2GU3 A;  1TU8 A;  3BOA A;  3FR6 A;  1TK5 B;  1M99 A;  1F37 A;  4EUY A;  3GIX A;  3UB1 A;  4FMD A;  1JKG A;  4TR0 A;  3LXU X;  1ISK A;  2Z9S A;  4YQM A;  1AAZ A;  3M1G A;  3M0F A;  3B4O A;  3TKR A;  1GOY A;  1DMQ A;  2VM1 A;  3KP8 A;  2YCD A;  3FYG A;  1E3R A;  14GS A;  3WA2 X;  3WT2 A;  1Q9E A;  1KBN A;  3IAS 2;  3HZ4 A;  3IA1 A;  1UDI I;  2OBK A;  3DM8 A;  2NDO A;  3KFQ C;  3L4N A;  1DE1 A;  1GWC A;  2FUG 2;  4ECB A;  5ECO B;  2JDI H;  2BT3 A;  2N5A A;  4I4K A;  3CPW 2;  3U97 A;  1WQL B;  2QA1 A;  3H4K A;  3O3T A;  4GSP A;  4NV2 A;  2ZL8 A;  4U13 A;  2JAC A;  5JCG A;  3HJP A;  3LGC A;  1IYH A;  2A4V A;  3L9V A;  1V57 A;  2I81 A;  5IOW A;  1B21 A;  1C72 A;  2W56 B;  1LVN A;  1O81 A;  4OO5 A;  2OAC A;  1IYY A;  3P90 A;  1ZYE A;  13GS A;  1RRL A;  2PUK C;  4BA7 A;  5IF6 A;  4NRE A;  3N54 B;  3C71 A;  3F6F A;  1I3F A;  4K6X A;  3G0K A;  3FR3 A;  4G9H A;  1FHE A;  4MCU A;  2BMQ B;  2CX4 A;  1OUN A;  5IG5 A;  1O85 A;  3SYU A;  2VCW A;  4A5P A;  5TGN A;  3L78 A;  1AR0 A;  2YZH A;  4KCA A;  5DJM A;  1XOA A;  1GSD A;  4CJN A;  1GSF A;  2HZF A;  1DMN A;  4D73 B;  4OMV A;  1I2G A;  3AY8 A;  2HFD A;  3KTL A;  1VQL 3;  4HM2 B;  3IHG A;  5HGR A;  3K7C A;  3HJO A;  2R41 A;  3TCO A;  3LTB A;  4ZBB A;  1AQZ A;  3P7X A;  2VCZ A;  1GY7 A;  1OHS A;  1Z6M A;  3RGR A;  3EPT A;  2OE1 A;  4FYB A;  3UBL A;  3TGZ A;  1LOY A;  6RNT A;  4XIH A;  4K7I A;  2C0F A;  1LJR A;  1TRP A;  4BVY B;  4HDE A;  4TKY A;  3F7X A;  1DE3 A;  1RGA A;  22GS A;  3G8Z A;  4ILF A;  3BLZ A;  3BD2 A;  3GFK A;  5CK6 A;  2KLX A;  4AEQ A;  2BO9 B;  1BG5 A;  1M0U A;  2LNS A;  2LQV A;  4L0U A;  4ID0 A;  4WHA A;  2RUF A;  5JCW A;  3UVH A;  5ABR A;  5ELG A;  2F4Y A;  1DUG A;  2PNC A;  4DSQ A;  3DXB A;  4XB5 A;  1NO3 A;  4KX4 A;  1WPI A;  4HQZ A;  2GXF A;  3D5G A;  3IXR A;  1JV2 B;  4EV5 A;  1ZZY A;  4HM4 B;  1URM A;  1ZL9 A;  1I5G A;  1R26 A;  4OO4 A;  3X3Z A;  3ZLP A;  3C1S A;  1TOF A;  1S3C A;  1R5P A;  1U87 A;  2EIR A;  3LT8 A;  1Z3E A;  2CFD A;  4LSO A;  3S67 A;  2IFQ A;  4MJD A;  4MJE A;  5HR3 A;  4KDU A;  4ECC A;  4ECI A;  4K5S A;  4BL7 A;  1Y4K A;  2XBI A;  3WT1 A;  4V1A p;  3LYK A;  1O8W A;  1VQN 3;  8RNT A;  2QA2 A;  2FHE A;  3FG3 A;  1OF5 A;  4G0L A;  3IAM 2;  1SD9 A;  3H1N A;  1I9D A;  4H3U A;  1W00 A;  3IMA B;  3PH9 A;  3SBC A;  2WB9 A;  5BIR A;  1YF1 A;  3IOS A;  7STD A;  4E8E A;  2QC7 A;  1A2L A;  5AIF A;  3HXS A;  2F8F A;  4ZBD A;  2NBS A;  2H1B A;  3TKQ A;  4HQS A;  4YQU A;  1G96 A;  2C0G A;  2GLR A;  1TU5 A;  5J3R A;  2L4Q A;  3JUO A;  1EEM A;  1GSE A;  1IT7 A;  3V92 A;  1QUW A;  4KF9 A;  3LWA A;  1H75 A;  5G30 A;  5D9X A;  3OV4 A;  1B2M A;  4MNN A;  1SQW A;  3AMO A;  2QA4 3;  3FZ5 A;  4EO3 A;  1ASK A;  2K9F A;  3PR8 A;  3GUS A;  4LL4 B;  2VUP A;  2E2T A;  5KN1 A;  3GRX A;  4H61 A;  3UNL A;  2I4A A;  4IQ1 A;  2YP6 A;  4KT3 B;  1RNB A;  4YKF A;  4IJ3 A;  1RN7 A;  2CVD A;  4FYU A;  4LA1 A;  1C7H A;  3CSH A;  4ZIJ A;  2YJ7 A;  3S28 A;  1SK2 A;  4HZ4 A;  1I70 A;  3CD6 3;  3NBR A;  2BMR B;  4IT7 A;  4X2H A;  4KA0 A;  3A2V A;  1US1 A;  2WGQ A;  4MEI A;  3DUK A;  2FA4 A;  4ZB6 A;  3LOY A;  2P5Q A;  1FUW A;  3CCV 3;  4HVN A;  3EBY A;  3R3E A;  2N5B A;  2LYX A;  2C10 A;  3TRQ A;  3QAG A;  1TUH A;  1PU4 A;  3KEB A;  3GSP A;  1ON4 A;  1YKA A;  4BVX A;  1RHL A;  5IO0 A;  4KND A;  2CIU A;  3M8C A;  1M7T A;  3HVX A;  1IT8 A;  4FO5 A;  1DBY A;  1Q40 A;  3QDN A;  3KGK A;  1CQS A;  3KCM A;  1FGT A;  5I97 A;  3S29 A;  3TKS A;  2DJ1 A;  2CZ2 A;  5LC6 A;  1A90 A;  4L8E A;  2DSA A;  4JR6 A;  4HJL B;  3F6D A;  4R1K A;  20GS A;  1VQQ A;  1CEW I;  4MJC A;  1HNC A;  4POB A;  1QMA A;  3T8U A;  1MWR A;  4KFF A;  2OE0 A;  3WHO A;  2Z7A A;  2WGO A;  2MBT A;  1U3A A;  3LML A;  5BMU A;  2CW9 A;  4TXV A;  5INY A;  3FGY A;  2CC3 A;  5DRV A;  1OAZ A;  2C3T A;  1AQX A;  4ML6 A;  3UBK A;  1B2X A;  5DAK B;  5HOH A;  1W4N A;  4CY6 A;  2I9W A;  3VSY A;  1J9B A;  1QAK A;  5D93 A;  1SU9 A;  2WO0 A;  1TI3 A;  1NJI 4;  2P38 A;  4CDL A; 
#chains in the Genus database with same CATH homology
 3F3R A;  1XCC A;  2M46 A;  1SL0 B;  1N2A A;  4CW9 A;  2C3Q A;  4IVF A;  4AJ7 A;  3Q19 A;  1M2D A;  4FIW A;  3VWW A;  3EUR A;  5F8B A;  4KDX A;  5KN2 A;  2OAD A;  4TR1 B;  2VCQ A;  4O5Q A;  2H71 A;  4HJM A;  4GLT A;  3TUE A;  2A2R A;  2GZZ A;  4YAP A;  5KEJ A;  2WS2 A;  3L9S A;  4PUF C;  3CXG A;  4LMV A;  1V58 A;  5AIS A;  1V2A A;  2M72 A;  1J0F A;  5G2Z A;  3ZYW A;  1IYI A;  2HZE B;  1VF4 A;  2VL3 A;  4Z2T A;  4BVY A;  2HRF A;  1V98 A;  3CMI A;  4MF5 A;  3RBT A;  1JZW A;  4X4J A;  2JZS A;  1OC3 A;  2FY6 A;  2GGT A;  2CV4 A;  1G0T A;  1F3B A;  4MZB A;  3E3E A;  2B7J A;  5IQY A;  4EE0 A;  1BX9 A;  2R6K A;  5COH A;  2C1Y A;  3QCP A;  4HEA 2;  4BWQ A;  1XWK A;  3FR9 A;  4V1A g;  2AV4 A;  5LCZ A;  1OE8 A;  4MAB A;  1S3D A;  3CYN A;  1S3A A;  4OWY A;  6GSY A;  16GS A;  2H66 A;  3A2W A;  1GUH A;  2DKH A;  1GNW A;  2R37 A;  3VK9 A;  1MEK A;  5BRT A;  3DKS A;  4NWY A;  4KCE A;  2MMA A;  3BCK A;  1PX6 A;  2H72 A;  1EV9 A;  5A4W A;  1SYX A;  1X9W B;  2IL3 A;  4HS1 A;  3ZRE A;  3ERG A;  1NSW A;  1EEJ A;  6GSX A;  1RQM A;  1PQN A;  4NXI A;  2DC5 A;  5LD0 A;  5DDL A;  2IY2 A;  3DIE A;  4TR3 A;  3GUR A;  1FOV A;  2XHF A;  1TW9 A;  1MTC A;  4FYC A;  4MJA A;  2H8L A;  2DJ3 A;  2EIQ A;  5G1K A;  4BPY A;  3P2A A;  4OFT A;  2AYT A;  3D4T A;  2PPT A;  4JED A;  3ERW A;  5HFG A;  4H86 A;  1WOU A;  4NHZ A;  3Q18 A;  4IBP A;  4MDC A;  1OE7 A;  3N9J A;  1YEX A;  5EPF A;  1A0R P;  2X8H A;  2PBJ A;  3VPQ A;  1VRS D;  3RPP A;  5E59 A;  4O5U A;  2OA7 A;  5D9T A;  3LW9 A;  3KP9 A;  1AC1 A;  5ECM B;  4MPF A;  2K18 A;  2JZT A;  2CX3 A;  1CQH A;  1VF2 A;  1M2A A;  1XW5 A;  2GZY A;  3KH7 A;  4O92 A;  5IMC A;  1Z5Y E;  3GTU A;  1GH2 A;  4ZIL A;  3I9V 2;  4QQ7 A;  3FEU A;  3TJJ A;  4XRD A;  2PN8 A;  4WF4 A;  4MH2 A;  1YZX A;  2V2G A;  4D73 A;  8GSS A;  4GQF A;  2V1M A;  1TI1 A;  2L57 A;  5AGY A;  1UN2 A;  2GT6 A;  1TU7 A;  4G19 A;  4PUR A;  1B9Y C;  5A5K A;  5IMZ A;  1YEP A;  4LLR A;  2HSY A;  3N5O A;  5ECN B;  3F0I A;  1ERU A;  3FHK A;  2GQM A;  1JHB A;  1ILO A;  2IN3 A;  2GSQ A;  1JFU A;  1VF3 A;  2CA8 A;  3GKM A;  5IPH A;  1ERW A;  4OFM A;  3V1W A;  2I3Y A;  3TJB A;  1AUC A;  3GA4 A;  4X1U A;  1F3A A;  2OBI A;  3JCM L;  3LG6 A;  4JZQ A;  2PVO C;  3HVV A;  4PTS A;  5E4W A;  1V40 A;  2LUS A;  3TKS C;  1RW1 A;  5KN0 A;  1EGO A;  1DSB A;  2WFC A;  2L5O A;  3F8U A;  3APS A;  1ERT A;  3CTF A;  4DEJ A;  4RI6 A;  3D4M A;  3IDV A;  2LJA A;  3LXZ A;  1HD2 A;  2PMT A;  2CVB A;  2O85 A;  5ECS A;  3ZZX A;  1GLQ A;  4HOJ A;  2HRA A;  4V2L A;  4POK A;  1SK0 A;  3C73 A;  4ML1 A;  3FRC A;  4MF6 A;  2CT6 A;  1SKW B;  2YV7 A;  2V6K A;  3QMX A;  3RHC A;  1GTA A;  2D2Z A;  3TJK A;  1JLW A;  2NPB A;  4FH8 A;  1USB A;  7GSS A;  4GQC A;  4NMU A;  3RHB A;  1R7H A;  1EV4 A;  2JAD A;  4K7O A;  4GSN A;  1THX A;  1B48 A;  4TW5 A;  2K8V A;  4XS1 A;  1E2Y A;  2I1U A;  2DJ0 A;  3IR4 A;  2ON5 A;  3U5R E;  3GKK A;  1SL2 B;  2QKE A;  3GH9 A;  3UOM A;  5JCU A;  2F51 A;  1AQW A;  1WRY A;  1K0M A;  2P31 A;  3TB2 A;  3A5I A;  3TOU A;  2DLX A;  4LL1 B;  3E0U A;  4JE1 A;  5A4V A;  2AHE A;  3LEF A;  4LMW A;  4NPB A;  1QXH A;  1PA3 A;  5ECL B;  3M9K A;  3VWU A;  4CY8 A;  3ZVJ A;  1K3O A;  4EKZ A;  2JSY A;  1M2B A;  1PL2 A;  1ZYP A;  2LS5 A;  2O8V B;  3PPU A;  1GSQ A;  3G7J A;  2H70 A;  2RLI A;  3ZL5 A;  1G6Y A;  2X49 A;  2PVQ A;  3EVI A;  1SK1 A;  4WET A;  1Z7P A;  5IMF A;  2IYJ A;  3GN3 A;  1T00 A;  1PGT A;  2CQ9 A;  3QPM A;  5B6M A;  4O5R A;  3ME8 A;  3LJR A;  2RM6 A;  5IOX A;  1BQ7 A;  3APO A;  3VLN A;  2IMD A;  1KEB A;  2E0Q A;  3F4T A;  2EIO A;  3QFA C;  2KUC A;  3GMF A;  3KXO A;  5CAX A;  1V9W A;  2LKU A;  5F06 A;  1SEN A;  4MF7 A;  3IV4 A;  4TOP A;  2B1L A;  1DE2 A;  5C00 A;  2X4A A;  3D21 A;  3EE2 A;  2VLT A;  6GSV A;  3I6A A;  2GST A;  3EIN A;  1QMV A;  4GXZ A;  1YY7 A;  1EP8 A;  3KMN A;  4JR4 A;  2C3N A;  1M9A A;  1TXX A;  1ML6 A;  4WBJ A;  4TXO B;  5ECQ B;  3CTG A;  1XWG A;  4J57 E;  4EF0 A;  4GSS A;  2MBS A;  2YZU A;  1TK8 B;  2KHP A;  3KZQ A;  1GRX A;  4L5L A;  1O8X A;  4K2X A;  2B5X A;  4KUN A;  1OKD A;  1FG4 A;  2IME A;  5J9C A;  3ISO A;  4V2N A;  3IBH A;  2KOK A;  3UAR A;  5CNW A;  3QR6 A;  4IGJ A;  4K2D A;  1O7U A;  3D6I A;  4IP1 A;  4PGT A;  3ZVJ D;  3ZIV A;  2OKA A;  2GTU A;  4MZW A;  3GHA A;  2IJY A;  4FQU A;  2YWM A;  1E6B A;  4N0V A;  4I97 A;  3L9U A;  3GKX A;  4EL1 A;  4I8B A;  4MH3 A;  1GTB A;  4POL A;  2VD1 A;  5CYY A;  19GS A;  2H6X A;  2B1K A;  1SL1 B;  4IHU A;  2PER A;  3C8E A;  4K5R A;  3H8Q A;  4BWS A;  1XWB A;  5KN3 A;  5CRW A;  1FB6 A;  1ST9 A;  4KSM A;  2R3X A;  3U6V A;  1QK8 A;  4GF0 A;  3KIJ A;  2KP2 A;  1B4P A;  2L6C A;  4HU9 A;  4IQA A;  1EOG A;  1XBS A;  2B7K A;  5JWR B;  2YWN A;  1JZR A;  2V32 A;  4HUA A;  2M80 A;  1TRU A;  2O89 A;  3D0Z A;  4WKW A;  1MDJ A;  4XTS A;  4G0K A;  4POM A;  1Y6E A;  2GVP A;  2H6Z A;  1TJD A;  4L0W A;  4WBR D;  5H5Q A;  5AIX A;  1A24 A;  2C0D A;  5F07 A;  2DJ2 A;  3EC3 A;  1GUK A;  3BCI A;  3VI7 A;  5ECI B;  3K8N A;  1FOH A;  1WJK A;  3MSZ A;  1T7P B;  1EZK A;  5DBQ A;  2ZNM A;  1X5D A;  5L71 A;  2NTO A;  4WR5 A;  1VGL A;  3CRU A;  3HDC A;  2UZ8 A;  2I9H A;  2YJH A;  4MMM A;  4XS6 A;  3W6G A;  3LFL A;  2OE3 A;  2H76 A;  3QD9 A;  3GYK A;  3A5W A;  4JU5 A;  1G7O A;  2P0G A;  4KB3 A;  2MMO A;  1TTZ A;  1AW9 A;  3EMP A;  4QL7 A;  2C80 A;  5D73 A;  1SJZ A;  2VCV A;  3EMX A;  2E2M A;  1LU4 A;  4KSO A;  2PU9 C;  5GAP D;  4PX1 A;  2GDR A;  1XVQ A;  5DAL B;  1PSQ A;  3TKP A;  3MWH A;  5IMD A;  2HZE A;  2GS3 A;  5B6N A;  4GTU A;  1TRS A;  2F8A A;  4KGI A;  2WJU A;  2REM A;  4OCE A;  4YKG A;  3ZFB A;  1Q4J A;  1YQ1 A;  5EY6 A;  1EGR A;  3CSJ A;  2K6V A;  3HCZ A;  3GTU B;  5B8B A;  1OVN A;  3M8N A;  2VLU A;  2DIY A;  1B4Q A;  4NHW A;  5DVB A;  2AB6 A;  3FK8 A;  4XRA A;  4O7H A;  2G0F A;  4DSS A;  4DSS B;  2R2J A;  5FWG A;  4WEY A;  5KOW A;  18GS A;  2E7P A;  1XXU A;  2VL2 C;  4F82 A;  4J56 E;  3C7M A;  2H19 A;  1PRX A;  3I69 A;  5LNK e;  2DML A;  2DBC A;  2QSI A;  4CHS A;  1U88 A;  3GL5 A;  1FB0 A;  3KD0 A;  5A4U A;  2IWT A;  4EDY A;  1TK0 B;  5CRH A;  2X99 A;  2FWF A;  2YWO A;  3EU3 A;  4ACS A;  3M3M A;  1B8X A;  2BJX A;  3E9J B;  4XCS A;  3WGE A;  2YN1 A;  4PXO A;  2XPE A;  5CRE A;  1U3I A;  2ALB A;  3VFI A;  4G2E A;  5DJL A;  4MZC A;  3ZRD A;  1G7E A;  2L4C A;  4HJ2 A;  4Q5Q A;  2VAF A;  4BVX B;  1RK4 A;  3DVX A;  5HR2 A;  2WRT A;  3MIX A;  2FCH A;  1XW6 A;  4ECJ A;  4I2U A;  2B5E A;  3ED3 A;  2L5L A;  3HKR A;  1FO5 A;  1XVW A;  4MPG A;  3IK9 A;  4HU7 A;  3FZ4 A;  5IM9 A;  4Q5N A;  2VM2 A;  4N30 A;  2RII A;  1AQV A;  5EL8 A;  2MYG A;  2J23 A;  3F4R A;  4L5O A;  4YAV A;  5DQY A;  5G1L A;  4ZL8 A;  1J08 A;  1XOB A;  3DEX A;  2X8G A;  1SKR B;  2VLV A;  1PN9 A;  4ZL7 A;  2CVK A;  4ZL9 A;  3RAZ A;  2CAQ A;  5B8A A;  1O6J A;  1ZYQ B;  3VWV A;  3IC8 A;  1WE0 A;  1R5A A;  1T4Z A;  3LYP A;  1QQ2 A;  5ECR B;  5JWQ B;  1GLP A;  2X64 A;  4K1F A;  1PKW A;  2GT5 A;  4AJ8 A;  1JZO A;  4GST A;  4DSR A;  2LST A;  1A8L A;  2AJQ B;  3FKF A;  1THO A;  1FVJ A;  5D9V A;  1X9S B;  1PN0 A;  1FVK A;  2FNO A;  3NOF A;  4I6X A;  2C0E A;  5D8I A;  3FMW A;  4TR1 A;  4E8H A;  3HVS A;  4X0X A;  2O87 A;  5D96 A;  2IMF A;  4O32 A;  1OC9 A;  1LBK A;  1YJ6 A;  2IMK A;  3MAK A;  3Q74 A;  1AXD A;  4IEL A;  1ERV A;  2LEG A;  5DQS A;  2CAI A;  3MNG A;  4KAE A;  4WF5 A;  5DCH A;  1KTE A;  2J9H A;  4ZB9 A;  2YOI A;  1EWX A;  2P5R A;  3IRA A;  4NAX A;  2R5G A;  2R4V A;  6GSW A;  4MK3 A;  2WCI A;  2V41 A;  2L6D A;  3TRP A;  3F3Q A;  5G31 A;  1GP1 A;  5G5E A;  4GCI A;  4ULX A;  2X8C A;  3HJM A;  5ECK B;  4I2T A;  5AIV A;  4N0Z A;  6GST A;  1BAY A;  4AGS A;  1WMJ A;  5D9W A;  2DIZ A;  4PQ1 A;  1Z6N A;  4IJI A;  4PQH A;  3C1R A;  2B6M A;  2WDU A;  1BJX A;  2ZUP A;  4PNG A;  2GZP A;  2MMN A;  2DMM A;  2GSR A;  3PGT A;  4XS4 A;  3PIN A;  3QAW A;  4NV5 A;  3W8J A;  3P8W A;  1XPV A;  3GX8 A;  3MDK A;  3IPZ A;  4BL7 B;  2YV9 A;  4K0G A;  4YH2 A;  1K0O A;  3F4S A;  4EIQ A;  1FW1 A;  1HYU A;  4MJB A;  1XIY A;  5GSS A;  2HI7 A;  2HNL A;  4K0N A;  3M9J A;  5ENU A;  1PD2 1;  1A2J A;  4G0I A;  2AAW A;  3QAV A;  4XS4 B;  3KM6 A;  2LJK A;  2NVL A;  1HNA A;  1SD8 A;  4KE3 A;  6GSU A;  2ES7 A;  3H79 A;  4HI7 A;  1GUL A;  1A8Y A;  1Y25 A;  5CRG A;  2JZR A;  2PGT A;  1ZMA A;  4OD7 A;  2KP1 A;  3WGD A;  1PL1 A;  1ZGN A;  5F05 A;  2B5Y A;  1UA5 A;  2MZC A;  3QOU A;  5ID2 A;  2GQL A;  2H74 A;  1G6W A;  3J7Y k;  2XC2 A;  4GWR A;  4OCF A;  3HZ8 A;  3F9U A;  2HRK A;  3LXT A;  3VPT A;  1A2M A;  3O76 A;  3ZTL A;  3RPN A;  2YNX A;  5CRD A;  2F9S A;  1SJ6 A;  1MD4 A;  1W4V A;  1OYJ A;  4TN8 A;  2FGX A;  2G2Q A;  2BTO T;  4IN0 A;  4K8M A;  1NM3 A;  1H4O A;  1TRV A;  5HFK A;  4IS0 A;  1T3B A;  5FHI A;  4CDO A;  5G5F A;  2R0P A;  1XWA A;  3OR5 A;  5JWO B;  3VWX A;  4RQX A;  3GL3 A;  4KW6 A;  1F9M A;  1VF1 A;  3EWL A;  3DML A;  2JL4 A;  2BMX A;  3FY7 A;  2A2P A;  4JRR A;  2LRT A;  2LV3 A;  3D5J A;  4F0B A;  1GL8 A;  5ECP B;  3DWV A;  4JBB A;  5IMA A;  2A4H A;  4XHM A;  1EP7 A;  3ZIJ A;  3LOR A;  4G10 A;  2FWE A;  3TDG A;  2LRC A;  2LJR A;  3TRX A;  3DD3 A;  4Z2U A;  3J7Y b;  3ERF A;  4TR4 A;  4F2I A;  5DCG A;  3D22 A;  1KNG A;  2H6Y A;  3TKS E;  2K8S A;  1ZOF A;  1ZYN A;  2VOC A;  4RQR A;  2IFQ B;  3TOT A;  3GX0 A;  2E2G A;  2V6O A;  5HR0 A;  1QFN A;  1CQG A;  1NHO A;  2WUL A;  4K9Z A;  2VCT A;  1R4W A;  1O73 A;  1YKC A;  3L0H A;  1XFL A;  5IO2 A;  2IMI A;  9GSS A;  4TRX A;  2TRC P;  3EU4 A;  4Z2R A;  2TIR A;  4PUA A;  2HRN A;  5FT3 A;  3MYD A;  3HD5 A;  10GS A;  1GUM A;  3GSS A;  2IPA A;  1ACV A;  12GS A;  1F6M C;  2YAN A;  4P3Y B;  3HA9 A;  1BED A;  2VL2 A;  1UVZ A;  1T8E B;  5ELA A;  1XW9 A;  2JU5 A;  3UEM A;  3KJY A;  3IE3 A;  2A2S A;  3VI5 A;  2O7K A;  4PNF A;  5CP1 A;  3GV1 A;  2FD3 A;  1ABA A;  1HNB A;  2L59 A;  2TRX A;  3H93 A;  4KH7 A;  1TKD B;  1TRW A;  2ZCT A;  1MD3 A;  4ISD A;  2HT9 A;  1QGV A;  3ZML A;  3TJG A;  3G7Y A;  2H73 A;  3WD6 A;  17GS A;  2EC4 A;  2VO4 A;  1PX7 A;  4MA9 A;  2JSZ A;  2HSM A;  2FWG A;  3UMA A;  1HQO A;  5H5S A;  1OC9 B;  2HXK A;  3QFB C;  3KTB A;  3O6T A;  4EXJ A;  2H30 A;  2YPM A;  2WZ9 A;  5IMV A;  1NHY A;  4IW9 A;  3UJ1 A;  2FA8 A;  3ME7 A;  1T1V A;  2F3M A;  5EVO A;  2VIM A;  1B9X C;  1K0C A;  1K0A A;  4ZBA A;  4YQV A;  3APQ A;  3HYP A;  1UC7 A;  3G9B A;  4F0C A;  2CZ3 A;  4F03 A;  2HLS A;  4EC0 A;  5DAL A;  1GNE A;  5C04 A;  1F2E A;  2XBQ A;  1YF0 A;  3I43 A;  1A0F A;  5ID2 B;  1NW2 A;  5DAK A;  4AJ6 A;  2DKI A;  2WGR A;  1K0D A;  1GSY A;  1GTU A;  5J41 A;  4IKH A;  3F63 A;  1X5E A;  1WIK A;  5HFI A;  2LQQ A;  2FWH A;  1N8J A;  1PKZ A;  3US3 A;  3GH6 A;  1YDK A;  5J5N A;  3GNJ A;  3GKN A;  2MMZ A;  1T4Y A;  1GTI A;  2H75 A;  3ZFL A;  2RUE A;  1A23 A;  1SKS B;  3WYW A;  2LNT A;  4TXO A;  2LTK A;  3ZIT A;  1EOH A;  3CSI A;  3ZMK A;  3LSZ A;  2VL9 A;  4RUV A;  4WR4 A;  1WWJ A;  3W8S A;  5F0G A;  2C8U A;  2H1A A;  4USS A;  5HR1 A;  4ZXG A;  4ZB8 A;  11GS A;  1X9M B;  4I5Q A;  4V2M A;  2R0G A;  5CO3 A;  5AN1 A;  4QL9 A;  4Q5F A;  4KDY A;  2H0G A;  2LRN A;  4F9Z A;  1ZCP A;  3IC4 A;  4DVC A;  1SJI A;  5IIZ A;  3CBU A;  4TVE A;  2QGV A;  5ECH B;  3FW2 A;  5B7C A;  2IIY A;  5H5R A;  3NZN A;  4WXT A;  4X43 A;  2LQO A;  1GSU A;  3RDW A;  1MDK A;  1Q98 A;  2FLS A;  2HYX A;  2AUV A;  4MP4 A;  4RI7 A;  3DVW A;  4PQI A;  3HY2 A;  3FZ9 A;  1X5C A;  1K3Y A;  1XZO A;  3Q6O A;  4EDZ A;  3IHQ A;  4ICY A;  2ON7 A;  3DRN A;  2GQK A;  3A2X A;  3KMO A;  3SWL A;  4Q5R A;  5J9B A;  2RM5 A;  2YWI A;  1FAA A;  5J4U A;  2DJJ A;  3HHV A;  1OC8 A;  2H0H A;  1WP0 A;  2H0I A;  4GRF A;  3FZA A;  2B3S A;  1K0N A;  1MDI A;  5IPG A;  2R0C A;  2DJK A;  3UVT A;  2OJL A;  2PWJ A;  3BJ5 A;  3TJF A;  3GST A;  4J2F A;  4MLY A;  1OKT A;  2HE3 A;  3UL3 A;  3LQ7 A;  1Z7R A;  5HQP A;  1JLV A;  1TP9 A;  3A3T A;  3UIW A;  1BYE A;  1AIU A;  1GSS A;  3DGQ A;  1K3L A;  4EVM A;  3DYR A;  3UAP A;  5KOX A;  1U6T A;  4Z7X A;  2HSH A;  1XWC A;  4OFN A;  4HZ2 A;  4EIP A;  1X0R A;  2VCX A;  3IK7 A;  3BBY A;  3R2Q A;  2XPD A;  3VUR A;  3S9F A;  1W89 A;  5GZZ B;  3G7I A;  1TDI A;  3EYT A;  1SYR A;  2VD0 A;  2H1D A;  1PMT A;  3CRT A;  5GST A;  2H01 A;  4K7N A;  6GSS A;  3WGX A;  4N11 A;  1M9B A;  2H1G A;  4AF2 A;  5GAN D;  2N5F A;  2GSS A;  3KH9 A;  1Z9H A;  3NIV A;  2C4J A;  4IP6 A;  3FR6 A;  1K0B A;  3BOA A;  1JZD A;  1TU8 A;  1TK5 B;  1M99 A;  1F37 A;  4EUY A;  3GIX A;  4TR0 A;  2Z9S A;  4YQM A;  1AAZ A;  3M1G A;  3M0F A;  3TKR A;  3KP8 A;  2VM1 A;  2YCD A;  3FYG A;  14GS A;  3WT2 A;  1KBN A;  3IAS 2;  3HZ4 A;  3IA1 A;  2OBK A;  2NDO A;  3L4N A;  1DE1 A;  1GWC A;  2FUG 2;  4ECB A;  5ECO B;  2N5A A;  2QA1 A;  3H4K A;  3O3T A;  4NV2 A;  2JAC A;  5JCG A;  3HJP A;  3LGC A;  1IYH A;  2A4V A;  3L9V A;  1V57 A;  2I81 A;  5IOW A;  1C72 A;  1O81 A;  4OO5 A;  2OAC A;  3P90 A;  1ZYE A;  13GS A;  4BA7 A;  2PUK C;  3C71 A;  3F6F A;  4K6X A;  3FR3 A;  4G9H A;  1FHE A;  4MCU A;  2CX4 A;  1O85 A;  2VCW A;  4A5P A;  3L78 A;  2YZH A;  4KCA A;  5DJM A;  1XOA A;  1GSD A;  2HZF A;  1GSF A;  4D73 B;  4OMV A;  3AY8 A;  2HFD A;  3KTL A;  3IHG A;  3HJO A;  3TCO A;  4ZBB A;  3P7X A;  2VCZ A;  1Z6M A;  3EPT A;  2OE1 A;  4FYB A;  3UBL A;  3TGZ A;  4XIH A;  4K7I A;  2C0F A;  1LJR A;  4BVY B;  4HDE A;  4TKY A;  4ILF A;  22GS A;  3BD2 A;  3GFK A;  2KLX A;  1BG5 A;  1M0U A;  2LNS A;  4L0U A;  4ID0 A;  2RUF A;  5JCW A;  3UVH A;  5ABR A;  5ELG A;  1DUG A;  4DSQ A;  3DXB A;  4KX4 A;  1WPI A;  4HQZ A;  3IXR A;  1ZZY A;  1URM A;  1ZL9 A;  1I5G A;  1R26 A;  4OO4 A;  3ZLP A;  3C1S A;  1TOF A;  1S3C A;  1R5P A;  1U87 A;  2EIR A;  1Z3E A;  2IFQ A;  4MJE A;  5HR3 A;  4KDU A;  4ECC A;  4ECI A;  4K5S A;  4BL7 A;  2XBI A;  3WT1 A;  4V1A p;  3LYK A;  1O8W A;  2QA2 A;  2FHE A;  4G0L A;  3IAM 2;  1SD9 A;  3H1N A;  1I9D A;  3PH9 A;  3SBC A;  2WB9 A;  1YF1 A;  3IOS A;  4E8E A;  2QC7 A;  1A2L A;  3HXS A;  2F8F A;  4ZBD A;  2NBS A;  2H1B A;  3TKQ A;  4HQS A;  4YQU A;  2C0G A;  2GLR A;  5J3R A;  2L4Q A;  1EEM A;  1GSE A;  1QUW A;  4KF9 A;  3LWA A;  1H75 A;  5G30 A;  5D9X A;  4MNN A;  3FZ5 A;  4EO3 A;  2K9F A;  3PR8 A;  4LL4 B;  3GUS A;  2VUP A;  5KN1 A;  3GRX A;  2I4A A;  4IQ1 A;  2YP6 A;  4YKF A;  4IJ3 A;  4LA1 A;  2CVD A;  4FYU A;  3CSH A;  4ZIJ A;  2YJ7 A;  1SK2 A;  4HZ4 A;  4KA0 A;  3A2V A;  2FA4 A;  4ZB6 A;  2P5Q A;  3R3E A;  2N5B A;  3TRQ A;  3QAG A;  3KEB A;  1ON4 A;  1YKA A;  4BVX A;  5IO0 A;  4KND A;  1M7T A;  3HVX A;  4FO5 A;  1DBY A;  3QDN A;  3KGK A;  3KCM A;  3TKS A;  2DJ1 A;  2CZ2 A;  4L8E A;  2DSA A;  4JR6 A;  3F6D A;  20GS A;  4MJC A;  1HNC A;  4POB A;  2OE0 A;  2MBT A;  1U3A A;  5BMU A;  5INY A;  4TXV A;  2C3T A;  1OAZ A;  3UBK A;  1AQX A;  4ML6 A;  5DAK B;  4CY6 A;  1J9B A;  5D93 A;  1SU9 A;  1TI3 A;  4N10 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...