2H0HA

Crystal structure of dsbg k113e mutant
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
229
structure length
229
Chain Sequence
ELPAPVKAIEKQGITIIKTFDAPGGMKGYLGKYQDMGVTIYLTPDGKHAISGYMYNEKGENLSNTLIEKEIYAPAGREMWQRMEQSHWLLDGKKDAPVIVYVFADPFCPYCEQFWQQARPWVDSGKVQLRTLLVGVIKPESPATAAAILASKDPAKTWQQYEASGGKLKLNVPANVSTEQMKVLSDNEKLMDDLGANVTPAIYYMSKENTLQQAVGLPDQKTLNIIMGN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Thiol:disulfide interchange protein dsbG
publication title Short-circuiting divergent evolution: laboratory evolution of one disulfide isomerase to resemble another
rcsb
source organism Escherichia coli
molecule tags Isomerase
total genus 67
structure length 229
sequence length 229
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-05-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13098 Thioredoxin_2 Thioredoxin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.70 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Disulphide bond isomerase, DsbC/G, N-terminal 2h0hA01
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 2h0hA02
2IPAA 1XXUA 2LQOA 1WWJA 3GURA 1DBYA 1U3AA 5ELGA 3ZFLA 3GMFA 1UC7A 1G6YA 1W89A 2GQMA 5LCZA 4DSQA 4ACSA 3TKSC 3QAWA 2PERA 3ZRDA 4Q5QA 1VRSD 2IY2A 2V6KA 3IAS2 1ERVA 3FY7A 3LQ7A 1AAZA 5D8IA 4HZ4A 4TR4A 1ILOA 1N8JA 1O6JA 4NV2A 3FR6A 4PQIA 4Q5RA 2R2JA 3DYRA 2DJKA 4F2IA 4TXVA 3KP9A 2DJ0A 2H0IA 2C0EA 6GSYA 2VL3A 3GL3A 2YOIA 2GSRA 1XWAA 3P2AA 3WT2A 3BCKA 5CREA 3F9UA 4FYBA 4MDCA 5EL8A 4GLTA 3C8EA 3CXGA 3HYPA 5G2ZA 4PUFC 2EIQA 3LYPA 1Z7RA 5LD0A 5B8AA 4X0XA 2DLXA 1M2AA 3ED3A 4NHZA 3IE3A 4FO5A 13GSA 2H6YA 3ZL5A 3VURA 3LXZA 5F0GA 1BQ7A 3FR9A 4I97A 5HFKA 3F3QA 1EGOA 2HE3A 4MPFA 2AV4A 3HZ8A 4WBRD 3IC4A 1ZMAA 3PH9A 4IELA 1WIKA 1YZXA 3UARA 1BJXA 5B6MA 1WOUA 5D9WA 4IKHA 4YAPA 2XBIA 5JCWA 2LRNA 3BBYA 2B1LA 1NHYA 2VAFA 2HZEA 4NPBA 3WGXA 5ELAA 5G5FA 2FWGA 1UN2A 3IV4A 3VFIA 4E8EA 2GGTA 3A2WA 1V40A 5A4WA 3EU4A 4E8HA 2GT5A 3ZTLA 1U3IA 3KTLA 4KCAA 5IO0A 2TRCP 4D73B 1TI3A 5D9XA 3EINA 3DKSA 3W8JA 2WGRA 3APQA 4ULXA 2M80A 3ME7A 2IYJA 1YDKA 1OE7A 2DMMA 3G9BA 2NBSA 4HQZA 5JCGA 2DJ1A 4MA9A 3H8QA 1JZRA 3UOMA 2VD0A 1HNAA 1EEJA 1M9AA 3RAZA 4PUAA 1K0BA 1F37A 2PVOC 3LJRA 5D9TA 1AQXA 5J5NA 5DVBA 4MJEA 4L5OA 3GSTA 3CSIA 3HY2A 1ERWA 3LXTA 4V2NA 2DC5A 3HVVA 1SKRB 5DALB 4AJ8A 1JZOA 1XWKA 2HSHA 2I3YA 1AIUA 3HCZA 2LRTA 5CP1A 3L9SA 2RM5A 2GLRA 5A4UA 1NSWA 2C3QA 1DE1A 3FZ5A 1PKZA 3GX0A 5HFGA 4DSSA 1OAZA 2DIYA 2RUEA 2JSZA 1GUHA 4KW6A 3HJOA 3D6IA 2GQKA 4BVXA 3P90A 2YPMA 1URMA 4JU5A 3J7Yb 1XZOA 2JSYA 4LA1A 4KSOA 4IJ3A 3APSA 4J57E 1K3YA 2KP1A 1M2DA 2A2RA 4MZWA 1KEBA 2PUKC 1U87A 1YF1A 1SL2B 3TKRA 5GSSA 1GTUA 1R4WA 1Q98A 3TKSA 1G6WA 3IOSA 2FWFA 3FZ4A 1K0NA 22GSA 5ECOB 1RK4A 3I9V2 4X43A 3VWUA 1SD8A 4WR4A 2CX3A 1F6MC 2N5BA 4KH7A 2H1BA 3ZIVA 4K0GA 3A2XA 1T7PB 3UMAA 3A5WA 3C1RA 1A0RP 1GH2A 3GTUB 4Q5FA 1F2EA 1ST9A 1MTCA 3I6AA 3IK7A 2V1MA 3KGKA 5HFIA 3UBKA 1M0UA 2FHEA 2C1YA 2WJUA 3WGEA 3H93A 4K0NA 1XWCA 4K7NA 2L59A 1WRYA 1VF1A 1DSBA 1EZKA 2YJ7A 1Z3EA 4WR5A 1YKCA 4MJCA 3DMLA 3F4SA 3JCML 2KLXA 1BAYA 3CTGA 4GWRA 3CRTA 4ZBAA 2JZRA 3ZMKA 2CVBA 4YH2A 2YZUA 3W6GA 1EP7A 2E2MA 4XCSA 5AN1A 4IGJA 5JWOB 2LUSA 3H79A 2B6MA 3F0IA 4IHUA 1PL1A 1SKSB 2C0DA 1Z6MA 1A2MA 3GX8A 3IPZA 1B48A 5JWRB 3O76A 3H4KA 4GF0A 4EXJA 1SD9A 3OR5A 2VLTA 2H30A 5D73A 6GSWA 1MD4A 2HRFA 2N5AA 3VWXA 1Z5YE 2R37A 1XWBA 1GL8A 5JWQB 3IR4A 2B5YA 4NXIA 3EMPA 16GSA 2XHFA 2L5LA 3BD2A 4HS1A 3QR6A 1U6TA 3C7MA 3TRQA 2CVDA 3DD3A 3A2VA 5FWGA 3TJBA 2O7KA 3ME8A 4V2MA 2L4CA 4ID0A 3Q74A 1O81A 3HKRA 4RI6A 4HQSA 3GL5A 2JZTA 5ECPB 3VWWA 3KZQA 3IK9A 3D22A 4KSMA 1GLQA 1TOFA 5B7CA 3TJFA 1HQOA 5IPGA 2I81A 3CSHA 4HJ2A 1OVNA 2HFDA 1FO5A 2IFQB 5DJMA 2GS3A 2PBJA 5IQYA 5L71A 1M9BA 1SL0B 1W4VA 3SWLA 3ERGA 1T4YA 2QSIA 1NM3A 3LSZA 3FYGA 1XVWA 5KN3A 1SU9A 4HI7A 4IW9A 4MH3A 2CT6A 3G7JA 3EVIA 4GTUA 4QQ7A 5ECMB 2VLVA 2E0QA 1HNCA 3F6DA 3F4TA 2MYGA 4WETA 2E2GA 2F8AA 4OO4A 5H5SA 4L0UA 3LEFA 4KDYA 1GRXA 3LGCA 4IBPA 2N5FA 4F0BA 18GSA 4MH2A 5EY6A 2GVPA 5ECSA 4IQ1A 3UVHA 5HQPA 3DIEA 2NPBA 1QK8A 4G10A 4F0CA 4EL1A 8GSSA 3QFBC 3ISOA 1TK0B 2YP6A 5G31A 1A8LA 3KMOA 3KTBA 3GNJA 1VF4A 1X5EA 5FHIA 4KA0A 2C8UA 2X99A 1YF0A 2WFCA 2IMDA 3IRAA 2CZ2A 5G1LA 3APOA 2HXKA 4HU9A 3UAPA 3TOUA 4BPYA 4TXOB 4K2DA 3ZMLA 1WP0A 4QL7A 4IVFA 1ML6A 5IO2A 5AISA 1V9WA 2L6DA 3GV1A 1GTAA 3GH6A 2H8LA 2QC7A 5ECHB 4L0WA 5A5KA 2VUPA 2OBKA 2QKEA 1K0MA 1OKTA 3P8WA 1NW2A 3ZLPA 1OKDA 2FCHA 1Y6EA 4K8MA 1TK8B 3BCIA 2OACA 4EVMA 1DUGA 3TGZA 2H76A 3CSJA 1C72A 3O3TA 1H4OA 1PQNA 5AIXA 2O89A 2H1DA 4HUAA 1O7UA 2LJKA 4ZL9A 2H70A 1GSEA 3H1NA 2B7KA 5G5EA 1KTEA 2YANA 1OC9B 2EIOA 2MZCA 2IMKA 4FIWA 1B4PA 1HYUA 4P3YB 1GWCA 3FKFA 1BEDA 5J9BA 3RBTA 1V2AA 4TW5A 5G30A 5HR3A 2VCVA 1M2BA 3TKPA 1FVKA 3HVXA 2F51A 4ECBA 3GH9A 1YJ6A 1XCCA 1TP9A 4KAEA 5D93A 4EUYA 4HU7A 1Y25A 1R7HA 3DWVA 2H71A 2LTKA 1QUWA 3MSZA 2HZFA 5DCGA 4HEA2 2PN8A 2ZUPA 3KM6A 1XW6A 3ZYWA 2PGTA 4GSSA 4F9ZA 3Q18A 1IYIA 2CA8A 3HJMA 2H0HA 1X0RA 5HR1A 3FR3A 5DDLA 2LSTA 5ECKB 3LG6A 2RM6A 1T00A 2Z9SA 2X8CA 2CAQA 1AQVA 3BJ5A 3GHAA 1K0OA 4MLYA 5ID2B 1J08A 2KOKA 4PQHA 4GSNA 2LEGA 4WKWA 4MABA 1QGVA 1PL2A 1B8XA 3CTFA 1KBNA 1V98A 1GSQA 2XPEA 2OKAA 3VK9A 3GRXA 1MD3A 1XOAA 2OADA 1O85A 2ZNMA 2WULA 3FW2A 1LU4A 2GSQA 2IN3A 2H01A 2MMNA 4V1Ap 4DSRA 1A23A 1A2LA 4TKYA 3KJYA 4PX1A 2P31A 2GZZA 4K7OA 5ID2A 1PA3A 4MF5A 2HLSA 1X5CA 4ECJA 4OCEA 1FG4A 3BOAA 1TRVA 4D73A 1TRSA 1SKWB 4EC0A 3KMNA 1PSQA 4ZB9A 5B6NA 2LNTA 4XRAA 4XTSA 1ABAA 2OJLA 4BVYA 2TRXA 5IOXA 5ECRB 3TJJA 1X9WB 6GSTA 3EU3A 4KB3A 3UVTA 3KP8A 2O8VB 2DJJA 4ZL7A 2AUVA 3ZVJD 1A24A 4V1Ag 2I1UA 5HR2A 1GSDA 1CQGA 1TK5B 2VCTA 5IIZA 3GKNA 3M1GA 1ZGNA 4NHWA 5KN0A 2GSTA 2WCIA 1VF3A 4MP4A 3ZVJA 3L0HA 5D9VA 1R5AA 5IMVA 5F05A 3GIXA 1MEKA 1XWGA 1PN9A 3GKXA 4XS4B 2YNXA 5DAKB 5DALA 3S9FA 2IJYA 5COHA 2DSAA 3N5OA 1GTIA 1GUKA 1PRXA 4OO5A 4KCEA 1ERUA 2VCZA 2V2GA 3E3EA 3IDVA 2ZCTA 5ENUA 2C0FA 2H73A 2GZYA 3C73A 2OBIA 4LLRA 2WB9A 4WEYA 4PNFA 1JZWA 1ZL9A 2L5OA 3DEXA 2PWJA 2VIMA 3C71A 3MNGA 4GXZA 2DBCA 1SENA 2PMTA 4IN0A 1ZZYA 4KNDA 1WPIA 3FK8A 1PD21 4WXTA 2CAIA 2E7PA 4MPGA 1E2YA 1FB6A 2H0GA 3LORA 3TCOA 5C00A 14GSA 1Z7PA 4HOJA 4KDXA 2WDUA 1TI1A 2B3SA 1B9XC 2K6VA 4ZBDA 5IPHA 2YWIA 1M7TA 2LNSA 2XBQA 3KH9A 2KP2A 3GFKA 2IL3A 3FEUA 1SJIA 2OE3A 2K8VA 1YKAA 5CRGA 1GULA 2VO4A 5FT3A 2KUCA 4N10A 4MF7A 2ES7A 1FHEA 11GSA 1HD2A 3FZ9A 3VPTA 5GAND 1GTBA 5E59A 1X9SB 4JR4A 3VWVA 1EWXA 2HRNA 5CYYA 4IS0A 5F07A 5ECLB 5A4VA 2B5XA 2MBTA 2VD1A 4IJIA 3GTUA 4IP6A 2LQQA 9GSSA 2YWOA 4LMVA 5DQYA 3D0ZA 2FLSA 4GQCA 3HZ4A 4GCIA 4ZB6A 1EGRA 2K18A 5ECNB 4N0VA 2PPTA 1OYJA 2NVLA 4YAVA 2LRCA 3EURA 4WF4A 3GN3A 3N9JA 1RW1A 2HYXA 3EMXA 1JHBA 2IMEA 1X5DA 2YWMA 4XRDA 1XW5A 3U5RE 2A4VA 1GSUA 3G7YA 2J23A 1U88A 2RIIA 4ILFA 1AW9A 5AIVA 1G7EA 2LJAA 3Q19A 3EC3A 2HSYA 4WF5A 1B4QA 5CRWA 2WRTA 1M99A 4MF6A 1VF2A 5E4WA 1O8XA 4G2EA 1XFLA 3QFAC 4CDOA 1TXXA 19GSA 2IIYA 2P5RA 2CX4A 1GLPA 2PU9C 5F8BA 3Q6OA 2REMA 3HJPA 2YV9A 1EV4A 5J3RA 2JZSA 4PGTA 2EC4A 2C0GA 3KIJA 2VM1A 4XIHA 2J9HA 4TR1B 2K8SA 3HDCA 4EDZA 5KEJA 3IBHA 1PGTA 4KE3A 4CW9A 4K1FA 4I5QA 1OE8A 4I2TA 1HNBA 1OC8A 4EKZA 4YQVA 3NIVA 1ZYEA 3MAKA 3DVXA 3TKSE 2FWHA 3LFLA 2IFQA 5IMFA 3UL3A 3TJGA 3F6FA 1SJ6A 1JFUA 2MMZA 3VLNA 3L4NA 4NAXA 3D4MA 5DBQA 2R5GA 5F06A 1TTZA 4KUNA 5IMZA 4ECIA 4N11A 2NDOA 2YJHA 3EWLA 4N30A 4BA7A 1MDKA 3WGDA 4NMUA 2FA8A 3F3RA 3ERFA 1GUMA 2ON5A 4JR6A 2H1GA 5IM9A 1K0DA 4TRXA 1Z6NA 2VL9A 2H19A 3F4RA 1S3DA 1EEMA 2GQLA 1TRWA 3QMXA 1NHOA 1THXA 4OFMA 3L9VA 3RPPA 3DGQA 4ISDA 4MJAA 3IHQA 3ZZXA 4OMVA 3E0UA 4RQXA 3NOFA 2FY6A 4MZBA 4H86A 2FA4A 5G1KA 3TB2A 1K0AA 1DE2A 1V58A 2K9FA 1SYRA 1ERTA 10GSA 3TJKA 2A2SA 5GSTA 4FYUA 3QAVA 2AHEA 1TJDA 5KN2A 3D4TA 4GRFA 1S3AA 4TXOA 3ZIJA 3KXOA 5IOWA 2C3TA 2H6XA 1A0FA 2YCDA 4I8BA 3E9JB 2WZ9A 2P5QA 2CQ9A 3QPMA 4CHSA 3V1WA 5EPFA 1GSFA 2IMFA 3MDKA 2R3XA 4EE0A 2YN1A 3HA9A 1F3AA 2FWEA 1YEXA 4K6XA 4KX4A 3VI5A 4BWSA 2X8HA 3F63A 3GKKA 2VL2C 2ON7A 5KN1A 3PINA 2CZ3A 3GSSA 1LJRA 2JACA 5J9CA 3RHBA 1LBKA 2GTUA 1K3LA 1CQHA 4ZBBA 4TVEA 1N2AA 4POKA 2HZEB 1Q4JA 2CV4A 1B9YC 3M9JA 4RI7A 4LL4B 1T3BA 1SK0A 2V6OA 4ML1A 1TU7A 4ZXGA 3WT1A 1IYHA 2D2ZA 3W8SA 4HZ2A 4PQ1A 1OC9A 1H75A 6GSVA 1O73A 4QL9A 1XW9A 3HXSA 4LMWA 2LV3A 4EO3A 3QDNA 4TR0A 2F3MA 1ZYQB 4ZB8A 3ZITA 4MMMA 2H72A 2VOCA 3PR8A 2O87A 2F8FA 4OCFA 2MMAA 4HDEA 1BYEA 2BTOT 2MMOA 4J56E 5DCHA 4ECCA 1AUCA 3TOTA 4AF2A 3DRNA 3O6TA 3QOUA 2DJ2A 3CBUA 5EVOA 1XVQA 3VI7A 3FRCA 3I43A 4V2LA 1R26A 4F03A 1PMTA 2CVKA 1ON4A 3CRUA 3HVSA 4POMA 2DJ3A 1EOGA 3UBLA 2H1AA 3GA4A 3QD9A 1XBSA 3HHVA 4XS6A 1G7OA 3R2QA 3LYKA 2B1KA 3CYNA 1EP8A 1WE0A 2BJXA 4XS1A 2YV7A 4ML6A 3C1SA 5GAPD 5J41A 3QAGA 1ACVA 3QCPA 1SYXA 1QFNA 3VPQA 1MDIA 1K3OA 5AGYA 4AJ6A 1TKDB 2FUG2 5C04A 2V41A 4DSSB 4RUVA 2H66A 1UVZA 4BWQA 3A3TA 4F82A 2BMXA 1GP1A 1SK2A 2EIRA 2LKUA 3WD6A 2H74A 3K8NA 5H5QA 2HT9A 2AAWA 4DEJA 3US3A 1BX9A 1A8YA 3CMIA 1YY7A 1TU8A 3TRPA 5IMAA 4ZIJA 2L6CA 2OE1A 2G0FA 1FAAA 2L4QA 4Z7XA 1EOHA 1FW1A 1I9DA 2FGXA 2QGVA 1FVJA 1E6BA 1TRUA 4KDUA 3GYKA 4MJBA 2NTOA 1UA5A 2IWTA 5CRHA 4OWYA 5CNWA 1WMJA 3RDWA 5ECIB 1BG5A 2C4JA 4GQFA 1OC3A 1QQ2A 4OFTA 1X9MB 3I69A 4O32A 17GSA 2H75A 1T1VA 3MWHA 3GUSA 1GSSA 5JCUA 4KGIA 3SBCA 2JU5A 3L78A 4L5LA 1F9MA 1ZOFA 4JEDA 1T4ZA 4X1UA 2PVQA 2AYTA 5CRDA 3KCMA 4XS4A 4L8EA 5DAKA 3RHCA 4MK3A 3RPNA 2VCQA 3TRXA 2OE0A 4I2UA 2FNOA 5HR0A 2B7JA 1J0FA 4PXOA 4AJ7A 3DVWA 2R6KA 5GZZB 3GKMA 4ZILA 1J9BA 2HNLA 2F9SA 5ECQB 4O5RA 4OFNA 1XOBA 3NZNA 1RQMA 1JLWA 3TDGA 1GSYA 2V32A 1GNWA 2IMIA 1YQ1A 2C3NA 5IMCA 2RUFA 1K0CA 2X8GA 1SJZA 4YQUA 4POLA 3U6VA 4EF0A 5IMDA 2VL2A 4J2FA 3M0FA 2AJQB 3ZFBA 3PGTA 2MBSA 2GSSA 1I5GA 4FYCA 1SL1B 1S3CA 4TR3A 1KNGA 2R4VA 2GZPA 3HD5A 1GNEA 1AQWA 2WS2A 4WBJA 1R5PA 2TIRA 5B8BA 1QMVA 1TDIA 3EE2A 4JE1A 1JLVA 2JL4A 3G7IA 1YEPA 2HI7A 1FB0A 3M3MA 1EV9A 2AB6A 4IP1A 2LJRA 2LS5A 4G9HA 4K9ZA 4EDYA 3P7XA 3KH7A 4POBA 2YWNA 5CAXA 2ALBA 1TW9A 4RQRA 3D5JA 2H6ZA 1XIYA 4AGSA 7GSSA 3EYTA 3UIWA 3M8NA 4XHMA 3IA1A 5INYA 2I4AA 2XC2A 1PKWA 12GSA 3DXBA 1XPVA 1AC1A 3FHKA 1A2JA 4OD7A 2VCWA 4PURA 3KD0A 4MZCA 4FH8A 4LL1B 3IAM2 4O92A 5H5RA 5LNKe 3AY8A 4Q5NA 4JBBA 3F8UA 4JZQA 2I9HA 4TN8A 2M72A 2L57A 4IQAA 3UJ1A 1V57A 4TOPA 5D96A 4BL7A 1MDJA 3FZAA 4NV5A 3L9UA 4NWYA 2DIZA 5J4UA 1PX6A 2G2QA 2O85A 6GSUA 2KHPA 4YQMA 4G19A 4DVCA 2FD3A 4JRRA 3ZREA 3UEMA 2M46A 4K7IA 1QXHA 3ERWA 3TUEA 2C80A 1Z9HA 4PNGA 1T8EB 2VM2A 1ZCPA 5DQSA 1PX7A 5CO3A 3M9KA 5ABRA 20GSA 2GT6A 1SK1A 1AXDA 3D21A 4ZL8A 4GSTA 1F3BA 4O7HA 4I6XA 6GSSA 2RLIA 1O8WA 3WYWA 1WJKA 1FOVA 1THOA 4TR1A 4MCUA 1G0TA 3KEBA 3J7Yk 2B5EA 2YZHA 5DJLA 3TKQA 6GSXA 3IXRA 1USBA 2VLUA 2X64A 1JZDA 1VGLA 2OA7A 2GDRA 3LWAA 2P0GA 4N0ZA 2DMLA 2XPDA 4HJMA 2JADA 2VCXA
chains in the Genus database with same CATH superfamily
2IPAA 1D6YA 2LYXA 1XXUA 2LQOA 1WWJA 3GURA 2BNGA 4EV5A 1DBYA 3F7XA 1U3AA 5ELGA 3ZFLA 3GMFA 1UC7A 1G6YA 1W89A 1MGWA 1RTUA 2GQMA 5LCZA 4DSQA 4ACSA 3TKSC 1S5AA 1BNFA 2Y74A 3QAWA 2PERA 3ZRDA 4Q5QA 1VRSD 2IY2A 2V6KA 3IAS2 5IG5A 1ERVA 3FY7A 3LQ7A 1US1A 1RN1A 2WOHA 4L8PA 5IF6A 1EA2A 1AAZA 5D8IA 4HZ4A 4TR4A 1ILOA 1RN4A 5IEOA 1N8JA 1O6JA 4NV2A 1HU9A 3FR6A 4PQIA 4Q5RA 3SVAA 2R2JA 1I2GA 3DYRA 3F14A 2DJKA 4F2IA 3FF0A 4TXVA 1CYVA 3KP9A 2DJ0A 2H0IA 3KZTA 2C0EA 6GSYA 2VL3A 3GL3A 3URPA 2CFDA 1BOXA 4K90B 2YOIA 1SARA 2GSRA 1XWAA 1JKGB 3P2AA 5LC7A 2M7OA 3BCKA 3WT2A 5CREA 3F9UA 1HKXA 2IUKA 4FYBA 4MDCA 5EL8A 4GLTA 3C8EA 3CXGA 3HYPA 5G2ZA 1FGQA 3EX9A 4PUFC 2EIQA 3PCRA 3CU3A 1RCLA 3LYPA 2C11A 2XSHB 1B20A 1Z7RA 5LD0A 5B8AA 4X0XA 2BT3A 1BRIA 1ULJB 1BAOA 3G8ZA 1FGMA 2DLXA 1M2AA 2CC3A 2XSOB 3ED3A 3ER7A 4BL2A 2UZ8A 4NHZA 3IE3A 1GD3A 4FO5A 13GSA 2H6YA 1W2ZA 3N54B 4DKIA 1RGLA 5JBSA 3ZL5A 3VURA 3LXZA 1C7HA 5F0GA 2WOFA 4N6MA 1BQ7A 3FR9A 4I97A 3PGBA 4U13A 3X42A 1NB5I 5HFKA 3F3QA 8CHOA 1EGOA 2HE3A 4MPFA 4NREA 1QALA 2AV4A 4LYLB 3HZ8A 4WBRD 3IC4A 1ZMAA 2XRXB 3PH9A 4O5UA 1RGKA 3AMOA 1WIKA 1YZXA 4IELA 3UARA 1BJXA 5B6MA 4R9KA 3D3LA 1WOUA 3AGOA 5D9WA 1ZX2A 1BUQA 4IKHA 4YAPA 2XBIA 5JCWA 1IYYA 2LRNA 3BBYA 2B1LA 1NHYA 2VAFA 1RN7A 3EF8A 4R1KA 2HZEA 4NPBA 3WGXA 5ELAA 5G5FA 1B2UA 2FWGA 1UN2A 3NM7A 2JQ5A 3IV4A 3VFIA 2P0XA 4E8EA 1VQM3 3UNLA 2GGTA 2C10A 3A2WA 1YI23 1V40A 5A4WA 1RRLA 1W01A 5KP1A 3EU4A 4E8HA 1IT8A 2GT5A 3ZTLA 4N6LA 1U3IA 3BNBA 3CQFA 3KTLA 4KCAA 4EXRA 5IO0A 2TRCP 4D73B 2QA2A 2K0MA 1B3SA 1K28A 1TI3A 2BMQB 5D9XA 3EINA 3DZLA 4BVYB 3DKSA 3W8JA 2GXFA 2WGRA 3APQA 4ULXA 3I0YA 3LOYA 2M80A 3ME7A 1BSEA 1RGCA 3LZAA 4CDLA 4OK0A 2IYJA 1YDKA 1OE7A 1B27A 1UCKA 2DMMA 2E2UA 3G9BA 4KT3B 2NBSA 2L1SA 4HQZA 5JCGA 2J8XB 2HMKB 3FKAA 1IQXA 5AYRB 3CCV3 4BIKA 2DJ1A 3H8QA 4MA9A 1JZRA 2R0GA 3UOMA 4HM5B 2VD0A 1HNAA 5A0OB 1EEJA 1M9AA 3RAZA 4PUAA 5AI1A 1K0BA 1F37A 2PVOC 3LJRA 5D9TA 1AQXA 5J5NA 3WHOA 5DVBA 4MJEA 4L5OA 3SOYA 3GSTA 3CSIA 3HY2A 1ERWA 3LXTA 1YGWA 6STDA 4YKGA 4V2NA 3UJMA 2DC5A 3HVVA 1SKRB 5DALB 4AJ8A 1KSIA 1R4CA 1JZOA 1XWKA 2HSHA 4MJDA 2X4AA 2I3YA 1AIUA 3HCZA 4LSOA 2LRTA 5IG0A 5CP1A 3L9SA 4FMBA 1VQO3 2RM5A 2GLRA 5A4UA 1NWWA 3AHWA 1NSWA 1OACA 2C3QA 1C54A 1ULIB 3VF1A 3FZ5A 1DE1A 2KXGA 1PKZA 3FG4A 3GX0A 4MNNA 2OQEA 5HFGA 3WMDA 4DSSA 1OAZA 4O02B 4GB5A 2DIYA 2RUEA 2JSZA 1GUHA 5AEUB 3GSPA 4KW6A 3HJOA 1A2VA 1VQP3 3D6IA 2CFGA 4RNTA 3NBJA 2GQKA 4BVXA 1G02A 3P90A 3LTDA 3V98A 2YPMA 2QA43 1NNVA 1URMA 4JU5A 4FMDA 3J7Yb 1Q864 1K734 1VQN3 5KOXA 1XZOA 3HOHA 2R0PA 2A2PA 2JSYA 4LA1A 4KSOA 3T8NA 2W6JH 4IJ3A 3MG3A 7RNTA 3APSA 1MNLA 4J57E 1BU4A 1K3YA 3S5CA 1GOYA 2KP1A 3OWSA 1M2DA 2A2RA 4YKFA 1IV9A 3KE7A 1FYSA 4MZWA 1KEBA 2PUKC 4NHFA 1U87A 1YF1A 1SL2B 3TKRA 1KWIA 4EIQA 1LQMB 3R3EA 1W6CA 7STDA 5LC6A 5GSSA 1LVNA 1GTUA 1R4WA 1AV4A 4G0LA 1B2ZA 1Q98A 1B2MA 3TKSA 1G6WA 3D5IA 3IOSA 2FWFA 1J2BA 1N5PA 3FZ4A 1K0NA 3RNTA 4MMXB 22GSA 5ECOB 1RK4A 3I9V2 4X43A 2CK3H 3VWUA 1SD8A 4WR4A 2CX3A 1W7CA 3HIGA 2WGOA 1F6MC 2N5BA 2QGUA 3CC43 4KH7A 1STDA 2H1BA 3ZIVA 1Q824 3K63A 4K0GA 3A2XA 3SOAA 4EIPA 3SX1A 3NHXA 1T7PB 3UMAA 4HVNA 2A15A 3A5WA 2CW9A 3C1RA 1A0RP 3LTCA 1GH2A 3GTUB 1SQWA 4O2HA 4Q5FA 1F2EA 1ST9A 1MTCA 3I6AA 3IK7A 3EBYA 2F86B 2V1MA 3SLUA 3KGKA 4H3UA 5HFIA 1RMSA 3UBKA 3FLJA 1M0UA 1WTHA 2FHEA 5M1AA 5IEPA 2C1YA 1K41A 2WJUA 3WGEA 1JRQA 3H93A 1XWCA 4K0NA 4K7NA 2L59A 1WRYA 2GSPA 1VF1A 1PY3A 4A5PA 1DSBA 1EZKA 2YJ7A 1BRJA 1Z3EA 3UL5A 5TGNA 1JB4A 2IUJA 3O8YA 4WR5A 1A2PA 3GAXA 3DGLA 1YKCA 4MJCA 3BB9A 3DMLA 1LOXA 5DREA 1ZYPA 3F4SA 3JCML 2KLXA 1BAYA 3S28A 3WA2X 1OH0A 1SIHA 3CTGA 1UI8A 4GWRA 1W6GA 3CRTA 4ZBAA 2JZRA 2P05A 3ZMKA 2CVBA 4YH2A 2YZUA 4X4JA 3W6GA 1EP7A 4HBRA 2E2MA 4XB5A 4XCSA 3EN8A 5AN1A 4IGJA 5JWOB 2LUSA 1YIJ3 3H79A 2FGTA 2B6MA 3K5TA 3F0IA 3PCSA 4IHUA 1X1UA 1PL1A 1SKSB 2C0DA 1RGEA 1Z6MA 1A2MA 4BU4A 3GX8A 3IPZA 1B48A 5JWRB 4KVHA 3O76A 3H4KA 4GF0A 4EXJA 1SD9A 3OR5A 2C4BA 2VLTA 2H30A 5D73A 6GSWA 1MD4A 3IHGA 1ROAA 2HRFA 1FGTA 2N5AA 3VWXA 3PZWA 1Z5YE 1IVWA 2R37A 1XWBA 1GL8A 1N5HA 1O7MB 1MWSA 2F99A 3MWZA 5JWQB 3IR4A 2B5YA 4NXIA 3EMPA 1I3FA 1NO3A 2KF6A 1UCLA 16GSA 1IV7A 2L5LA 2XHFA 3BD2A 3QR6A 1U6TA 4HS1A 3C7MA 3TRQA 2CVDA 3DD3A 3FMWA 3A2VA 3M8CA 2BMOB 5M19A 1BGSA 5D82A 1TTOA 5FWGA 3TJBA 1BNJA 2O7KA 1BUJA 3ME8A 4V2MA 1Q7Y4 2L4CA 4ID0A 3Q74A 3V99A 2F5WA 1O81A 2XF3A 3HKRA 4RI6A 4HQSA 3GL5A 3JUPA 2JZTA 3GZBA 5ECPB 3VWWA 1MOLA 3KZQA 3IK9A 4GHOA 1QAKA 1RNTA 4HOHA 1PN0A 3D22A 4KSMA 1GLQA 1TOFA 5B7CA 3CMA3 3TJFA 1HQOA 5IPGA 2I81A 3CSHA 4BTYA 4HJ2A 1OVNA 1WQLB 2JADA 3NM2A 2HFDA 2D42A 1FO5A 2IFQB 5DJMA 1VZZA 2GS3A 1BNGA 4FMAA 2PBJA 5IQYA 4X2HA 5L71A 3HIIA 2E2TA 1M9BA 1SL0B 1W4VA 3SWLA 3ERGA 1T4YA 2QSIA 1NM3A 3LSZA 2DKHA 5JPPA 3FYGA 1XVWA 1JV2B 5CXOA 5KN3A 4FCZA 4HM1B 1SU9A 4BIRA 4HI7A 3FG3A 4IW9A 5HOHA 1ZGXA 2CT6A 4MH3A 3G7JA 3EVIA 4GTUA 4QQ7A 4KFDA 1GS3A 5ECMB 2VLVA 2E0QA 4TX4A 1HNCA 3MHEA 3WR2A 3F6DA 3F4TA 3LW9A 2MYGA 4WETA 2CHCA 1BANA 2E2GA 2F8AA 4OO4A 1E3VA 1TP6A 5H5SA 3EJVA 4L0UA 3LEFA 4KDYA 1GRXA 3LGCA 4IBPA 2N5FA 2KAAA 4KZ1A 4F0BA 3MG1A 18GSA 4MH2A 5EY6A 2GVPA 5ECSA 2OQEC 4IQ1A 3UVHA 5HQPA 3DIEA 3FGYA 4J5KA 1YJW3 2NPBA 3KSPA 1QK8A 4G10A 4F0CA 2Z6BA 4EL1A 3G0KA 8GSSA 3QFBC 3ECFA 3LTAA 3ISOA 1TK0B 2HSMA 2YP6A 4N6NB 5G31A 4WWUC 1A8LA 3KMOA 3KTBA 3RGAA 3GNJA 3SYUA 4XBYA 4WP5A 1VF4A 1X5EA 5FHIA 4KA0A 2C8UA 2X99A 1YF0A 1RGFA 2KCDA 3G16A 4ORLA 2WFCA 2IMDA 3WDGB 3IRAA 2PZVA 2P09A 4N6TA 5EEOA 2CZ2A 2E2VA 5G1LA 3APOA 2GEXA 2HXKA 4HU9A 3UAPA 4BTWA 3TOUA 3N9HA 4TXOB 4BPYA 1W4NA 4K2DA 3ZMLA 3MSOA 1WP0A 1Q814 4IVFA 3CPW2 1IVXA 4QL7A 1OF5B 2OTJ3 1ML6A 5IO2A 5AISA 1UW1A 1V9WA 2L6DA 3GV1A 1GTAA 3IJEB 3EHCA 3GH6A 2H8LA 2HRKA 2QC7A 5ECHB 4L0WA 5A5KA 3KKGA 2HMNB 2VUPA 3NV0B 4XBXA 2OBKA 1EQKA 3NQYA 2RFRA 2QKEA 5G2GA 3B8LA 3FSDA 1T5YA 1A2KA 5JPUA 1K0MA 1GOUA 1OKTA 3P8WA 1NW2A 3ZLPA 2UUGC 2RNTA 1OKDA 2FCHA 1Y6EA 4K8MA 1TK8B 3BCIA 4KFEA 2OACA 1Q42A 4EVMA 1BSBA 4RBNA 1DUGA 4AKZA 4WHAA 3TGZA 2H76A 3GRDA 1DVDA 3CSJA 1C72A 3O3TA 1H4OA 1PQNA 5AIXA 1OF5A 1I2EA 1YNVX 1F8NA 3A76A 2O89A 2H1DA 4HUAA 4USSA 1TRQA 1O7UA 4K2XA 2LJKA 4ZL9A 2H70A 1GSEA 2Z77A 1M3JA 3H1NA 2B7KA 5G5EA 1G96A 4GL6A 3I553 1KTEA 1RLSA 1O7PB 2YANA 1OC9B 1ASKA 2W56B 1HYFA 3GZXB 2EIOA 1MWUA 2MZCA 1RRHA 2IMKA 1R4YA 2BMRB 4CY6A 1LOYA 1ZS7A 4FIWA 1B4PA 1HYUA 4P3YB 3QK9A 1WMNA 1GWCA 3FKFA 4WFOA 5BMUA 1BEDA 2CIUA 3KIIA 5J9BA 3A5IA 3RBTA 1V2AA 3G6E3 1LXEA 4TW5A 5CF2A 3LT8A 4WYKB 5G30A 1FZUA 4HYZA 5HR3A 2VCVA 1JKGA 1BSCA 1W2B2 1M2BA 3FF2A 3TKPA 1FVKA 3HVXA 2F51A 4ECBA 3GH9A 1GMPA 1CYUA 1YJ6A 2X49A 1XCCA 1TP9A 2XEPA 4KAEA 5D93A 4EUYA 3JVCA 4HU7A 1MGRA 1Y25A 1R7HA 3DWVA 3CXC2 2H71A 2ML5A 2LTKA 3DGNA 3HZPA 1QUWA 3MSZA 2HZFA 2FNQA 2AADA 5DCGA 4HEA2 2RBIA 2PN8A 2ZUPA 3HK4A 1BRGA 1XW6A 3ZG0A 3KM6A 3ZYWA 3DGYA 1Y4KA 2OTL3 2PGTA 4GSSA 4F9ZA 3Q18A 1JBSA 1IYIA 3X3ZA 3SEDA 2CA8A 2F5MA 1IK3A 3HJMA 2H0HA 1X0RA 5HR1A 3FR3A 5DDLA 1TUHA 4RNZA 2LSTA 4WYKA 5ECKB 2MC8A 3LG6A 2SARA 1IQYA 2RM6A 1T00A 2Z9SA 2X8CA 1ISKA 4HZ9B 2B24B 2CAQA 1AQVA 3F8HA 3MG2A 3BJ5A 3GHAA 1K0OA 4MLYA 5ID2B 4N3VA 1BRHA 1I70A 1J08A 2KOKA 4PQHA 4GSNA 2LEGA 4ICYA 4WKWA 4MABA 1M3IA 1QGVA 1EUIC 2HMLB 1PL2A 1PU4A 1B8XA 3CTFA 1KBNA 1V98A 1GSQA 2XPEA 1GMRA 2OKAA 3VK9A 3GRXA 1MD3A 1XOAA 2OADA 1O85A 2DKIA 1JB5A 2ZNMA 4MMZB 1BIRA 3LTBA 3DGMA 3CD63 1VQ83 3S67A 3KCHA 2WULA 3K0ZA 4LMIA 4RNYA 3EBTA 3WOFB 3FW2A 3Q90A 1LU4A 2GSQA 2IN3A 2H01A 2MMNA 3OW22 4V1Ap 4DSRA 1A23A 3EB8A 3UL6A 3X40A 5CF1A 1A2LA 3F9SA 4TKYA 1OCVA 3KJYA 1VQL3 1UGHI 1D6ZA 1S3RA 4K1VA 4PX1A 1JN5B 4HAAA 2P31A 4K5SA 2GZZA 4K7OA 5ID2A 2CG0A 1PA3A 3KSED 4STDA 4MF5A 2HLSA 1X5CA 4ECJA 4OCEA 3F40A 1FG4A 3BOAA 1TRVA 4D73A 1TRSA 1SKWB 1T2HA 4EC0A 3KMNA 1PSQA 1N9JA 4ZB9A 5B6NA 5D81A 2LNTA 4XRAA 4XTSA 1ABAA 2OJLA 4BVYA 1YJN3 2TRXA 5IOXA 5ECRB 2LQVA 1AVLA 3TJJA 2W9QA 1X9WB 6GSTA 3LYGA 1WMOA 3EU3A 3EN1B 4KB3A 3UVTA 3KP8A 2O8VB 3Q2PA 2DJJA 3BNDA 2KRTA 3BLZA 3OV4A 4ZL7A 3JUNA 2AUVA 3ZVJD 1A24A 4V1Ag 1K8A4 2I1UA 5HR2A 1GSDA 1CQGA 1TK5B 2VCTA 5IIZA 3GKNA 3M1GA 1ZGNA 1M1K4 1VQ53 4NHWA 4OVMA 5KN0A 2GSTA 1FOHA 2WCIA 1VF3A 4MP4A 3ZVJA 3L0HA 1RDSA 3J7Yd 5D9VA 1R5AA 4EYCA 5IMVA 5F05A 3GIXA 1MEKA 1XWGA 2HMJB 1PN9A 5FGOA 1WMPA 3GKXA 4XS4B 2YNXA 3T0UA 5DAKB 5DALA 3S9FA 2P0MA 2IJYA 3EC9A 1IVVA 5COHA 1Q40B 4QWTA 1RCKA 2DSAA 4XDVA 1DE3A 3N5OA 1GTIA 1OPYA 2IA7A 1GUKA 1PRXA 4OO5A 4KCEA 3CCQ3 1FUTA 2R41A 1ERUA 3CCU3 2V2GA 2VCZA 3E3EA 3IDVA 2ZCTA 5ENUA 2C0FA 2H73A 2GZYA 3C73A 4Z2RA 2OBIA 4LLRA 3DY5A 4HM7B 4G0KA 2JDIH 5BU4A 2WB9A 1YJ93 4WEYA 4PNFA 1JZWA 1Q7HA 1ZL9A 2L5OA 3DEXA 2PWJA 4O3VA 2VIMA 3C71A 3MNGA 3CCR3 4GXZA 2DBCA 1SENA 2PMTA 1UGIA 4JF8A 4IN0A 1ZZYA 4KNDA 3NX0A 1WPIA 3FK8A 1PD21 5GSPA 4WXTA 2XGLA 2CAIA 1GD4A 3NQZA 2E7PA 1UUGB 2B1XB 4MPGA 1E2YA 3D9RA 1FB6A 2H0GA 3LORA 3TCOA 5C00A 14GSA 1Z7PA 2R0CA 4HOJA 4EC6A 4KDXA 2WDUA 2CWUA 1TI1A 2B3SA 1B9XC 2K6VA 1BRKA 4ZBDA 2YWIA 5IPHA 4LGQA 1M7TA 5ELJA 2LNSA 2XBQA 1RKYA 3KH9A 3QRDA 2KP2A 3GFKA 4Q53A 2IL3A 3FEUA 2CKFB 1SJIA 1VQK3 2OE3A 2K3DA 2IMJA 2K8VA 1YKAA 5CRGA 1GULA 3H51A 2VO4A 3JUQA 4R80A 4KF9A 5IERA 5FT3A 2KUCA 4N10A 4MF7A 3CCM3 2ES7A 1FHEA 11GSA 1HD2A 3FZ9A 3STDA 4ZXGA 5AIIA 3VPTA 5GAND 1GTBA 5E59A 1X9SB 4JR4A 3VWVA 1EWXA 2HRNA 5CYYA 2YX9A 1ROVA 4IS0A 5F07A 5ECLB 5A4VA 1FGOA 2Z76A 2B5XA 2MBTA 2VD1A 4IJIA 3GTUA 4IP6A 2LQQA 9GSSA 2YWOA 2BO9B 3RDEA 4LMVA 5DQYA 3D0ZA 3JUOA 2FLSA 4GQCA 3HZ4A 4GCIA 4G1MB 4ZB6A 1EGRA 2K18A 5ECNB 1O7NB 4N0VA 2PPTA 1OYJA 2ZL8A 2NVLA 4YAVA 2LRCA 3EURA 4WF4A 3GN3A 1DYUA 3N9JA 2XH9A 1OHSA 1RW1A 4HKVB 2HYXA 3EMXA 1JHBA 2IMEA 1X5DA 2YWMA 4XRDA 3CNXA 1AVKA 1XW5A 1L5GB 3U5RE 2A4VA 1GSUA 3Q3FA 3G7YA 2J23A 1U88A 4BL7B 3WODG 5DRVA 4ILFA 2Q07A 1AW9A 2RIIA 5AIVA 2LJAA 1G7EA 2F56A 3DGOA 3Q19A 1N8R4 1PFOA 1I0XA 3EC3A 2HSYA 4WF5A 1B4QA 5CRWA 4HM8B 1IT7A 2WRTA 1M99A 4MF6A 1VF2A 5E4WA 3RGRA 3BU4A 1O8XA 4G2EA 1LOVA 1XFLA 3QFAC 4N6UA 4CDOA 3CC23 1EG9B 1W6YA 1CH0A 1TXXA 19GSA 5KP3A 2IIYA 2YFLB 5CK6A 3CCL3 2P5RA 2CX4A 3CCS3 1E97A 1GLPA 2PU9C 5F8BA 3Q6OA 2REMA 3HJPA 2YV9A 5BVBA 1EV4A 5J3RA 2JZSA 4PGTA 1TRPA 2EC4A 3X3YA 1RGGA 3ROBA 1RNBA 3MYTA 2C0GA 3KIJA 2VM1A 4XIHA 4HJLB 3GZYB 2J9HA 4TR1B 2K8SA 3HDCA 4EDZA 2OOVA 2ML6A 1FUWA 1PGTA 3IBHA 4KE3A 5KEJA 4CW9A 1W02A 1M904 4K1FA 4I5QA 1OE8A 1FGRA 4I2TA 1HNBA 1OC8A 4EKZA 4YQVA 3NIVA 1OGXA 1K9M4 3K7CA 1ZYEA 5KOWA 2PNCA 3MAKA 1U5OA 3DVXA 1I8VA 2CWTA 5IW9A 3TKSE 2FWHA 3LFLA 2IFQA 2RSXA 3GWRA 5IMFA 3HX8A 3UL3A 3TJGA 3F6FA 1SJ6A 1JFUA 2MMZA 3VLNA 3L4NA 4NAXA 2W03A 1PFPA 3D4MA 1CEWI 1IDPA 5DBQA 3V92A 2R5GA 5F06A 1TTZA 4KUNA 4OUQA 5IMZA 4ECIA 4N11A 2NDOA 2F4YA 2YJHA 3EWLA 4N30A 4BA7A 3CNMA 1MDKA 3VSYA 3WGDA 1Z1SA 1DMMA 1KQS2 4NMUA 8RNTA 5CLKA 5IG3A 2FA8A 3LMLA 2A4HA 3F3RA 3ERFA 4HM2B 1GUMA 1N8QA 3EPTA 2ON5A 4HM6B 4JR6A 1RHLA 2H1GA 4K61A 1O7WB 5IM9A 1K0DA 4TRXA 4XBTA 1Z6NA 2VL9A 2H19A 3F4RA 1S3DA 1EEMA 2GQLA 1TRWA 3QMXA 4IIAA 1X1XA 2Z7AA 1NHOA 1E3RA 1THXA 3X3XA 4R4KA 2OWPA 4OFMA 3L9VA 2GEYA 2CWVA 2D1WA 4BTXA 3RPPA 3DGQA 4ISDA 4MJAA 3IHQA 3ZZXA 3S29A 4OMVA 3E0UA 3OWYA 4RQXA 2W2CA 3NOFA 3N8BA 2FY6A 4MZBA 1MWRA 4H86A 2FA4A 5G1KA 3TB2A 1I2FA 1K0AA 1DE2A 1V58A 2K9FA 1SYRA 2KF3A 1ERTA 10GSA 2BHMA 2A2SA 3TJKA 5GSTA 4FYUA 3OXAA 1BRSA 3QAVA 5EVHA 1BNIA 3K9MC 2KF5A 2AHEA 1DMNA 1QJGA 1TJDA 5KN2A 3D4TA 4GRFA 1S3AA 4TXOA 3ZIJA 1S723 3IC8A 3KXOA 4EBGA 4FR9A 5IOWA 2C3TA 2H6XA 4O8SA 1A0FA 1IVUA 2YCDA 4I8BA 3E9JB 3DM8A 2WZ9A 2P5QA 1STFI 1VQ43 2CQ9A 3QPMA 4CHSA 3V1WA 1W00A 5EPFA 1GSFA 2IMFA 3MDKA 2R3XA 4RZMA 4EE0A 2YN1A 3HA9A 1F3AA 2FWEA 1YEXA 4K6XA 1YIT3 4KX4A 3VI5A 4BWSA 3NV0A 2X8HA 4CPKA 3DMCA 2GU1A 1TFKA 3F63A 3GKKA 2VL2C 2W0QA 4Z2TA 2ON7A 5KN1A 1UCJA 3S27A 4PEJA 3B7CA 3PINA 3DH2A 3WOEB 2CZ3A 1A67A 3GSSA 1LJRA 3NUVA 2JACA 1BNRA 1O7GB 3AMOB 4XM4A 2QEX3 5J9CA 3LH4A 3ALAA 3RHBA 1LBKA 2GTUA 2KF4A 1K3LA 2QIYA 1CQHA 1VQQA 3PYJA 3Q1CA 3MPHA 4ZBBA 4TVEA 1N2AA 4POKA 1OHPA 1M9GA 2V1LA 1SPUA 3CCJ3 1Q4JA 2CV4A 2HZEB 1B9YC 3M9JA 1KC84 4RI7A 4LL4B 1T3BA 1VQ93 1SK0A 2V6OA 1LRAA 1BSDA 1TU7A 4ML1A 1IYHA 5I97A 3WT1A 3EQQB 2D2ZA 3W8SA 4N6V0 1JB2A 2MF7A 1BSAA 4N6OB 4HZ2A 1FA3A 4PQ1A 3AGNA 1OC9A 1H75A 6GSVA 2W56A 1O73A 4QL9A 4LZIA 1XW9A 3HXSA 4LMWA 2R4IA 4MEIA 2LV3A 4EW5A 2W04A 4H61A 4EO3A 3QDNA 4TR0A 2Y73A 3FCSB 1OHOA 2F3MA 2AAEA 1ZYQB 4ZB8A 3ZITA 4MMMA 2H72A 2VOCA 3PR8A 2O87A 2F8FA 4OCFA 2MMAA 4HDEA 2WGQA 1BYEA 1UCIA 4PTSA 2BTOT 2MMOA 4J56E 5DCHA 4ECCA 1W5ZA 1AUCA 1BNSA 3G713 3TOTA 4AF2A 3DRNA 3O6TA 4LEHA 1NDOB 3QOUA 2DJ2A 3CBUA 5EVOA 1XVQA 3VI7A 1NJI4 3FRCA 3I43A 1GYBA 3AHSA 4V2LA 1R26A 3GZRA 1X1WA 1RGAA 4F03A 3DUKA 3HVNA 1T2IA 1PMTA 2CVKA 1ON4A 3CRUA 3HVSA 4POMA 3B4OA 2DJ3A 2CFKA 1EOGA 3UBLA 2H1AA 3GA4A 2HRAA 1LNIA 3QD9A 1DVCA 1XBSA 3D5GA 1IQ8A 4JRFA 1PYLA 3HHVA 4XS6A 1G7OA 3R2QA 3LYKA 2B1KA 3CYNA 1EP8A 4L8OA 1WE0A 3H3HA 1DETA 2BJXA 4XS1A 2K54A 3G4S3 3NBBA 2YV7A 4ML6A 3C1SA 1ZO2A 1U8CB 5GAPD 1GMQA 5J41A 3QAGA 1ACVA 3E99A 3QCPA 3FG1A 2OOVC 4I4KA 5AIHA 1SYXA 1QFNA 1B2SA 1VQ73 3VPQA 1MDIA 5IG4A 4FCMA 1K3OA 5AGYA 2QA1A 4AJ6A 2W9PA 2FUG2 1TKDB 5C04A 2V41A 5AIGA 4DSSB 5KP4A 4RUVA 3LXUX 2H66A 1UVZA 2F98A 2I9WA 4BWQA 3A3TA 4F82A 4GSPA 2BMXA 1GP1A 1SK2A 5M18A 2EIRA 4BVXB 5AYSC 2LKUA 5STDA 2P38A 4O5QA 3WD6A 2ZDJA 3WA3A 1JJ22 2H74A 4CY8A 1YVBI 1I3IA 4HM4B 5EQLA 3K8NA 3HI7A 5H5QA 4IPBA 2HT9A 1LNHA 1TU5A 2AAWA 4DEJA 3US3A 1RSNA 4K1UA 3KN4A 1BX9A 1M1XB 2BIRA 2CX0A 1A8YA 1YY7A 1SIIA 1YVSA 3CMIA 4J9AA 1TU8A 3TRPA 5IMAA 4XDWA 4ZIJA 4FCJA 2XFSA 3ZG5A 2L6CA 2OE1A 1RGHA 1JN5A 1CQSA 1UUWB 2G0FA 4KFFA 2RCDA 1FAAA 2L4QA 1JNQA 3BNEA 4Z7XA 1EOHA 3VGNA 1FW1A 1I9DA 2FGXA 2GBWB 2QGVA 3X41A 4HM0B 4ZM8A 1FVJA 1E6BA 1TRUA 4KDUA 3GYKA 4MJBA 1XG8A 3NXJA 2NTOA 1UA5A 1DMQA 2CFWA 1QVF2 2IWTA 3MIXA 5CRHA 4OWYA 1WNHA 5CNWA 1WMJA 3RDWA 5ECIB 1BG5A 5ELUA 3A5EA 2C4JA 3F8XA 1AY7A 4K5RA 3U97A 4GQFA 1OC3A 1QQ2A 1MWTA 4OFTA 1X9MB 3I69A 4O32A 17GSA 2H75A 1T1VA 3MWHA 3GUSA 1GSSA 5JCUA 3D79A 4L7KA 4KGIA 3SBCA 2JU5A 3L78A 4CCVA 4L5LA 1F9MA 1ZOFA 4JEDA 1T4ZA 4X1UA 2PVQA 2AYTA 5CRDA 3KCMA 4AEQA 1I0VA 4XS4A 5AIFA 4L8EA 5DAKA 3RHCA 1GY5A 4MK3A 1EKMA 3I563 3RPNA 3IMAB 2VCQA 5BRTA 3TRXA 1Q40A 1D6UA 2OE0A 1BVIA 4I2UA 2FNOA 5HR0A 2B7JA 1J0FA 4HZBB 4PXOA 4AJ7A 3DVWA 2R6KA 5GZZB 2HMOB 1B21A 3GKMA 4ZILA 1J9BA 2HNLA 2CG1A 2F9SA 4AKYA 5ECQB 3KFQC 4O5RA 4OFNA 1XOBA 3NZNA 2FXTA 1RQMA 3TDGA 1JLWA 5FW5A 4R9LA 4BL3A 7GSPA 3D4AA 1GSYA 2V32A 1GNWA 2IMIA 1YQ1A 2C3NA 5IMCA 2RUFA 1GY6A 1K0CA 1SJZA 2X8GA 4YQUA 4POLA 3CME3 1UI7A 2GBXB 1HZ1A 3NBRA 6GSPA 3U6VA 4EF0A 2L4VA 5IMDA 5BXQA 2VL2A 1O7HB 4J2FA 3ZFZA 3M0FA 2AJQB 3ZFBA 3UB1A 3PGTA 2MBSA 3FZWA 1TIJA 2GSSA 3BNCA 3OWUA 2O9UX 1I5GA 4FYCA 1SL1B 1S3CA 4TR3A 1KNGA 2R4VA 2GZPA 3HD5A 1GNEA 1B2XA 1AQWA 2WS2A 4WBJA 1R5PA 2TIRA 3L0RA 5B8BA 1QMVA 1TDIA 1KD14 3EE2A 4JE1A 1JLVA 2JL4A 3G7IA 1FW7A 1YEPA 2HI7A 1FB0A 3M3MA 4HSCX 1EV9A 2HOHA 2AB6A 4IP1A 2XR8B 2LJRA 2LS5A 4G9HA 4K9ZA 4EDYA 5AEWB 1A90A 2OCTA 1VQ63 3PXMA 1UUVB 3P7XA 4CJNA 3KH7A 2XFTA 3MYDA 4POBA 2YWNA 5CAXA 2ALBA 1OUNA 1AR0A 1AQZA 3PS8A 2YFJB 4X2OA 1TW9A 2CX1A 2UX0A 4RQRA 3PPUA 3D5JA 2H6ZA 1XIYA 1BNEA 4AGSA 7GSSA 3EYTA 3UIWA 5RNTA 1YGEA 3M8NA 4XHMA 3IA1A 5INYA 3FH1A 2WO0A 4HM3B 2ZA4A 2I4AA 2XC2A 1PKWA 12GSA 3DXBA 2UGIA 3CCE3 1XPVA 1AC1A 3FHKA 1A2JA 4EV2A 4OD7A 2VCWA 1QAFA 4PURA 1SJWA 3KD0A 1NB3I 4MZCA 4FH8A 4LL1B 3IAM2 4O92A 5H5RA 5LNKe 3AY8A 4Q5NA 4JBBA 3IPTA 3F8UA 3B4PA 4JZQA 2I9HA 4TN8A 2M72A 2L57A 4IQAA 3UJ1A 1V57A 4TOPA 1UDII 2ZHXB 5D96A 4FQUA 4BL7A 2CH9A 1MDJA 1N9EA 1JBTA 3FZAA 3MKIA 5BIRA 4NV5A 2RGQA 3L9UA 4NWYA 2DIZA 5J4UA 2HMMB 1PX6A 2BU4A 2G2QA 1NU3A 3CC73 4Z2UA 1X1YA 1FUSA 1TFOA 2O3OA 4J5GA 5D83A 2O85A 1GY7A 2KHPA 6GSUA 4YQMA 3CPOA 4G19A 4DVCA 2FD3A 3SXXA 4JRRA 3ZREA 3UEMA 2M46A 3DXOA 4K7IA 1QXHA 1RJOA 3ERWA 1Q9EA 3TUEA 2C80A 6RNTA 1Z9HA 4PNGA 1T8EB 2VM2A 1ZCPA 5IENA 5DQSA 9RNTA 3T8UA 1PX7A 3BIRA 5CO3A 3M9KA 2YFIB 5ABRA 1BRNL 20GSA 2GT6A 3OX9A 1SK1A 1AXDA 3D21A 1V74A 3U1WA 4ZL8A 4GSTA 1F3BA 4O7HA 4I6XA 6GSSA 2RLIA 1O8WA 3F7SA 1QVG2 3WYWA 5HGRA 1OGZA 1WJKA 1FOVA 1GSPA 1THOA 4TR1A 4MCUA 1G0TA 3KEBA 2INXA 3J7Yk 1YHQ3 4FMCA 2B5EA 4MMYB 2CFLA 2YZHA 5DJLA 1ZYNA 2XGNA 3TKQA 3LT9A 6GSXA 3IXRA 2SBLA 3EE1A 1USBA 2VLUA 2STDA 1JZDA 4J8TA 1VGLA 2OA7A 2X64A 2GDRA 3LWAA 1IU7A 1GOVA 3JUMA 2P0GA 4G0IA 2GU3A 1LOWA 4N0ZA 2DMLA 4IT7A 2XPDA 4HJMA 1LQGC 1QMAA 1JBRA 2VCXA
chains in the Genus database with same CATH topology
2IPAA 1XXUA 2LQOA 1WWJA 3GURA 1DBYA 1U3AA 5ELGA 3ZFLA 3GMFA 1UC7A 1G6YA 1W89A 2GQMA 5LCZA 4DSQA 4ACSA 3TKSC 3QAWA 2PERA 3ZRDA 4Q5QA 1VRSD 2IY2A 2V6KA 3IAS2 1ERVA 3FY7A 3LQ7A 1AAZA 5D8IA 4HZ4A 4TR4A 1ILOA 1N8JA 1O6JA 4NV2A 3FR6A 4PQIA 4Q5RA 2R2JA 3DYRA 2DJKA 4F2IA 4TXVA 3KP9A 2DJ0A 2H0IA 2C0EA 6GSYA 2VL3A 3GL3A 2YOIA 2GSRA 1XWAA 3P2AA 3WT2A 3BCKA 5CREA 3F9UA 4FYBA 4MDCA 5EL8A 4GLTA 3C8EA 3CXGA 3HYPA 5G2ZA 4PUFC 2EIQA 3LYPA 1Z7RA 5LD0A 5B8AA 4X0XA 2DLXA 1M2AA 3ED3A 2UZ8A 4NHZA 3IE3A 4FO5A 13GSA 2H6YA 3ZL5A 3VURA 3LXZA 5F0GA 1BQ7A 3FR9A 4I97A 5HFKA 3F3QA 1EGOA 2HE3A 4MPFA 2AV4A 3HZ8A 4WBRD 3IC4A 1ZMAA 3PH9A 4O5UA 4IELA 1WIKA 1YZXA 3UARA 1BJXA 5B6MA 1WOUA 5D9WA 4IKHA 4YAPA 2XBIA 5JCWA 2LRNA 3BBYA 2B1LA 1NHYA 2VAFA 2HZEA 4NPBA 3WGXA 5ELAA 5G5FA 2FWGA 1UN2A 3IV4A 3VFIA 4E8EA 2GGTA 3A2WA 1V40A 5A4WA 3EU4A 4E8HA 2GT5A 3ZTLA 1U3IA 3KTLA 4KCAA 5IO0A 2TRCP 4D73B 2QA2A 1TI3A 5D9XA 3EINA 4BVYB 3DKSA 3W8JA 2WGRA 3APQA 4ULXA 2M80A 3ME7A 2IYJA 1YDKA 1OE7A 2DMMA 3G9BA 2NBSA 4HQZA 5JCGA 2DJ1A 4MA9A 3H8QA 1JZRA 2R0GA 3UOMA 2VD0A 1HNAA 1EEJA 1M9AA 3RAZA 4PUAA 1K0BA 1F37A 2PVOC 3LJRA 5D9TA 1AQXA 5J5NA 5DVBA 4MJEA 4L5OA 3GSTA 3CSIA 3HY2A 1ERWA 3LXTA 4YKGA 4V2NA 2DC5A 3HVVA 1SKRB 5DALB 4AJ8A 1JZOA 1XWKA 2HSHA 2X4AA 2I3YA 1AIUA 3HCZA 2LRTA 5CP1A 3L9SA 2RM5A 2GLRA 5A4UA 1NSWA 2C3QA 1DE1A 3FZ5A 1PKZA 3GX0A 4MNNA 5HFGA 4DSSA 1OAZA 2DIYA 2RUEA 2JSZA 1GUHA 4KW6A 3HJOA 3D6IA 2GQKA 4BVXA 3P90A 2YPMA 1URMA 4JU5A 3J7Yb 5KOXA 1XZOA 2R0PA 2A2PA 2JSYA 4LA1A 4KSOA 4IJ3A 3APSA 4J57E 1K3YA 2KP1A 1M2DA 2A2RA 4YKFA 4MZWA 1KEBA 2PUKC 1U87A 1YF1A 1SL2B 3TKRA 4EIQA 3R3EA 5GSSA 1GTUA 1R4WA 4G0LA 1Q98A 3TKSA 1G6WA 3IOSA 2FWFA 3FZ4A 1K0NA 22GSA 5ECOB 1RK4A 3I9V2 4X43A 3VWUA 1SD8A 4WR4A 2CX3A 1F6MC 2N5BA 4KH7A 2H1BA 3ZIVA 4K0GA 3A2XA 4EIPA 1T7PB 3UMAA 3A5WA 3C1RA 1A0RP 1GH2A 3GTUB 4Q5FA 1F2EA 1ST9A 1MTCA 3I6AA 3IK7A 2V1MA 3KGKA 5HFIA 3UBKA 1M0UA 2FHEA 2C1YA 2WJUA 3WGEA 3H93A 4K0NA 1XWCA 4K7NA 2L59A 1WRYA 1VF1A 4A5PA 1DSBA 1EZKA 2YJ7A 1Z3EA 4WR5A 1YKCA 4MJCA 3DMLA 1ZYPA 3F4SA 3JCML 2KLXA 1BAYA 3CTGA 4GWRA 3CRTA 4ZBAA 2JZRA 3ZMKA 2CVBA 4YH2A 2YZUA 4X4JA 3W6GA 1EP7A 2E2MA 4XCSA 5AN1A 4IGJA 5JWOB 2LUSA 3H79A 2B6MA 3F0IA 4IHUA 1PL1A 1SKSB 2C0DA 1Z6MA 1A2MA 3GX8A 3IPZA 1B48A 5JWRB 3O76A 3H4KA 4GF0A 4EXJA 1SD9A 3OR5A 2VLTA 2H30A 5D73A 6GSWA 1MD4A 3IHGA 2HRFA 2N5AA 3VWXA 1Z5YE 2R37A 1XWBA 1GL8A 5JWQB 3IR4A 2B5YA 4NXIA 3EMPA 16GSA 2XHFA 2L5LA 3BD2A 4HS1A 3QR6A 1U6TA 3C7MA 3TRQA 2CVDA 3DD3A 3FMWA 3A2VA 5FWGA 3TJBA 2O7KA 3ME8A 4V2MA 2L4CA 4ID0A 3Q74A 1O81A 3HKRA 4RI6A 4HQSA 3GL5A 2JZTA 5ECPB 3VWWA 3KZQA 3IK9A 1PN0A 3D22A 4KSMA 1GLQA 1TOFA 5B7CA 3TJFA 1HQOA 5IPGA 2I81A 3CSHA 4HJ2A 1OVNA 2HFDA 1FO5A 2IFQB 5DJMA 2GS3A 2PBJA 5IQYA 5L71A 1M9BA 1SL0B 1W4VA 3SWLA 3ERGA 1T4YA 2QSIA 1NM3A 3LSZA 2DKHA 3FYGA 1XVWA 5KN3A 1SU9A 4HI7A 4IW9A 4MH3A 2CT6A 3G7JA 3EVIA 4GTUA 4QQ7A 5ECMB 2VLVA 2E0QA 1HNCA 3F6DA 3F4TA 3LW9A 2MYGA 4WETA 2E2GA 2F8AA 4OO4A 5H5SA 4L0UA 3LEFA 4KDYA 1GRXA 3LGCA 4IBPA 2N5FA 4F0BA 18GSA 4MH2A 5EY6A 2GVPA 5ECSA 4IQ1A 3UVHA 5HQPA 3DIEA 2NPBA 1QK8A 4G10A 4F0CA 4EL1A 8GSSA 3QFBC 3ISOA 1TK0B 2HSMA 2YP6A 5G31A 1A8LA 3KMOA 3KTBA 3GNJA 1VF4A 1X5EA 5FHIA 4KA0A 2C8UA 2X99A 1YF0A 2WFCA 2IMDA 3IRAA 2CZ2A 5G1LA 3APOA 2HXKA 4HU9A 3UAPA 3TOUA 4BPYA 4TXOB 4K2DA 3ZMLA 1WP0A 4QL7A 4IVFA 1ML6A 5IO2A 5AISA 1V9WA 2L6DA 3GV1A 1GTAA 3GH6A 2H8LA 2HRKA 2QC7A 5ECHB 4L0WA 5A5KA 2VUPA 2OBKA 2QKEA 1K0MA 1OKTA 3P8WA 1NW2A 3ZLPA 1OKDA 2FCHA 1Y6EA 4K8MA 1TK8B 3BCIA 2OACA 4EVMA 1DUGA 3TGZA 2H76A 3CSJA 1C72A 3O3TA 1H4OA 1PQNA 5AIXA 2O89A 2H1DA 4HUAA 4USSA 1O7UA 4K2XA 2LJKA 4ZL9A 2H70A 1GSEA 3H1NA 2B7KA 5G5EA 1KTEA 2YANA 1OC9B 2EIOA 2MZCA 2IMKA 4CY6A 4FIWA 1B4PA 1HYUA 4P3YB 1GWCA 3FKFA 5BMUA 1BEDA 5J9BA 3A5IA 3RBTA 1V2AA 4TW5A 5G30A 5HR3A 2VCVA 1M2BA 3TKPA 1FVKA 3HVXA 2F51A 4ECBA 3GH9A 1YJ6A 2X49A 1XCCA 1TP9A 4KAEA 5D93A 4EUYA 4HU7A 1Y25A 1R7HA 3DWVA 2H71A 2LTKA 1QUWA 3MSZA 2HZFA 5DCGA 4HEA2 2PN8A 2ZUPA 3KM6A 1XW6A 3ZYWA 2PGTA 4GSSA 4F9ZA 3Q18A 1IYIA 2CA8A 3HJMA 2H0HA 1X0RA 5HR1A 3FR3A 5DDLA 2LSTA 5ECKB 3LG6A 2RM6A 1T00A 2Z9SA 2X8CA 2CAQA 1AQVA 3BJ5A 3GHAA 1K0OA 4MLYA 5ID2B 1J08A 2KOKA 4PQHA 4GSNA 2LEGA 4ICYA 4WKWA 4MABA 1QGVA 1PL2A 1B8XA 3CTFA 1KBNA 1V98A 1GSQA 2XPEA 2OKAA 3VK9A 3GRXA 1MD3A 1XOAA 2OADA 1O85A 2DKIA 2ZNMA 2WULA 3FW2A 1LU4A 2GSQA 2IN3A 2H01A 2MMNA 4V1Ap 4DSRA 1A23A 1A2LA 4TKYA 3KJYA 4PX1A 2P31A 4K5SA 2GZZA 4K7OA 5ID2A 1PA3A 4MF5A 2HLSA 1X5CA 4ECJA 4OCEA 1FG4A 3BOAA 1TRVA 4D73A 1TRSA 1SKWB 4EC0A 3KMNA 1PSQA 4ZB9A 5B6NA 2LNTA 4XRAA 4XTSA 1ABAA 2OJLA 4BVYA 2TRXA 5IOXA 5ECRB 3TJJA 1X9WB 6GSTA 3EU3A 4KB3A 3UVTA 3KP8A 2O8VB 2DJJA 4ZL7A 2AUVA 3ZVJD 1A24A 4V1Ag 2I1UA 5HR2A 1GSDA 1CQGA 1TK5B 2VCTA 5IIZA 3GKNA 3M1GA 1ZGNA 4NHWA 5KN0A 2GSTA 1FOHA 2WCIA 1VF3A 4MP4A 3ZVJA 3L0HA 5D9VA 1R5AA 5IMVA 5F05A 3GIXA 1MEKA 1XWGA 1PN9A 3GKXA 4XS4B 2YNXA 5DAKB 5DALA 3S9FA 2IJYA 5COHA 2DSAA 3N5OA 1GTIA 1GUKA 1PRXA 4OO5A 4KCEA 1ERUA 2VCZA 2V2GA 3E3EA 3IDVA 2ZCTA 5ENUA 2C0FA 2H73A 2GZYA 3C73A 4Z2RA 2OBIA 4LLRA 4G0KA 2WB9A 4WEYA 4PNFA 1JZWA 1ZL9A 2L5OA 3DEXA 2PWJA 2VIMA 3C71A 3MNGA 4GXZA 2DBCA 1SENA 2PMTA 4IN0A 1ZZYA 4KNDA 1WPIA 3FK8A 1PD21 4WXTA 2CAIA 2E7PA 4MPGA 1E2YA 1FB6A 2H0GA 3LORA 3TCOA 5C00A 14GSA 1Z7PA 2R0CA 4HOJA 4KDXA 2WDUA 1TI1A 2B3SA 1B9XC 2K6VA 4ZBDA 5IPHA 2YWIA 1M7TA 2LNSA 2XBQA 3KH9A 2KP2A 3GFKA 2IL3A 3FEUA 1SJIA 2OE3A 2K8VA 1YKAA 5CRGA 1GULA 2VO4A 4KF9A 5FT3A 2KUCA 4N10A 4MF7A 2ES7A 1FHEA 11GSA 1HD2A 3FZ9A 3VPTA 5GAND 1GTBA 5E59A 1X9SB 4JR4A 3VWVA 1EWXA 2HRNA 5CYYA 4IS0A 5F07A 5ECLB 5A4VA 2B5XA 2MBTA 2VD1A 4IJIA 3GTUA 4IP6A 2LQQA 9GSSA 2YWOA 4LMVA 5DQYA 3D0ZA 2FLSA 4GQCA 3HZ4A 4GCIA 4ZB6A 1EGRA 2K18A 5ECNB 4N0VA 2PPTA 1OYJA 2NVLA 4YAVA 2LRCA 3EURA 4WF4A 3GN3A 3N9JA 1RW1A 2HYXA 3EMXA 1JHBA 2IMEA 1X5DA 2YWMA 4XRDA 1XW5A 3U5RE 2A4VA 1GSUA 3G7YA 2J23A 1U88A 4BL7B 2RIIA 4ILFA 1AW9A 5AIVA 1G7EA 2LJAA 3Q19A 3EC3A 2HSYA 4WF5A 1B4QA 5CRWA 2WRTA 1M99A 4MF6A 1VF2A 5E4WA 1O8XA 4G2EA 1XFLA 3QFAC 4CDOA 1TXXA 19GSA 2IIYA 2P5RA 2CX4A 1GLPA 2PU9C 5F8BA 3Q6OA 2REMA 3HJPA 2YV9A 1EV4A 5J3RA 2JZSA 4PGTA 2EC4A 2C0GA 3KIJA 2VM1A 4XIHA 2J9HA 4TR1B 2K8SA 3HDCA 4EDZA 5KEJA 3IBHA 1PGTA 4KE3A 4CW9A 4K1FA 4I5QA 1OE8A 4I2TA 1HNBA 1OC8A 4EKZA 4YQVA 3NIVA 1ZYEA 5KOWA 3MAKA 3DVXA 3TKSE 2FWHA 3LFLA 2IFQA 5IMFA 3UL3A 3TJGA 3F6FA 1SJ6A 1JFUA 2MMZA 3VLNA 3L4NA 4NAXA 3D4MA 5DBQA 2R5GA 5F06A 1TTZA 4KUNA 5IMZA 4ECIA 4N11A 2NDOA 2YJHA 3EWLA 4N30A 4BA7A 1MDKA 3WGDA 4NMUA 2FA8A 2A4HA 3F3RA 3ERFA 1GUMA 3EPTA 2ON5A 4JR6A 2H1GA 5IM9A 1K0DA 4TRXA 1Z6NA 2VL9A 2H19A 3F4RA 1S3DA 1EEMA 2GQLA 1TRWA 3QMXA 1NHOA 1THXA 4OFMA 3L9VA 3RPPA 3DGQA 4ISDA 4MJAA 3IHQA 3ZZXA 4OMVA 3E0UA 4RQXA 3NOFA 2FY6A 4MZBA 4H86A 2FA4A 5G1KA 3TB2A 1K0AA 1DE2A 1V58A 2K9FA 1SYRA 1ERTA 10GSA 3TJKA 2A2SA 5GSTA 4FYUA 3QAVA 2AHEA 1TJDA 5KN2A 3D4TA 4GRFA 1S3AA 4TXOA 3ZIJA 3IC8A 3KXOA 5IOWA 2C3TA 2H6XA 1A0FA 2YCDA 4I8BA 3E9JB 2WZ9A 2P5QA 2CQ9A 3QPMA 4CHSA 3V1WA 5EPFA 1GSFA 2IMFA 3MDKA 2R3XA 4EE0A 2YN1A 3HA9A 1F3AA 2FWEA 1YEXA 4K6XA 4KX4A 3VI5A 4BWSA 2X8HA 3F63A 3GKKA 2VL2C 4Z2TA 2ON7A 5KN1A 3PINA 2CZ3A 3GSSA 1LJRA 2JACA 5J9CA 3RHBA 1LBKA 2GTUA 1K3LA 1CQHA 4ZBBA 4TVEA 1N2AA 4POKA 2HZEB 1Q4JA 2CV4A 1B9YC 3M9JA 4RI7A 4LL4B 1T3BA 1SK0A 2V6OA 4ML1A 1TU7A 4ZXGA 3WT1A 1IYHA 2D2ZA 3W8SA 4HZ2A 4PQ1A 1OC9A 1H75A 6GSVA 1O73A 4QL9A 1XW9A 3HXSA 4LMWA 2LV3A 4EO3A 3QDNA 4TR0A 2F3MA 1ZYQB 4ZB8A 3ZITA 4MMMA 2H72A 2VOCA 3PR8A 2O87A 2F8FA 4OCFA 2MMAA 4HDEA 1BYEA 4PTSA 2BTOT 2MMOA 4J56E 5DCHA 4ECCA 1AUCA 3TOTA 4AF2A 3DRNA 3O6TA 3QOUA 2DJ2A 3CBUA 5EVOA 1XVQA 3VI7A 3FRCA 3I43A 4V2LA 1R26A 4F03A 1PMTA 2CVKA 1ON4A 3CRUA 3HVSA 4POMA 2DJ3A 1EOGA 3UBLA 2H1AA 3GA4A 2HRAA 3QD9A 1XBSA 3HHVA 4XS6A 1G7OA 3R2QA 3LYKA 2B1KA 3CYNA 1EP8A 1WE0A 2BJXA 4XS1A 2YV7A 4ML6A 3C1SA 5GAPD 5J41A 3QAGA 1ACVA 3QCPA 1SYXA 1QFNA 3VPQA 1MDIA 1K3OA 5AGYA 2QA1A 4AJ6A 1TKDB 2FUG2 5C04A 2V41A 4DSSB 4RUVA 2H66A 1UVZA 4BWQA 3A3TA 4F82A 2BMXA 1GP1A 1SK2A 2EIRA 4BVXB 2LKUA 4O5QA 3WD6A 2H74A 4CY8A 3K8NA 5H5QA 2HT9A 2AAWA 4DEJA 3US3A 1BX9A 1A8YA 3CMIA 1YY7A 1TU8A 3TRPA 5IMAA 4ZIJA 2L6CA 2OE1A 2G0FA 1FAAA 2L4QA 4Z7XA 1EOHA 1FW1A 1I9DA 2FGXA 2QGVA 1FVJA 1E6BA 1TRUA 4KDUA 3GYKA 4MJBA 2NTOA 1UA5A 2IWTA 3MIXA 5CRHA 4OWYA 5CNWA 1WMJA 3RDWA 5ECIB 1BG5A 2C4JA 4K5RA 4GQFA 1OC3A 1QQ2A 4OFTA 1X9MB 3I69A 4O32A 17GSA 2H75A 1T1VA 3MWHA 3GUSA 1GSSA 5JCUA 4KGIA 3SBCA 2JU5A 3L78A 4L5LA 1F9MA 1ZOFA 4JEDA 1T4ZA 4X1UA 2PVQA 2AYTA 5CRDA 3KCMA 4XS4A 4L8EA 5DAKA 3RHCA 4MK3A 3RPNA 2VCQA 5BRTA 3TRXA 2OE0A 4I2UA 2FNOA 5HR0A 2B7JA 1J0FA 4PXOA 4AJ7A 3DVWA 2R6KA 5GZZB 3GKMA 4ZILA 1J9BA 2HNLA 2F9SA 5ECQB 4O5RA 4OFNA 1XOBA 3NZNA 1RQMA 1JLWA 3TDGA 1GSYA 2V32A 1GNWA 2IMIA 1YQ1A 2C3NA 5IMCA 2RUFA 1K0CA 2X8GA 1SJZA 4YQUA 4POLA 3U6VA 4EF0A 5IMDA 2VL2A 4J2FA 3M0FA 2AJQB 3ZFBA 3PGTA 2MBSA 2GSSA 1I5GA 4FYCA 1SL1B 1S3CA 4TR3A 1KNGA 2R4VA 2GZPA 3HD5A 1GNEA 1AQWA 2WS2A 4WBJA 1R5PA 2TIRA 5B8BA 1QMVA 1TDIA 3EE2A 4JE1A 1JLVA 2JL4A 3G7IA 1YEPA 2HI7A 1FB0A 3M3MA 1EV9A 2AB6A 4IP1A 2LJRA 2LS5A 4G9HA 4K9ZA 4EDYA 3P7XA 3KH7A 3MYDA 4POBA 2YWNA 5CAXA 2ALBA 1TW9A 4RQRA 3PPUA 3D5JA 2H6ZA 1XIYA 4AGSA 7GSSA 3EYTA 3UIWA 3M8NA 4XHMA 3IA1A 5INYA 2I4AA 2XC2A 1PKWA 12GSA 3DXBA 1XPVA 1AC1A 3FHKA 1A2JA 4OD7A 2VCWA 4PURA 3KD0A 4MZCA 4FH8A 4LL1B 3IAM2 4O92A 5H5RA 5LNKe 3AY8A 4Q5NA 4JBBA 3F8UA 4JZQA 2I9HA 4TN8A 2M72A 2L57A 4IQAA 3UJ1A 1V57A 4TOPA 5D96A 4FQUA 4BL7A 1MDJA 3FZAA 4NV5A 3L9UA 4NWYA 2DIZA 5J4UA 1PX6A 2G2QA 4Z2UA 2O85A 6GSUA 2KHPA 4YQMA 4G19A 4DVCA 2FD3A 4JRRA 3ZREA 3UEMA 2M46A 4K7IA 1QXHA 3ERWA 3TUEA 2C80A 1Z9HA 4PNGA 1T8EB 2VM2A 1ZCPA 5DQSA 1PX7A 5CO3A 3M9KA 5ABRA 20GSA 2GT6A 1SK1A 1AXDA 3D21A 4ZL8A 4GSTA 1F3BA 4O7HA 4I6XA 6GSSA 2RLIA 1O8WA 3WYWA 1WJKA 1FOVA 1THOA 4TR1A 4MCUA 1G0TA 3KEBA 3J7Yk 2B5EA 2YZHA 5DJLA 1ZYNA 3TKQA 6GSXA 3IXRA 1USBA 2VLUA 2X64A 1JZDA 1VGLA 2OA7A 2GDRA 3LWAA 2P0GA 4G0IA 4N0ZA 2DMLA 2XPDA 4HJMA 2JADA 2VCXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2IPA A;  1XXU A;  2LQO A;  1WWJ A;  3GUR A;  1DBY A;  1U3A A;  5ELG A;  3ZFL A;  3GMF A;  1UC7 A;  1G6Y A;  1W89 A;  2GQM A;  5LCZ A;  4DSQ A;  4ACS A;  3TKS C;  3QAW A;  2PER A;  3ZRD A;  4Q5Q A;  1VRS D;  2IY2 A;  2V6K A;  3IAS 2;  1ERV A;  3FY7 A;  3LQ7 A;  1AAZ A;  5D8I A;  4HZ4 A;  4TR4 A;  1ILO A;  1N8J A;  1O6J A;  4NV2 A;  3FR6 A;  4PQI A;  4Q5R A;  2R2J A;  3DYR A;  2DJK A;  4F2I A;  4TXV A;  3KP9 A;  2DJ0 A;  2H0I A;  2C0E A;  6GSY A;  2VL3 A;  3GL3 A;  2YOI A;  2GSR A;  1XWA A;  3P2A A;  3WT2 A;  3BCK A;  5CRE A;  3F9U A;  4FYB A;  4MDC A;  5EL8 A;  4GLT A;  3C8E A;  3CXG A;  3HYP A;  5G2Z A;  4PUF C;  2EIQ A;  3LYP A;  1Z7R A;  5LD0 A;  5B8A A;  4X0X A;  2DLX A;  1M2A A;  3ED3 A;  4NHZ A;  3IE3 A;  4FO5 A;  13GS A;  2H6Y A;  3ZL5 A;  3VUR A;  3LXZ A;  5F0G A;  1BQ7 A;  3FR9 A;  4I97 A;  5HFK A;  3F3Q A;  1EGO A;  2HE3 A;  4MPF A;  2AV4 A;  3HZ8 A;  4WBR D;  3IC4 A;  1ZMA A;  3PH9 A;  4IEL A;  1WIK A;  1YZX A;  3UAR A;  1BJX A;  5B6M A;  1WOU A;  5D9W A;  4IKH A;  4YAP A;  2XBI A;  5JCW A;  2LRN A;  3BBY A;  2B1L A;  1NHY A;  2VAF A;  2HZE A;  4NPB A;  3WGX A;  5ELA A;  5G5F A;  2FWG A;  1UN2 A;  3IV4 A;  3VFI A;  4E8E A;  2GGT A;  3A2W A;  1V40 A;  5A4W A;  3EU4 A;  4E8H A;  2GT5 A;  3ZTL A;  1U3I A;  3KTL A;  4KCA A;  5IO0 A;  2TRC P;  4D73 B;  1TI3 A;  5D9X A;  3EIN A;  3DKS A;  3W8J A;  2WGR A;  3APQ A;  4ULX A;  2M80 A;  3ME7 A;  2IYJ A;  1YDK A;  1OE7 A;  2DMM A;  3G9B A;  2NBS A;  4HQZ A;  5JCG A;  2DJ1 A;  4MA9 A;  3H8Q A;  1JZR A;  3UOM A;  2VD0 A;  1HNA A;  1EEJ A;  1M9A A;  3RAZ A;  4PUA A;  1K0B A;  1F37 A;  2PVO C;  3LJR A;  5D9T A;  1AQX A;  5J5N A;  5DVB A;  4MJE A;  4L5O A;  3GST A;  3CSI A;  3HY2 A;  1ERW A;  3LXT A;  4V2N A;  2DC5 A;  3HVV A;  1SKR B;  5DAL B;  4AJ8 A;  1JZO A;  1XWK A;  2HSH A;  2I3Y A;  1AIU A;  3HCZ A;  2LRT A;  5CP1 A;  3L9S A;  2RM5 A;  2GLR A;  5A4U A;  1NSW A;  2C3Q A;  1DE1 A;  3FZ5 A;  1PKZ A;  3GX0 A;  5HFG A;  4DSS A;  1OAZ A;  2DIY A;  2RUE A;  2JSZ A;  1GUH A;  4KW6 A;  3HJO A;  3D6I A;  2GQK A;  4BVX A;  3P90 A;  2YPM A;  1URM A;  4JU5 A;  3J7Y b;  1XZO A;  2JSY A;  4LA1 A;  4KSO A;  4IJ3 A;  3APS A;  4J57 E;  1K3Y A;  2KP1 A;  1M2D A;  2A2R A;  4MZW A;  1KEB A;  2PUK C;  1U87 A;  1YF1 A;  1SL2 B;  3TKR A;  5GSS A;  1GTU A;  1R4W A;  1Q98 A;  3TKS A;  1G6W A;  3IOS A;  2FWF A;  3FZ4 A;  1K0N A;  22GS A;  5ECO B;  1RK4 A;  3I9V 2;  4X43 A;  3VWU A;  1SD8 A;  4WR4 A;  2CX3 A;  1F6M C;  2N5B A;  4KH7 A;  2H1B A;  3ZIV A;  4K0G A;  3A2X A;  1T7P B;  3UMA A;  3A5W A;  3C1R A;  1A0R P;  1GH2 A;  3GTU B;  4Q5F A;  1F2E A;  1ST9 A;  1MTC A;  3I6A A;  3IK7 A;  2V1M A;  3KGK A;  5HFI A;  3UBK A;  1M0U A;  2FHE A;  2C1Y A;  2WJU A;  3WGE A;  3H93 A;  4K0N A;  1XWC A;  4K7N A;  2L59 A;  1WRY A;  1VF1 A;  1DSB A;  1EZK A;  2YJ7 A;  1Z3E A;  4WR5 A;  1YKC A;  4MJC A;  3DML A;  3F4S A;  3JCM L;  2KLX A;  1BAY A;  3CTG A;  4GWR A;  3CRT A;  4ZBA A;  2JZR A;  3ZMK A;  2CVB A;  4YH2 A;  2YZU A;  3W6G A;  1EP7 A;  2E2M A;  4XCS A;  5AN1 A;  4IGJ A;  5JWO B;  2LUS A;  3H79 A;  2B6M A;  3F0I A;  4IHU A;  1PL1 A;  1SKS B;  2C0D A;  1Z6M A;  1A2M A;  3GX8 A;  3IPZ A;  1B48 A;  5JWR B;  3O76 A;  3H4K A;  4GF0 A;  4EXJ A;  1SD9 A;  3OR5 A;  2VLT A;  2H30 A;  5D73 A;  6GSW A;  1MD4 A;  2HRF A;  2N5A A;  3VWX A;  1Z5Y E;  2R37 A;  1XWB A;  1GL8 A;  5JWQ B;  3IR4 A;  2B5Y A;  4NXI A;  3EMP A;  16GS A;  2XHF A;  2L5L A;  3BD2 A;  4HS1 A;  3QR6 A;  1U6T A;  3C7M A;  3TRQ A;  2CVD A;  3DD3 A;  3A2V A;  5FWG A;  3TJB A;  2O7K A;  3ME8 A;  4V2M A;  2L4C A;  4ID0 A;  3Q74 A;  1O81 A;  3HKR A;  4RI6 A;  4HQS A;  3GL5 A;  2JZT A;  5ECP B;  3VWW A;  3KZQ A;  3IK9 A;  3D22 A;  4KSM A;  1GLQ A;  1TOF A;  5B7C A;  3TJF A;  1HQO A;  5IPG A;  2I81 A;  3CSH A;  4HJ2 A;  1OVN A;  2HFD A;  1FO5 A;  2IFQ B;  5DJM A;  2GS3 A;  2PBJ A;  5IQY A;  5L71 A;  1M9B A;  1SL0 B;  1W4V A;  3SWL A;  3ERG A;  1T4Y A;  2QSI A;  1NM3 A;  3LSZ A;  3FYG A;  1XVW A;  5KN3 A;  1SU9 A;  4HI7 A;  4IW9 A;  4MH3 A;  2CT6 A;  3G7J A;  3EVI A;  4GTU A;  4QQ7 A;  5ECM B;  2VLV A;  2E0Q A;  1HNC A;  3F6D A;  3F4T A;  2MYG A;  4WET A;  2E2G A;  2F8A A;  4OO4 A;  5H5S A;  4L0U A;  3LEF A;  4KDY A;  1GRX A;  3LGC A;  4IBP A;  2N5F A;  4F0B A;  18GS A;  4MH2 A;  5EY6 A;  2GVP A;  5ECS A;  4IQ1 A;  3UVH A;  5HQP A;  3DIE A;  2NPB A;  1QK8 A;  4G10 A;  4F0C A;  4EL1 A;  8GSS A;  3QFB C;  3ISO A;  1TK0 B;  2YP6 A;  5G31 A;  1A8L A;  3KMO A;  3KTB A;  3GNJ A;  1VF4 A;  1X5E A;  5FHI A;  4KA0 A;  2C8U A;  2X99 A;  1YF0 A;  2WFC A;  2IMD A;  3IRA A;  2CZ2 A;  5G1L A;  3APO A;  2HXK A;  4HU9 A;  3UAP A;  3TOU A;  4BPY A;  4TXO B;  4K2D A;  3ZML A;  1WP0 A;  4QL7 A;  4IVF A;  1ML6 A;  5IO2 A;  5AIS A;  1V9W A;  2L6D A;  3GV1 A;  1GTA A;  3GH6 A;  2H8L A;  2QC7 A;  5ECH B;  4L0W A;  5A5K A;  2VUP A;  2OBK A;  2QKE A;  1K0M A;  1OKT A;  3P8W A;  1NW2 A;  3ZLP A;  1OKD A;  2FCH A;  1Y6E A;  4K8M A;  1TK8 B;  3BCI A;  2OAC A;  4EVM A;  1DUG A;  3TGZ A;  2H76 A;  3CSJ A;  1C72 A;  3O3T A;  1H4O A;  1PQN A;  5AIX A;  2O89 A;  2H1D A;  4HUA A;  1O7U A;  2LJK A;  4ZL9 A;  2H70 A;  1GSE A;  3H1N A;  2B7K A;  5G5E A;  1KTE A;  2YAN A;  1OC9 B;  2EIO A;  2MZC A;  2IMK A;  4FIW A;  1B4P A;  1HYU A;  4P3Y B;  1GWC A;  3FKF A;  1BED A;  5J9B A;  3RBT A;  1V2A A;  4TW5 A;  5G30 A;  5HR3 A;  2VCV A;  1M2B A;  3TKP A;  1FVK A;  3HVX A;  2F51 A;  4ECB A;  3GH9 A;  1YJ6 A;  1XCC A;  1TP9 A;  4KAE A;  5D93 A;  4EUY A;  4HU7 A;  1Y25 A;  1R7H A;  3DWV A;  2H71 A;  2LTK A;  1QUW A;  3MSZ A;  2HZF A;  5DCG A;  4HEA 2;  2PN8 A;  2ZUP A;  3KM6 A;  1XW6 A;  3ZYW A;  2PGT A;  4GSS A;  4F9Z A;  3Q18 A;  1IYI A;  2CA8 A;  3HJM A;  2H0H A;  1X0R A;  5HR1 A;  3FR3 A;  5DDL A;  2LST A;  5ECK B;  3LG6 A;  2RM6 A;  1T00 A;  2Z9S A;  2X8C A;  2CAQ A;  1AQV A;  3BJ5 A;  3GHA A;  1K0O A;  4MLY A;  5ID2 B;  1J08 A;  2KOK A;  4PQH A;  4GSN A;  2LEG A;  4WKW A;  4MAB A;  1QGV A;  1PL2 A;  1B8X A;  3CTF A;  1KBN A;  1V98 A;  1GSQ A;  2XPE A;  2OKA A;  3VK9 A;  3GRX A;  1MD3 A;  1XOA A;  2OAD A;  1O85 A;  2ZNM A;  2WUL A;  3FW2 A;  1LU4 A;  2GSQ A;  2IN3 A;  2H01 A;  2MMN A;  4V1A p;  4DSR A;  1A23 A;  1A2L A;  4TKY A;  3KJY A;  4PX1 A;  2P31 A;  2GZZ A;  4K7O A;  5ID2 A;  1PA3 A;  4MF5 A;  2HLS A;  1X5C A;  4ECJ A;  4OCE A;  1FG4 A;  3BOA A;  1TRV A;  4D73 A;  1TRS A;  1SKW B;  4EC0 A;  3KMN A;  1PSQ A;  4ZB9 A;  5B6N A;  2LNT A;  4XRA A;  4XTS A;  1ABA A;  2OJL A;  4BVY A;  2TRX A;  5IOX A;  5ECR B;  3TJJ A;  1X9W B;  6GST A;  3EU3 A;  4KB3 A;  3UVT A;  3KP8 A;  2O8V B;  2DJJ A;  4ZL7 A;  2AUV A;  3ZVJ D;  1A24 A;  4V1A g;  2I1U A;  5HR2 A;  1GSD A;  1CQG A;  1TK5 B;  2VCT A;  5IIZ A;  3GKN A;  3M1G A;  1ZGN A;  4NHW A;  5KN0 A;  2GST A;  2WCI A;  1VF3 A;  4MP4 A;  3ZVJ A;  3L0H A;  5D9V A;  1R5A A;  5IMV A;  5F05 A;  3GIX A;  1MEK A;  1XWG A;  1PN9 A;  3GKX A;  4XS4 B;  2YNX A;  5DAK B;  5DAL A;  3S9F A;  2IJY A;  5COH A;  2DSA A;  3N5O A;  1GTI A;  1GUK A;  1PRX A;  4OO5 A;  4KCE A;  1ERU A;  2VCZ A;  2V2G A;  3E3E A;  3IDV A;  2ZCT A;  5ENU A;  2C0F A;  2H73 A;  2GZY A;  3C73 A;  2OBI A;  4LLR A;  2WB9 A;  4WEY A;  4PNF A;  1JZW A;  1ZL9 A;  2L5O A;  3DEX A;  2PWJ A;  2VIM A;  3C71 A;  3MNG A;  4GXZ A;  2DBC A;  1SEN A;  2PMT A;  4IN0 A;  1ZZY A;  4KND A;  1WPI A;  3FK8 A;  1PD2 1;  4WXT A;  2CAI A;  2E7P A;  4MPG A;  1E2Y A;  1FB6 A;  2H0G A;  3LOR A;  3TCO A;  5C00 A;  14GS A;  1Z7P A;  4HOJ A;  4KDX A;  2WDU A;  1TI1 A;  2B3S A;  1B9X C;  2K6V A;  4ZBD A;  5IPH A;  2YWI A;  1M7T A;  2LNS A;  2XBQ A;  3KH9 A;  2KP2 A;  3GFK A;  2IL3 A;  3FEU A;  1SJI A;  2OE3 A;  2K8V A;  1YKA A;  5CRG A;  1GUL A;  2VO4 A;  5FT3 A;  2KUC A;  4N10 A;  4MF7 A;  2ES7 A;  1FHE A;  11GS A;  1HD2 A;  3FZ9 A;  3VPT A;  5GAN D;  1GTB A;  5E59 A;  1X9S B;  4JR4 A;  3VWV A;  1EWX A;  2HRN A;  5CYY A;  4IS0 A;  5F07 A;  5ECL B;  5A4V A;  2B5X A;  2MBT A;  2VD1 A;  4IJI A;  3GTU A;  4IP6 A;  2LQQ A;  9GSS A;  2YWO A;  4LMV A;  5DQY A;  3D0Z A;  2FLS A;  4GQC A;  3HZ4 A;  4GCI A;  4ZB6 A;  1EGR A;  2K18 A;  5ECN B;  4N0V A;  2PPT A;  1OYJ A;  2NVL A;  4YAV A;  2LRC A;  3EUR A;  4WF4 A;  3GN3 A;  3N9J A;  1RW1 A;  2HYX A;  3EMX A;  1JHB A;  2IME A;  1X5D A;  2YWM A;  4XRD A;  1XW5 A;  3U5R E;  2A4V A;  1GSU A;  3G7Y A;  2J23 A;  1U88 A;  2RII A;  4ILF A;  1AW9 A;  5AIV A;  1G7E A;  2LJA A;  3Q19 A;  3EC3 A;  2HSY A;  4WF5 A;  1B4Q A;  5CRW A;  2WRT A;  1M99 A;  4MF6 A;  1VF2 A;  5E4W A;  1O8X A;  4G2E A;  1XFL A;  3QFA C;  4CDO A;  1TXX A;  19GS A;  2IIY A;  2P5R A;  2CX4 A;  1GLP A;  2PU9 C;  5F8B A;  3Q6O A;  2REM A;  3HJP A;  2YV9 A;  1EV4 A;  5J3R A;  2JZS A;  4PGT A;  2EC4 A;  2C0G A;  3KIJ A;  2VM1 A;  4XIH A;  2J9H A;  4TR1 B;  2K8S A;  3HDC A;  4EDZ A;  5KEJ A;  3IBH A;  1PGT A;  4KE3 A;  4CW9 A;  4K1F A;  4I5Q A;  1OE8 A;  4I2T A;  1HNB A;  1OC8 A;  4EKZ A;  4YQV A;  3NIV A;  1ZYE A;  3MAK A;  3DVX A;  3TKS E;  2FWH A;  3LFL A;  2IFQ A;  5IMF A;  3UL3 A;  3TJG A;  3F6F A;  1SJ6 A;  1JFU A;  2MMZ A;  3VLN A;  3L4N A;  4NAX A;  3D4M A;  5DBQ A;  2R5G A;  5F06 A;  1TTZ A;  4KUN A;  5IMZ A;  4ECI A;  4N11 A;  2NDO A;  2YJH A;  3EWL A;  4N30 A;  4BA7 A;  1MDK A;  3WGD A;  4NMU A;  2FA8 A;  3F3R A;  3ERF A;  1GUM A;  2ON5 A;  4JR6 A;  2H1G A;  5IM9 A;  1K0D A;  4TRX A;  1Z6N A;  2VL9 A;  2H19 A;  3F4R A;  1S3D A;  1EEM A;  2GQL A;  1TRW A;  3QMX A;  1NHO A;  1THX A;  4OFM A;  3L9V A;  3RPP A;  3DGQ A;  4ISD A;  4MJA A;  3IHQ A;  3ZZX A;  4OMV A;  3E0U A;  4RQX A;  3NOF A;  2FY6 A;  4MZB A;  4H86 A;  2FA4 A;  5G1K A;  3TB2 A;  1K0A A;  1DE2 A;  1V58 A;  2K9F A;  1SYR A;  1ERT A;  10GS A;  3TJK A;  2A2S A;  5GST A;  4FYU A;  3QAV A;  2AHE A;  1TJD A;  5KN2 A;  3D4T A;  4GRF A;  1S3A A;  4TXO A;  3ZIJ A;  3KXO A;  5IOW A;  2C3T A;  2H6X A;  1A0F A;  2YCD A;  4I8B A;  3E9J B;  2WZ9 A;  2P5Q A;  2CQ9 A;  3QPM A;  4CHS A;  3V1W A;  5EPF A;  1GSF A;  2IMF A;  3MDK A;  2R3X A;  4EE0 A;  2YN1 A;  3HA9 A;  1F3A A;  2FWE A;  1YEX A;  4K6X A;  4KX4 A;  3VI5 A;  4BWS A;  2X8H A;  3F63 A;  3GKK A;  2VL2 C;  2ON7 A;  5KN1 A;  3PIN A;  2CZ3 A;  3GSS A;  1LJR A;  2JAC A;  5J9C A;  3RHB A;  1LBK A;  2GTU A;  1K3L A;  1CQH A;  4ZBB A;  4TVE A;  1N2A A;  4POK A;  2HZE B;  1Q4J A;  2CV4 A;  1B9Y C;  3M9J A;  4RI7 A;  4LL4 B;  1T3B A;  1SK0 A;  2V6O A;  4ML1 A;  1TU7 A;  4ZXG A;  3WT1 A;  1IYH A;  2D2Z A;  3W8S A;  4HZ2 A;  4PQ1 A;  1OC9 A;  1H75 A;  6GSV A;  1O73 A;  4QL9 A;  1XW9 A;  3HXS A;  4LMW A;  2LV3 A;  4EO3 A;  3QDN A;  4TR0 A;  2F3M A;  1ZYQ B;  4ZB8 A;  3ZIT A;  4MMM A;  2H72 A;  2VOC A;  3PR8 A;  2O87 A;  2F8F A;  4OCF A;  2MMA A;  4HDE A;  1BYE A;  2BTO T;  2MMO A;  4J56 E;  5DCH A;  4ECC A;  1AUC A;  3TOT A;  4AF2 A;  3DRN A;  3O6T A;  3QOU A;  2DJ2 A;  3CBU A;  5EVO A;  1XVQ A;  3VI7 A;  3FRC A;  3I43 A;  4V2L A;  1R26 A;  4F03 A;  1PMT A;  2CVK A;  1ON4 A;  3CRU A;  3HVS A;  4POM A;  2DJ3 A;  1EOG A;  3UBL A;  2H1A A;  3GA4 A;  3QD9 A;  1XBS A;  3HHV A;  4XS6 A;  1G7O A;  3R2Q A;  3LYK A;  2B1K A;  3CYN A;  1EP8 A;  1WE0 A;  2BJX A;  4XS1 A;  2YV7 A;  4ML6 A;  3C1S A;  5GAP D;  5J41 A;  3QAG A;  1ACV A;  3QCP A;  1SYX A;  1QFN A;  3VPQ A;  1MDI A;  1K3O A;  5AGY A;  4AJ6 A;  1TKD B;  2FUG 2;  5C04 A;  2V41 A;  4DSS B;  4RUV A;  2H66 A;  1UVZ A;  4BWQ A;  3A3T A;  4F82 A;  2BMX A;  1GP1 A;  1SK2 A;  2EIR A;  2LKU A;  3WD6 A;  2H74 A;  3K8N A;  5H5Q A;  2HT9 A;  2AAW A;  4DEJ A;  3US3 A;  1BX9 A;  1A8Y A;  3CMI A;  1YY7 A;  1TU8 A;  3TRP A;  5IMA A;  4ZIJ A;  2L6C A;  2OE1 A;  2G0F A;  1FAA A;  2L4Q A;  4Z7X A;  1EOH A;  1FW1 A;  1I9D A;  2FGX A;  2QGV A;  1FVJ A;  1E6B A;  1TRU A;  4KDU A;  3GYK A;  4MJB A;  2NTO A;  1UA5 A;  2IWT A;  5CRH A;  4OWY A;  5CNW A;  1WMJ A;  3RDW A;  5ECI B;  1BG5 A;  2C4J A;  4GQF A;  1OC3 A;  1QQ2 A;  4OFT A;  1X9M B;  3I69 A;  4O32 A;  17GS A;  2H75 A;  1T1V A;  3MWH A;  3GUS A;  1GSS A;  5JCU A;  4KGI A;  3SBC A;  2JU5 A;  3L78 A;  4L5L A;  1F9M A;  1ZOF A;  4JED A;  1T4Z A;  4X1U A;  2PVQ A;  2AYT A;  5CRD A;  3KCM A;  4XS4 A;  4L8E A;  5DAK A;  3RHC A;  4MK3 A;  3RPN A;  2VCQ A;  3TRX A;  2OE0 A;  4I2U A;  2FNO A;  5HR0 A;  2B7J A;  1J0F A;  4PXO A;  4AJ7 A;  3DVW A;  2R6K A;  5GZZ B;  3GKM A;  4ZIL A;  1J9B A;  2HNL A;  2F9S A;  5ECQ B;  4O5R A;  4OFN A;  1XOB A;  3NZN A;  1RQM A;  1JLW A;  3TDG A;  1GSY A;  2V32 A;  1GNW A;  2IMI A;  1YQ1 A;  2C3N A;  5IMC A;  2RUF A;  1K0C A;  2X8G A;  1SJZ A;  4YQU A;  4POL A;  3U6V A;  4EF0 A;  5IMD A;  2VL2 A;  4J2F A;  3M0F A;  2AJQ B;  3ZFB A;  3PGT A;  2MBS A;  2GSS A;  1I5G A;  4FYC A;  1SL1 B;  1S3C A;  4TR3 A;  1KNG A;  2R4V A;  2GZP A;  3HD5 A;  1GNE A;  1AQW A;  2WS2 A;  4WBJ A;  1R5P A;  2TIR A;  5B8B A;  1QMV A;  1TDI A;  3EE2 A;  4JE1 A;  1JLV A;  2JL4 A;  3G7I A;  1YEP A;  2HI7 A;  1FB0 A;  3M3M A;  1EV9 A;  2AB6 A;  4IP1 A;  2LJR A;  2LS5 A;  4G9H A;  4K9Z A;  4EDY A;  3P7X A;  3KH7 A;  4POB A;  2YWN A;  5CAX A;  2ALB A;  1TW9 A;  4RQR A;  3D5J A;  2H6Z A;  1XIY A;  4AGS A;  7GSS A;  3EYT A;  3UIW A;  3M8N A;  4XHM A;  3IA1 A;  5INY A;  2I4A A;  2XC2 A;  1PKW A;  12GS A;  3DXB A;  1XPV A;  1AC1 A;  3FHK A;  1A2J A;  4OD7 A;  2VCW A;  4PUR A;  3KD0 A;  4MZC A;  4FH8 A;  4LL1 B;  3IAM 2;  4O92 A;  5H5R A;  5LNK e;  3AY8 A;  4Q5N A;  4JBB A;  3F8U A;  4JZQ A;  2I9H A;  4TN8 A;  2M72 A;  2L57 A;  4IQA A;  3UJ1 A;  1V57 A;  4TOP A;  5D96 A;  4BL7 A;  1MDJ A;  3FZA A;  4NV5 A;  3L9U A;  4NWY A;  2DIZ A;  5J4U A;  1PX6 A;  2G2Q A;  2O85 A;  6GSU A;  2KHP A;  4YQM A;  4G19 A;  4DVC A;  2FD3 A;  4JRR A;  3ZRE A;  3UEM A;  2M46 A;  4K7I A;  1QXH A;  3ERW A;  3TUE A;  2C80 A;  1Z9H A;  4PNG A;  1T8E B;  2VM2 A;  1ZCP A;  5DQS A;  1PX7 A;  5CO3 A;  3M9K A;  5ABR A;  20GS A;  2GT6 A;  1SK1 A;  1AXD A;  3D21 A;  4ZL8 A;  4GST A;  1F3B A;  4O7H A;  4I6X A;  6GSS A;  2RLI A;  1O8W A;  3WYW A;  1WJK A;  1FOV A;  1THO A;  4TR1 A;  4MCU A;  1G0T A;  3KEB A;  3J7Y k;  2B5E A;  2YZH A;  5DJL A;  3TKQ A;  6GSX A;  3IXR A;  1USB A;  2VLU A;  2X64 A;  1JZD A;  1VGL A;  2OA7 A;  2GDR A;  3LWA A;  2P0G A;  4N0Z A;  2DML A;  2XPD A;  4HJM A;  2JAD A;  2VCX A; 
#chains in the Genus database with same CATH topology
 2IPA A;  1D6Y A;  2LYX A;  1XXU A;  2LQO A;  1WWJ A;  3GUR A;  2BNG A;  4EV5 A;  1DBY A;  3F7X A;  1U3A A;  5ELG A;  3ZFL A;  3GMF A;  1UC7 A;  1G6Y A;  1W89 A;  1MGW A;  1RTU A;  2GQM A;  5LCZ A;  4DSQ A;  4ACS A;  3TKS C;  1S5A A;  1BNF A;  2Y74 A;  3QAW A;  2PER A;  3ZRD A;  4Q5Q A;  1VRS D;  2IY2 A;  2V6K A;  3IAS 2;  5IG5 A;  1ERV A;  3FY7 A;  3LQ7 A;  1US1 A;  1RN1 A;  2WOH A;  4L8P A;  5IF6 A;  1EA2 A;  1AAZ A;  5D8I A;  4HZ4 A;  4TR4 A;  1ILO A;  1RN4 A;  5IEO A;  1N8J A;  1O6J A;  4NV2 A;  1HU9 A;  3FR6 A;  4PQI A;  4Q5R A;  3SVA A;  2R2J A;  1I2G A;  3DYR A;  3F14 A;  2DJK A;  4F2I A;  3FF0 A;  4TXV A;  1CYV A;  3KP9 A;  2DJ0 A;  2H0I A;  3KZT A;  2C0E A;  6GSY A;  2VL3 A;  3GL3 A;  3URP A;  2CFD A;  1BOX A;  4K90 B;  2YOI A;  1SAR A;  2GSR A;  1XWA A;  1JKG B;  3P2A A;  5LC7 A;  2M7O A;  3BCK A;  3WT2 A;  5CRE A;  3F9U A;  1HKX A;  2IUK A;  4FYB A;  4MDC A;  5EL8 A;  4GLT A;  3C8E A;  3CXG A;  3HYP A;  5G2Z A;  1FGQ A;  3EX9 A;  4PUF C;  2EIQ A;  3PCR A;  3CU3 A;  1RCL A;  3LYP A;  2C11 A;  2XSH B;  1B20 A;  1Z7R A;  5LD0 A;  5B8A A;  4X0X A;  2BT3 A;  1BRI A;  1ULJ B;  1BAO A;  3G8Z A;  1FGM A;  2DLX A;  1M2A A;  2CC3 A;  2XSO B;  3ED3 A;  3ER7 A;  4BL2 A;  2UZ8 A;  4NHZ A;  3IE3 A;  1GD3 A;  4FO5 A;  13GS A;  2H6Y A;  1W2Z A;  3N54 B;  4DKI A;  1RGL A;  5JBS A;  3ZL5 A;  3VUR A;  3LXZ A;  1C7H A;  5F0G A;  2WOF A;  4N6M A;  1BQ7 A;  3FR9 A;  4I97 A;  3PGB A;  4U13 A;  3X42 A;  1NB5 I;  5HFK A;  3F3Q A;  8CHO A;  1EGO A;  2HE3 A;  4MPF A;  4NRE A;  1QAL A;  2AV4 A;  4LYL B;  3HZ8 A;  4WBR D;  3IC4 A;  1ZMA A;  2XRX B;  3PH9 A;  4O5U A;  1RGK A;  3AMO A;  1WIK A;  1YZX A;  4IEL A;  3UAR A;  1BJX A;  5B6M A;  4R9K A;  3D3L A;  1WOU A;  3AGO A;  5D9W A;  1ZX2 A;  1BUQ A;  4IKH A;  4YAP A;  2XBI A;  5JCW A;  1IYY A;  2LRN A;  3BBY A;  2B1L A;  1NHY A;  2VAF A;  1RN7 A;  3EF8 A;  4R1K A;  2HZE A;  4NPB A;  3WGX A;  5ELA A;  5G5F A;  1B2U A;  2FWG A;  1UN2 A;  3NM7 A;  2JQ5 A;  3IV4 A;  3VFI A;  2P0X A;  4E8E A;  1VQM 3;  3UNL A;  2GGT A;  2C10 A;  3A2W A;  1YI2 3;  1V40 A;  5A4W A;  1RRL A;  1W01 A;  5KP1 A;  3EU4 A;  4E8H A;  1IT8 A;  2GT5 A;  3ZTL A;  4N6L A;  1U3I A;  3BNB A;  3CQF A;  3KTL A;  4KCA A;  4EXR A;  5IO0 A;  2TRC P;  4D73 B;  2QA2 A;  2K0M A;  1B3S A;  1K28 A;  1TI3 A;  2BMQ B;  5D9X A;  3EIN A;  3DZL A;  4BVY B;  3DKS A;  3W8J A;  2GXF A;  2WGR A;  3APQ A;  4ULX A;  3I0Y A;  3LOY A;  2M80 A;  3ME7 A;  1BSE A;  1RGC A;  3LZA A;  4CDL A;  4OK0 A;  2IYJ A;  1YDK A;  1OE7 A;  1B27 A;  1UCK A;  2DMM A;  2E2U A;  3G9B A;  4KT3 B;  2NBS A;  2L1S A;  4HQZ A;  5JCG A;  2J8X B;  2HMK B;  3FKA A;  1IQX A;  5AYR B;  3CCV 3;  4BIK A;  2DJ1 A;  3H8Q A;  4MA9 A;  1JZR A;  2R0G A;  3UOM A;  4HM5 B;  2VD0 A;  1HNA A;  5A0O B;  1EEJ A;  1M9A A;  3RAZ A;  4PUA A;  5AI1 A;  1K0B A;  1F37 A;  2PVO C;  3LJR A;  5D9T A;  1AQX A;  5J5N A;  3WHO A;  5DVB A;  4MJE A;  4L5O A;  3SOY A;  3GST A;  3CSI A;  3HY2 A;  1ERW A;  3LXT A;  1YGW A;  6STD A;  4YKG A;  4V2N A;  3UJM A;  2DC5 A;  3HVV A;  1SKR B;  5DAL B;  4AJ8 A;  1KSI A;  1R4C A;  1JZO A;  1XWK A;  2HSH A;  4MJD A;  2X4A A;  2I3Y A;  1AIU A;  3HCZ A;  4LSO A;  2LRT A;  5IG0 A;  5CP1 A;  3L9S A;  4FMB A;  1VQO 3;  2RM5 A;  2GLR A;  5A4U A;  1NWW A;  3AHW A;  1NSW A;  1OAC A;  2C3Q A;  1C54 A;  1ULI B;  3VF1 A;  3FZ5 A;  1DE1 A;  2KXG A;  1PKZ A;  3FG4 A;  3GX0 A;  4MNN A;  2OQE A;  5HFG A;  3WMD A;  4DSS A;  1OAZ A;  4O02 B;  4GB5 A;  2DIY A;  2RUE A;  2JSZ A;  1GUH A;  5AEU B;  3GSP A;  4KW6 A;  3HJO A;  1A2V A;  1VQP 3;  3D6I A;  2CFG A;  4RNT A;  3NBJ A;  2GQK A;  4BVX A;  1G02 A;  3P90 A;  3LTD A;  3V98 A;  2YPM A;  2QA4 3;  1NNV A;  1URM A;  4JU5 A;  4FMD A;  3J7Y b;  1Q86 4;  1K73 4;  1VQN 3;  5KOX A;  1XZO A;  3HOH A;  2R0P A;  2A2P A;  2JSY A;  4LA1 A;  4KSO A;  3T8N A;  2W6J H;  4IJ3 A;  3MG3 A;  7RNT A;  3APS A;  1MNL A;  4J57 E;  1BU4 A;  1K3Y A;  3S5C A;  1GOY A;  2KP1 A;  3OWS A;  1M2D A;  2A2R A;  4YKF A;  1IV9 A;  3KE7 A;  1FYS A;  4MZW A;  1KEB A;  2PUK C;  4NHF A;  1U87 A;  1YF1 A;  1SL2 B;  3TKR A;  1KWI A;  4EIQ A;  1LQM B;  3R3E A;  1W6C A;  7STD A;  5LC6 A;  5GSS A;  1LVN A;  1GTU A;  1R4W A;  1AV4 A;  4G0L A;  1B2Z A;  1Q98 A;  1B2M A;  3TKS A;  1G6W A;  3D5I A;  3IOS A;  2FWF A;  1J2B A;  1N5P A;  3FZ4 A;  1K0N A;  3RNT A;  4MMX B;  22GS A;  5ECO B;  1RK4 A;  3I9V 2;  4X43 A;  2CK3 H;  3VWU A;  1SD8 A;  4WR4 A;  2CX3 A;  1W7C A;  3HIG A;  2WGO A;  1F6M C;  2N5B A;  2QGU A;  3CC4 3;  4KH7 A;  1STD A;  2H1B A;  3ZIV A;  1Q82 4;  3K63 A;  4K0G A;  3A2X A;  3SOA A;  4EIP A;  3SX1 A;  3NHX A;  1T7P B;  3UMA A;  4HVN A;  2A15 A;  3A5W A;  2CW9 A;  3C1R A;  1A0R P;  3LTC A;  1GH2 A;  3GTU B;  1SQW A;  4O2H A;  4Q5F A;  1F2E A;  1ST9 A;  1MTC A;  3I6A A;  3IK7 A;  3EBY A;  2F86 B;  2V1M A;  3SLU A;  3KGK A;  4H3U A;  5HFI A;  1RMS A;  3UBK A;  3FLJ A;  1M0U A;  1WTH A;  2FHE A;  5M1A A;  5IEP A;  2C1Y A;  1K41 A;  2WJU A;  3WGE A;  1JRQ A;  3H93 A;  1XWC A;  4K0N A;  4K7N A;  2L59 A;  1WRY A;  2GSP A;  1VF1 A;  1PY3 A;  4A5P A;  1DSB A;  1EZK A;  2YJ7 A;  1BRJ A;  1Z3E A;  3UL5 A;  5TGN A;  1JB4 A;  2IUJ A;  3O8Y A;  4WR5 A;  1A2P A;  3GAX A;  3DGL A;  1YKC A;  4MJC A;  3BB9 A;  3DML A;  1LOX A;  5DRE A;  1ZYP A;  3F4S A;  3JCM L;  2KLX A;  1BAY A;  3S28 A;  3WA2 X;  1OH0 A;  1SIH A;  3CTG A;  1UI8 A;  4GWR A;  1W6G A;  3CRT A;  4ZBA A;  2JZR A;  2P05 A;  3ZMK A;  2CVB A;  4YH2 A;  2YZU A;  4X4J A;  3W6G A;  1EP7 A;  4HBR A;  2E2M A;  4XB5 A;  4XCS A;  3EN8 A;  5AN1 A;  4IGJ A;  5JWO B;  2LUS A;  1YIJ 3;  3H79 A;  2FGT A;  2B6M A;  3K5T A;  3F0I A;  3PCS A;  4IHU A;  1X1U A;  1PL1 A;  1SKS B;  2C0D A;  1RGE A;  1Z6M A;  1A2M A;  4BU4 A;  3GX8 A;  3IPZ A;  1B48 A;  5JWR B;  4KVH A;  3O76 A;  3H4K A;  4GF0 A;  4EXJ A;  1SD9 A;  3OR5 A;  2C4B A;  2VLT A;  2H30 A;  5D73 A;  6GSW A;  1MD4 A;  3IHG A;  1ROA A;  2HRF A;  1FGT A;  2N5A A;  3VWX A;  3PZW A;  1Z5Y E;  1IVW A;  2R37 A;  1XWB A;  1GL8 A;  1N5H A;  1O7M B;  1MWS A;  2F99 A;  3MWZ A;  5JWQ B;  3IR4 A;  2B5Y A;  4NXI A;  3EMP A;  1I3F A;  1NO3 A;  2KF6 A;  1UCL A;  16GS A;  1IV7 A;  2L5L A;  2XHF A;  3BD2 A;  3QR6 A;  1U6T A;  4HS1 A;  3C7M A;  3TRQ A;  2CVD A;  3DD3 A;  3FMW A;  3A2V A;  3M8C A;  2BMO B;  5M19 A;  1BGS A;  5D82 A;  1TTO A;  5FWG A;  3TJB A;  1BNJ A;  2O7K A;  1BUJ A;  3ME8 A;  4V2M A;  1Q7Y 4;  2L4C A;  4ID0 A;  3Q74 A;  3V99 A;  2F5W A;  1O81 A;  2XF3 A;  3HKR A;  4RI6 A;  4HQS A;  3GL5 A;  3JUP A;  2JZT A;  3GZB A;  5ECP B;  3VWW A;  1MOL A;  3KZQ A;  3IK9 A;  4GHO A;  1QAK A;  1RNT A;  4HOH A;  1PN0 A;  3D22 A;  4KSM A;  1GLQ A;  1TOF A;  5B7C A;  3CMA 3;  3TJF A;  1HQO A;  5IPG A;  2I81 A;  3CSH A;  4BTY A;  4HJ2 A;  1OVN A;  1WQL B;  2JAD A;  3NM2 A;  2HFD A;  2D42 A;  1FO5 A;  2IFQ B;  5DJM A;  1VZZ A;  2GS3 A;  1BNG A;  4FMA A;  2PBJ A;  5IQY A;  4X2H A;  5L71 A;  3HII A;  2E2T A;  1M9B A;  1SL0 B;  1W4V A;  3SWL A;  3ERG A;  1T4Y A;  2QSI A;  1NM3 A;  3LSZ A;  2DKH A;  5JPP A;  3FYG A;  1XVW A;  1JV2 B;  5CXO A;  5KN3 A;  4FCZ A;  4HM1 B;  1SU9 A;  4BIR A;  4HI7 A;  3FG3 A;  4IW9 A;  5HOH A;  1ZGX A;  2CT6 A;  4MH3 A;  3G7J A;  3EVI A;  4GTU A;  4QQ7 A;  4KFD A;  1GS3 A;  5ECM B;  2VLV A;  2E0Q A;  4TX4 A;  1HNC A;  3MHE A;  3WR2 A;  3F6D A;  3F4T A;  3LW9 A;  2MYG A;  4WET A;  2CHC A;  1BAN A;  2E2G A;  2F8A A;  4OO4 A;  1E3V A;  1TP6 A;  5H5S A;  3EJV A;  4L0U A;  3LEF A;  4KDY A;  1GRX A;  3LGC A;  4IBP A;  2N5F A;  2KAA A;  4KZ1 A;  4F0B A;  3MG1 A;  18GS A;  4MH2 A;  5EY6 A;  2GVP A;  5ECS A;  2OQE C;  4IQ1 A;  3UVH A;  5HQP A;  3DIE A;  3FGY A;  4J5K A;  1YJW 3;  2NPB A;  3KSP A;  1QK8 A;  4G10 A;  4F0C A;  2Z6B A;  4EL1 A;  3G0K A;  8GSS A;  3QFB C;  3ECF A;  3LTA A;  3ISO A;  1TK0 B;  2HSM A;  2YP6 A;  4N6N B;  5G31 A;  4WWU C;  1A8L A;  3KMO A;  3KTB A;  3RGA A;  3GNJ A;  3SYU A;  4XBY A;  4WP5 A;  1VF4 A;  1X5E A;  5FHI A;  4KA0 A;  2C8U A;  2X99 A;  1YF0 A;  1RGF A;  2KCD A;  3G16 A;  4ORL A;  2WFC A;  2IMD A;  3WDG B;  3IRA A;  2PZV A;  2P09 A;  4N6T A;  5EEO A;  2CZ2 A;  2E2V A;  5G1L A;  3APO A;  2GEX A;  2HXK A;  4HU9 A;  3UAP A;  4BTW A;  3TOU A;  3N9H A;  4TXO B;  4BPY A;  1W4N A;  4K2D A;  3ZML A;  3MSO A;  1WP0 A;  1Q81 4;  4IVF A;  3CPW 2;  1IVX A;  4QL7 A;  1OF5 B;  2OTJ 3;  1ML6 A;  5IO2 A;  5AIS A;  1UW1 A;  1V9W A;  2L6D A;  3GV1 A;  1GTA A;  3IJE B;  3EHC A;  3GH6 A;  2H8L A;  2HRK A;  2QC7 A;  5ECH B;  4L0W A;  5A5K A;  3KKG A;  2HMN B;  2VUP A;  3NV0 B;  4XBX A;  2OBK A;  1EQK A;  3NQY A;  2RFR A;  2QKE A;  5G2G A;  3B8L A;  3FSD A;  1T5Y A;  1A2K A;  5JPU A;  1K0M A;  1GOU A;  1OKT A;  3P8W A;  1NW2 A;  3ZLP A;  2UUG C;  2RNT A;  1OKD A;  2FCH A;  1Y6E A;  4K8M A;  1TK8 B;  3BCI A;  4KFE A;  2OAC A;  1Q42 A;  4EVM A;  1BSB A;  4RBN A;  1DUG A;  4AKZ A;  4WHA A;  3TGZ A;  2H76 A;  3GRD A;  1DVD A;  3CSJ A;  1C72 A;  3O3T A;  1H4O A;  1PQN A;  5AIX A;  1OF5 A;  1I2E A;  1YNV X;  1F8N A;  3A76 A;  2O89 A;  2H1D A;  4HUA A;  4USS A;  1TRQ A;  1O7U A;  4K2X A;  2LJK A;  4ZL9 A;  2H70 A;  1GSE A;  2Z77 A;  1M3J A;  3H1N A;  2B7K A;  5G5E A;  1G96 A;  4GL6 A;  3I55 3;  1KTE A;  1RLS A;  1O7P B;  2YAN A;  1OC9 B;  1ASK A;  2W56 B;  1HYF A;  3GZX B;  2EIO A;  1MWU A;  2MZC A;  1RRH A;  2IMK A;  1R4Y A;  2BMR B;  4CY6 A;  1LOY A;  1ZS7 A;  4FIW A;  1B4P A;  1HYU A;  4P3Y B;  3QK9 A;  1WMN A;  1GWC A;  3FKF A;  4WFO A;  5BMU A;  1BED A;  2CIU A;  3KII A;  5J9B A;  3A5I A;  3RBT A;  1V2A A;  3G6E 3;  1LXE A;  4TW5 A;  5CF2 A;  3LT8 A;  4WYK B;  5G30 A;  1FZU A;  4HYZ A;  5HR3 A;  2VCV A;  1JKG A;  1BSC A;  1W2B 2;  1M2B A;  3FF2 A;  3TKP A;  1FVK A;  3HVX A;  2F51 A;  4ECB A;  3GH9 A;  1GMP A;  1CYU A;  1YJ6 A;  2X49 A;  1XCC A;  1TP9 A;  2XEP A;  4KAE A;  5D93 A;  4EUY A;  3JVC A;  4HU7 A;  1MGR A;  1Y25 A;  1R7H A;  3DWV A;  3CXC 2;  2H71 A;  2ML5 A;  2LTK A;  3DGN A;  3HZP A;  1QUW A;  3MSZ A;  2HZF A;  2FNQ A;  2AAD A;  5DCG A;  4HEA 2;  2RBI A;  2PN8 A;  2ZUP A;  3HK4 A;  1BRG A;  1XW6 A;  3ZG0 A;  3KM6 A;  3ZYW A;  3DGY A;  1Y4K A;  2OTL 3;  2PGT A;  4GSS A;  4F9Z A;  3Q18 A;  1JBS A;  1IYI A;  3X3Z A;  3SED A;  2CA8 A;  2F5M A;  1IK3 A;  3HJM A;  2H0H A;  1X0R A;  5HR1 A;  3FR3 A;  5DDL A;  1TUH A;  4RNZ A;  2LST A;  4WYK A;  5ECK B;  2MC8 A;  3LG6 A;  2SAR A;  1IQY A;  2RM6 A;  1T00 A;  2Z9S A;  2X8C A;  1ISK A;  4HZ9 B;  2B24 B;  2CAQ A;  1AQV A;  3F8H A;  3MG2 A;  3BJ5 A;  3GHA A;  1K0O A;  4MLY A;  5ID2 B;  4N3V A;  1BRH A;  1I70 A;  1J08 A;  2KOK A;  4PQH A;  4GSN A;  2LEG A;  4ICY A;  4WKW A;  4MAB A;  1M3I A;  1QGV A;  1EUI C;  2HML B;  1PL2 A;  1PU4 A;  1B8X A;  3CTF A;  1KBN A;  1V98 A;  1GSQ A;  2XPE A;  1GMR A;  2OKA A;  3VK9 A;  3GRX A;  1MD3 A;  1XOA A;  2OAD A;  1O85 A;  2DKI A;  1JB5 A;  2ZNM A;  4MMZ B;  1BIR A;  3LTB A;  3DGM A;  3CD6 3;  1VQ8 3;  3S67 A;  3KCH A;  2WUL A;  3K0Z A;  4LMI A;  4RNY A;  3EBT A;  3WOF B;  3FW2 A;  3Q90 A;  1LU4 A;  2GSQ A;  2IN3 A;  2H01 A;  2MMN A;  3OW2 2;  4V1A p;  4DSR A;  1A23 A;  3EB8 A;  3UL6 A;  3X40 A;  5CF1 A;  1A2L A;  3F9S A;  4TKY A;  1OCV A;  3KJY A;  1VQL 3;  1UGH I;  1D6Z A;  1S3R A;  4K1V A;  4PX1 A;  1JN5 B;  4HAA A;  2P31 A;  4K5S A;  2GZZ A;  4K7O A;  5ID2 A;  2CG0 A;  1PA3 A;  3KSE D;  4STD A;  4MF5 A;  2HLS A;  1X5C A;  4ECJ A;  4OCE A;  3F40 A;  1FG4 A;  3BOA A;  1TRV A;  4D73 A;  1TRS A;  1SKW B;  1T2H A;  4EC0 A;  3KMN A;  1PSQ A;  1N9J A;  4ZB9 A;  5B6N A;  5D81 A;  2LNT A;  4XRA A;  4XTS A;  1ABA A;  2OJL A;  4BVY A;  1YJN 3;  2TRX A;  5IOX A;  5ECR B;  2LQV A;  1AVL A;  3TJJ A;  2W9Q A;  1X9W B;  6GST A;  3LYG A;  1WMO A;  3EU3 A;  3EN1 B;  4KB3 A;  3UVT A;  3KP8 A;  2O8V B;  3Q2P A;  2DJJ A;  3BND A;  2KRT A;  3BLZ A;  3OV4 A;  4ZL7 A;  3JUN A;  2AUV A;  3ZVJ D;  1A24 A;  4V1A g;  1K8A 4;  2I1U A;  5HR2 A;  1GSD A;  1CQG A;  1TK5 B;  2VCT A;  5IIZ A;  3GKN A;  3M1G A;  1ZGN A;  1M1K 4;  1VQ5 3;  4NHW A;  4OVM A;  5KN0 A;  2GST A;  1FOH A;  2WCI A;  1VF3 A;  4MP4 A;  3ZVJ A;  3L0H A;  1RDS A;  3J7Y d;  5D9V A;  1R5A A;  4EYC A;  5IMV A;  5F05 A;  3GIX A;  1MEK A;  1XWG A;  2HMJ B;  1PN9 A;  5FGO A;  1WMP A;  3GKX A;  4XS4 B;  2YNX A;  3T0U A;  5DAK B;  5DAL A;  3S9F A;  2P0M A;  2IJY A;  3EC9 A;  1IVV A;  5COH A;  1Q40 B;  4QWT A;  1RCK A;  2DSA A;  4XDV A;  1DE3 A;  3N5O A;  1GTI A;  1OPY A;  2IA7 A;  1GUK A;  1PRX A;  4OO5 A;  4KCE A;  3CCQ 3;  1FUT A;  2R41 A;  1ERU A;  3CCU 3;  2V2G A;  2VCZ A;  3E3E A;  3IDV A;  2ZCT A;  5ENU A;  2C0F A;  2H73 A;  2GZY A;  3C73 A;  4Z2R A;  2OBI A;  4LLR A;  3DY5 A;  4HM7 B;  4G0K A;  2JDI H;  5BU4 A;  2WB9 A;  1YJ9 3;  4WEY A;  4PNF A;  1JZW A;  1Q7H A;  1ZL9 A;  2L5O A;  3DEX A;  2PWJ A;  4O3V A;  2VIM A;  3C71 A;  3MNG A;  3CCR 3;  4GXZ A;  2DBC A;  1SEN A;  2PMT A;  1UGI A;  4JF8 A;  4IN0 A;  1ZZY A;  4KND A;  3NX0 A;  1WPI A;  3FK8 A;  1PD2 1;  5GSP A;  4WXT A;  2XGL A;  2CAI A;  1GD4 A;  3NQZ A;  2E7P A;  1UUG B;  2B1X B;  4MPG A;  1E2Y A;  3D9R A;  1FB6 A;  2H0G A;  3LOR A;  3TCO A;  5C00 A;  14GS A;  1Z7P A;  2R0C A;  4HOJ A;  4EC6 A;  4KDX A;  2WDU A;  2CWU A;  1TI1 A;  2B3S A;  1B9X C;  2K6V A;  1BRK A;  4ZBD A;  2YWI A;  5IPH A;  4LGQ A;  1M7T A;  5ELJ A;  2LNS A;  2XBQ A;  1RKY A;  3KH9 A;  3QRD A;  2KP2 A;  3GFK A;  4Q53 A;  2IL3 A;  3FEU A;  2CKF B;  1SJI A;  1VQK 3;  2OE3 A;  2K3D A;  2IMJ A;  2K8V A;  1YKA A;  5CRG A;  1GUL A;  3H51 A;  2VO4 A;  3JUQ A;  4R80 A;  4KF9 A;  5IER A;  5FT3 A;  2KUC A;  4N10 A;  4MF7 A;  3CCM 3;  2ES7 A;  1FHE A;  11GS A;  1HD2 A;  3FZ9 A;  3STD A;  4ZXG A;  5AII A;  3VPT A;  5GAN D;  1GTB A;  5E59 A;  1X9S B;  4JR4 A;  3VWV A;  1EWX A;  2HRN A;  5CYY A;  2YX9 A;  1ROV A;  4IS0 A;  5F07 A;  5ECL B;  5A4V A;  1FGO A;  2Z76 A;  2B5X A;  2MBT A;  2VD1 A;  4IJI A;  3GTU A;  4IP6 A;  2LQQ A;  9GSS A;  2YWO A;  2BO9 B;  3RDE A;  4LMV A;  5DQY A;  3D0Z A;  3JUO A;  2FLS A;  4GQC A;  3HZ4 A;  4GCI A;  4G1M B;  4ZB6 A;  1EGR A;  2K18 A;  5ECN B;  1O7N B;  4N0V A;  2PPT A;  1OYJ A;  2ZL8 A;  2NVL A;  4YAV A;  2LRC A;  3EUR A;  4WF4 A;  3GN3 A;  1DYU A;  3N9J A;  2XH9 A;  1OHS A;  1RW1 A;  4HKV B;  2HYX A;  3EMX A;  1JHB A;  2IME A;  1X5D A;  2YWM A;  4XRD A;  3CNX A;  1AVK A;  1XW5 A;  1L5G B;  3U5R E;  2A4V A;  1GSU A;  3Q3F A;  3G7Y A;  2J23 A;  1U88 A;  4BL7 B;  3WOD G;  5DRV A;  4ILF A;  2Q07 A;  1AW9 A;  2RII A;  5AIV A;  2LJA A;  1G7E A;  2F56 A;  3DGO A;  3Q19 A;  1N8R 4;  1PFO A;  1I0X A;  3EC3 A;  2HSY A;  4WF5 A;  1B4Q A;  5CRW A;  4HM8 B;  1IT7 A;  2WRT A;  1M99 A;  4MF6 A;  1VF2 A;  5E4W A;  3RGR A;  3BU4 A;  1O8X A;  4G2E A;  1LOV A;  1XFL A;  3QFA C;  4N6U A;  4CDO A;  3CC2 3;  1EG9 B;  1W6Y A;  1CH0 A;  1TXX A;  19GS A;  5KP3 A;  2IIY A;  2YFL B;  5CK6 A;  3CCL 3;  2P5R A;  2CX4 A;  3CCS 3;  1E97 A;  1GLP A;  2PU9 C;  5F8B A;  3Q6O A;  2REM A;  3HJP A;  2YV9 A;  5BVB A;  1EV4 A;  5J3R A;  2JZS A;  4PGT A;  1TRP A;  2EC4 A;  3X3Y A;  1RGG A;  3ROB A;  1RNB A;  3MYT A;  2C0G A;  3KIJ A;  2VM1 A;  4XIH A;  4HJL B;  3GZY B;  2J9H A;  4TR1 B;  2K8S A;  3HDC A;  4EDZ A;  2OOV A;  2ML6 A;  1FUW A;  1PGT A;  3IBH A;  4KE3 A;  5KEJ A;  4CW9 A;  1W02 A;  1M90 4;  4K1F A;  4I5Q A;  1OE8 A;  1FGR A;  4I2T A;  1HNB A;  1OC8 A;  4EKZ A;  4YQV A;  3NIV A;  1OGX A;  1K9M 4;  3K7C A;  1ZYE A;  5KOW A;  2PNC A;  3MAK A;  1U5O A;  3DVX A;  1I8V A;  2CWT A;  5IW9 A;  3TKS E;  2FWH A;  3LFL A;  2IFQ A;  2RSX A;  3GWR A;  5IMF A;  3HX8 A;  3UL3 A;  3TJG A;  3F6F A;  1SJ6 A;  1JFU A;  2MMZ A;  3VLN A;  3L4N A;  4NAX A;  2W03 A;  1PFP A;  3D4M A;  1CEW I;  1IDP A;  5DBQ A;  3V92 A;  2R5G A;  5F06 A;  1TTZ A;  4KUN A;  4OUQ A;  5IMZ A;  4ECI A;  4N11 A;  2NDO A;  2F4Y A;  2YJH A;  3EWL A;  4N30 A;  4BA7 A;  3CNM A;  1MDK A;  3VSY A;  3WGD A;  1Z1S A;  1DMM A;  1KQS 2;  4NMU A;  8RNT A;  5CLK A;  5IG3 A;  2FA8 A;  3LML A;  2A4H A;  3F3R A;  3ERF A;  4HM2 B;  1GUM A;  1N8Q A;  3EPT A;  2ON5 A;  4HM6 B;  4JR6 A;  1RHL A;  2H1G A;  4K61 A;  1O7W B;  5IM9 A;  1K0D A;  4TRX A;  4XBT A;  1Z6N A;  2VL9 A;  2H19 A;  3F4R A;  1S3D A;  1EEM A;  2GQL A;  1TRW A;  3QMX A;  4IIA A;  1X1X A;  2Z7A A;  1NHO A;  1E3R A;  1THX A;  3X3X A;  4R4K A;  2OWP A;  4OFM A;  3L9V A;  2GEY A;  2CWV A;  2D1W A;  4BTX A;  3RPP A;  3DGQ A;  4ISD A;  4MJA A;  3IHQ A;  3ZZX A;  3S29 A;  4OMV A;  3E0U A;  3OWY A;  4RQX A;  2W2C A;  3NOF A;  3N8B A;  2FY6 A;  4MZB A;  1MWR A;  4H86 A;  2FA4 A;  5G1K A;  3TB2 A;  1I2F A;  1K0A A;  1DE2 A;  1V58 A;  2K9F A;  1SYR A;  2KF3 A;  1ERT A;  10GS A;  2BHM A;  2A2S A;  3TJK A;  5GST A;  4FYU A;  3OXA A;  1BRS A;  3QAV A;  5EVH A;  1BNI A;  3K9M C;  2KF5 A;  2AHE A;  1DMN A;  1QJG A;  1TJD A;  5KN2 A;  3D4T A;  4GRF A;  1S3A A;  4TXO A;  3ZIJ A;  1S72 3;  3IC8 A;  3KXO A;  4EBG A;  4FR9 A;  5IOW A;  2C3T A;  2H6X A;  4O8S A;  1A0F A;  1IVU A;  2YCD A;  4I8B A;  3E9J B;  3DM8 A;  2WZ9 A;  2P5Q A;  1STF I;  1VQ4 3;  2CQ9 A;  3QPM A;  4CHS A;  3V1W A;  1W00 A;  5EPF A;  1GSF A;  2IMF A;  3MDK A;  2R3X A;  4RZM A;  4EE0 A;  2YN1 A;  3HA9 A;  1F3A A;  2FWE A;  1YEX A;  4K6X A;  1YIT 3;  4KX4 A;  3VI5 A;  4BWS A;  3NV0 A;  2X8H A;  4CPK A;  3DMC A;  2GU1 A;  1TFK A;  3F63 A;  3GKK A;  2VL2 C;  2W0Q A;  4Z2T A;  2ON7 A;  5KN1 A;  1UCJ A;  3S27 A;  4PEJ A;  3B7C A;  3PIN A;  3DH2 A;  3WOE B;  2CZ3 A;  1A67 A;  3GSS A;  1LJR A;  3NUV A;  2JAC A;  1BNR A;  1O7G B;  3AMO B;  4XM4 A;  2QEX 3;  5J9C A;  3LH4 A;  3ALA A;  3RHB A;  1LBK A;  2GTU A;  2KF4 A;  1K3L A;  2QIY A;  1CQH A;  1VQQ A;  3PYJ A;  3Q1C A;  3MPH A;  4ZBB A;  4TVE A;  1N2A A;  4POK A;  1OHP A;  1M9G A;  2V1L A;  1SPU A;  3CCJ 3;  1Q4J A;  2CV4 A;  2HZE B;  1B9Y C;  3M9J A;  1KC8 4;  4RI7 A;  4LL4 B;  1T3B A;  1VQ9 3;  1SK0 A;  2V6O A;  1LRA A;  1BSD A;  1TU7 A;  4ML1 A;  1IYH A;  5I97 A;  3WT1 A;  3EQQ B;  2D2Z A;  3W8S A;  4N6V 0;  1JB2 A;  2MF7 A;  1BSA A;  4N6O B;  4HZ2 A;  1FA3 A;  4PQ1 A;  3AGN A;  1OC9 A;  1H75 A;  6GSV A;  2W56 A;  1O73 A;  4QL9 A;  4LZI A;  1XW9 A;  3HXS A;  4LMW A;  2R4I A;  4MEI A;  2LV3 A;  4EW5 A;  2W04 A;  4H61 A;  4EO3 A;  3QDN A;  4TR0 A;  2Y73 A;  3FCS B;  1OHO A;  2F3M A;  2AAE A;  1ZYQ B;  4ZB8 A;  3ZIT A;  4MMM A;  2H72 A;  2VOC A;  3PR8 A;  2O87 A;  2F8F A;  4OCF A;  2MMA A;  4HDE A;  2WGQ A;  1BYE A;  1UCI A;  4PTS A;  2BTO T;  2MMO A;  4J56 E;  5DCH A;  4ECC A;  1W5Z A;  1AUC A;  1BNS A;  3G71 3;  3TOT A;  4AF2 A;  3DRN A;  3O6T A;  4LEH A;  1NDO B;  3QOU A;  2DJ2 A;  3CBU A;  5EVO A;  1XVQ A;  3VI7 A;  1NJI 4;  3FRC A;  3I43 A;  1GYB A;  3AHS A;  4V2L A;  1R26 A;  3GZR A;  1X1W A;  1RGA A;  4F03 A;  3DUK A;  3HVN A;  1T2I A;  1PMT A;  2CVK A;  1ON4 A;  3CRU A;  3HVS A;  4POM A;  3B4O A;  2DJ3 A;  2CFK A;  1EOG A;  3UBL A;  2H1A A;  3GA4 A;  2HRA A;  1LNI A;  3QD9 A;  1DVC A;  1XBS A;  3D5G A;  1IQ8 A;  4JRF A;  1PYL A;  3HHV A;  4XS6 A;  1G7O A;  3R2Q A;  3LYK A;  2B1K A;  3CYN A;  1EP8 A;  4L8O A;  1WE0 A;  3H3H A;  1DET A;  2BJX A;  4XS1 A;  2K54 A;  3G4S 3;  3NBB A;  2YV7 A;  4ML6 A;  3C1S A;  1ZO2 A;  1U8C B;  5GAP D;  1GMQ A;  5J41 A;  3QAG A;  1ACV A;  3E99 A;  3QCP A;  3FG1 A;  2OOV C;  4I4K A;  5AIH A;  1SYX A;  1QFN A;  1B2S A;  1VQ7 3;  3VPQ A;  1MDI A;  5IG4 A;  4FCM A;  1K3O A;  5AGY A;  2QA1 A;  4AJ6 A;  2W9P A;  2FUG 2;  1TKD B;  5C04 A;  2V41 A;  5AIG A;  4DSS B;  5KP4 A;  4RUV A;  3LXU X;  2H66 A;  1UVZ A;  2F98 A;  2I9W A;  4BWQ A;  3A3T A;  4F82 A;  4GSP A;  2BMX A;  1GP1 A;  1SK2 A;  5M18 A;  2EIR A;  4BVX B;  5AYS C;  2LKU A;  5STD A;  2P38 A;  4O5Q A;  3WD6 A;  2ZDJ A;  3WA3 A;  1JJ2 2;  2H74 A;  4CY8 A;  1YVB I;  1I3I A;  4HM4 B;  5EQL A;  3K8N A;  3HI7 A;  5H5Q A;  4IPB A;  2HT9 A;  1LNH A;  1TU5 A;  2AAW A;  4DEJ A;  3US3 A;  1RSN A;  4K1U A;  3KN4 A;  1BX9 A;  1M1X B;  2BIR A;  2CX0 A;  1A8Y A;  1YY7 A;  1SII A;  1YVS A;  3CMI A;  4J9A A;  1TU8 A;  3TRP A;  5IMA A;  4XDW A;  4ZIJ A;  4FCJ A;  2XFS A;  3ZG5 A;  2L6C A;  2OE1 A;  1RGH A;  1JN5 A;  1CQS A;  1UUW B;  2G0F A;  4KFF A;  2RCD A;  1FAA A;  2L4Q A;  1JNQ A;  3BNE A;  4Z7X A;  1EOH A;  3VGN A;  1FW1 A;  1I9D A;  2FGX A;  2GBW B;  2QGV A;  3X41 A;  4HM0 B;  4ZM8 A;  1FVJ A;  1E6B A;  1TRU A;  4KDU A;  3GYK A;  4MJB A;  1XG8 A;  3NXJ A;  2NTO A;  1UA5 A;  1DMQ A;  2CFW A;  1QVF 2;  2IWT A;  3MIX A;  5CRH A;  4OWY A;  1WNH A;  5CNW A;  1WMJ A;  3RDW A;  5ECI B;  1BG5 A;  5ELU A;  3A5E A;  2C4J A;  3F8X A;  1AY7 A;  4K5R A;  3U97 A;  4GQF A;  1OC3 A;  1QQ2 A;  1MWT A;  4OFT A;  1X9M B;  3I69 A;  4O32 A;  17GS A;  2H75 A;  1T1V A;  3MWH A;  3GUS A;  1GSS A;  5JCU A;  3D79 A;  4L7K A;  4KGI A;  3SBC A;  2JU5 A;  3L78 A;  4CCV A;  4L5L A;  1F9M A;  1ZOF A;  4JED A;  1T4Z A;  4X1U A;  2PVQ A;  2AYT A;  5CRD A;  3KCM A;  4AEQ A;  1I0V A;  4XS4 A;  5AIF A;  4L8E A;  5DAK A;  3RHC A;  1GY5 A;  4MK3 A;  1EKM A;  3I56 3;  3RPN A;  3IMA B;  2VCQ A;  5BRT A;  3TRX A;  1Q40 A;  1D6U A;  2OE0 A;  1BVI A;  4I2U A;  2FNO A;  5HR0 A;  2B7J A;  1J0F A;  4HZB B;  4PXO A;  4AJ7 A;  3DVW A;  2R6K A;  5GZZ B;  2HMO B;  1B21 A;  3GKM A;  4ZIL A;  1J9B A;  2HNL A;  2CG1 A;  2F9S A;  4AKY A;  5ECQ B;  3KFQ C;  4O5R A;  4OFN A;  1XOB A;  3NZN A;  2FXT A;  1RQM A;  3TDG A;  1JLW A;  5FW5 A;  4R9L A;  4BL3 A;  7GSP A;  3D4A A;  1GSY A;  2V32 A;  1GNW A;  2IMI A;  1YQ1 A;  2C3N A;  5IMC A;  2RUF A;  1GY6 A;  1K0C A;  1SJZ A;  2X8G A;  4YQU A;  4POL A;  3CME 3;  1UI7 A;  2GBX B;  1HZ1 A;  3NBR A;  6GSP A;  3U6V A;  4EF0 A;  2L4V A;  5IMD A;  5BXQ A;  2VL2 A;  1O7H B;  4J2F A;  3ZFZ A;  3M0F A;  2AJQ B;  3ZFB A;  3UB1 A;  3PGT A;  2MBS A;  3FZW A;  1TIJ A;  2GSS A;  3BNC A;  3OWU A;  2O9U X;  1I5G A;  4FYC A;  1SL1 B;  1S3C A;  4TR3 A;  1KNG A;  2R4V A;  2GZP A;  3HD5 A;  1GNE A;  1B2X A;  1AQW A;  2WS2 A;  4WBJ A;  1R5P A;  2TIR A;  3L0R A;  5B8B A;  1QMV A;  1TDI A;  1KD1 4;  3EE2 A;  4JE1 A;  1JLV A;  2JL4 A;  3G7I A;  1FW7 A;  1YEP A;  2HI7 A;  1FB0 A;  3M3M A;  4HSC X;  1EV9 A;  2HOH A;  2AB6 A;  4IP1 A;  2XR8 B;  2LJR A;  2LS5 A;  4G9H A;  4K9Z A;  4EDY A;  5AEW B;  1A90 A;  2OCT A;  1VQ6 3;  3PXM A;  1UUV B;  3P7X A;  4CJN A;  3KH7 A;  2XFT A;  3MYD A;  4POB A;  2YWN A;  5CAX A;  2ALB A;  1OUN A;  1AR0 A;  1AQZ A;  3PS8 A;  2YFJ B;  4X2O A;  1TW9 A;  2CX1 A;  2UX0 A;  4RQR A;  3PPU A;  3D5J A;  2H6Z A;  1XIY A;  1BNE A;  4AGS A;  7GSS A;  3EYT A;  3UIW A;  5RNT A;  1YGE A;  3M8N A;  4XHM A;  3IA1 A;  5INY A;  3FH1 A;  2WO0 A;  4HM3 B;  2ZA4 A;  2I4A A;  2XC2 A;  1PKW A;  12GS A;  3DXB A;  2UGI A;  3CCE 3;  1XPV A;  1AC1 A;  3FHK A;  1A2J A;  4EV2 A;  4OD7 A;  2VCW A;  1QAF A;  4PUR A;  1SJW A;  3KD0 A;  1NB3 I;  4MZC A;  4FH8 A;  4LL1 B;  3IAM 2;  4O92 A;  5H5R A;  5LNK e;  3AY8 A;  4Q5N A;  4JBB A;  3IPT A;  3F8U A;  3B4P A;  4JZQ A;  2I9H A;  4TN8 A;  2M72 A;  2L57 A;  4IQA A;  3UJ1 A;  1V57 A;  4TOP A;  1UDI I;  2ZHX B;  5D96 A;  4FQU A;  4BL7 A;  2CH9 A;  1MDJ A;  1N9E A;  1JBT A;  3FZA A;  3MKI A;  5BIR A;  4NV5 A;  2RGQ A;  3L9U A;  4NWY A;  2DIZ A;  5J4U A;  2HMM B;  1PX6 A;  2BU4 A;  2G2Q A;  1NU3 A;  3CC7 3;  4Z2U A;  1X1Y A;  1FUS A;  1TFO A;  2O3O A;  4J5G A;  5D83 A;  2O85 A;  1GY7 A;  2KHP A;  6GSU A;  4YQM A;  3CPO A;  4G19 A;  4DVC A;  2FD3 A;  3SXX A;  4JRR A;  3ZRE A;  3UEM A;  2M46 A;  3DXO A;  4K7I A;  1QXH A;  1RJO A;  3ERW A;  1Q9E A;  3TUE A;  2C80 A;  6RNT A;  1Z9H A;  4PNG A;  1T8E B;  2VM2 A;  1ZCP A;  5IEN A;  5DQS A;  9RNT A;  3T8U A;  1PX7 A;  3BIR A;  5CO3 A;  3M9K A;  2YFI B;  5ABR A;  1BRN L;  20GS A;  2GT6 A;  3OX9 A;  1SK1 A;  1AXD A;  3D21 A;  1V74 A;  3U1W A;  4ZL8 A;  4GST A;  1F3B A;  4O7H A;  4I6X A;  6GSS A;  2RLI A;  1O8W A;  3F7S A;  1QVG 2;  3WYW A;  5HGR A;  1OGZ A;  1WJK A;  1FOV A;  1GSP A;  1THO A;  4TR1 A;  4MCU A;  1G0T A;  3KEB A;  2INX A;  3J7Y k;  1YHQ 3;  4FMC A;  2B5E A;  4MMY B;  2CFL A;  2YZH A;  5DJL A;  1ZYN A;  2XGN A;  3TKQ A;  3LT9 A;  6GSX A;  3IXR A;  2SBL A;  3EE1 A;  1USB A;  2VLU A;  2STD A;  1JZD A;  4J8T A;  1VGL A;  2OA7 A;  2X64 A;  2GDR A;  3LWA A;  1IU7 A;  1GOV A;  3JUM A;  2P0G A;  4G0I A;  2GU3 A;  1LOW A;  4N0Z A;  2DML A;  4IT7 A;  2XPD A;  4HJM A;  1LQG C;  1QMA A;  1JBR A;  2VCX A; 
#chains in the Genus database with same CATH homology
 2IPA A;  1XXU A;  2LQO A;  1WWJ A;  3GUR A;  1DBY A;  1U3A A;  5ELG A;  3ZFL A;  3GMF A;  1UC7 A;  1G6Y A;  1W89 A;  2GQM A;  5LCZ A;  4DSQ A;  4ACS A;  3TKS C;  3QAW A;  2PER A;  3ZRD A;  4Q5Q A;  1VRS D;  2IY2 A;  2V6K A;  3IAS 2;  1ERV A;  3FY7 A;  3LQ7 A;  1AAZ A;  5D8I A;  4HZ4 A;  4TR4 A;  1ILO A;  1N8J A;  1O6J A;  4NV2 A;  3FR6 A;  4PQI A;  4Q5R A;  2R2J A;  3DYR A;  2DJK A;  4F2I A;  4TXV A;  3KP9 A;  2DJ0 A;  2H0I A;  2C0E A;  6GSY A;  2VL3 A;  3GL3 A;  2YOI A;  2GSR A;  1XWA A;  3P2A A;  3WT2 A;  3BCK A;  5CRE A;  3F9U A;  4FYB A;  4MDC A;  5EL8 A;  4GLT A;  3C8E A;  3CXG A;  3HYP A;  5G2Z A;  4PUF C;  2EIQ A;  3LYP A;  1Z7R A;  5LD0 A;  5B8A A;  4X0X A;  2DLX A;  1M2A A;  3ED3 A;  2UZ8 A;  4NHZ A;  3IE3 A;  4FO5 A;  13GS A;  2H6Y A;  3ZL5 A;  3VUR A;  3LXZ A;  5F0G A;  1BQ7 A;  3FR9 A;  4I97 A;  5HFK A;  3F3Q A;  1EGO A;  2HE3 A;  4MPF A;  2AV4 A;  3HZ8 A;  4WBR D;  3IC4 A;  1ZMA A;  3PH9 A;  4O5U A;  4IEL A;  1WIK A;  1YZX A;  3UAR A;  1BJX A;  5B6M A;  1WOU A;  5D9W A;  4IKH A;  4YAP A;  2XBI A;  5JCW A;  2LRN A;  3BBY A;  2B1L A;  1NHY A;  2VAF A;  2HZE A;  4NPB A;  3WGX A;  5ELA A;  5G5F A;  2FWG A;  1UN2 A;  3IV4 A;  3VFI A;  4E8E A;  2GGT A;  3A2W A;  1V40 A;  5A4W A;  3EU4 A;  4E8H A;  2GT5 A;  3ZTL A;  1U3I A;  3KTL A;  4KCA A;  5IO0 A;  2TRC P;  4D73 B;  2QA2 A;  1TI3 A;  5D9X A;  3EIN A;  4BVY B;  3DKS A;  3W8J A;  2WGR A;  3APQ A;  4ULX A;  2M80 A;  3ME7 A;  2IYJ A;  1YDK A;  1OE7 A;  2DMM A;  3G9B A;  2NBS A;  4HQZ A;  5JCG A;  2DJ1 A;  4MA9 A;  3H8Q A;  1JZR A;  2R0G A;  3UOM A;  2VD0 A;  1HNA A;  1EEJ A;  1M9A A;  3RAZ A;  4PUA A;  1K0B A;  1F37 A;  2PVO C;  3LJR A;  5D9T A;  1AQX A;  5J5N A;  5DVB A;  4MJE A;  4L5O A;  3GST A;  3CSI A;  3HY2 A;  1ERW A;  3LXT A;  4YKG A;  4V2N A;  2DC5 A;  3HVV A;  1SKR B;  5DAL B;  4AJ8 A;  1JZO A;  1XWK A;  2HSH A;  2X4A A;  2I3Y A;  1AIU A;  3HCZ A;  2LRT A;  5CP1 A;  3L9S A;  2RM5 A;  2GLR A;  5A4U A;  1NSW A;  2C3Q A;  1DE1 A;  3FZ5 A;  1PKZ A;  3GX0 A;  4MNN A;  5HFG A;  4DSS A;  1OAZ A;  2DIY A;  2RUE A;  2JSZ A;  1GUH A;  4KW6 A;  3HJO A;  3D6I A;  2GQK A;  4BVX A;  3P90 A;  2YPM A;  1URM A;  4JU5 A;  3J7Y b;  5KOX A;  1XZO A;  2R0P A;  2A2P A;  2JSY A;  4LA1 A;  4KSO A;  4IJ3 A;  3APS A;  4J57 E;  1K3Y A;  2KP1 A;  1M2D A;  2A2R A;  4YKF A;  4MZW A;  1KEB A;  2PUK C;  1U87 A;  1YF1 A;  1SL2 B;  3TKR A;  4EIQ A;  3R3E A;  5GSS A;  1GTU A;  1R4W A;  4G0L A;  1Q98 A;  3TKS A;  1G6W A;  3IOS A;  2FWF A;  3FZ4 A;  1K0N A;  22GS A;  5ECO B;  1RK4 A;  3I9V 2;  4X43 A;  3VWU A;  1SD8 A;  4WR4 A;  2CX3 A;  1F6M C;  2N5B A;  4KH7 A;  2H1B A;  3ZIV A;  4K0G A;  3A2X A;  4EIP A;  1T7P B;  3UMA A;  3A5W A;  3C1R A;  1A0R P;  1GH2 A;  3GTU B;  4Q5F A;  1F2E A;  1ST9 A;  1MTC A;  3I6A A;  3IK7 A;  2V1M A;  3KGK A;  5HFI A;  3UBK A;  1M0U A;  2FHE A;  2C1Y A;  2WJU A;  3WGE A;  3H93 A;  4K0N A;  1XWC A;  4K7N A;  2L59 A;  1WRY A;  1VF1 A;  4A5P A;  1DSB A;  1EZK A;  2YJ7 A;  1Z3E A;  4WR5 A;  1YKC A;  4MJC A;  3DML A;  1ZYP A;  3F4S A;  3JCM L;  2KLX A;  1BAY A;  3CTG A;  4GWR A;  3CRT A;  4ZBA A;  2JZR A;  3ZMK A;  2CVB A;  4YH2 A;  2YZU A;  4X4J A;  3W6G A;  1EP7 A;  2E2M A;  4XCS A;  5AN1 A;  4IGJ A;  5JWO B;  2LUS A;  3H79 A;  2B6M A;  3F0I A;  4IHU A;  1PL1 A;  1SKS B;  2C0D A;  1Z6M A;  1A2M A;  3GX8 A;  3IPZ A;  1B48 A;  5JWR B;  3O76 A;  3H4K A;  4GF0 A;  4EXJ A;  1SD9 A;  3OR5 A;  2VLT A;  2H30 A;  5D73 A;  6GSW A;  1MD4 A;  3IHG A;  2HRF A;  2N5A A;  3VWX A;  1Z5Y E;  2R37 A;  1XWB A;  1GL8 A;  5JWQ B;  3IR4 A;  2B5Y A;  4NXI A;  3EMP A;  16GS A;  2XHF A;  2L5L A;  3BD2 A;  4HS1 A;  3QR6 A;  1U6T A;  3C7M A;  3TRQ A;  2CVD A;  3DD3 A;  3FMW A;  3A2V A;  5FWG A;  3TJB A;  2O7K A;  3ME8 A;  4V2M A;  2L4C A;  4ID0 A;  3Q74 A;  1O81 A;  3HKR A;  4RI6 A;  4HQS A;  3GL5 A;  2JZT A;  5ECP B;  3VWW A;  3KZQ A;  3IK9 A;  1PN0 A;  3D22 A;  4KSM A;  1GLQ A;  1TOF A;  5B7C A;  3TJF A;  1HQO A;  5IPG A;  2I81 A;  3CSH A;  4HJ2 A;  1OVN A;  2HFD A;  1FO5 A;  2IFQ B;  5DJM A;  2GS3 A;  2PBJ A;  5IQY A;  5L71 A;  1M9B A;  1SL0 B;  1W4V A;  3SWL A;  3ERG A;  1T4Y A;  2QSI A;  1NM3 A;  3LSZ A;  2DKH A;  3FYG A;  1XVW A;  5KN3 A;  1SU9 A;  4HI7 A;  4IW9 A;  4MH3 A;  2CT6 A;  3G7J A;  3EVI A;  4GTU A;  4QQ7 A;  5ECM B;  2VLV A;  2E0Q A;  1HNC A;  3F6D A;  3F4T A;  3LW9 A;  2MYG A;  4WET A;  2E2G A;  2F8A A;  4OO4 A;  5H5S A;  4L0U A;  3LEF A;  4KDY A;  1GRX A;  3LGC A;  4IBP A;  2N5F A;  4F0B A;  18GS A;  4MH2 A;  5EY6 A;  2GVP A;  5ECS A;  4IQ1 A;  3UVH A;  5HQP A;  3DIE A;  2NPB A;  1QK8 A;  4G10 A;  4F0C A;  4EL1 A;  8GSS A;  3QFB C;  3ISO A;  1TK0 B;  2HSM A;  2YP6 A;  5G31 A;  1A8L A;  3KMO A;  3KTB A;  3GNJ A;  1VF4 A;  1X5E A;  5FHI A;  4KA0 A;  2C8U A;  2X99 A;  1YF0 A;  2WFC A;  2IMD A;  3IRA A;  2CZ2 A;  5G1L A;  3APO A;  2HXK A;  4HU9 A;  3UAP A;  3TOU A;  4BPY A;  4TXO B;  4K2D A;  3ZML A;  1WP0 A;  4QL7 A;  4IVF A;  1ML6 A;  5IO2 A;  5AIS A;  1V9W A;  2L6D A;  3GV1 A;  1GTA A;  3GH6 A;  2H8L A;  2HRK A;  2QC7 A;  5ECH B;  4L0W A;  5A5K A;  2VUP A;  2OBK A;  2QKE A;  1K0M A;  1OKT A;  3P8W A;  1NW2 A;  3ZLP A;  1OKD A;  2FCH A;  1Y6E A;  4K8M A;  1TK8 B;  3BCI A;  2OAC A;  4EVM A;  1DUG A;  3TGZ A;  2H76 A;  3CSJ A;  1C72 A;  3O3T A;  1H4O A;  1PQN A;  5AIX A;  2O89 A;  2H1D A;  4HUA A;  4USS A;  1O7U A;  4K2X A;  2LJK A;  4ZL9 A;  2H70 A;  1GSE A;  3H1N A;  2B7K A;  5G5E A;  1KTE A;  2YAN A;  1OC9 B;  2EIO A;  2MZC A;  2IMK A;  4CY6 A;  4FIW A;  1B4P A;  1HYU A;  4P3Y B;  1GWC A;  3FKF A;  5BMU A;  1BED A;  5J9B A;  3A5I A;  3RBT A;  1V2A A;  4TW5 A;  5G30 A;  5HR3 A;  2VCV A;  1M2B A;  3TKP A;  1FVK A;  3HVX A;  2F51 A;  4ECB A;  3GH9 A;  1YJ6 A;  2X49 A;  1XCC A;  1TP9 A;  4KAE A;  5D93 A;  4EUY A;  4HU7 A;  1Y25 A;  1R7H A;  3DWV A;  2H71 A;  2LTK A;  1QUW A;  3MSZ A;  2HZF A;  5DCG A;  4HEA 2;  2PN8 A;  2ZUP A;  3KM6 A;  1XW6 A;  3ZYW A;  2PGT A;  4GSS A;  4F9Z A;  3Q18 A;  1IYI A;  2CA8 A;  3HJM A;  2H0H A;  1X0R A;  5HR1 A;  3FR3 A;  5DDL A;  2LST A;  5ECK B;  3LG6 A;  2RM6 A;  1T00 A;  2Z9S A;  2X8C A;  2CAQ A;  1AQV A;  3BJ5 A;  3GHA A;  1K0O A;  4MLY A;  5ID2 B;  1J08 A;  2KOK A;  4PQH A;  4GSN A;  2LEG A;  4ICY A;  4WKW A;  4MAB A;  1QGV A;  1PL2 A;  1B8X A;  3CTF A;  1KBN A;  1V98 A;  1GSQ A;  2XPE A;  2OKA A;  3VK9 A;  3GRX A;  1MD3 A;  1XOA A;  2OAD A;  1O85 A;  2DKI A;  2ZNM A;  2WUL A;  3FW2 A;  1LU4 A;  2GSQ A;  2IN3 A;  2H01 A;  2MMN A;  4V1A p;  4DSR A;  1A23 A;  1A2L A;  4TKY A;  3KJY A;  4PX1 A;  2P31 A;  4K5S A;  2GZZ A;  4K7O A;  5ID2 A;  1PA3 A;  4MF5 A;  2HLS A;  1X5C A;  4ECJ A;  4OCE A;  1FG4 A;  3BOA A;  1TRV A;  4D73 A;  1TRS A;  1SKW B;  4EC0 A;  3KMN A;  1PSQ A;  4ZB9 A;  5B6N A;  2LNT A;  4XRA A;  4XTS A;  1ABA A;  2OJL A;  4BVY A;  2TRX A;  5IOX A;  5ECR B;  3TJJ A;  1X9W B;  6GST A;  3EU3 A;  4KB3 A;  3UVT A;  3KP8 A;  2O8V B;  2DJJ A;  4ZL7 A;  2AUV A;  3ZVJ D;  1A24 A;  4V1A g;  2I1U A;  5HR2 A;  1GSD A;  1CQG A;  1TK5 B;  2VCT A;  5IIZ A;  3GKN A;  3M1G A;  1ZGN A;  4NHW A;  5KN0 A;  2GST A;  1FOH A;  2WCI A;  1VF3 A;  4MP4 A;  3ZVJ A;  3L0H A;  5D9V A;  1R5A A;  5IMV A;  5F05 A;  3GIX A;  1MEK A;  1XWG A;  1PN9 A;  3GKX A;  4XS4 B;  2YNX A;  5DAK B;  5DAL A;  3S9F A;  2IJY A;  5COH A;  2DSA A;  3N5O A;  1GTI A;  1GUK A;  1PRX A;  4OO5 A;  4KCE A;  1ERU A;  2VCZ A;  2V2G A;  3E3E A;  3IDV A;  2ZCT A;  5ENU A;  2C0F A;  2H73 A;  2GZY A;  3C73 A;  4Z2R A;  2OBI A;  4LLR A;  4G0K A;  2WB9 A;  4WEY A;  4PNF A;  1JZW A;  1ZL9 A;  2L5O A;  3DEX A;  2PWJ A;  2VIM A;  3C71 A;  3MNG A;  4GXZ A;  2DBC A;  1SEN A;  2PMT A;  4IN0 A;  1ZZY A;  4KND A;  1WPI A;  3FK8 A;  1PD2 1;  4WXT A;  2CAI A;  2E7P A;  4MPG A;  1E2Y A;  1FB6 A;  2H0G A;  3LOR A;  3TCO A;  5C00 A;  14GS A;  1Z7P A;  2R0C A;  4HOJ A;  4KDX A;  2WDU A;  1TI1 A;  2B3S A;  1B9X C;  2K6V A;  4ZBD A;  5IPH A;  2YWI A;  1M7T A;  2LNS A;  2XBQ A;  3KH9 A;  2KP2 A;  3GFK A;  2IL3 A;  3FEU A;  1SJI A;  2OE3 A;  2K8V A;  1YKA A;  5CRG A;  1GUL A;  2VO4 A;  4KF9 A;  5FT3 A;  2KUC A;  4N10 A;  4MF7 A;  2ES7 A;  1FHE A;  11GS A;  1HD2 A;  3FZ9 A;  3VPT A;  5GAN D;  1GTB A;  5E59 A;  1X9S B;  4JR4 A;  3VWV A;  1EWX A;  2HRN A;  5CYY A;  4IS0 A;  5F07 A;  5ECL B;  5A4V A;  2B5X A;  2MBT A;  2VD1 A;  4IJI A;  3GTU A;  4IP6 A;  2LQQ A;  9GSS A;  2YWO A;  4LMV A;  5DQY A;  3D0Z A;  2FLS A;  4GQC A;  3HZ4 A;  4GCI A;  4ZB6 A;  1EGR A;  2K18 A;  5ECN B;  4N0V A;  2PPT A;  1OYJ A;  2NVL A;  4YAV A;  2LRC A;  3EUR A;  4WF4 A;  3GN3 A;  3N9J A;  1RW1 A;  2HYX A;  3EMX A;  1JHB A;  2IME A;  1X5D A;  2YWM A;  4XRD A;  1XW5 A;  3U5R E;  2A4V A;  1GSU A;  3G7Y A;  2J23 A;  1U88 A;  4BL7 B;  2RII A;  4ILF A;  1AW9 A;  5AIV A;  1G7E A;  2LJA A;  3Q19 A;  3EC3 A;  2HSY A;  4WF5 A;  1B4Q A;  5CRW A;  2WRT A;  1M99 A;  4MF6 A;  1VF2 A;  5E4W A;  1O8X A;  4G2E A;  1XFL A;  3QFA C;  4CDO A;  1TXX A;  19GS A;  2IIY A;  2P5R A;  2CX4 A;  1GLP A;  2PU9 C;  5F8B A;  3Q6O A;  2REM A;  3HJP A;  2YV9 A;  1EV4 A;  5J3R A;  2JZS A;  4PGT A;  2EC4 A;  2C0G A;  3KIJ A;  2VM1 A;  4XIH A;  2J9H A;  4TR1 B;  2K8S A;  3HDC A;  4EDZ A;  5KEJ A;  3IBH A;  1PGT A;  4KE3 A;  4CW9 A;  4K1F A;  4I5Q A;  1OE8 A;  4I2T A;  1HNB A;  1OC8 A;  4EKZ A;  4YQV A;  3NIV A;  1ZYE A;  5KOW A;  3MAK A;  3DVX A;  3TKS E;  2FWH A;  3LFL A;  2IFQ A;  5IMF A;  3UL3 A;  3TJG A;  3F6F A;  1SJ6 A;  1JFU A;  2MMZ A;  3VLN A;  3L4N A;  4NAX A;  3D4M A;  5DBQ A;  2R5G A;  5F06 A;  1TTZ A;  4KUN A;  5IMZ A;  4ECI A;  4N11 A;  2NDO A;  2YJH A;  3EWL A;  4N30 A;  4BA7 A;  1MDK A;  3WGD A;  4NMU A;  2FA8 A;  2A4H A;  3F3R A;  3ERF A;  1GUM A;  3EPT A;  2ON5 A;  4JR6 A;  2H1G A;  5IM9 A;  1K0D A;  4TRX A;  1Z6N A;  2VL9 A;  2H19 A;  3F4R A;  1S3D A;  1EEM A;  2GQL A;  1TRW A;  3QMX A;  1NHO A;  1THX A;  4OFM A;  3L9V A;  3RPP A;  3DGQ A;  4ISD A;  4MJA A;  3IHQ A;  3ZZX A;  4OMV A;  3E0U A;  4RQX A;  3NOF A;  2FY6 A;  4MZB A;  4H86 A;  2FA4 A;  5G1K A;  3TB2 A;  1K0A A;  1DE2 A;  1V58 A;  2K9F A;  1SYR A;  1ERT A;  10GS A;  3TJK A;  2A2S A;  5GST A;  4FYU A;  3QAV A;  2AHE A;  1TJD A;  5KN2 A;  3D4T A;  4GRF A;  1S3A A;  4TXO A;  3ZIJ A;  3IC8 A;  3KXO A;  5IOW A;  2C3T A;  2H6X A;  1A0F A;  2YCD A;  4I8B A;  3E9J B;  2WZ9 A;  2P5Q A;  2CQ9 A;  3QPM A;  4CHS A;  3V1W A;  5EPF A;  1GSF A;  2IMF A;  3MDK A;  2R3X A;  4EE0 A;  2YN1 A;  3HA9 A;  1F3A A;  2FWE A;  1YEX A;  4K6X A;  4KX4 A;  3VI5 A;  4BWS A;  2X8H A;  3F63 A;  3GKK A;  2VL2 C;  4Z2T A;  2ON7 A;  5KN1 A;  3PIN A;  2CZ3 A;  3GSS A;  1LJR A;  2JAC A;  5J9C A;  3RHB A;  1LBK A;  2GTU A;  1K3L A;  1CQH A;  4ZBB A;  4TVE A;  1N2A A;  4POK A;  2HZE B;  1Q4J A;  2CV4 A;  1B9Y C;  3M9J A;  4RI7 A;  4LL4 B;  1T3B A;  1SK0 A;  2V6O A;  4ML1 A;  1TU7 A;  4ZXG A;  3WT1 A;  1IYH A;  2D2Z A;  3W8S A;  4HZ2 A;  4PQ1 A;  1OC9 A;  1H75 A;  6GSV A;  1O73 A;  4QL9 A;  1XW9 A;  3HXS A;  4LMW A;  2LV3 A;  4EO3 A;  3QDN A;  4TR0 A;  2F3M A;  1ZYQ B;  4ZB8 A;  3ZIT A;  4MMM A;  2H72 A;  2VOC A;  3PR8 A;  2O87 A;  2F8F A;  4OCF A;  2MMA A;  4HDE A;  1BYE A;  4PTS A;  2BTO T;  2MMO A;  4J56 E;  5DCH A;  4ECC A;  1AUC A;  3TOT A;  4AF2 A;  3DRN A;  3O6T A;  3QOU A;  2DJ2 A;  3CBU A;  5EVO A;  1XVQ A;  3VI7 A;  3FRC A;  3I43 A;  4V2L A;  1R26 A;  4F03 A;  1PMT A;  2CVK A;  1ON4 A;  3CRU A;  3HVS A;  4POM A;  2DJ3 A;  1EOG A;  3UBL A;  2H1A A;  3GA4 A;  2HRA A;  3QD9 A;  1XBS A;  3HHV A;  4XS6 A;  1G7O A;  3R2Q A;  3LYK A;  2B1K A;  3CYN A;  1EP8 A;  1WE0 A;  2BJX A;  4XS1 A;  2YV7 A;  4ML6 A;  3C1S A;  5GAP D;  5J41 A;  3QAG A;  1ACV A;  3QCP A;  1SYX A;  1QFN A;  3VPQ A;  1MDI A;  1K3O A;  5AGY A;  2QA1 A;  4AJ6 A;  1TKD B;  2FUG 2;  5C04 A;  2V41 A;  4DSS B;  4RUV A;  2H66 A;  1UVZ A;  4BWQ A;  3A3T A;  4F82 A;  2BMX A;  1GP1 A;  1SK2 A;  2EIR A;  4BVX B;  2LKU A;  4O5Q A;  3WD6 A;  2H74 A;  4CY8 A;  3K8N A;  5H5Q A;  2HT9 A;  2AAW A;  4DEJ A;  3US3 A;  1BX9 A;  1A8Y A;  3CMI A;  1YY7 A;  1TU8 A;  3TRP A;  5IMA A;  4ZIJ A;  2L6C A;  2OE1 A;  2G0F A;  1FAA A;  2L4Q A;  4Z7X A;  1EOH A;  1FW1 A;  1I9D A;  2FGX A;  2QGV A;  1FVJ A;  1E6B A;  1TRU A;  4KDU A;  3GYK A;  4MJB A;  2NTO A;  1UA5 A;  2IWT A;  3MIX A;  5CRH A;  4OWY A;  5CNW A;  1WMJ A;  3RDW A;  5ECI B;  1BG5 A;  2C4J A;  4K5R A;  4GQF A;  1OC3 A;  1QQ2 A;  4OFT A;  1X9M B;  3I69 A;  4O32 A;  17GS A;  2H75 A;  1T1V A;  3MWH A;  3GUS A;  1GSS A;  5JCU A;  4KGI A;  3SBC A;  2JU5 A;  3L78 A;  4L5L A;  1F9M A;  1ZOF A;  4JED A;  1T4Z A;  4X1U A;  2PVQ A;  2AYT A;  5CRD A;  3KCM A;  4XS4 A;  4L8E A;  5DAK A;  3RHC A;  4MK3 A;  3RPN A;  2VCQ A;  5BRT A;  3TRX A;  2OE0 A;  4I2U A;  2FNO A;  5HR0 A;  2B7J A;  1J0F A;  4PXO A;  4AJ7 A;  3DVW A;  2R6K A;  5GZZ B;  3GKM A;  4ZIL A;  1J9B A;  2HNL A;  2F9S A;  5ECQ B;  4O5R A;  4OFN A;  1XOB A;  3NZN A;  1RQM A;  1JLW A;  3TDG A;  1GSY A;  2V32 A;  1GNW A;  2IMI A;  1YQ1 A;  2C3N A;  5IMC A;  2RUF A;  1K0C A;  2X8G A;  1SJZ A;  4YQU A;  4POL A;  3U6V A;  4EF0 A;  5IMD A;  2VL2 A;  4J2F A;  3M0F A;  2AJQ B;  3ZFB A;  3PGT A;  2MBS A;  2GSS A;  1I5G A;  4FYC A;  1SL1 B;  1S3C A;  4TR3 A;  1KNG A;  2R4V A;  2GZP A;  3HD5 A;  1GNE A;  1AQW A;  2WS2 A;  4WBJ A;  1R5P A;  2TIR A;  5B8B A;  1QMV A;  1TDI A;  3EE2 A;  4JE1 A;  1JLV A;  2JL4 A;  3G7I A;  1YEP A;  2HI7 A;  1FB0 A;  3M3M A;  1EV9 A;  2AB6 A;  4IP1 A;  2LJR A;  2LS5 A;  4G9H A;  4K9Z A;  4EDY A;  3P7X A;  3KH7 A;  3MYD A;  4POB A;  2YWN A;  5CAX A;  2ALB A;  1TW9 A;  4RQR A;  3PPU A;  3D5J A;  2H6Z A;  1XIY A;  4AGS A;  7GSS A;  3EYT A;  3UIW A;  3M8N A;  4XHM A;  3IA1 A;  5INY A;  2I4A A;  2XC2 A;  1PKW A;  12GS A;  3DXB A;  1XPV A;  1AC1 A;  3FHK A;  1A2J A;  4OD7 A;  2VCW A;  4PUR A;  3KD0 A;  4MZC A;  4FH8 A;  4LL1 B;  3IAM 2;  4O92 A;  5H5R A;  5LNK e;  3AY8 A;  4Q5N A;  4JBB A;  3F8U A;  4JZQ A;  2I9H A;  4TN8 A;  2M72 A;  2L57 A;  4IQA A;  3UJ1 A;  1V57 A;  4TOP A;  5D96 A;  4FQU A;  4BL7 A;  1MDJ A;  3FZA A;  4NV5 A;  3L9U A;  4NWY A;  2DIZ A;  5J4U A;  1PX6 A;  2G2Q A;  4Z2U A;  2O85 A;  6GSU A;  2KHP A;  4YQM A;  4G19 A;  4DVC A;  2FD3 A;  4JRR A;  3ZRE A;  3UEM A;  2M46 A;  4K7I A;  1QXH A;  3ERW A;  3TUE A;  2C80 A;  1Z9H A;  4PNG A;  1T8E B;  2VM2 A;  1ZCP A;  5DQS A;  1PX7 A;  5CO3 A;  3M9K A;  5ABR A;  20GS A;  2GT6 A;  1SK1 A;  1AXD A;  3D21 A;  4ZL8 A;  4GST A;  1F3B A;  4O7H A;  4I6X A;  6GSS A;  2RLI A;  1O8W A;  3WYW A;  1WJK A;  1FOV A;  1THO A;  4TR1 A;  4MCU A;  1G0T A;  3KEB A;  3J7Y k;  2B5E A;  2YZH A;  5DJL A;  1ZYN A;  3TKQ A;  6GSX A;  3IXR A;  1USB A;  2VLU A;  2X64 A;  1JZD A;  1VGL A;  2OA7 A;  2GDR A;  3LWA A;  2P0G A;  4G0I A;  4N0Z A;  2DML A;  2XPD A;  4HJM A;  2JAD A;  2VCX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...