2H0HA

Crystal structure of dsbg k113e mutant
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
229
structure length
229
Chain Sequence
b'ELPAPVKAIEKQGITIIKTFDAPGGMKGYLGKYQDMGVTIYLTPDGKHAISGYMYNEKGENLSNTLIEKEIYAPAGREMWQRMEQSHWLLDGKKDAPVIVYVFADPFCPYCEQFWQQARPWVDSGKVQLRTLLVGVIKPESPATAAAILASKDPAKTWQQYEASGGKLKLNVPANVSTEQMKVLSDNEKLMDDLGANVTPAIYYMSKENTLQQAVGLPDQKTLNIIMGN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Thiol:disulfide interchange protein dsbG
publication title Short-circuiting divergent evolution: laboratory evolution of one disulfide isomerase to resemble another
rcsb
source organism Escherichia coli
molecule tags Isomerase
total genus 67
structure length 229
sequence length 229
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-05-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13098 Thioredoxin_2 Thioredoxin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.70 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Disulphide bond isomerase, DsbC/G, N-terminal 2h0hA01
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 2h0hA02
1BAYA 2YJHA 1GTAA 3GMFA 4YQVA 1TRSA 2VL2C 5KN1A 3IDVA 1JZDA 2WGRA 3H8QA 1EV4A 2HLSA 4V1Ap 2J23A 2E2MA 1XW6A 4ZL9A 4K0NA 4ZL7A 2B1LA 3DYRA 5CRWA 3SBCA 2FUG2 4J57E 1GTIA 1TXXA 2VL3A 1EZKA 3F3RA 2YWMA 3IA1A 2DJJA 2LKUA 1THOA 2WULA 3US3A 4HI7A 1GTBA 2GVPA 1JLVA 2KOKA 1GSYA 13GSA 4KDUA 1SL1B 2KHPA 1QXHA 3TCOA 1GLPA 2IIYA 1A23A 2OE0A 1B4QA 1A0RP 1Z3EA 3KP9A 3D4MA 5HQPA 1KNGA 1R5AA 2GZPA 5B7CA 4MLYA 4FO5A 1O8WA 2H66A 1YKCA 1X9MB 4EDYA 2V1MA 2CVDA 1XIYA 4FYBA 5H5QA 2B1KA 3IR4A 1PMTA 3GSSA 1PKWA 3GKMA 4MJBA 4MDCA 3ZTLA 2PMTA 3TOTA 2OA7A 3CMIA 2D2ZA 1YEPA 2MZCA 1J08A 4NHZA 5HFKA 2TIRA 2PVQA 5LCZA 1C72A 5IOWA 4XS4A 2MBSA 1V40A 5JWQB 4WEYA 3I69A 1XOBA 2NDOA 2EC4A 3W6GA 3UARA 3EMPA 5GAPD 3GFKA 3HJMA 3BD2A 2R37A 4KAEA 2LV3A 3IBHA 4MK3A 2KP1A 3APOA 4EO3A 2AB6A 3LJRA 1A2JA 4FIWA 5G5FA 1NSWA 2IMFA 4JBBA 1CQHA 1O85A 1AW9A 1Y25A 1EV9A 1TU7A 2XBIA 1SU9A 1Z7PA 2GT5A 1ZZYA 2WFCA 2F8AA 1TRUA 1Z9HA 8GSSA 3PR8A 1AC1A 3WT2A 2B6MA 4NXIA 2LS5A 3KH9A 1T4YA 4XS1A 1O8XA 2B3SA 1B48A 2M80A 2IWTA 4CHSA 4G10A 2VLUA 2B5XA 1X9SB 3FW2A 1NM3A 4TXOA 4Q5RA 4WBJA 1F3AA 1GLQA 3I9V2 4AJ7A 4MCUA 4P3YB 1WE0A 2YV7A 3HKRA 2HZFA 3F9UA 4L0UA 1SJ6A 1M2AA 2PERA 3A5WA 1H4OA 2RUEA 4WR4A 3UAPA 4K1FA 3N5OA 4IELA 1TOFA 2O89A 1A8YA 2GGTA 3UVTA 4K9ZA 3ZRDA 2TRCP 3ISOA 2H19A 5LD0A 5GSTA 2I9HA 2K9FA 2H1GA 4DSSB 4XTSA 3I6AA 4NAXA 20GSA 1AXDA 1YJ6A 4I6XA 4TR4A 5A4VA 4AGSA 2YPMA 4HDEA 5CAXA 5ENUA 3VWVA 2FD3A 3L9VA 2BTOT 2YZHA 4PQ1A 1PL2A 2K6VA 5IPGA 2CZ3A 2HSYA 1AIUA 4WF4A 1SK2A 3GHAA 3TRPA 3TOUA 4FH8A 1GNEA 2OKAA 4X0XA 5ELGA 4ULXA 1FAAA 3EE2A 4N30A 1GP1A 1GSUA 1OKTA 3ZIVA 6GSXA 5DCHA 1XVQA 4HJ2A 3G9BA 1I9DA 4HU7A 1Z5YE 2LTKA 6GSWA 2DJ1A 2JZSA 1J9BA 4X1UA 2IL3A 5D9XA 3IPZA 5E4WA 1QK8A 4GLTA 4DEJA 3NIVA 2LEGA 1F6MC 3D0ZA 4G19A 5FHIA 3QFAC 3QMXA 1ZL9A 5GAND 5ID2A 1Z6MA 1PGTA 2CVKA 4EF0A 4BPYA 4E8EA 1WIKA 3W8SA 1F2EA 4PGTA 17GSA 4TR3A 4GQCA 4QQ7A 1AQVA 3C71A 2LRTA 4IW9A 2J9HA 3CSHA 5D96A 3KEBA 4PURA 3FR9A 2H01A 2H1BA 1VF2A 1HQOA 2FWEA 2O7KA 2H70A 2V6KA 2F9SA 2GZZA 3ME7A 4NWYA 2EIRA 1WRYA 4EC0A 4BA7A 3KZQA 5DJMA 2CAIA 3UIWA 3FHKA 4LMWA 2H75A 3TKSC 1LJRA 2FY6A 1U3IA 4RI6A 1F3BA 1X9WB 1NHOA 4D73B 5J4UA 1PL1A 2MYGA 3H79A 4I2UA 1FOVA 1AQXA 3GL5A 2DJ0A 1T4ZA 4YAVA 5IM9A 2H72A 3FZ9A 1EP8A 3IC4A 2VCTA 3ZVJA 5DDLA 4PQIA 2IMIA 3H1NA 4K8MA 1K3OA 2B5YA 9GSSA 3DVWA 1DE2A 1ST9A 2R3XA 2F8FA 3DD3A 3L9SA 2H73A 2Z9SA 4Q5QA 2L6CA 4JEDA 3QD9A 4POKA 4F82A 3ERWA 2PVOC 4KX4A 4GSSA 5J9BA 1ERUA 1RW1A 4K7OA 3KJYA 2GDRA 2LJRA 4L5LA 5G30A 4KCEA 1G7EA 4MF6A 3G7YA 1EGRA 4MF5A 1HYUA 3ZZXA 1ERWA 3APQA 3EURA 3CYNA 4IJ3A 4IS0A 5IMDA 2MMOA 2YZUA 4MJCA 3E3EA 4WBRD 5ECQB 1O73A 1M9BA 1SKWB 2A2SA 4G2EA 3M0FA 1FW1A 4NHWA 5LNKe 3KIJA 2H1AA 1EP7A 2XBQA 4EUYA 1MDKA 5J5NA 4KA0A 3F6FA 3VPQA 4JZQA 4ILFA 6GSVA 2VCWA 4FYUA 2K8SA 2H0HA 2GTUA 3GURA 2JU5A 3C73A 2C3QA 12GSA 1DBYA 3VI5A 2IFQB 1X5CA 5ECSA 4E8HA 3LORA 3PINA 2I3YA 5G5EA 2MMNA 1ZGNA 2WDUA 1GUMA 5EVOA 3HJPA 3H93A 2C4JA 2GLRA 3FEUA 3VK9A 4TKYA 3F0IA 5CO3A 1K3YA 4MMMA 5DCGA 1MDJA 5JCWA 3TJJA 1GTUA 1XWGA 3JCML 3LSZA 3LYKA 3A2VA 3FKFA 1FB0A 1QFNA 2H71A 1UC7A 3MDKA 1WWJA 4NPBA 4POMA 1TK5B 1JZOA 4PNFA 4Q5FA 1TP9A 1A8LA 1MDIA 3KM6A 4MH3A 1MTCA 2VLTA 3UBLA 2HXKA 3GX8A 2C80A 4ZILA 1W4VA 4XHMA 2DBCA 3LGCA 3ERGA 4HOJA 4F03A 5IQYA 2K18A 3CRTA 1T8EB 4ECBA 5A4WA 5J3RA 3FZ5A 2GSSA 5ECRB 2G2QA 3EINA 3QR6A 4JR6A 2VIMA 4LL4B 2FWFA 2ZUPA 1THXA 3D21A 3W8JA 1W89A 4MH2A 3KP8A 2ZNMA 3DMLA 4IBPA 3BBYA 3FZAA 1ML6A 4MF7A 3MWHA 1GSFA 3GA4A 2K8VA 5B6NA 3UOMA 3ZMLA 1YEXA 1OC3A 5AIVA 1K0OA 1O6JA 5E59A 1XCCA 1QMVA 4JU5A 5IMCA 4HJMA 3TDGA 1BG5A 1FHEA 5F07A 4QL7A 4EKZA 2OBIA 2FA8A 1SJZA 3UL3A 1M0UA 1OYJA 4PUAA 5ABRA 3HCZA 3FR3A 2C0FA 3FRCA 3EMXA 4HQZA 2VM1A 3GH9A 2CX4A 4YH2A 1USBA 4PNGA 2NVLA 2QSIA 4DSSA 3A3TA 4IJIA 1NW2A 2RM5A 1TJDA 1GRXA 3ZMKA 5IO2A 1TRWA 1XWBA 2OE3A 4K7IA 4V2NA 1MEKA 1M2BA 1TU8A 1XWAA 3QDNA 4KB3A 3HA9A 1PKZA 2VCZA 2I81A 2LUSA 2IY2A 5IMZA 5C04A 3A2XA 2RLIA 4BVYA 2YANA 2C0DA 4HUAA 2CZ2A 2DJ3A 2HRFA 1EEMA 1K0MA 3VPTA 3IE3A 5ECMB 3MSZA 3GV1A 4L0WA 2XPDA 2H6YA 3E0UA 4O92A 1DE1A 4ML6A 4RUVA 4AJ8A 4ECJA 2C0GA 1CQGA 3HD5A 4WETA 3GH6A 4OCEA 1M2DA 2C8UA 4OWYA 1V58A 1YDKA 1TDIA 3TKRA 4N0ZA 1G0TA 4Z7XA 5AISA 2B7JA 2NBSA 4TVEA 4K0GA 6GSYA 2X64A 1JZRA 4NMUA 1DSBA 1AAZA 2FCHA 3G7JA 4KE3A 4F2IA 2JSYA 3CTFA 3VLNA 1SK0A 2P5QA 5JCGA 3TKQA 1SL0B 5JCUA 1YF0A 3KCMA 5DALB 3TB2A 4GSNA 4AF2A 3KXOA 3KMOA 3NZNA 4NV5A 4ZB9A 2C3NA 3QAVA 4ACSA 5CP1A 1XVWA 2FWGA 1WPIA 2EIQA 3RBTA 3VURA 2VL9A 4TR0A 4IQ1A 6GSTA 4OFTA 1ZCPA 4YQMA 3F4TA 1YKAA 2LNSA 2QKEA 2REMA 3K8NA 3Q6OA 2DMMA 3FK8A 3FY7A 2OACA 4AJ6A 1TI3A 2GQLA 4KDYA 3KTBA 1K0NA 3TUEA 2IN3A 2YWNA 3L9UA 5EPFA 3O6TA 2CV4A 3Q19A 1I5GA 3NOFA 5ECHB 2RIIA 1SK1A 3HVVA 3ZIJA 5CNWA 4D73A 3ZFBA 2R6KA 3A2WA 4KH7A 1YZXA 2VOCA 1QUWA 3QFBC 2PWJA 2R4VA 5A5KA 2H76A 2IMKA 1J0FA 3EWLA 3VFIA 5KN3A 4FYCA 4GQFA 4KCAA 1OE7A 3R2QA 2N5BA 4ECIA 1JZWA 2KLXA 4XRDA 1XZOA 1BQ7A 2AUVA 3SWLA 2CQ9A 3UEMA 14GSA 4F0CA 4V2MA 1GUKA 2VD1A 2DJ2A 3F4SA 3U6VA 4WR5A 4HQSA 5ELAA 3UVHA 1S3DA 1UA5A 5AN1A 2IYJA 4O5RA 1X0RA 4YAPA 3VWWA 1PX7A 2VD0A 2LSTA 19GSA 1XFLA 1VF3A 1FG4A 3I43A 5G31A 4EVMA 3QAWA 6GSUA 3M1GA 1F9MA 2G0FA 4MZWA 4RQRA 4DVCA 4ZB8A 2LJKA 2AYTA 3M9JA 2LRCA 5CRDA 2B5EA 5ECNB 2HZEB 3TKSE 2X8GA 2KP2A 3IHQA 1B9XC 2WB9A 2GT6A 1WJKA 1YF1A 2HNLA 5GSSA 4TOPA 1SKRB 1MD4A 1GWCA 1OAZA 3O76A 3KGKA 3GX0A 3P2AA 3M3MA 2P5RA 5EY6A 1SYRA 2JADA 2P0GA 3TRXA 5KN0A 2FHEA 2C1YA 2BJXA 2JZRA 3D22A 3IOSA 3TJBA 4MABA 2I1UA 4MZCA 3ZL5A 1SD8A 4TR1B 3CXGA 4XS6A 2IFQA 1V2AA 3WD6A 5HFIA 2H6ZA 2L4QA 2HE3A 4OD7A 3CBUA 3FZ4A 4KUNA 4TN8A 1TK8B 1GL8A 4ZBBA 4L8EA 1OVNA 5F0GA 3CSIA 4IQAA 3GTUB 1ZYEA 2QGVA 3D6IA 4ZBDA 2OJLA 4IGJA 1SYXA 4DSRA 1URMA 4HZ2A 4POBA 3RHBA 5HR2A 1XBSA 3TJKA 5COHA 3F63A 3P7XA 3C7MA 4EDZA 2X8HA 1O7UA 3VI7A 3GKXA 1S3AA 16GSA 2JSZA 3GIXA 2OE1A 2PBJA 4MA9A 5KEJA 3D5JA 4WF5A 3V1WA 3BOAA 3TGZA 1IYHA 4IKHA 3GNJA 3GKKA 4V2LA 5IMFA 1R4WA 1V98A 4ML1A 3RHCA 3LYPA 4N0VA 4PXOA 3TJGA 3E9JB 1B8XA 4ZXGA 4JRRA 1M99A 2ES7A 1Q4JA 2VCXA 1R5PA 2WRTA 1G6WA 3LQ7A 3F8UA 1IYIA 4PQHA 3L0HA 4BWSA 2M72A 5B8AA 3FR6A 5IMAA 1G7OA 1GSEA 1Z7RA 5CYYA 2NPBA 4ZL8A 1VF4A 5IMVA 4KW6A 2VL2A 3DXBA 3D4TA 2AV4A 5F8BA 3GUSA 1QQ2A 2X8CA 2HI7A 2FLSA 3GKNA 5D93A 2XHFA 2L5LA 2PUKC 1OC9B 1GUHA 2I4AA 1VF1A 3PGTA 5D9TA 5ECPB 2HSHA 2V32A 3LXZA 1X5DA 4LMVA 5IIZA 1YQ1A 1T3BA 2VCQA 3ZYWA 3RPNA 1TI1A 5F05A 3ZREA 4ID0A 3QPMA 5DVBA 3IAS2 3IAM2 5ECIB 2IMDA 4J56E 3PH9A 4F9ZA 1TK0B 1H75A 2R2JA 4IHUA 1TW9A 1SENA 4TXVA 1FO5A 4EXJA 3IK9A 3HZ8A 2LNTA 4K6XA 2YWIA 3DRNA 3RDWA 1XW9A 2WJUA 2GQMA 2VLVA 4MJEA 3HJOA 4K2DA 4KSOA 1T1VA 3QCPA 1VGLA 4WXTA 3WGEA 3MNGA 2L6DA 3P8WA 2XPEA 5J9CA 2YOIA 3IRAA 1AQWA 5CREA 2MMAA 1NHYA 4ECCA 2C0EA 5B6MA 4NV2A 1K3LA 1UVZA 2QC7A 4OFNA 1SD9A 3OR5A 2JL4A 2XC2A 2HFDA 1E6BA 1X5EA 2CAQA 1ZMAA 2V41A 2RM6A 5DAKB 1S3CA 3GN3A 3ED3A 3KH7A 5D8IA 1EWXA 3TRQA 3DGQA 3LEFA 2AAWA 4YQUA 3EU3A 4IP1A 5ECLB 1K0DA 2E7PA 3UMAA 5DALA 5IO0A 2CT6A 2FA4A 1QGVA 5HR3A 2DLXA 1LU4A 1PQNA 3O3TA 2O8VB 1R7HA 1ACVA 3C1SA 2LRNA 3DVXA 3HHVA 4J2FA 4Q5NA 1BYEA 3ERFA 3M9KA 3N9JA 1PN9A 2YWOA 5H5RA 4ZBAA 3L78A 1M9AA 2DC5A 5KN2A 2CVBA 1U88A 3C1RA 2H6XA 3GYKA 5DJLA 4LA1A 1OE8A 2H8LA 1KTEA 1ON4A 3DWVA 4OO5A 3CTGA 1PA3A 2GS3A 2DIYA 2EIOA 4L5OA 4HS1A 1WP0A 1GULA 2IJYA 4GCIA 3Q74A 2ALBA 1K0BA 2DMLA 3F6DA 1FVKA 5B8BA 1WOUA 1K0AA 3CSJA 1JHBA 3GRXA 18GSA 1B4PA 4GXZA 1E2YA 2LJAA 1U3AA 3IXRA 3DEXA 2L59A 3EVIA 3G7IA 1ILOA 5G2ZA 5HFGA 1A2MA 3EC3A 4CW9A 6GSSA 3ZITA 4N11A 1N8JA 1U6TA 2OADA 1JLWA 2E2GA 2PU9C 1GH2A 4EE0A 2YN1A 1M7TA 1GSSA 3C8EA 4ZB6A 4I97A 2ON5A 4POLA 2PGTA 4XS4B 2CA8A 1EGOA 4OO4A 1U87A 2FNOA 4CDOA 3LG6A 3AY8A 2ZCTA 4XIHA 1B9YC 1FVJA 4RI7A 1OKDA 4WKWA 1T7PB 2H74A 2MBTA 2A4VA 4MJAA 3WT1A 2HZEA 3BCIA 5L71A 2VM2A 4X43A 3ZFLA 4JR4A 4K7NA 5CRHA 4QL9A 4IVFA 4KSMA 3HVSA 2VCVA 2YP6A 5HR1A 4GWRA 4BVXA 3ME8A 2F51A 3LWAA 10GSA 3DIEA 4GSTA 2IMEA 3QAGA 4TXOB 5JWRB 2AJQB 3WYWA 5INYA 5DQSA 4EL1A 2GSQA 2HT9A 3RAZA 5IPHA 1TTZA 2YJ7A 2KUCA 1GSDA 4TR1A 4LLRA 4G9HA 2MMZA 3U5RE 3WGXA 2DIZA 4O32A 2C3TA 4BL7A 1RQMA 3MAKA 3RPPA 5DQYA 2LQOA 1ERVA 1BEDA 2L5OA 3HXSA 2BMXA 4OMVA 1OC8A 2O85A 1GSQA 1KEBA 4ZIJA 1XPVA 2TRXA 1V9WA 2L57A 2GSTA 4DSQA 4KDXA 3GTUA 2DSAA 1HD2A 4N10A 4GRFA 1MD3A 5GZZB 3HY2A 4HZ4A 2L4CA 4RQXA 1SL2B 4MPFA 1A2LA 4GF0A 2GZYA 3HZ4A 4IN0A 4XCSA 3GL3A 1AUCA 1F37A 3VWUA 5D9WA 3H4KA 2H1DA 5FWGA 1WMJA 3TKPA 5HR0A 2FWHA 4BWQA 3Q18A 3UBKA 3TKSA 2M46A 2P31A 1V57A 4I2TA 1HNCA 2H0IA 3VWXA 1T00A 4MPGA 3CRUA 1FB6A 4HEA2 2HYXA 4JE1A 4PX1A 5EL8A 3J7Yb 1ABAA 4TW5A 1TKDB 2JACA 2WCIA 5F06A 3F3QA 2AHEA 2GSRA 4O7HA 2RUFA 4LL1B 1Y6EA 1G6YA 4PUFC 2YNXA 3GSTA 1EOHA 2JZTA 1Z6NA 5G1LA 3S9FA 1PRXA 1PD21 1XWCA 3BJ5A 5FT3A 3DKSA 1ZOFA 4H86A 5G1KA 2HRNA 1BJXA 1ERTA 2VAFA 3EYTA 3QOUA 5IOXA 1SKSB 4KGIA 3LFLA 1OC9A 5ECKB 5D9VA 22GSA 2V2GA 4V1Ag 4OCFA 2N5FA 2H0GA 1O81A 1EOGA 1XOAA 1HNBA 3P90A 1DUGA 1XXUA 3APSA 2X99A 2GQKA 4MZBA 2WS2A 4ISDA 3HYPA 5ID2B 2VO4A 2DJKA 2LQQA 1JFUA 1RK4A 1GNWA 2IPAA 2A2RA 1VRSD 1TRVA 2YCDA 5D73A 4TRXA 5CRGA 3F4RA 2F3MA 1EEJA 5DBQA 5ECOB 3TJFA 7GSSA 2VUPA 1A0FA 3KD0A 1XW5A 3KTLA 1HNAA 5H5SA 4HU9A 1Q98A 1UN2A 2O87A 4KNDA 3EU4A 2E0QA 2R5GA 3HDCA 4I8BA 3UJ1A 2PN8A 5C00A 3WGDA 5AIXA 2OBKA 1R26A 3FYGA 5AGYA 5A4UA 3LXTA 1SJIA 2PPTA 4F0BA 1KBNA 1N2AA 3L4NA 1PSQA 1A24A 4I5QA 2N5AA 3ZLPA 4GTUA 5J41A 3BCKA 3J7Yk 1XWKA 2YV9A 1BX9A 3HVXA 4MP4A 1ZYQB 5DAKA 2H30A 2NTOA 2ON7A 3IV4A 4XRAA 2V6OA 11GSA 2FGXA 1LBKA 1K0CA 1YY7A 3IK7A 2CX3A 3KMNA 3ZVJD 5JWOB 1PX6A 2B7KA 4IP6A 3M8NA 4OFMA 2WZ9A
chains in the Genus database with same CATH superfamily
1JBTA 3B4OA 3OW22 1BAYA 2YJHA 1GTAA 3GMFA 4YQVA 1TRSA 1ZX2A 4GB5A 2VL2C 5KN1A 1VQL3 3IDVA 2W9PA 3M8CA 1JZDA 5CXOA 2WGRA 1B2ZA 3H8QA 5CLKA 1EV4A 3PPUA 2HLSA 4V1Ap 2J23A 2E2MA 1XW6A 4ZL9A 1ULJB 1JBSA 1CEWI 4K0NA 4ZL7A 1BRHA 2B1LA 3DYRA 2OQEC 5CRWA 3SBCA 2FUG2 5CF2A 4J57E 1GTIA 3X3XA 4R9LA 1TXXA 2VL3A 2STDA 1EZKA 3F3RA 2YWMA 3JUNA 3IA1A 3MG3A 2DJJA 2LKUA 1THOA 2WULA 3US3A 4HI7A 1GTBA 2GVPA 1JLVA 2KOKA 3CNXA 7STDA 2V1LA 3F14A 1GSYA 3WMDA 13GSA 4KDUA 2HSMA 1SL1B 2KHPA 1R4CA 5M1AA 1QXHA 3TCOA 4WFOA 1QAKA 1I2FA 1LQGC 1GLPA 3Q90A 2IIYA 1A23A 2OE0A 1B4QA 1A0RP 2K0MA 4K1VA 1Z3EA 3KP9A 1I3FA 1N8R4 3D4MA 5HQPA 1KNGA 4I4KA 1R5AA 2GZPA 5B7CA 3NQZA 4KF9A 4MLYA 3WA2X 1R4YA 4FO5A 1O8WA 2ML5A 2H66A 1SARA 1YKCA 1X9MB 4EDYA 3F9SA 2V1MA 2CVDA 1XIYA 4HM8B 5TGNA 4FYBA 3EN8A 5H5QA 3E99A 2UZ8A 1B2MA 3LZAA 2B1KA 2K54A 3IR4A 3EBTA 4JF8A 1PMTA 3GSSA 1PKWA 3GKMA 1VQK3 5IW9A 4MJBA 4G0LA 4MDCA 3ZTLA 2PMTA 3TOTA 2OA7A 3CMIA 3LTBA 2D2ZA 2KCDA 1YEPA 2MZCA 3LH4A 4KVHA 4CDLA 1J08A 4NHZA 2E2VA 1OF5A 5HFKA 2TIRA 2PVQA 5LCZA 1C72A 5IOWA 3NBJA 4XS4A 2MBSA 1V40A 5JWQB 3URPA 1RGKA 1UCIA 4WEYA 1SIHA 5M19A 1JBRA 3I69A 1E3RA 1XOBA 2NDOA 2EC4A 2F56A 3W6GA 1PU4A 1M3IA 3UARA 3EMPA 5GAPD 3GFKA 3HJMA 3I553 3BD2A 2R37A 5CF1A 4KAEA 1B20A 2LV3A 3MSOA 3IBHA 1UW1A 3EHCA 4MK3A 4RNZA 4PEJA 2KP1A 3APOA 1EG9B 4EO3A 2AB6A 1KC84 3LJRA 1A2JA 4FIWA 5G5FA 1NSWA 1BANA 2IMFA 4JBBA 1CQHA 1O85A 1AW9A 1Y25A 1X1UA 1EV9A 1TU7A 1DVCA 2XBIA 1SU9A 3PZWA 1Z7PA 2GT5A 1ZZYA 2WFCA 2F8AA 1GY7A 1TRUA 1Z9HA 2GEYA 1GMQA 8GSSA 3PR8A 3KIIA 1AC1A 3WT2A 2B6MA 1RTUA 3U1WA 3DGYA 4NXIA 2LS5A 3KH9A 1T4YA 1RHLA 4N3VA 2RNTA 4XS1A 3RGAA 1O8XA 4J5GA 2B3SA 1BU4A 1B48A 3RNTA 2M80A 2IWTA 4CHSA 4G10A 2VLUA 2B5XA 1X9SB 3FW2A 1NM3A 4TXOA 4Q5RA 4OK0A 4WP5A 4WBJA 1F3AA 5BRTA 1I3IA 2XGLA 1GLQA 3I9V2 4AJ7A 4MCUA 1T2IA 4P3YB 1WE0A 2YV7A 3DH2A 4R80A 3HKRA 1BNRA 2HZFA 3F9UA 2M7OA 4L0UA 1AV4A 1O7GB 1SJ6A 1M2AA 2PERA 3A5WA 1K41A 1H4OA 1I2GA 3FF0A 3G4S3 2RUEA 4LMIA 4WR4A 3UAPA 5AIIA 4K1FA 3N5OA 4IELA 3PCRA 1TOFA 1BNEA 3LOYA 4EW5A 2O89A 1A8YA 2GEXA 2GGTA 4K9ZA 3UVTA 3ZRDA 4BTYA 2TRCP 3MIXA 3ISOA 3CCS3 3HVNA 3FMWA 2H19A 5LD0A 5GSTA 2XFTA 2I9HA 2K9FA 2H1GA 4DSSB 4XTSA 3I6AA 1RRLA 4HKVB 4NAXA 20GSA 1AXDA 3AHWA 1YJ6A 4I6XA 1D6YA 4TR4A 2WO0A 5JPUA 5A4VA 4AGSA 2YPMA 4HDEA 5CAXA 4OUQA 5ENUA 3VWVA 2FD3A 5EEOA 3L9VA 2HMMB 2BTOT 2X4AA 2YZHA 1STFI 2Z7AA 4PQ1A 1PL2A 1BRNL 3K9MC 2K6VA 3ZG5A 5IPGA 2CZ3A 2HSYA 8CHOA 4WWUC 1AIUA 4EBGA 3IPTA 9RNTA 4WF4A 5AI1A 4BVYB 1SK2A 1US1A 1K8A4 1PY3A 3GHAA 1ZYPA 3TRPA 3NBRA 3TOUA 1ZYNA 4FH8A 2Q07A 1GNEA 2OKAA 4X0XA 5ELGA 3PYJA 4ULXA 1FAAA 1ASKA 3CCR3 3EE2A 4N30A 4AKZA 3LYGA 1GP1A 1GSUA 1O7PB 1OKTA 4XB5A 3F7XA 3ZIVA 6GSXA 5DCHA 1XVQA 1W2B2 2XSHB 4HJ2A 2UUGC 3G9BA 1IV7A 1IQXA 1I9DA 4HU7A 1Z5YE 1IVWA 2LTKA 6GSWA 2XFSA 2DJ1A 2JZSA 4KT3B 1J9BA 5D81A 3BLZA 4X1UA 2IL3A 5D9XA 3IPZA 5E4WA 1QK8A 4FR9A 3Q1CA 2W6JH 1UCJA 4GLTA 4DEJA 1GOVA 1AVKA 3NIVA 3FSDA 1F6MC 2LEGA 3D0ZA 4G19A 3X40A 5FHIA 1FGRA 3QFAC 3QMXA 1GD3A 1ZL9A 5GAND 4N6MA 1KWIA 3DGLA 1PN0A 4DKIA 2E2TA 1IQYA 4IIAA 4EIPA 1GD4A 5ID2A 1TUHA 1Z6MA 1NNVA 1K9M4 1PGTA 1FA3A 2CVKA 4EF0A 4BPYA 4E8EA 1WIKA 3W8SA 1F2EA 1TP6A 4PGTA 2I9WA 17GSA 4G1MB 4TR3A 1BNGA 4GQCA 4QQ7A 1AQVA 3C71A 2LRTA 4IW9A 1W01A 3CCU3 4G0IA 2J9HA 3CSHA 5CK6A 5D96A 3KEBA 3QK9A 5BIRA 3N54B 5AEUB 1FW7A 4MEIA 3EX9A 4PURA 3FR9A 2H01A 2H1BA 1VF2A 2P09A 3FG3A 1HQOA 2FWEA 2O7KA 2H70A 5JBSA 2V6KA 2F9SA 2GZZA 3ME7A 4NWYA 2EIRA 1WRYA 4Z2TA 3AMOA 4EC0A 4BA7A 3KZQA 5DJMA 2J8XB 1TTOA 2ZHXB 2CAIA 1Q7HA 2CH9A 1OGXA 3NQYA 3UIWA 3FHKA 2QA2A 1Q42A 4KFEA 4LMWA 2H75A 3TKSC 1LJRA 3KCHA 4ZM8A 1U3IA 2FY6A 1F3BA 4RI6A 1WMOA 1X9WB 1NHOA 4D73B 5J4UA 2W0QA 1PL1A 2IUJA 2MYGA 1RN1A 3H79A 2A15A 1OUNA 4I2UA 1FOVA 3B7CA 4Q53A 1AQXA 3GL5A 1VQ53 3NUVA 2DJ0A 1T4ZA 4YAVA 3ZFZA 1A2KA 5IM9A 2H72A 3FZ9A 1EP8A 3IC4A 4L8PA 2VCTA 3ZVJA 5DDLA 4PQIA 2IMIA 3WA3A 3H1NA 3NM2A 1K3OA 4K8MA 5FW5A 2B5YA 3FG1A 9GSSA 3DVWA 2BMOB 1DE2A 3FLJA 1ST9A 2D1WA 1EA2A 1O7NB 1ROVA 4O5QA 3T0UA 2R3XA 2F8FA 3DD3A 3V92A 3L9SA 1IT8A 2H73A 2Z9SA 4Q5QA 1Y4KA 3PCSA 2L6CA 2CC3A 4O02B 3OX9A 2Z6BA 4JEDA 1W7CA 2CX1A 3QD9A 4POKA 1M3JA 4F82A 3ERWA 1GSPA 2PVOC 2BHMA 2KF6A 1PFOA 4KX4A 4GSSA 1RCLA 5J9BA 1ERUA 1RW1A 2Z77A 4K7OA 1B2SA 3KJYA 2GDRA 2LJRA 5IENA 4HM4B 4L5LA 3G0KA 5G30A 3N8BA 1NB3I 2CHCA 4KCEA 1G7EA 1J2BA 4MF6A 1X1XA 3G7YA 1EGRA 1IVVA 4MF5A 1HYUA 5AIGA 3ZZXA 1ZGXA 2GBWB 2QIYA 1ERWA 2C10A 3APQA 3EURA 3CYNA 1Q40B 4IJ3A 4IS0A 5IMDA 2MMOA 2YZUA 4MJCA 3FGYA 1TFKA 3E3EA 1MOLA 2UGIA 4WBRD 1BIRA 3JUOA 1UUVB 2QEX3 5ECQB 1O73A 1BSAA 1M9BA 2BMRB 2A2SA 4G2EA 1SKWB 1C54A 2IA7A 3M0FA 1TU5A 1CYVA 1FW1A 4NHWA 3CXC2 1LVNA 5LNKe 3KIJA 2H1AA 1EP7A 4BU4A 1BNSA 3CC23 2XBQA 1LOYA 4EIQA 2INXA 3MYTA 1MDKA 4EUYA 5J5NA 4KA0A 3F6FA 1MNLA 3VPQA 4JZQA 1BRKA 4ILFA 2KF4A 2CIUA 2QA1A 2HOHA 2VCWA 6GSVA 1AQZA 4FYUA 2K8SA 2H0HA 2MC8A 2GTUA 3GURA 1FUWA 2JU5A 3C73A 1S723 2C3QA 5JPPA 12GSA 1DBYA 2HMNB 3VI5A 2IFQB 3JUQA 1X5CA 4FCMA 5ECSA 3SX1A 4E8HA 5D83A 3LORA 3PINA 2I3YA 5G5EA 2MMNA 5D82A 1ZGNA 2WDUA 1GUMA 4O3VA 5EVOA 3HJPA 2IMJA 3H93A 2GU3A 2ZDJA 2C4JA 2GLRA 3FEUA 3VK9A 4TKYA 1FGTA 3F0IA 1I0VA 5CO3A 1K3YA 1TIJA 2GBXB 4MMMA 5DCGA 1MDJA 5JCWA 1I8VA 3CCM3 3TJJA 3HIIA 1GTUA 1XWGA 3JCML 3LSZA 1NJI4 3DZLA 3LYKA 3A2VA 5A0OB 3FKFA 5IERA 1FB0A 1NB5I 2RFRA 5ELUA 1QFNA 2H71A 1UC7A 3MDKA 2XGNA 4X2HA 1LNIA 1WWJA 4NPBA 1BSDA 2R0PA 4POMA 1JZOA 1TK5B 1RN4A 2OTL3 2RSXA 4PNFA 1TRPA 4Q5FA 1TP9A 1A8LA 3KSED 1MDIA 3G6E3 4R9KA 3KM6A 1RGLA 4MH3A 3EC9A 3Q3FA 1MTCA 1C7HA 6RNTA 5KP1A 2VLTA 3UBLA 2HXKA 4MMZB 3GX8A 2C80A 4ZILA 1W4VA 4RNYA 4STDA 2DBCA 2F5WA 4XHMA 3LGCA 1Z1SA 1YI23 3ERGA 8RNTA 4HOJA 4F03A 1UUGB 5IQYA 2K18A 5KP4A 3CRTA 1T8EB 3T8NA 4ECBA 3N9HA 5A4WA 1TFOA 5J3RA 1B2UA 3FZ5A 1AY7A 3I563 2GSSA 5ECRB 2G2QA 3EINA 3QR6A 4JR6A 2VIMA 4LL4B 1IYYA 2FWFA 2ZUPA 2BT3A 3G713 1THXA 5M18A 3D21A 3W8JA 1W89A 4MH2A 1BSBA 3HX8A 1A67A 3KP8A 2ZNMA 3UJMA 3DMLA 4IBPA 4GHOA 3BBYA 3FZAA 3F40A 1ML6A 2FXTA 3ROBA 4MF7A 4FMBA 3MWHA 1GSFA 4CJNA 3GA4A 2K8VA 3JUPA 5B6NA 3UOMA 3ZMLA 4HZ9B 1YEXA 2F98A 1OC3A 5AIVA 1K0OA 1O6JA 5E59A 1O7HB 1XCCA 1QMVA 4JU5A 1RDSA 3SXXA 5IMCA 3R3EA 4HJMA 3TDGA 2KF5A 1BG5A 1FHEA 5F07A 4QL7A 4EKZA 2OBIA 2FA8A 1SJZA 3UL3A 3LW9A 1CQSA 3CME3 1M0UA 1OYJA 4PUAA 5ABRA 3HCZA 1VQ93 3FR3A 2C0FA 1RRHA 3FRCA 3CNMA 2PNCA 3EMXA 4HQZA 2VM1A 3GH9A 1BRSA 2CX4A 4YH2A 1USBA 4PNGA 3GZYB 3EQQB 2NVLA 2QSIA 4DSSA 3PXMA 3A3TA 3OWUA 3OV4A 1BUJA 4IJIA 3HOHA 1U8CB 1MWRA 4XBTA 3LT9A 1NW2A 2RM5A 1TJDA 1GRXA 3ZMKA 1VQ73 4HM5B 5IO2A 1M904 1TRWA 4RBNA 1XWBA 2OE3A 4K7IA 3CCJ3 2GSPA 4V2NA 1MEKA 1M2BA 1TU8A 4HZBB 1XWAA 3QDNA 4KB3A 3HA9A 4FQUA 1PKZA 2VCZA 1N9EA 1PYLA 2R0GA 2I81A 2LUSA 3VSYA 2IY2A 5IMZA 3DMCA 5C04A 3A2XA 3FH1A 1I70A 1ZO2A 2RLIA 4BVYA 2YANA 2C0DA 4HUAA 2CZ2A 1G02A 2DJ3A 2HRFA 1DETA 1EEMA 1K0MA 3VPTA 4RNTA 3IE3A 2CG0A 5ECMB 1GOYA 1KD14 3MSZA 3GV1A 4L0WA 1NU3A 1FZUA 3WHOA 1VQN3 2XPDA 2H6YA 3E0UA 4O92A 1DE1A 3KZTA 4ML6A 1A90A 4RUVA 4AJ8A 4ECJA 2C0GA 1CQGA 3HD5A 4WETA 3GH6A 3NV0B 1W6GA 3MYDA 4OCEA 1T5YA 1GYBA 3WDGB 2LQVA 4NREA 3NHXA 1RCKA 1M2DA 1RKYA 2C8UA 4OWYA 1V58A 1YDKA 4LGQA 2OOVA 1TDIA 3TKRA 4N0ZA 1G0TA 4Z7XA 1I0XA 5AISA 1LOVA 2B7JA 2NBSA 4TVEA 4K0GA 6GSYA 2X64A 1BRGA 1JZRA 4NMUA 1VQ43 3IJEB 3OWYA 2CWTA 1DSBA 1BVIA 1AAZA 1RGCA 2FCHA 3G7JA 4KE3A 4F2IA 2JSYA 5DRVA 3CTFA 1SK0A 3VLNA 1IK3A 2P5QA 5JCGA 3TKQA 1SL0B 3EB8A 5JCUA 1YF0A 3KCMA 5DALB 3FG4A 3TB2A 2BO9B 4GSNA 4AF2A 3DY5A 3IC8A 3KXOA 3KMOA 3NZNA 1FUSA 4NV5A 4ZB9A 4Z2RA 2C3NA 4XDWA 3QAVA 4ACSA 5CP1A 1XVWA 2FWGA 1WPIA 2EIQA 3RBTA 3VURA 2VL9A 3CCL3 4TR0A 3A76A 4IQ1A 6GSTA 3GZXB 4OFTA 1ZCPA 4YQMA 6GSPA 3F4TA 1X1WA 1YKAA 2LNSA 1VZZA 2QKEA 1LRAA 1SQWA 2X49A 3ALAA 2REMA 3K8NA 4FMDA 3Q6OA 2DMMA 3EBYA 1YVSA 3FK8A 2YFJB 2HRKA 3FY7A 1W00A 4K1UA 1CYUA 1T2HA 2OACA 4AJ6A 4RZMA 2XEPA 1TI3A 2GQLA 4KDYA 2CX0A 1YGEA 1K0NA 3KTBA 3TUEA 1MWUA 2IN3A 2CFDA 2YWNA 3L9UA 5AYRB 5EPFA 2F5MA 3O6TA 2CV4A 5AYSC 3Q19A 5BU4A 1I5GA 3NOFA 1MGRA 5ECHB 5IG0A 2HMKB 2RIIA 2KF3A 1SK1A 1S3RA 1EKMA 4QWTA 3HVVA 1FGOA 1B21A 5IEOA 1IU7A 3ZIJA 5CNWA 2Z76A 3BU4A 4D73A 4BTXA 3ZFBA 4HBRA 3STDA 2R6KA 3A2WA 4KH7A 3V98A 1STDA 1YZXA 2VOCA 4A5PA 1QUWA 2K3DA 3D9RA 3QFBC 2PWJA 2BNGA 4K90B 1BGSA 2R4VA 1MWSA 5A5KA 2H76A 2IMKA 3GAXA 1J0FA 3GZRA 4MMYB 3FCSB 2R0CA 3EWLA 3D79A 4BL3A 1UUWB 3VFIA 5KN3A 1FUTA 4FYCA 4GQFA 4KCAA 1RNBA 1OE7A 3R2QA 2N5BA 4ECIA 1Q864 1JZWA 2KLXA 4XRDA 1XZOA 3CQFA 1BQ7A 1FGMA 2AUVA 3SWLA 2CQ9A 2R4IA 3UEMA 14GSA 4F0CA 4V2MA 1GUKA 2VD1A 4N6OB 3K7CA 2DJ2A 4LZIA 3F4SA 3U6VA 2YFIB 4CY6A 4WR5A 4HQSA 5ELAA 3UVHA 1S3DA 2W2CA 1UA5A 2IYJA 5AN1A 4O5RA 1X0RA 4YAPA 1V74A 1Q814 3VWWA 2P38A 3OWSA 2L1SA 1PX7A 1OGZA 2VD0A 2LSTA 3SEDA 19GSA 1XFLA 1VF3A 1FG4A 3I43A 5EVHA 5G31A 4L8OA 4EVMA 1RSNA 3QAWA 2ZA4A 6GSUA 3M1GA 1F9MA 2G0FA 1BRIA 4MZWA 4RQRA 1SJWA 4DVCA 4ZB8A 3CPW2 4O8SA 2LJKA 2AYTA 3M9JA 2LRCA 5CRDA 2B5EA 3AGNA 3CCV3 2OCTA 5ECNB 1Q40A 2HZEB 3TKSE 2X8GA 4WHAA 2KP2A 3IHQA 1B9XC 1VQP3 2B24B 1LNHA 2WB9A 2GT6A 1WJKA 1YF1A 2HNLA 5GSSA 4TOPA 1SKRB 1MD4A 1AR0A 1BNFA 1GWCA 1OAZA 3O76A 3EJVA 3KGKA 1QAFA 3GX0A 3P2AA 3M3MA 3A5EA 2P5RA 5EY6A 1SYRA 4TX4A 2JADA 3KSPA 2P0GA 3TRXA 2Y74A 5KN0A 2FHEA 2C1YA 3SOAA 2BJXA 2JZRA 3D22A 3IOSA 3TJBA 4MABA 2C4BA 2I1UA 3UNLA 4MZCA 3ZL5A 1O7MB 1SD8A 4TR1B 4YKGA 3CXGA 1FOHA 2IFQA 4XS6A 1V2AA 4K5SA 2OWPA 4BL7B 2W56B 2E2UA 4MMXB 5RNTA 3WD6A 2MF7A 1LQMB 5HFIA 2H6ZA 1BSCA 2L4QA 4ORLA 2HE3A 4OD7A 1UDII 3CBUA 4R4KA 3FZ4A 2CFLA 3LT8A 3S29A 4KUNA 4IT7A 4TN8A 1TK8B 1GL8A 4ZBBA 4L8EA 1OVNA 5F0GA 3CSIA 4IQAA 3GTUB 4HM3B 1ZYEA 1NO3A 2QGVA 3D6IA 3BNDA 2WOHA 2LYXA 2XH9A 1DMQA 4ZBDA 1S5AA 3J7Yd 2OJLA 1B27A 3H3HA 1DE3A 4IGJA 3Q2PA 3RGRA 1SYXA 4DSRA 1URMA 4HZ2A 1N8QA 2F4YA 4POBA 1AVLA 3RHBA 3AGOA 5HR2A 1XBSA 3TJKA 1M1K4 5COHA 5IEPA 3F63A 3P7XA 3C7MA 4EDZA 5HOHA 2X8HA 1O7UA 2D42A 2BMQB 3VI7A 5STDA 3GKXA 1S3AA 1W6CA 16GSA 5IG4A 2JSZA 3GIXA 2OE1A 2PBJA 4MA9A 5KEJA 7GSPA 3D5JA 4WF5A 3V1WA 1RJOA 4PTSA 1QVG2 3BOAA 1Q7Y4 1SPUA 1IYHA 3TGZA 4IKHA 1MWTA 1RN7A 3GKKA 3GNJA 4V2LA 5IMFA 2P05A 1A2PA 1IT7A 4EC6A 1R4WA 1V98A 4ML1A 3CCQ3 3RHCA 3X41A 3LYPA 4N0VA 1FYSA 4PXOA 3OXAA 3TJGA 3E9JB 1B8XA 4ZXGA 4XM4A 2RCDA 2QA43 1M99A 4BIRA 4JRRA 3HK4A 2ES7A 1Q4JA 2VCXA 1R5PA 2WRTA 1F8NA 1G6WA 3LQ7A 3F8UA 1IYIA 2HMOB 4PQHA 3L0HA 4BWSA 3GWRA 3O8YA 2M72A 5B8AA 4HM0B 3FR6A 1OH0A 4N6LA 1NWWA 5IMAA 1G7OA 1GSEA 3NXJA 1QVF2 1Z7RA 4EV5A 5CYYA 3VGNA 4USSA 2NPBA 4ZL8A 1RNTA 1VF4A 5IMVA 4L7KA 3JUMA 4KW6A 3MG2A 2VL2A 1JKGB 3DXBA 2AAEA 3D4TA 2AV4A 5F8BA 3GUSA 1QQ2A 2X8CA 2HI7A 2FLSA 3GKNA 5D93A 2XHFA 3KFQC 2L5LA 2RBIA 2PUKC 1OC9B 1VQM3 1JN5B 1GUHA 2I4AA 1HYFA 1VF1A 3PGTA 2OQEA 3AHSA 1YHQ3 5D9TA 4CY8A 5ECPB 4U13A 5KOXA 4K5RA 2HSHA 2V32A 5KOWA 3LXZA 4HM1B 1ULIB 2B1XB 1X5DA 4LMVA 5IIZA 1YQ1A 2JQ5A 1T3BA 2VCQA 4EXRA 2QGUA 3G8ZA 3ZYWA 3RPNA 1GS3A 1TI1A 6STDA 3B4PA 5F05A 7RNTA 3ZREA 4ID0A 3QPMA 5DVBA 1HKXA 3IAM2 2CKFB 3IAS2 5AEWB 5ECIB 2CFGA 2IMDA 4J56E 1W5ZA 4XDVA 3T8UA 3PH9A 1BUQA 4F9ZA 1TK0B 1JNQA 1H75A 5AIFA 2A2PA 2R2JA 4IHUA 1RGFA 1SENA 5GSPA 1TW9A 4TXVA 1FO5A 4GSPA 3GRDA 3S28A 5AIHA 4EXJA 3IK9A 1I2EA 3HZ8A 2C11A 2LNTA 1YGWA 4K6XA 2YWIA 1YJW3 3A5IA 3DRNA 3I0YA 3RDWA 1XW9A 1HZ1A 2WJUA 3LTCA 2GQMA 1IDPA 2VLVA 3PS8A 4MJEA 4JRFA 3HJOA 4K2DA 4KSOA 1IV9A 3SVAA 1T1VA 3QCPA 1VGLA 4WXTA 3WGEA 1VQO3 3MNGA 4HM6B 3MPHA 2L6DA 3FZWA 3P8WA 1CH0A 2XPEA 5J9CA 2YOIA 1OHOA 3IRAA 1AQWA 5CREA 2MMAA 1WMNA 1GY5A 1OACA 1NHYA 3CPOA 4ECCA 2C0EA 5B6MA 4NV2A 1K3LA 1IVXA 1RGHA 1UVZA 2XRXB 2QC7A 3DXOA 4OFNA 1SD9A 3OR5A 2JL4A 1L5GB 1HU9A 3NV0A 2XC2A 2HFDA 1E6BA 1X5EA 2CAQA 2WOFA 1ZMAA 1NDOB 2F86B 2V41A 2RM6A 1OPYA 2JDIH 4CPKA 3X42A 5DAKB 1BAOA 1A2VA 2PZVA 3LXUX 1S3CA 3GN3A 3ED3A 2W04A 4WYKB 1N9JA 3KH7A 5D8IA 4N6UA 1EWXA 3FKAA 3K5TA 1GOUA 3TRQA 2ZL8A 3DGQA 3LEFA 2AAWA 1B2XA 1X1YA 4BIKA 1N5PA 3WOFB 1IQ8A 1UI7A 3WOEB 3EU3A 4IP1A 4YQUA 5ECLB 3SLUA 1K0DA 1YIT3 2E7PA 1W02A 2A4HA 3UMAA 3CU3A 2KXGA 5BMUA 3D4AA 3LTDA 5DALA 5IO0A 2CT6A 3CCE3 2FA4A 1QGVA 3DGOA 1RLSA 5HR3A 2DLXA 1LU4A 1PQNA 1KQS2 3O3TA 2O8VB 1R7HA 4K61A 4CCVA 1ACVA 1XG8A 3C1SA 2ML6A 1E97A 1VQ63 2LRNA 3BNCA 3DVXA 2CG1A 4BL2A 3HHVA 4J2FA 1WQLB 4Q5NA 1BYEA 3ERFA 3M9KA 1RGGA 4N6V0 3N9JA 3CC73 1PN9A 2YWOA 5H5RA 2W03A 4J8TA 1DYUA 4R1KA 4ZBAA 3L78A 1M9AA 2DC5A 5KN2A 2CVBA 1U88A 3C1RA 2H6XA 2FNQA 3GYKA 5DJLA 4LA1A 3SYUA 3UL5A 1OE8A 3U97A 2H8LA 2P0MA 1KTEA 1ON4A 4EYCA 3DWVA 5IG5A 4OO5A 3CTGA 1PA3A 2GS3A 2DIYA 1OCVA 2CFWA 2EIOA 4L5OA 4HS1A 1WP0A 1JB4A 3JVCA 3D5IA 1GULA 2IJYA 4G0KA 4GCIA 3Q74A 4KZ1A 1BNJA 1YJ93 4H61A 2ALBA 1K0BA 2DMLA 3F6DA 1FVKA 5B8BA 1WOUA 3MWZA 1K0AA 3CSJA 1ROAA 1G96A 4HYZA 3CD63 1JHBA 3GRXA 18GSA 1B4PA 4GXZA 1E2YA 3WR2A 2LJAA 5DREA 1U3AA 3IXRA 3DEXA 1UCLA 2L59A 2XF3A 1DMMA 3X3YA 3ZG0A 3EVIA 3G7IA 1ILOA 3ECFA 5G2ZA 5HFGA 1A2MA 3NX0A 3EC3A 4CW9A 6GSSA 3ZITA 4O5UA 4N11A 3DUKA 1N8JA 1U6TA 2OADA 1JLWA 2E2GA 2PU9C 3K0ZA 1GH2A 1Q9EA 4Z2UA 4EE0A 2YN1A 1M7TA 1GSSA 3K63A 1VQ83 3FF2A 3C8EA 4ZB6A 3DM8A 1OF5B 4FMAA 4I97A 2ON5A 4FCJA 4POLA 2PGTA 4X2OA 1GY6A 2OOVC 4HJLB 3F7SA 2DKIA 4XS4B 1D6ZA 2CA8A 5IG3A 1EGOA 4OO4A 2HMJB 2WGQA 4XBXA 1U87A 2KAAA 2FNOA 4CDOA 3LG6A 3AY8A 2ZCTA 4XIHA 1U5OA 5EQLA 3BNEA 1B9YC 1FVJA 4RI7A 3BIRA 1OKDA 1E3VA 4WKWA 1T7PB 2H74A 2MBTA 2A4VA 4MJAA 1DVDA 3WT1A 2HZEA 2SBLA 3BCIA 5L71A 1JRQA 2VM2A 2FGTA 4X43A 3ZFLA 4JR4A 3BNBA 3UB1A 4K7NA 5CRHA 1WMPA 4XBYA 4QL9A 1M1XB 4IVFA 1ZS7A 4KSMA 3HVSA 1O7WB 1VQQA 2VCVA 2YP6A 4OVMA 5HR1A 4GWRA 4FMCA 4BVXA 5ELJA 3ME8A 3SOYA 2F51A 3LWAA 4HM2B 10GSA 3DIEA 4GSTA 2IMEA 2GXFA 1IVUA 3QAGA 4TXOB 5JWRB 2AJQB 3WYWA 5INYA 2HRAA 3F8HA 4HSCX 5DQSA 2O3OA 2GSQA 2BIRA 4EL1A 2HT9A 2GU1A 3RAZA 5IPHA 3S5CA 2CFKA 1TTZA 2YJ7A 2KUCA 1GSDA 4TR1A 4LLRA 4G9HA 2MMZA 2YX9A 3U5RE 3WGXA 4EV2A 2CW9A 2C3TA 2DIZA 4O32A 4BL7A 1RQMA 2W56A 3X3ZA 4HVNA 3MAKA 3RPPA 1UI8A 5DQYA 2LQOA 1RMSA 1BEDA 1ERVA 2L5OA 3D3LA 3HXSA 4LSOA 4K2XA 1WNHA 2P0XA 2BMXA 3D5GA 1Q824 4OMVA 1OC8A 2O85A 1GSQA 3CC43 1KEBA 4ZIJA 1YVBI 1YNVX 1XPVA 1BSEA 2TRXA 1V9WA 2L57A 4X4JA 2GSTA 4DSQA 4KDXA 3GTUA 2DSAA 2L4VA 1HD2A 4N10A 3UL6A 4GRFA 1MD3A 5GZZB 2XR8B 1JJ22 3HY2A 3DGMA 4HZ4A 2L4CA 4RQXA 1SL2B 4MPFA 1RGAA 1A2LA 4GF0A 5LC6A 2GZYA 2SARA 3HZ4A 4IN0A 4XCSA 3GL3A 1AUCA 1F37A 3VWUA 5D9WA 3H4KA 2AADA 2H1DA 4YKFA 5LC7A 3NM7A 3IMAB 4J9AA 5FWGA 3B8LA 1WMJA 3TKPA 3LMLA 4MJDA 5KP3A 5HR0A 2FWHA 4BWQA 3Q18A 3UBKA 4GL6A 3TKSA 2M46A 1LXEA 2P31A 2CK3H 3EN1B 1MGWA 3KKGA 3MKIA 2DKHA 4HAAA 1KSIA 1V57A 4I2TA 3BB9A 1HNCA 1ISKA 2H0IA 3VWXA 1T00A 4MPGA 5G2GA 5BVBA 4HM7B 3CRUA 1FB6A 4HEA2 2HYXA 4JE1A 4PX1A 1RGEA 5EL8A 3J7Yb 5I97A 1WTHA 1ABAA 4ICYA 4TW5A 4IPBA 1TKDB 2JACA 4BVXB 3GSPA 2WCIA 5F06A 1D6UA 3F3QA 2AHEA 1DMNA 2O9UX 2GSRA 4O7HA 1YJN3 2RUFA 4LL1B 1Y6EA 3EPTA 1G6YA 4PUFC 2YNXA 3GSTA 2UX0A 2W9QA 1EOHA 2BU4A 4MNNA 4BTWA 2JZTA 1Z6NA 5G1LA 1N5HA 3S9FA 1PRXA 1PD21 4N6NB 1XWCA 3BJ5A 2KRTA 3V99A 3DKSA 1ZOFA 3IHGA 4H86A 5FT3A 3KN4A 5G1KA 2HRNA 1EUIC 1FGQA 1BNIA 1BJXA 1JB2A 1ERTA 1W4NA 2VAFA 1JKGA 1OHSA 3EYTA 3QOUA 5IOXA 3HZPA 1SKSB 4KGIA 3LFLA 1QALA 1OHPA 1OC9A 5ECKB 1JN5A 5D9VA 22GSA 4KFDA 2V2GA 4NHFA 2XSOB 4V1Ag 3G16A 4OCFA 2N5FA 1O81A 2H0GA 5FGOA 1B3SA 1EOGA 3PGBA 2CWVA 1XOAA 3KE7A 1HNBA 3P90A 1M9GA 1LOXA 1DUGA 1XXUA 3APSA 2X99A 2GQKA 4MZBA 2WS2A 3QRDA 4ISDA 3HYPA 5ID2B 3HI7A 1YIJ3 2VO4A 3L0RA 4N6TA 2DJKA 2LQQA 1BRJA 1JFUA 1RK4A 1GNWA 2IPAA 3VF1A 2A2RA 1VRSD 5BXQA 1TRVA 2YCDA 2F99A 5D73A 4TRXA 4HOHA 4O2HA 2HMLB 1UGIA 2YFLB 5CRGA 3F4RA 2F3MA 1EEJA 4AKYA 5DBQA 1QMAA 1GMPA 2R41A 5ECOB 3DGNA 3EF8A 2IUKA 3TJFA 7GSSA 1K28A 2VUPA 4KFFA 3S27A 1A0FA 1JB5A 3F8XA 3KD0A 1XW5A 3KTLA 1HNAA 5H5SA 4AEQA 1EQKA 1Q98A 4HU9A 1UN2A 1W2ZA 2O87A 3MG1A 2WGOA 3ER7A 4KNDA 1TRQA 2E0QA 4FCZA 3EU4A 1GMRA 2Y73A 2R5GA 3S67A 3HDCA 4I8BA 3UJ1A 2PN8A 3AMOB 5C00A 3WGDA 5AIXA 2OBKA 1PFPA 1LOWA 4LEHA 1R26A 3GZBA 3FYGA 5AGYA 5A4UA 3LXTA 1W6YA 1SJIA 2PPTA 4F0BA 1KBNA 1N2AA 3L4NA 5HGRA 1UGHI 3NBBA 1PSQA 1A24A 2OTJ3 4I5QA 2N5AA 2CWUA 3CMA3 3ZLPA 4GTUA 5J41A 3BCKA 3J7Yk 1XWKA 5IF6A 2YV9A 1BX9A 3HVXA 4MP4A 1ZYQB 5DAKA 2H30A 2NTOA 3RDEA 2ON7A 3EE1A 3IV4A 4XRAA 3LTAA 2RGQA 4WYKA 3HIGA 1QJGA 2V6OA 3MHEA 4H3UA 4J5KA 11GSA 2FGXA 1LBKA 1K0CA 1K734 1YY7A 3IK7A 3H51A 2CX3A 1JV2B 3KMNA 3ZVJD 1BOXA 5JWOB 1PX6A 2B7KA 3WODG 4IP6A 4LYLB 3M8NA 4OFMA 2WZ9A 1SIIA 1UCKA
chains in the Genus database with same CATH topology
1BAYA 2YJHA 1GTAA 3GMFA 4YQVA 1TRSA 2VL2C 5KN1A 3IDVA 1JZDA 2WGRA 3H8QA 1EV4A 3PPUA 2HLSA 4V1Ap 2J23A 2E2MA 1XW6A 4ZL9A 4K0NA 4ZL7A 2B1LA 3DYRA 5CRWA 3SBCA 2FUG2 4J57E 1GTIA 1TXXA 2VL3A 1EZKA 3F3RA 2YWMA 3IA1A 2DJJA 2LKUA 1THOA 2WULA 3US3A 4HI7A 1GTBA 2GVPA 1JLVA 2KOKA 1GSYA 13GSA 4KDUA 2HSMA 1SL1B 2KHPA 1QXHA 3TCOA 1GLPA 2IIYA 1A23A 2OE0A 1B4QA 1A0RP 1Z3EA 3KP9A 3D4MA 5HQPA 1KNGA 1R5AA 2GZPA 5B7CA 4KF9A 4MLYA 4FO5A 1O8WA 2H66A 1YKCA 1X9MB 4EDYA 2V1MA 2CVDA 1XIYA 4FYBA 5H5QA 2UZ8A 2B1KA 3IR4A 1PMTA 3GSSA 1PKWA 3GKMA 4MJBA 4G0LA 4MDCA 3ZTLA 2PMTA 3TOTA 2OA7A 3CMIA 2D2ZA 1YEPA 2MZCA 1J08A 4NHZA 5HFKA 2TIRA 2PVQA 5LCZA 1C72A 5IOWA 4XS4A 2MBSA 1V40A 5JWQB 4WEYA 3I69A 1XOBA 2NDOA 2EC4A 3W6GA 3UARA 3EMPA 5GAPD 3GFKA 3HJMA 3BD2A 2R37A 4KAEA 2LV3A 3IBHA 4MK3A 2KP1A 3APOA 4EO3A 2AB6A 3LJRA 1A2JA 4FIWA 5G5FA 1NSWA 2IMFA 4JBBA 1CQHA 1O85A 1AW9A 1Y25A 1EV9A 1TU7A 2XBIA 1SU9A 1Z7PA 2GT5A 1ZZYA 2WFCA 2F8AA 1TRUA 1Z9HA 8GSSA 3PR8A 1AC1A 3WT2A 2B6MA 4NXIA 2LS5A 3KH9A 1T4YA 4XS1A 1O8XA 2B3SA 1B48A 2M80A 2IWTA 4CHSA 4G10A 2VLUA 2B5XA 1X9SB 3FW2A 1NM3A 4TXOA 4Q5RA 4WBJA 1F3AA 5BRTA 1GLQA 3I9V2 4AJ7A 4MCUA 4P3YB 1WE0A 2YV7A 3HKRA 2HZFA 3F9UA 4L0UA 1SJ6A 1M2AA 2PERA 3A5WA 1H4OA 2RUEA 4WR4A 3UAPA 4K1FA 3N5OA 4IELA 1TOFA 2O89A 1A8YA 2GGTA 3UVTA 4K9ZA 3ZRDA 2TRCP 3MIXA 3ISOA 3FMWA 2H19A 5LD0A 5GSTA 2I9HA 2K9FA 2H1GA 4DSSB 4XTSA 3I6AA 4NAXA 20GSA 1AXDA 1YJ6A 4I6XA 4TR4A 5A4VA 4AGSA 2YPMA 4HDEA 5CAXA 5ENUA 3VWVA 2FD3A 3L9VA 2BTOT 2X4AA 2YZHA 4PQ1A 1PL2A 2K6VA 5IPGA 2CZ3A 2HSYA 1AIUA 4WF4A 4BVYB 1SK2A 3GHAA 1ZYPA 3TRPA 3TOUA 1ZYNA 4FH8A 1GNEA 2OKAA 4X0XA 5ELGA 4ULXA 1FAAA 3EE2A 4N30A 1GP1A 1GSUA 1OKTA 3ZIVA 6GSXA 5DCHA 1XVQA 4HJ2A 3G9BA 1I9DA 4HU7A 1Z5YE 2LTKA 6GSWA 2DJ1A 2JZSA 1J9BA 4X1UA 2IL3A 5D9XA 3IPZA 5E4WA 1QK8A 4GLTA 4DEJA 3NIVA 2LEGA 1F6MC 3D0ZA 4G19A 5FHIA 3QFAC 3QMXA 1ZL9A 5GAND 1PN0A 4EIPA 5ID2A 1Z6MA 1PGTA 2CVKA 4EF0A 4BPYA 4E8EA 1WIKA 3W8SA 1F2EA 4PGTA 17GSA 4TR3A 4GQCA 4QQ7A 1AQVA 3C71A 2LRTA 4IW9A 4G0IA 2J9HA 3CSHA 5D96A 3KEBA 4PURA 3FR9A 2H01A 2H1BA 1VF2A 1HQOA 2FWEA 2O7KA 2H70A 2V6KA 2F9SA 2GZZA 3ME7A 4NWYA 2EIRA 1WRYA 4Z2TA 4EC0A 4BA7A 3KZQA 5DJMA 2CAIA 3UIWA 3FHKA 2QA2A 4LMWA 2H75A 3TKSC 1LJRA 2FY6A 1U3IA 4RI6A 1F3BA 1X9WB 1NHOA 4D73B 5J4UA 1PL1A 2MYGA 3H79A 4I2UA 1FOVA 1AQXA 3GL5A 2DJ0A 1T4ZA 4YAVA 5IM9A 2H72A 3FZ9A 1EP8A 3IC4A 2VCTA 3ZVJA 5DDLA 4PQIA 2IMIA 3H1NA 4K8MA 1K3OA 2B5YA 9GSSA 3DVWA 1DE2A 1ST9A 4O5QA 2R3XA 2F8FA 3DD3A 3L9SA 2H73A 2Z9SA 4Q5QA 2L6CA 4JEDA 3QD9A 4POKA 4F82A 3ERWA 2PVOC 4KX4A 4GSSA 5J9BA 1ERUA 1RW1A 4K7OA 3KJYA 2GDRA 2LJRA 4L5LA 5G30A 4KCEA 1G7EA 4MF6A 3G7YA 1EGRA 4MF5A 1HYUA 3ZZXA 1ERWA 3APQA 3EURA 3CYNA 4IJ3A 4IS0A 5IMDA 2MMOA 2YZUA 4MJCA 3E3EA 4WBRD 5ECQB 1O73A 1M9BA 1SKWB 2A2SA 4G2EA 3M0FA 1FW1A 4NHWA 5LNKe 3KIJA 2H1AA 1EP7A 2XBQA 4EIQA 4EUYA 1MDKA 5J5NA 4KA0A 3F6FA 3VPQA 4JZQA 4ILFA 2QA1A 6GSVA 2VCWA 4FYUA 2K8SA 2H0HA 2GTUA 3GURA 2JU5A 3C73A 2C3QA 12GSA 1DBYA 3VI5A 2IFQB 1X5CA 5ECSA 4E8HA 3LORA 3PINA 2I3YA 5G5EA 2MMNA 1ZGNA 2WDUA 1GUMA 5EVOA 3HJPA 3H93A 2C4JA 2GLRA 3FEUA 3VK9A 4TKYA 3F0IA 5CO3A 1K3YA 4MMMA 5DCGA 1MDJA 5JCWA 3TJJA 1GTUA 1XWGA 3JCML 3LSZA 3LYKA 3A2VA 3FKFA 1FB0A 1QFNA 2H71A 1UC7A 3MDKA 1WWJA 4NPBA 2R0PA 4POMA 1JZOA 1TK5B 4PNFA 4Q5FA 1TP9A 1A8LA 1MDIA 3KM6A 4MH3A 1MTCA 2VLTA 3UBLA 2HXKA 3GX8A 2C80A 4ZILA 1W4VA 4XHMA 2DBCA 3LGCA 3ERGA 4HOJA 4F03A 5IQYA 2K18A 3CRTA 1T8EB 4ECBA 5A4WA 5J3RA 3FZ5A 2GSSA 5ECRB 2G2QA 3EINA 3QR6A 4JR6A 2VIMA 4LL4B 2FWFA 2ZUPA 1THXA 3D21A 3W8JA 1W89A 4MH2A 3KP8A 2ZNMA 3DMLA 4IBPA 3BBYA 3FZAA 1ML6A 4MF7A 3MWHA 1GSFA 3GA4A 2K8VA 5B6NA 3UOMA 3ZMLA 1YEXA 1OC3A 5AIVA 1K0OA 1O6JA 5E59A 1XCCA 1QMVA 4JU5A 5IMCA 3R3EA 4HJMA 3TDGA 1BG5A 1FHEA 5F07A 4QL7A 4EKZA 2OBIA 2FA8A 1SJZA 3UL3A 3LW9A 1M0UA 1OYJA 4PUAA 5ABRA 3HCZA 3FR3A 2C0FA 3FRCA 3EMXA 4HQZA 2VM1A 3GH9A 2CX4A 4YH2A 1USBA 4PNGA 2NVLA 2QSIA 4DSSA 3A3TA 4IJIA 1NW2A 2RM5A 1TJDA 1GRXA 3ZMKA 5IO2A 1TRWA 1XWBA 2OE3A 4K7IA 4V2NA 1MEKA 1M2BA 1TU8A 1XWAA 3QDNA 4KB3A 3HA9A 4FQUA 1PKZA 2VCZA 2R0GA 2I81A 2LUSA 2IY2A 5IMZA 5C04A 3A2XA 2RLIA 4BVYA 2YANA 2C0DA 4HUAA 2CZ2A 2DJ3A 2HRFA 1EEMA 1K0MA 3VPTA 3IE3A 5ECMB 3MSZA 3GV1A 4L0WA 2XPDA 2H6YA 3E0UA 4O92A 1DE1A 4ML6A 4RUVA 4AJ8A 4ECJA 2C0GA 1CQGA 3HD5A 4WETA 3GH6A 3MYDA 4OCEA 1M2DA 2C8UA 4OWYA 1V58A 1YDKA 1TDIA 3TKRA 4N0ZA 1G0TA 4Z7XA 5AISA 2B7JA 2NBSA 4TVEA 4K0GA 6GSYA 2X64A 1JZRA 4NMUA 1DSBA 1AAZA 2FCHA 3G7JA 4KE3A 4F2IA 2JSYA 3CTFA 3VLNA 1SK0A 2P5QA 5JCGA 3TKQA 1SL0B 5JCUA 1YF0A 3KCMA 5DALB 3TB2A 4GSNA 4AF2A 3IC8A 3KXOA 3KMOA 3NZNA 4NV5A 4ZB9A 4Z2RA 2C3NA 3QAVA 4ACSA 5CP1A 1XVWA 2FWGA 1WPIA 2EIQA 3RBTA 3VURA 2VL9A 4TR0A 4IQ1A 6GSTA 4OFTA 1ZCPA 4YQMA 3F4TA 1YKAA 2LNSA 2QKEA 2X49A 2REMA 3K8NA 3Q6OA 2DMMA 3FK8A 2HRKA 3FY7A 2OACA 4AJ6A 1TI3A 2GQLA 4KDYA 3KTBA 1K0NA 3TUEA 2IN3A 2YWNA 3L9UA 5EPFA 3O6TA 2CV4A 3Q19A 1I5GA 3NOFA 5ECHB 2RIIA 1SK1A 3HVVA 3ZIJA 5CNWA 4D73A 3ZFBA 2R6KA 3A2WA 4KH7A 1YZXA 2VOCA 4A5PA 1QUWA 3QFBC 2PWJA 2R4VA 5A5KA 2H76A 2IMKA 1J0FA 2R0CA 3EWLA 3VFIA 5KN3A 4FYCA 4GQFA 4KCAA 1OE7A 3R2QA 2N5BA 4ECIA 1JZWA 2KLXA 4XRDA 1XZOA 1BQ7A 2AUVA 3SWLA 2CQ9A 3UEMA 14GSA 4F0CA 4V2MA 1GUKA 2VD1A 2DJ2A 3F4SA 3U6VA 4CY6A 4WR5A 4HQSA 5ELAA 3UVHA 1S3DA 1UA5A 5AN1A 2IYJA 4O5RA 1X0RA 4YAPA 3VWWA 1PX7A 2VD0A 2LSTA 19GSA 1XFLA 1VF3A 1FG4A 3I43A 5G31A 4EVMA 3QAWA 6GSUA 3M1GA 1F9MA 2G0FA 4MZWA 4RQRA 4DVCA 4ZB8A 2LJKA 2AYTA 3M9JA 2LRCA 5CRDA 2B5EA 5ECNB 2HZEB 3TKSE 2X8GA 2KP2A 3IHQA 1B9XC 2WB9A 2GT6A 1WJKA 1YF1A 2HNLA 5GSSA 4TOPA 1SKRB 1MD4A 1GWCA 1OAZA 3O76A 3KGKA 3GX0A 3P2AA 3M3MA 2P5RA 5EY6A 1SYRA 2JADA 2P0GA 3TRXA 5KN0A 2FHEA 2C1YA 2BJXA 2JZRA 3D22A 3IOSA 3TJBA 4MABA 2I1UA 4MZCA 3ZL5A 1SD8A 4TR1B 4YKGA 3CXGA 1FOHA 2IFQA 4XS6A 1V2AA 4K5SA 4BL7B 3WD6A 5HFIA 2H6ZA 2L4QA 2HE3A 4OD7A 3CBUA 3FZ4A 4KUNA 4TN8A 1TK8B 1GL8A 4ZBBA 4L8EA 1OVNA 5F0GA 3CSIA 4IQAA 3GTUB 1ZYEA 2QGVA 3D6IA 4ZBDA 2OJLA 4IGJA 1SYXA 4DSRA 1URMA 4HZ2A 4POBA 3RHBA 5HR2A 1XBSA 3TJKA 5COHA 3F63A 3P7XA 3C7MA 4EDZA 2X8HA 1O7UA 3VI7A 3GKXA 1S3AA 16GSA 2JSZA 3GIXA 2OE1A 2PBJA 4MA9A 5KEJA 3D5JA 4WF5A 3V1WA 4PTSA 3BOAA 3TGZA 1IYHA 4IKHA 3GNJA 3GKKA 4V2LA 5IMFA 1R4WA 1V98A 4ML1A 3RHCA 3LYPA 4N0VA 4PXOA 3TJGA 3E9JB 1B8XA 4ZXGA 4JRRA 1M99A 2ES7A 1Q4JA 2VCXA 1R5PA 2WRTA 1G6WA 3LQ7A 3F8UA 1IYIA 4PQHA 3L0HA 4BWSA 2M72A 5B8AA 3FR6A 5IMAA 1G7OA 1GSEA 1Z7RA 5CYYA 4USSA 2NPBA 4ZL8A 1VF4A 5IMVA 4KW6A 2VL2A 3DXBA 3D4TA 2AV4A 5F8BA 3GUSA 1QQ2A 2X8CA 2HI7A 2FLSA 3GKNA 5D93A 2XHFA 2L5LA 2PUKC 1OC9B 1GUHA 2I4AA 1VF1A 3PGTA 5D9TA 4CY8A 5ECPB 5KOXA 4K5RA 2HSHA 2V32A 5KOWA 3LXZA 1X5DA 4LMVA 5IIZA 1YQ1A 1T3BA 2VCQA 3ZYWA 3RPNA 1TI1A 5F05A 3ZREA 4ID0A 3QPMA 5DVBA 3IAS2 3IAM2 5ECIB 2IMDA 4J56E 3PH9A 4F9ZA 1TK0B 1H75A 2A2PA 2R2JA 4IHUA 1TW9A 1SENA 4TXVA 1FO5A 4EXJA 3IK9A 3HZ8A 2LNTA 4K6XA 2YWIA 3A5IA 3DRNA 3RDWA 1XW9A 2WJUA 2GQMA 2VLVA 4MJEA 3HJOA 4K2DA 4KSOA 1T1VA 3QCPA 1VGLA 4WXTA 3WGEA 3MNGA 2L6DA 3P8WA 2XPEA 5J9CA 2YOIA 3IRAA 1AQWA 5CREA 2MMAA 1NHYA 4ECCA 2C0EA 5B6MA 4NV2A 1K3LA 1UVZA 2QC7A 4OFNA 1SD9A 3OR5A 2JL4A 2XC2A 2HFDA 1E6BA 1X5EA 2CAQA 1ZMAA 2V41A 2RM6A 5DAKB 1S3CA 3GN3A 3ED3A 3KH7A 5D8IA 1EWXA 3TRQA 3DGQA 3LEFA 2AAWA 4YQUA 3EU3A 4IP1A 5ECLB 1K0DA 2E7PA 2A4HA 3UMAA 5BMUA 5DALA 5IO0A 2CT6A 2FA4A 1QGVA 5HR3A 2DLXA 1LU4A 1PQNA 3O3TA 2O8VB 1R7HA 1ACVA 3C1SA 2LRNA 3DVXA 3HHVA 4J2FA 4Q5NA 1BYEA 3ERFA 3M9KA 3N9JA 1PN9A 2YWOA 5H5RA 4ZBAA 3L78A 1M9AA 2DC5A 5KN2A 2CVBA 1U88A 3C1RA 2H6XA 3GYKA 5DJLA 4LA1A 1OE8A 2H8LA 1KTEA 1ON4A 3DWVA 4OO5A 3CTGA 1PA3A 2GS3A 2DIYA 2EIOA 4L5OA 4HS1A 1WP0A 1GULA 2IJYA 4G0KA 4GCIA 3Q74A 2ALBA 1K0BA 2DMLA 3F6DA 1FVKA 5B8BA 1WOUA 1K0AA 3CSJA 1JHBA 3GRXA 18GSA 1B4PA 4GXZA 1E2YA 2LJAA 1U3AA 3IXRA 3DEXA 2L59A 3EVIA 3G7IA 1ILOA 5G2ZA 5HFGA 1A2MA 3EC3A 4CW9A 6GSSA 3ZITA 4O5UA 4N11A 1N8JA 1U6TA 2OADA 1JLWA 2E2GA 2PU9C 1GH2A 4Z2UA 4EE0A 2YN1A 1M7TA 1GSSA 3C8EA 4ZB6A 4I97A 2ON5A 4POLA 2PGTA 4XS4B 2DKIA 2CA8A 1EGOA 4OO4A 1U87A 2FNOA 4CDOA 3LG6A 3AY8A 2ZCTA 4XIHA 1B9YC 1FVJA 4RI7A 1OKDA 4WKWA 1T7PB 2H74A 2MBTA 2A4VA 4MJAA 3WT1A 2HZEA 3BCIA 5L71A 2VM2A 4X43A 3ZFLA 4JR4A 4K7NA 5CRHA 4QL9A 4IVFA 4KSMA 3HVSA 2VCVA 2YP6A 5HR1A 4GWRA 4BVXA 3ME8A 2F51A 3LWAA 10GSA 3DIEA 4GSTA 2IMEA 3QAGA 4TXOB 5JWRB 2AJQB 3WYWA 5INYA 2HRAA 5DQSA 4EL1A 2GSQA 2HT9A 3RAZA 5IPHA 1TTZA 2YJ7A 2KUCA 1GSDA 4TR1A 4LLRA 4G9HA 2MMZA 3U5RE 3WGXA 2DIZA 4O32A 2C3TA 4BL7A 1RQMA 3MAKA 3RPPA 5DQYA 2LQOA 1ERVA 1BEDA 2L5OA 3HXSA 4K2XA 2BMXA 4OMVA 1OC8A 2O85A 1GSQA 1KEBA 4ZIJA 1XPVA 2TRXA 1V9WA 2L57A 4X4JA 2GSTA 4DSQA 4KDXA 3GTUA 2DSAA 1HD2A 4N10A 4GRFA 1MD3A 5GZZB 3HY2A 4HZ4A 2L4CA 4RQXA 1SL2B 4MPFA 1A2LA 4GF0A 2GZYA 3HZ4A 4IN0A 4XCSA 3GL3A 1AUCA 1F37A 3VWUA 5D9WA 3H4KA 2H1DA 4YKFA 5FWGA 1WMJA 3TKPA 5HR0A 2FWHA 4BWQA 3Q18A 3UBKA 3TKSA 2M46A 2P31A 2DKHA 1V57A 4I2TA 1HNCA 2H0IA 3VWXA 1T00A 4MPGA 3CRUA 1FB6A 4HEA2 2HYXA 4JE1A 4PX1A 5EL8A 3J7Yb 4ICYA 1ABAA 4TW5A 1TKDB 2JACA 4BVXB 2WCIA 5F06A 3F3QA 2AHEA 2GSRA 4O7HA 2RUFA 4LL1B 1Y6EA 3EPTA 1G6YA 4PUFC 2YNXA 3GSTA 1EOHA 4MNNA 2JZTA 1Z6NA 5G1LA 3S9FA 1PRXA 1PD21 1XWCA 3BJ5A 3IHGA 5FT3A 3DKSA 1ZOFA 4H86A 5G1KA 2HRNA 1BJXA 1ERTA 2VAFA 3EYTA 3QOUA 5IOXA 1SKSB 4KGIA 3LFLA 1OC9A 5ECKB 5D9VA 22GSA 2V2GA 4V1Ag 4OCFA 2N5FA 2H0GA 1O81A 1EOGA 1XOAA 1HNBA 3P90A 1DUGA 1XXUA 3APSA 2X99A 2GQKA 4MZBA 2WS2A 4ISDA 3HYPA 5ID2B 2VO4A 2DJKA 2LQQA 1JFUA 1RK4A 1GNWA 2IPAA 2A2RA 1VRSD 1TRVA 2YCDA 5D73A 4TRXA 5CRGA 3F4RA 2F3MA 1EEJA 5DBQA 5ECOB 3TJFA 7GSSA 2VUPA 1A0FA 3KD0A 1XW5A 3KTLA 1HNAA 5H5SA 4HU9A 1Q98A 1UN2A 2O87A 4KNDA 3EU4A 2E0QA 2R5GA 3HDCA 4I8BA 3UJ1A 2PN8A 5C00A 3WGDA 5AIXA 2OBKA 1R26A 3FYGA 5AGYA 5A4UA 3LXTA 1SJIA 2PPTA 4F0BA 1KBNA 1N2AA 3L4NA 1PSQA 1A24A 4I5QA 2N5AA 3ZLPA 4GTUA 5J41A 3BCKA 3J7Yk 1XWKA 2YV9A 1BX9A 3HVXA 4MP4A 1ZYQB 5DAKA 2H30A 2NTOA 2ON7A 3IV4A 4XRAA 2V6OA 11GSA 2FGXA 1LBKA 1K0CA 1YY7A 3IK7A 2CX3A 3KMNA 3ZVJD 5JWOB 1PX6A 2B7KA 4IP6A 3M8NA 4OFMA 2WZ9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1BAY A;  2YJH A;  1GTA A;  3GMF A;  4YQV A;  1TRS A;  2VL2 C;  5KN1 A;  3IDV A;  1JZD A;  2WGR A;  3H8Q A;  1EV4 A;  2HLS A;  4V1A p;  2J23 A;  2E2M A;  1XW6 A;  4ZL9 A;  4K0N A;  4ZL7 A;  2B1L A;  3DYR A;  5CRW A;  3SBC A;  2FUG 2;  4J57 E;  1GTI A;  1TXX A;  2VL3 A;  1EZK A;  3F3R A;  2YWM A;  3IA1 A;  2DJJ A;  2LKU A;  1THO A;  2WUL A;  3US3 A;  4HI7 A;  1GTB A;  2GVP A;  1JLV A;  2KOK A;  1GSY A;  13GS A;  4KDU A;  1SL1 B;  2KHP A;  1QXH A;  3TCO A;  1GLP A;  2IIY A;  1A23 A;  2OE0 A;  1B4Q A;  1A0R P;  1Z3E A;  3KP9 A;  3D4M A;  5HQP A;  1KNG A;  1R5A A;  2GZP A;  5B7C A;  4MLY A;  4FO5 A;  1O8W A;  2H66 A;  1YKC A;  1X9M B;  4EDY A;  2V1M A;  2CVD A;  1XIY A;  4FYB A;  5H5Q A;  2B1K A;  3IR4 A;  1PMT A;  3GSS A;  1PKW A;  3GKM A;  4MJB A;  4MDC A;  3ZTL A;  2PMT A;  3TOT A;  2OA7 A;  3CMI A;  2D2Z A;  1YEP A;  2MZC A;  1J08 A;  4NHZ A;  5HFK A;  2TIR A;  2PVQ A;  5LCZ A;  1C72 A;  5IOW A;  4XS4 A;  2MBS A;  1V40 A;  5JWQ B;  4WEY A;  3I69 A;  1XOB A;  2NDO A;  2EC4 A;  3W6G A;  3UAR A;  3EMP A;  5GAP D;  3GFK A;  3HJM A;  3BD2 A;  2R37 A;  4KAE A;  2LV3 A;  3IBH A;  4MK3 A;  2KP1 A;  3APO A;  4EO3 A;  2AB6 A;  3LJR A;  1A2J A;  4FIW A;  5G5F A;  1NSW A;  2IMF A;  4JBB A;  1CQH A;  1O85 A;  1AW9 A;  1Y25 A;  1EV9 A;  1TU7 A;  2XBI A;  1SU9 A;  1Z7P A;  2GT5 A;  1ZZY A;  2WFC A;  2F8A A;  1TRU A;  1Z9H A;  8GSS A;  3PR8 A;  1AC1 A;  3WT2 A;  2B6M A;  4NXI A;  2LS5 A;  3KH9 A;  1T4Y A;  4XS1 A;  1O8X A;  2B3S A;  1B48 A;  2M80 A;  2IWT A;  4CHS A;  4G10 A;  2VLU A;  2B5X A;  1X9S B;  3FW2 A;  1NM3 A;  4TXO A;  4Q5R A;  4WBJ A;  1F3A A;  1GLQ A;  3I9V 2;  4AJ7 A;  4MCU A;  4P3Y B;  1WE0 A;  2YV7 A;  3HKR A;  2HZF A;  3F9U A;  4L0U A;  1SJ6 A;  1M2A A;  2PER A;  3A5W A;  1H4O A;  2RUE A;  4WR4 A;  3UAP A;  4K1F A;  3N5O A;  4IEL A;  1TOF A;  2O89 A;  1A8Y A;  2GGT A;  3UVT A;  4K9Z A;  3ZRD A;  2TRC P;  3ISO A;  2H19 A;  5LD0 A;  5GST A;  2I9H A;  2K9F A;  2H1G A;  4DSS B;  4XTS A;  3I6A A;  4NAX A;  20GS A;  1AXD A;  1YJ6 A;  4I6X A;  4TR4 A;  5A4V A;  4AGS A;  2YPM A;  4HDE A;  5CAX A;  5ENU A;  3VWV A;  2FD3 A;  3L9V A;  2BTO T;  2YZH A;  4PQ1 A;  1PL2 A;  2K6V A;  5IPG A;  2CZ3 A;  2HSY A;  1AIU A;  4WF4 A;  1SK2 A;  3GHA A;  3TRP A;  3TOU A;  4FH8 A;  1GNE A;  2OKA A;  4X0X A;  5ELG A;  4ULX A;  1FAA A;  3EE2 A;  4N30 A;  1GP1 A;  1GSU A;  1OKT A;  3ZIV A;  6GSX A;  5DCH A;  1XVQ A;  4HJ2 A;  3G9B A;  1I9D A;  4HU7 A;  1Z5Y E;  2LTK A;  6GSW A;  2DJ1 A;  2JZS A;  1J9B A;  4X1U A;  2IL3 A;  5D9X A;  3IPZ A;  5E4W A;  1QK8 A;  4GLT A;  4DEJ A;  3NIV A;  2LEG A;  1F6M C;  3D0Z A;  4G19 A;  5FHI A;  3QFA C;  3QMX A;  1ZL9 A;  5GAN D;  5ID2 A;  1Z6M A;  1PGT A;  2CVK A;  4EF0 A;  4BPY A;  4E8E A;  1WIK A;  3W8S A;  1F2E A;  4PGT A;  17GS A;  4TR3 A;  4GQC A;  4QQ7 A;  1AQV A;  3C71 A;  2LRT A;  4IW9 A;  2J9H A;  3CSH A;  5D96 A;  3KEB A;  4PUR A;  3FR9 A;  2H01 A;  2H1B A;  1VF2 A;  1HQO A;  2FWE A;  2O7K A;  2H70 A;  2V6K A;  2F9S A;  2GZZ A;  3ME7 A;  4NWY A;  2EIR A;  1WRY A;  4EC0 A;  4BA7 A;  3KZQ A;  5DJM A;  2CAI A;  3UIW A;  3FHK A;  4LMW A;  2H75 A;  3TKS C;  1LJR A;  2FY6 A;  1U3I A;  4RI6 A;  1F3B A;  1X9W B;  1NHO A;  4D73 B;  5J4U A;  1PL1 A;  2MYG A;  3H79 A;  4I2U A;  1FOV A;  1AQX A;  3GL5 A;  2DJ0 A;  1T4Z A;  4YAV A;  5IM9 A;  2H72 A;  3FZ9 A;  1EP8 A;  3IC4 A;  2VCT A;  3ZVJ A;  5DDL A;  4PQI A;  2IMI A;  3H1N A;  4K8M A;  1K3O A;  2B5Y A;  9GSS A;  3DVW A;  1DE2 A;  1ST9 A;  2R3X A;  2F8F A;  3DD3 A;  3L9S A;  2H73 A;  2Z9S A;  4Q5Q A;  2L6C A;  4JED A;  3QD9 A;  4POK A;  4F82 A;  3ERW A;  2PVO C;  4KX4 A;  4GSS A;  5J9B A;  1ERU A;  1RW1 A;  4K7O A;  3KJY A;  2GDR A;  2LJR A;  4L5L A;  5G30 A;  4KCE A;  1G7E A;  4MF6 A;  3G7Y A;  1EGR A;  4MF5 A;  1HYU A;  3ZZX A;  1ERW A;  3APQ A;  3EUR A;  3CYN A;  4IJ3 A;  4IS0 A;  5IMD A;  2MMO A;  2YZU A;  4MJC A;  3E3E A;  4WBR D;  5ECQ B;  1O73 A;  1M9B A;  1SKW B;  2A2S A;  4G2E A;  3M0F A;  1FW1 A;  4NHW A;  5LNK e;  3KIJ A;  2H1A A;  1EP7 A;  2XBQ A;  4EUY A;  1MDK A;  5J5N A;  4KA0 A;  3F6F A;  3VPQ A;  4JZQ A;  4ILF A;  6GSV A;  2VCW A;  4FYU A;  2K8S A;  2H0H A;  2GTU A;  3GUR A;  2JU5 A;  3C73 A;  2C3Q A;  12GS A;  1DBY A;  3VI5 A;  2IFQ B;  1X5C A;  5ECS A;  4E8H A;  3LOR A;  3PIN A;  2I3Y A;  5G5E A;  2MMN A;  1ZGN A;  2WDU A;  1GUM A;  5EVO A;  3HJP A;  3H93 A;  2C4J A;  2GLR A;  3FEU A;  3VK9 A;  4TKY A;  3F0I A;  5CO3 A;  1K3Y A;  4MMM A;  5DCG A;  1MDJ A;  5JCW A;  3TJJ A;  1GTU A;  1XWG A;  3JCM L;  3LSZ A;  3LYK A;  3A2V A;  3FKF A;  1FB0 A;  1QFN A;  2H71 A;  1UC7 A;  3MDK A;  1WWJ A;  4NPB A;  4POM A;  1TK5 B;  1JZO A;  4PNF A;  4Q5F A;  1TP9 A;  1A8L A;  1MDI A;  3KM6 A;  4MH3 A;  1MTC A;  2VLT A;  3UBL A;  2HXK A;  3GX8 A;  2C80 A;  4ZIL A;  1W4V A;  4XHM A;  2DBC A;  3LGC A;  3ERG A;  4HOJ A;  4F03 A;  5IQY A;  2K18 A;  3CRT A;  1T8E B;  4ECB A;  5A4W A;  5J3R A;  3FZ5 A;  2GSS A;  5ECR B;  2G2Q A;  3EIN A;  3QR6 A;  4JR6 A;  2VIM A;  4LL4 B;  2FWF A;  2ZUP A;  1THX A;  3D21 A;  3W8J A;  1W89 A;  4MH2 A;  3KP8 A;  2ZNM A;  3DML A;  4IBP A;  3BBY A;  3FZA A;  1ML6 A;  4MF7 A;  3MWH A;  1GSF A;  3GA4 A;  2K8V A;  5B6N A;  3UOM A;  3ZML A;  1YEX A;  1OC3 A;  5AIV A;  1K0O A;  1O6J A;  5E59 A;  1XCC A;  1QMV A;  4JU5 A;  5IMC A;  4HJM A;  3TDG A;  1BG5 A;  1FHE A;  5F07 A;  4QL7 A;  4EKZ A;  2OBI A;  2FA8 A;  1SJZ A;  3UL3 A;  1M0U A;  1OYJ A;  4PUA A;  5ABR A;  3HCZ A;  3FR3 A;  2C0F A;  3FRC A;  3EMX A;  4HQZ A;  2VM1 A;  3GH9 A;  2CX4 A;  4YH2 A;  1USB A;  4PNG A;  2NVL A;  2QSI A;  4DSS A;  3A3T A;  4IJI A;  1NW2 A;  2RM5 A;  1TJD A;  1GRX A;  3ZMK A;  5IO2 A;  1TRW A;  1XWB A;  2OE3 A;  4K7I A;  4V2N A;  1MEK A;  1M2B A;  1TU8 A;  1XWA A;  3QDN A;  4KB3 A;  3HA9 A;  1PKZ A;  2VCZ A;  2I81 A;  2LUS A;  2IY2 A;  5IMZ A;  5C04 A;  3A2X A;  2RLI A;  4BVY A;  2YAN A;  2C0D A;  4HUA A;  2CZ2 A;  2DJ3 A;  2HRF A;  1EEM A;  1K0M A;  3VPT A;  3IE3 A;  5ECM B;  3MSZ A;  3GV1 A;  4L0W A;  2XPD A;  2H6Y A;  3E0U A;  4O92 A;  1DE1 A;  4ML6 A;  4RUV A;  4AJ8 A;  4ECJ A;  2C0G A;  1CQG A;  3HD5 A;  4WET A;  3GH6 A;  4OCE A;  1M2D A;  2C8U A;  4OWY A;  1V58 A;  1YDK A;  1TDI A;  3TKR A;  4N0Z A;  1G0T A;  4Z7X A;  5AIS A;  2B7J A;  2NBS A;  4TVE A;  4K0G A;  6GSY A;  2X64 A;  1JZR A;  4NMU A;  1DSB A;  1AAZ A;  2FCH A;  3G7J A;  4KE3 A;  4F2I A;  2JSY A;  3CTF A;  3VLN A;  1SK0 A;  2P5Q A;  5JCG A;  3TKQ A;  1SL0 B;  5JCU A;  1YF0 A;  3KCM A;  5DAL B;  3TB2 A;  4GSN A;  4AF2 A;  3KXO A;  3KMO A;  3NZN A;  4NV5 A;  4ZB9 A;  2C3N A;  3QAV A;  4ACS A;  5CP1 A;  1XVW A;  2FWG A;  1WPI A;  2EIQ A;  3RBT A;  3VUR A;  2VL9 A;  4TR0 A;  4IQ1 A;  6GST A;  4OFT A;  1ZCP A;  4YQM A;  3F4T A;  1YKA A;  2LNS A;  2QKE A;  2REM A;  3K8N A;  3Q6O A;  2DMM A;  3FK8 A;  3FY7 A;  2OAC A;  4AJ6 A;  1TI3 A;  2GQL A;  4KDY A;  3KTB A;  1K0N A;  3TUE A;  2IN3 A;  2YWN A;  3L9U A;  5EPF A;  3O6T A;  2CV4 A;  3Q19 A;  1I5G A;  3NOF A;  5ECH B;  2RII A;  1SK1 A;  3HVV A;  3ZIJ A;  5CNW A;  4D73 A;  3ZFB A;  2R6K A;  3A2W A;  4KH7 A;  1YZX A;  2VOC A;  1QUW A;  3QFB C;  2PWJ A;  2R4V A;  5A5K A;  2H76 A;  2IMK A;  1J0F A;  3EWL A;  3VFI A;  5KN3 A;  4FYC A;  4GQF A;  4KCA A;  1OE7 A;  3R2Q A;  2N5B A;  4ECI A;  1JZW A;  2KLX A;  4XRD A;  1XZO A;  1BQ7 A;  2AUV A;  3SWL A;  2CQ9 A;  3UEM A;  14GS A;  4F0C A;  4V2M A;  1GUK A;  2VD1 A;  2DJ2 A;  3F4S A;  3U6V A;  4WR5 A;  4HQS A;  5ELA A;  3UVH A;  1S3D A;  1UA5 A;  5AN1 A;  2IYJ A;  4O5R A;  1X0R A;  4YAP A;  3VWW A;  1PX7 A;  2VD0 A;  2LST A;  19GS A;  1XFL A;  1VF3 A;  1FG4 A;  3I43 A;  5G31 A;  4EVM A;  3QAW A;  6GSU A;  3M1G A;  1F9M A;  2G0F A;  4MZW A;  4RQR A;  4DVC A;  4ZB8 A;  2LJK A;  2AYT A;  3M9J A;  2LRC A;  5CRD A;  2B5E A;  5ECN B;  2HZE B;  3TKS E;  2X8G A;  2KP2 A;  3IHQ A;  1B9X C;  2WB9 A;  2GT6 A;  1WJK A;  1YF1 A;  2HNL A;  5GSS A;  4TOP A;  1SKR B;  1MD4 A;  1GWC A;  1OAZ A;  3O76 A;  3KGK A;  3GX0 A;  3P2A A;  3M3M A;  2P5R A;  5EY6 A;  1SYR A;  2JAD A;  2P0G A;  3TRX A;  5KN0 A;  2FHE A;  2C1Y A;  2BJX A;  2JZR A;  3D22 A;  3IOS A;  3TJB A;  4MAB A;  2I1U A;  4MZC A;  3ZL5 A;  1SD8 A;  4TR1 B;  3CXG A;  4XS6 A;  2IFQ A;  1V2A A;  3WD6 A;  5HFI A;  2H6Z A;  2L4Q A;  2HE3 A;  4OD7 A;  3CBU A;  3FZ4 A;  4KUN A;  4TN8 A;  1TK8 B;  1GL8 A;  4ZBB A;  4L8E A;  1OVN A;  5F0G A;  3CSI A;  4IQA A;  3GTU B;  1ZYE A;  2QGV A;  3D6I A;  4ZBD A;  2OJL A;  4IGJ A;  1SYX A;  4DSR A;  1URM A;  4HZ2 A;  4POB A;  3RHB A;  5HR2 A;  1XBS A;  3TJK A;  5COH A;  3F63 A;  3P7X A;  3C7M A;  4EDZ A;  2X8H A;  1O7U A;  3VI7 A;  3GKX A;  1S3A A;  16GS A;  2JSZ A;  3GIX A;  2OE1 A;  2PBJ A;  4MA9 A;  5KEJ A;  3D5J A;  4WF5 A;  3V1W A;  3BOA A;  3TGZ A;  1IYH A;  4IKH A;  3GNJ A;  3GKK A;  4V2L A;  5IMF A;  1R4W A;  1V98 A;  4ML1 A;  3RHC A;  3LYP A;  4N0V A;  4PXO A;  3TJG A;  3E9J B;  1B8X A;  4ZXG A;  4JRR A;  1M99 A;  2ES7 A;  1Q4J A;  2VCX A;  1R5P A;  2WRT A;  1G6W A;  3LQ7 A;  3F8U A;  1IYI A;  4PQH A;  3L0H A;  4BWS A;  2M72 A;  5B8A A;  3FR6 A;  5IMA A;  1G7O A;  1GSE A;  1Z7R A;  5CYY A;  2NPB A;  4ZL8 A;  1VF4 A;  5IMV A;  4KW6 A;  2VL2 A;  3DXB A;  3D4T A;  2AV4 A;  5F8B A;  3GUS A;  1QQ2 A;  2X8C A;  2HI7 A;  2FLS A;  3GKN A;  5D93 A;  2XHF A;  2L5L A;  2PUK C;  1OC9 B;  1GUH A;  2I4A A;  1VF1 A;  3PGT A;  5D9T A;  5ECP B;  2HSH A;  2V32 A;  3LXZ A;  1X5D A;  4LMV A;  5IIZ A;  1YQ1 A;  1T3B A;  2VCQ A;  3ZYW A;  3RPN A;  1TI1 A;  5F05 A;  3ZRE A;  4ID0 A;  3QPM A;  5DVB A;  3IAS 2;  3IAM 2;  5ECI B;  2IMD A;  4J56 E;  3PH9 A;  4F9Z A;  1TK0 B;  1H75 A;  2R2J A;  4IHU A;  1TW9 A;  1SEN A;  4TXV A;  1FO5 A;  4EXJ A;  3IK9 A;  3HZ8 A;  2LNT A;  4K6X A;  2YWI A;  3DRN A;  3RDW A;  1XW9 A;  2WJU A;  2GQM A;  2VLV A;  4MJE A;  3HJO A;  4K2D A;  4KSO A;  1T1V A;  3QCP A;  1VGL A;  4WXT A;  3WGE A;  3MNG A;  2L6D A;  3P8W A;  2XPE A;  5J9C A;  2YOI A;  3IRA A;  1AQW A;  5CRE A;  2MMA A;  1NHY A;  4ECC A;  2C0E A;  5B6M A;  4NV2 A;  1K3L A;  1UVZ A;  2QC7 A;  4OFN A;  1SD9 A;  3OR5 A;  2JL4 A;  2XC2 A;  2HFD A;  1E6B A;  1X5E A;  2CAQ A;  1ZMA A;  2V41 A;  2RM6 A;  5DAK B;  1S3C A;  3GN3 A;  3ED3 A;  3KH7 A;  5D8I A;  1EWX A;  3TRQ A;  3DGQ A;  3LEF A;  2AAW A;  4YQU A;  3EU3 A;  4IP1 A;  5ECL B;  1K0D A;  2E7P A;  3UMA A;  5DAL A;  5IO0 A;  2CT6 A;  2FA4 A;  1QGV A;  5HR3 A;  2DLX A;  1LU4 A;  1PQN A;  3O3T A;  2O8V B;  1R7H A;  1ACV A;  3C1S A;  2LRN A;  3DVX A;  3HHV A;  4J2F A;  4Q5N A;  1BYE A;  3ERF A;  3M9K A;  3N9J A;  1PN9 A;  2YWO A;  5H5R A;  4ZBA A;  3L78 A;  1M9A A;  2DC5 A;  5KN2 A;  2CVB A;  1U88 A;  3C1R A;  2H6X A;  3GYK A;  5DJL A;  4LA1 A;  1OE8 A;  2H8L A;  1KTE A;  1ON4 A;  3DWV A;  4OO5 A;  3CTG A;  1PA3 A;  2GS3 A;  2DIY A;  2EIO A;  4L5O A;  4HS1 A;  1WP0 A;  1GUL A;  2IJY A;  4GCI A;  3Q74 A;  2ALB A;  1K0B A;  2DML A;  3F6D A;  1FVK A;  5B8B A;  1WOU A;  1K0A A;  3CSJ A;  1JHB A;  3GRX A;  18GS A;  1B4P A;  4GXZ A;  1E2Y A;  2LJA A;  1U3A A;  3IXR A;  3DEX A;  2L59 A;  3EVI A;  3G7I A;  1ILO A;  5G2Z A;  5HFG A;  1A2M A;  3EC3 A;  4CW9 A;  6GSS A;  3ZIT A;  4N11 A;  1N8J A;  1U6T A;  2OAD A;  1JLW A;  2E2G A;  2PU9 C;  1GH2 A;  4EE0 A;  2YN1 A;  1M7T A;  1GSS A;  3C8E A;  4ZB6 A;  4I97 A;  2ON5 A;  4POL A;  2PGT A;  4XS4 B;  2CA8 A;  1EGO A;  4OO4 A;  1U87 A;  2FNO A;  4CDO A;  3LG6 A;  3AY8 A;  2ZCT A;  4XIH A;  1B9Y C;  1FVJ A;  4RI7 A;  1OKD A;  4WKW A;  1T7P B;  2H74 A;  2MBT A;  2A4V A;  4MJA A;  3WT1 A;  2HZE A;  3BCI A;  5L71 A;  2VM2 A;  4X43 A;  3ZFL A;  4JR4 A;  4K7N A;  5CRH A;  4QL9 A;  4IVF A;  4KSM A;  3HVS A;  2VCV A;  2YP6 A;  5HR1 A;  4GWR A;  4BVX A;  3ME8 A;  2F51 A;  3LWA A;  10GS A;  3DIE A;  4GST A;  2IME A;  3QAG A;  4TXO B;  5JWR B;  2AJQ B;  3WYW A;  5INY A;  5DQS A;  4EL1 A;  2GSQ A;  2HT9 A;  3RAZ A;  5IPH A;  1TTZ A;  2YJ7 A;  2KUC A;  1GSD A;  4TR1 A;  4LLR A;  4G9H A;  2MMZ A;  3U5R E;  3WGX A;  2DIZ A;  4O32 A;  2C3T A;  4BL7 A;  1RQM A;  3MAK A;  3RPP A;  5DQY A;  2LQO A;  1ERV A;  1BED A;  2L5O A;  3HXS A;  2BMX A;  4OMV A;  1OC8 A;  2O85 A;  1GSQ A;  1KEB A;  4ZIJ A;  1XPV A;  2TRX A;  1V9W A;  2L57 A;  2GST A;  4DSQ A;  4KDX A;  3GTU A;  2DSA A;  1HD2 A;  4N10 A;  4GRF A;  1MD3 A;  5GZZ B;  3HY2 A;  4HZ4 A;  2L4C A;  4RQX A;  1SL2 B;  4MPF A;  1A2L A;  4GF0 A;  2GZY A;  3HZ4 A;  4IN0 A;  4XCS A;  3GL3 A;  1AUC A;  1F37 A;  3VWU A;  5D9W A;  3H4K A;  2H1D A;  5FWG A;  1WMJ A;  3TKP A;  5HR0 A;  2FWH A;  4BWQ A;  3Q18 A;  3UBK A;  3TKS A;  2M46 A;  2P31 A;  1V57 A;  4I2T A;  1HNC A;  2H0I A;  3VWX A;  1T00 A;  4MPG A;  3CRU A;  1FB6 A;  4HEA 2;  2HYX A;  4JE1 A;  4PX1 A;  5EL8 A;  3J7Y b;  1ABA A;  4TW5 A;  1TKD B;  2JAC A;  2WCI A;  5F06 A;  3F3Q A;  2AHE A;  2GSR A;  4O7H A;  2RUF A;  4LL1 B;  1Y6E A;  1G6Y A;  4PUF C;  2YNX A;  3GST A;  1EOH A;  2JZT A;  1Z6N A;  5G1L A;  3S9F A;  1PRX A;  1PD2 1;  1XWC A;  3BJ5 A;  5FT3 A;  3DKS A;  1ZOF A;  4H86 A;  5G1K A;  2HRN A;  1BJX A;  1ERT A;  2VAF A;  3EYT A;  3QOU A;  5IOX A;  1SKS B;  4KGI A;  3LFL A;  1OC9 A;  5ECK B;  5D9V A;  22GS A;  2V2G A;  4V1A g;  4OCF A;  2N5F A;  2H0G A;  1O81 A;  1EOG A;  1XOA A;  1HNB A;  3P90 A;  1DUG A;  1XXU A;  3APS A;  2X99 A;  2GQK A;  4MZB A;  2WS2 A;  4ISD A;  3HYP A;  5ID2 B;  2VO4 A;  2DJK A;  2LQQ A;  1JFU A;  1RK4 A;  1GNW A;  2IPA A;  2A2R A;  1VRS D;  1TRV A;  2YCD A;  5D73 A;  4TRX A;  5CRG A;  3F4R A;  2F3M A;  1EEJ A;  5DBQ A;  5ECO B;  3TJF A;  7GSS A;  2VUP A;  1A0F A;  3KD0 A;  1XW5 A;  3KTL A;  1HNA A;  5H5S A;  4HU9 A;  1Q98 A;  1UN2 A;  2O87 A;  4KND A;  3EU4 A;  2E0Q A;  2R5G A;  3HDC A;  4I8B A;  3UJ1 A;  2PN8 A;  5C00 A;  3WGD A;  5AIX A;  2OBK A;  1R26 A;  3FYG A;  5AGY A;  5A4U A;  3LXT A;  1SJI A;  2PPT A;  4F0B A;  1KBN A;  1N2A A;  3L4N A;  1PSQ A;  1A24 A;  4I5Q A;  2N5A A;  3ZLP A;  4GTU A;  5J41 A;  3BCK A;  3J7Y k;  1XWK A;  2YV9 A;  1BX9 A;  3HVX A;  4MP4 A;  1ZYQ B;  5DAK A;  2H30 A;  2NTO A;  2ON7 A;  3IV4 A;  4XRA A;  2V6O A;  11GS A;  2FGX A;  1LBK A;  1K0C A;  1YY7 A;  3IK7 A;  2CX3 A;  3KMN A;  3ZVJ D;  5JWO B;  1PX6 A;  2B7K A;  4IP6 A;  3M8N A;  4OFM A;  2WZ9 A; 
#chains in the Genus database with same CATH topology
 1JBT A;  3B4O A;  3OW2 2;  1BAY A;  2YJH A;  1GTA A;  3GMF A;  4YQV A;  1TRS A;  1ZX2 A;  4GB5 A;  2VL2 C;  5KN1 A;  1VQL 3;  3IDV A;  2W9P A;  3M8C A;  1JZD A;  5CXO A;  2WGR A;  1B2Z A;  3H8Q A;  5CLK A;  1EV4 A;  3PPU A;  2HLS A;  4V1A p;  2J23 A;  2E2M A;  1XW6 A;  4ZL9 A;  1ULJ B;  1JBS A;  1CEW I;  4K0N A;  4ZL7 A;  1BRH A;  2B1L A;  3DYR A;  2OQE C;  5CRW A;  3SBC A;  2FUG 2;  5CF2 A;  4J57 E;  1GTI A;  3X3X A;  4R9L A;  1TXX A;  2VL3 A;  2STD A;  1EZK A;  3F3R A;  2YWM A;  3JUN A;  3IA1 A;  3MG3 A;  2DJJ A;  2LKU A;  1THO A;  2WUL A;  3US3 A;  4HI7 A;  1GTB A;  2GVP A;  1JLV A;  2KOK A;  3CNX A;  7STD A;  2V1L A;  3F14 A;  1GSY A;  3WMD A;  13GS A;  4KDU A;  2HSM A;  1SL1 B;  2KHP A;  1R4C A;  5M1A A;  1QXH A;  3TCO A;  4WFO A;  1QAK A;  1I2F A;  1LQG C;  1GLP A;  3Q90 A;  2IIY A;  1A23 A;  2OE0 A;  1B4Q A;  1A0R P;  2K0M A;  4K1V A;  1Z3E A;  3KP9 A;  1I3F A;  1N8R 4;  3D4M A;  5HQP A;  1KNG A;  4I4K A;  1R5A A;  2GZP A;  5B7C A;  3NQZ A;  4KF9 A;  4MLY A;  3WA2 X;  1R4Y A;  4FO5 A;  1O8W A;  2ML5 A;  2H66 A;  1SAR A;  1YKC A;  1X9M B;  4EDY A;  3F9S A;  2V1M A;  2CVD A;  1XIY A;  4HM8 B;  5TGN A;  4FYB A;  3EN8 A;  5H5Q A;  3E99 A;  2UZ8 A;  1B2M A;  3LZA A;  2B1K A;  2K54 A;  3IR4 A;  3EBT A;  4JF8 A;  1PMT A;  3GSS A;  1PKW A;  3GKM A;  1VQK 3;  5IW9 A;  4MJB A;  4G0L A;  4MDC A;  3ZTL A;  2PMT A;  3TOT A;  2OA7 A;  3CMI A;  3LTB A;  2D2Z A;  2KCD A;  1YEP A;  2MZC A;  3LH4 A;  4KVH A;  4CDL A;  1J08 A;  4NHZ A;  2E2V A;  1OF5 A;  5HFK A;  2TIR A;  2PVQ A;  5LCZ A;  1C72 A;  5IOW A;  3NBJ A;  4XS4 A;  2MBS A;  1V40 A;  5JWQ B;  3URP A;  1RGK A;  1UCI A;  4WEY A;  1SIH A;  5M19 A;  1JBR A;  3I69 A;  1E3R A;  1XOB A;  2NDO A;  2EC4 A;  2F56 A;  3W6G A;  1PU4 A;  1M3I A;  3UAR A;  3EMP A;  5GAP D;  3GFK A;  3HJM A;  3I55 3;  3BD2 A;  2R37 A;  5CF1 A;  4KAE A;  1B20 A;  2LV3 A;  3MSO A;  3IBH A;  1UW1 A;  3EHC A;  4MK3 A;  4RNZ A;  4PEJ A;  2KP1 A;  3APO A;  1EG9 B;  4EO3 A;  2AB6 A;  1KC8 4;  3LJR A;  1A2J A;  4FIW A;  5G5F A;  1NSW A;  1BAN A;  2IMF A;  4JBB A;  1CQH A;  1O85 A;  1AW9 A;  1Y25 A;  1X1U A;  1EV9 A;  1TU7 A;  1DVC A;  2XBI A;  1SU9 A;  3PZW A;  1Z7P A;  2GT5 A;  1ZZY A;  2WFC A;  2F8A A;  1GY7 A;  1TRU A;  1Z9H A;  2GEY A;  1GMQ A;  8GSS A;  3PR8 A;  3KII A;  1AC1 A;  3WT2 A;  2B6M A;  1RTU A;  3U1W A;  3DGY A;  4NXI A;  2LS5 A;  3KH9 A;  1T4Y A;  1RHL A;  4N3V A;  2RNT A;  4XS1 A;  3RGA A;  1O8X A;  4J5G A;  2B3S A;  1BU4 A;  1B48 A;  3RNT A;  2M80 A;  2IWT A;  4CHS A;  4G10 A;  2VLU A;  2B5X A;  1X9S B;  3FW2 A;  1NM3 A;  4TXO A;  4Q5R A;  4OK0 A;  4WP5 A;  4WBJ A;  1F3A A;  5BRT A;  1I3I A;  2XGL A;  1GLQ A;  3I9V 2;  4AJ7 A;  4MCU A;  1T2I A;  4P3Y B;  1WE0 A;  2YV7 A;  3DH2 A;  4R80 A;  3HKR A;  1BNR A;  2HZF A;  3F9U A;  2M7O A;  4L0U A;  1AV4 A;  1O7G B;  1SJ6 A;  1M2A A;  2PER A;  3A5W A;  1K41 A;  1H4O A;  1I2G A;  3FF0 A;  3G4S 3;  2RUE A;  4LMI A;  4WR4 A;  3UAP A;  5AII A;  4K1F A;  3N5O A;  4IEL A;  3PCR A;  1TOF A;  1BNE A;  3LOY A;  4EW5 A;  2O89 A;  1A8Y A;  2GEX A;  2GGT A;  4K9Z A;  3UVT A;  3ZRD A;  4BTY A;  2TRC P;  3MIX A;  3ISO A;  3CCS 3;  3HVN A;  3FMW A;  2H19 A;  5LD0 A;  5GST A;  2XFT A;  2I9H A;  2K9F A;  2H1G A;  4DSS B;  4XTS A;  3I6A A;  1RRL A;  4HKV B;  4NAX A;  20GS A;  1AXD A;  3AHW A;  1YJ6 A;  4I6X A;  1D6Y A;  4TR4 A;  2WO0 A;  5JPU A;  5A4V A;  4AGS A;  2YPM A;  4HDE A;  5CAX A;  4OUQ A;  5ENU A;  3VWV A;  2FD3 A;  5EEO A;  3L9V A;  2HMM B;  2BTO T;  2X4A A;  2YZH A;  1STF I;  2Z7A A;  4PQ1 A;  1PL2 A;  1BRN L;  3K9M C;  2K6V A;  3ZG5 A;  5IPG A;  2CZ3 A;  2HSY A;  8CHO A;  4WWU C;  1AIU A;  4EBG A;  3IPT A;  9RNT A;  4WF4 A;  5AI1 A;  4BVY B;  1SK2 A;  1US1 A;  1K8A 4;  1PY3 A;  3GHA A;  1ZYP A;  3TRP A;  3NBR A;  3TOU A;  1ZYN A;  4FH8 A;  2Q07 A;  1GNE A;  2OKA A;  4X0X A;  5ELG A;  3PYJ A;  4ULX A;  1FAA A;  1ASK A;  3CCR 3;  3EE2 A;  4N30 A;  4AKZ A;  3LYG A;  1GP1 A;  1GSU A;  1O7P B;  1OKT A;  4XB5 A;  3F7X A;  3ZIV A;  6GSX A;  5DCH A;  1XVQ A;  1W2B 2;  2XSH B;  4HJ2 A;  2UUG C;  3G9B A;  1IV7 A;  1IQX A;  1I9D A;  4HU7 A;  1Z5Y E;  1IVW A;  2LTK A;  6GSW A;  2XFS A;  2DJ1 A;  2JZS A;  4KT3 B;  1J9B A;  5D81 A;  3BLZ A;  4X1U A;  2IL3 A;  5D9X A;  3IPZ A;  5E4W A;  1QK8 A;  4FR9 A;  3Q1C A;  2W6J H;  1UCJ A;  4GLT A;  4DEJ A;  1GOV A;  1AVK A;  3NIV A;  3FSD A;  1F6M C;  2LEG A;  3D0Z A;  4G19 A;  3X40 A;  5FHI A;  1FGR A;  3QFA C;  3QMX A;  1GD3 A;  1ZL9 A;  5GAN D;  4N6M A;  1KWI A;  3DGL A;  1PN0 A;  4DKI A;  2E2T A;  1IQY A;  4IIA A;  4EIP A;  1GD4 A;  5ID2 A;  1TUH A;  1Z6M A;  1NNV A;  1K9M 4;  1PGT A;  1FA3 A;  2CVK A;  4EF0 A;  4BPY A;  4E8E A;  1WIK A;  3W8S A;  1F2E A;  1TP6 A;  4PGT A;  2I9W A;  17GS A;  4G1M B;  4TR3 A;  1BNG A;  4GQC A;  4QQ7 A;  1AQV A;  3C71 A;  2LRT A;  4IW9 A;  1W01 A;  3CCU 3;  4G0I A;  2J9H A;  3CSH A;  5CK6 A;  5D96 A;  3KEB A;  3QK9 A;  5BIR A;  3N54 B;  5AEU B;  1FW7 A;  4MEI A;  3EX9 A;  4PUR A;  3FR9 A;  2H01 A;  2H1B A;  1VF2 A;  2P09 A;  3FG3 A;  1HQO A;  2FWE A;  2O7K A;  2H70 A;  5JBS A;  2V6K A;  2F9S A;  2GZZ A;  3ME7 A;  4NWY A;  2EIR A;  1WRY A;  4Z2T A;  3AMO A;  4EC0 A;  4BA7 A;  3KZQ A;  5DJM A;  2J8X B;  1TTO A;  2ZHX B;  2CAI A;  1Q7H A;  2CH9 A;  1OGX A;  3NQY A;  3UIW A;  3FHK A;  2QA2 A;  1Q42 A;  4KFE A;  4LMW A;  2H75 A;  3TKS C;  1LJR A;  3KCH A;  4ZM8 A;  1U3I A;  2FY6 A;  1F3B A;  4RI6 A;  1WMO A;  1X9W B;  1NHO A;  4D73 B;  5J4U A;  2W0Q A;  1PL1 A;  2IUJ A;  2MYG A;  1RN1 A;  3H79 A;  2A15 A;  1OUN A;  4I2U A;  1FOV A;  3B7C A;  4Q53 A;  1AQX A;  3GL5 A;  1VQ5 3;  3NUV A;  2DJ0 A;  1T4Z A;  4YAV A;  3ZFZ A;  1A2K A;  5IM9 A;  2H72 A;  3FZ9 A;  1EP8 A;  3IC4 A;  4L8P A;  2VCT A;  3ZVJ A;  5DDL A;  4PQI A;  2IMI A;  3WA3 A;  3H1N A;  3NM2 A;  1K3O A;  4K8M A;  5FW5 A;  2B5Y A;  3FG1 A;  9GSS A;  3DVW A;  2BMO B;  1DE2 A;  3FLJ A;  1ST9 A;  2D1W A;  1EA2 A;  1O7N B;  1ROV A;  4O5Q A;  3T0U A;  2R3X A;  2F8F A;  3DD3 A;  3V92 A;  3L9S A;  1IT8 A;  2H73 A;  2Z9S A;  4Q5Q A;  1Y4K A;  3PCS A;  2L6C A;  2CC3 A;  4O02 B;  3OX9 A;  2Z6B A;  4JED A;  1W7C A;  2CX1 A;  3QD9 A;  4POK A;  1M3J A;  4F82 A;  3ERW A;  1GSP A;  2PVO C;  2BHM A;  2KF6 A;  1PFO A;  4KX4 A;  4GSS A;  1RCL A;  5J9B A;  1ERU A;  1RW1 A;  2Z77 A;  4K7O A;  1B2S A;  3KJY A;  2GDR A;  2LJR A;  5IEN A;  4HM4 B;  4L5L A;  3G0K A;  5G30 A;  3N8B A;  1NB3 I;  2CHC A;  4KCE A;  1G7E A;  1J2B A;  4MF6 A;  1X1X A;  3G7Y A;  1EGR A;  1IVV A;  4MF5 A;  1HYU A;  5AIG A;  3ZZX A;  1ZGX A;  2GBW B;  2QIY A;  1ERW A;  2C10 A;  3APQ A;  3EUR A;  3CYN A;  1Q40 B;  4IJ3 A;  4IS0 A;  5IMD A;  2MMO A;  2YZU A;  4MJC A;  3FGY A;  1TFK A;  3E3E A;  1MOL A;  2UGI A;  4WBR D;  1BIR A;  3JUO A;  1UUV B;  2QEX 3;  5ECQ B;  1O73 A;  1BSA A;  1M9B A;  2BMR B;  2A2S A;  4G2E A;  1SKW B;  1C54 A;  2IA7 A;  3M0F A;  1TU5 A;  1CYV A;  1FW1 A;  4NHW A;  3CXC 2;  1LVN A;  5LNK e;  3KIJ A;  2H1A A;  1EP7 A;  4BU4 A;  1BNS A;  3CC2 3;  2XBQ A;  1LOY A;  4EIQ A;  2INX A;  3MYT A;  1MDK A;  4EUY A;  5J5N A;  4KA0 A;  3F6F A;  1MNL A;  3VPQ A;  4JZQ A;  1BRK A;  4ILF A;  2KF4 A;  2CIU A;  2QA1 A;  2HOH A;  2VCW A;  6GSV A;  1AQZ A;  4FYU A;  2K8S A;  2H0H A;  2MC8 A;  2GTU A;  3GUR A;  1FUW A;  2JU5 A;  3C73 A;  1S72 3;  2C3Q A;  5JPP A;  12GS A;  1DBY A;  2HMN B;  3VI5 A;  2IFQ B;  3JUQ A;  1X5C A;  4FCM A;  5ECS A;  3SX1 A;  4E8H A;  5D83 A;  3LOR A;  3PIN A;  2I3Y A;  5G5E A;  2MMN A;  5D82 A;  1ZGN A;  2WDU A;  1GUM A;  4O3V A;  5EVO A;  3HJP A;  2IMJ A;  3H93 A;  2GU3 A;  2ZDJ A;  2C4J A;  2GLR A;  3FEU A;  3VK9 A;  4TKY A;  1FGT A;  3F0I A;  1I0V A;  5CO3 A;  1K3Y A;  1TIJ A;  2GBX B;  4MMM A;  5DCG A;  1MDJ A;  5JCW A;  1I8V A;  3CCM 3;  3TJJ A;  3HII A;  1GTU A;  1XWG A;  3JCM L;  3LSZ A;  1NJI 4;  3DZL A;  3LYK A;  3A2V A;  5A0O B;  3FKF A;  5IER A;  1FB0 A;  1NB5 I;  2RFR A;  5ELU A;  1QFN A;  2H71 A;  1UC7 A;  3MDK A;  2XGN A;  4X2H A;  1LNI A;  1WWJ A;  4NPB A;  1BSD A;  2R0P A;  4POM A;  1JZO A;  1TK5 B;  1RN4 A;  2OTL 3;  2RSX A;  4PNF A;  1TRP A;  4Q5F A;  1TP9 A;  1A8L A;  3KSE D;  1MDI A;  3G6E 3;  4R9K A;  3KM6 A;  1RGL A;  4MH3 A;  3EC9 A;  3Q3F A;  1MTC A;  1C7H A;  6RNT A;  5KP1 A;  2VLT A;  3UBL A;  2HXK A;  4MMZ B;  3GX8 A;  2C80 A;  4ZIL A;  1W4V A;  4RNY A;  4STD A;  2DBC A;  2F5W A;  4XHM A;  3LGC A;  1Z1S A;  1YI2 3;  3ERG A;  8RNT A;  4HOJ A;  4F03 A;  1UUG B;  5IQY A;  2K18 A;  5KP4 A;  3CRT A;  1T8E B;  3T8N A;  4ECB A;  3N9H A;  5A4W A;  1TFO A;  5J3R A;  1B2U A;  3FZ5 A;  1AY7 A;  3I56 3;  2GSS A;  5ECR B;  2G2Q A;  3EIN A;  3QR6 A;  4JR6 A;  2VIM A;  4LL4 B;  1IYY A;  2FWF A;  2ZUP A;  2BT3 A;  3G71 3;  1THX A;  5M18 A;  3D21 A;  3W8J A;  1W89 A;  4MH2 A;  1BSB A;  3HX8 A;  1A67 A;  3KP8 A;  2ZNM A;  3UJM A;  3DML A;  4IBP A;  4GHO A;  3BBY A;  3FZA A;  3F40 A;  1ML6 A;  2FXT A;  3ROB A;  4MF7 A;  4FMB A;  3MWH A;  1GSF A;  4CJN A;  3GA4 A;  2K8V A;  3JUP A;  5B6N A;  3UOM A;  3ZML A;  4HZ9 B;  1YEX A;  2F98 A;  1OC3 A;  5AIV A;  1K0O A;  1O6J A;  5E59 A;  1O7H B;  1XCC A;  1QMV A;  4JU5 A;  1RDS A;  3SXX A;  5IMC A;  3R3E A;  4HJM A;  3TDG A;  2KF5 A;  1BG5 A;  1FHE A;  5F07 A;  4QL7 A;  4EKZ A;  2OBI A;  2FA8 A;  1SJZ A;  3UL3 A;  3LW9 A;  1CQS A;  3CME 3;  1M0U A;  1OYJ A;  4PUA A;  5ABR A;  3HCZ A;  1VQ9 3;  3FR3 A;  2C0F A;  1RRH A;  3FRC A;  3CNM A;  2PNC A;  3EMX A;  4HQZ A;  2VM1 A;  3GH9 A;  1BRS A;  2CX4 A;  4YH2 A;  1USB A;  4PNG A;  3GZY B;  3EQQ B;  2NVL A;  2QSI A;  4DSS A;  3PXM A;  3A3T A;  3OWU A;  3OV4 A;  1BUJ A;  4IJI A;  3HOH A;  1U8C B;  1MWR A;  4XBT A;  3LT9 A;  1NW2 A;  2RM5 A;  1TJD A;  1GRX A;  3ZMK A;  1VQ7 3;  4HM5 B;  5IO2 A;  1M90 4;  1TRW A;  4RBN A;  1XWB A;  2OE3 A;  4K7I A;  3CCJ 3;  2GSP A;  4V2N A;  1MEK A;  1M2B A;  1TU8 A;  4HZB B;  1XWA A;  3QDN A;  4KB3 A;  3HA9 A;  4FQU A;  1PKZ A;  2VCZ A;  1N9E A;  1PYL A;  2R0G A;  2I81 A;  2LUS A;  3VSY A;  2IY2 A;  5IMZ A;  3DMC A;  5C04 A;  3A2X A;  3FH1 A;  1I70 A;  1ZO2 A;  2RLI A;  4BVY A;  2YAN A;  2C0D A;  4HUA A;  2CZ2 A;  1G02 A;  2DJ3 A;  2HRF A;  1DET A;  1EEM A;  1K0M A;  3VPT A;  4RNT A;  3IE3 A;  2CG0 A;  5ECM B;  1GOY A;  1KD1 4;  3MSZ A;  3GV1 A;  4L0W A;  1NU3 A;  1FZU A;  3WHO A;  1VQN 3;  2XPD A;  2H6Y A;  3E0U A;  4O92 A;  1DE1 A;  3KZT A;  4ML6 A;  1A90 A;  4RUV A;  4AJ8 A;  4ECJ A;  2C0G A;  1CQG A;  3HD5 A;  4WET A;  3GH6 A;  3NV0 B;  1W6G A;  3MYD A;  4OCE A;  1T5Y A;  1GYB A;  3WDG B;  2LQV A;  4NRE A;  3NHX A;  1RCK A;  1M2D A;  1RKY A;  2C8U A;  4OWY A;  1V58 A;  1YDK A;  4LGQ A;  2OOV A;  1TDI A;  3TKR A;  4N0Z A;  1G0T A;  4Z7X A;  1I0X A;  5AIS A;  1LOV A;  2B7J A;  2NBS A;  4TVE A;  4K0G A;  6GSY A;  2X64 A;  1BRG A;  1JZR A;  4NMU A;  1VQ4 3;  3IJE B;  3OWY A;  2CWT A;  1DSB A;  1BVI A;  1AAZ A;  1RGC A;  2FCH A;  3G7J A;  4KE3 A;  4F2I A;  2JSY A;  5DRV A;  3CTF A;  1SK0 A;  3VLN A;  1IK3 A;  2P5Q A;  5JCG A;  3TKQ A;  1SL0 B;  3EB8 A;  5JCU A;  1YF0 A;  3KCM A;  5DAL B;  3FG4 A;  3TB2 A;  2BO9 B;  4GSN A;  4AF2 A;  3DY5 A;  3IC8 A;  3KXO A;  3KMO A;  3NZN A;  1FUS A;  4NV5 A;  4ZB9 A;  4Z2R A;  2C3N A;  4XDW A;  3QAV A;  4ACS A;  5CP1 A;  1XVW A;  2FWG A;  1WPI A;  2EIQ A;  3RBT A;  3VUR A;  2VL9 A;  3CCL 3;  4TR0 A;  3A76 A;  4IQ1 A;  6GST A;  3GZX B;  4OFT A;  1ZCP A;  4YQM A;  6GSP A;  3F4T A;  1X1W A;  1YKA A;  2LNS A;  1VZZ A;  2QKE A;  1LRA A;  1SQW A;  2X49 A;  3ALA A;  2REM A;  3K8N A;  4FMD A;  3Q6O A;  2DMM A;  3EBY A;  1YVS A;  3FK8 A;  2YFJ B;  2HRK A;  3FY7 A;  1W00 A;  4K1U A;  1CYU A;  1T2H A;  2OAC A;  4AJ6 A;  4RZM A;  2XEP A;  1TI3 A;  2GQL A;  4KDY A;  2CX0 A;  1YGE A;  1K0N A;  3KTB A;  3TUE A;  1MWU A;  2IN3 A;  2CFD A;  2YWN A;  3L9U A;  5AYR B;  5EPF A;  2F5M A;  3O6T A;  2CV4 A;  5AYS C;  3Q19 A;  5BU4 A;  1I5G A;  3NOF A;  1MGR A;  5ECH B;  5IG0 A;  2HMK B;  2RII A;  2KF3 A;  1SK1 A;  1S3R A;  1EKM A;  4QWT A;  3HVV A;  1FGO A;  1B21 A;  5IEO A;  1IU7 A;  3ZIJ A;  5CNW A;  2Z76 A;  3BU4 A;  4D73 A;  4BTX A;  3ZFB A;  4HBR A;  3STD A;  2R6K A;  3A2W A;  4KH7 A;  3V98 A;  1STD A;  1YZX A;  2VOC A;  4A5P A;  1QUW A;  2K3D A;  3D9R A;  3QFB C;  2PWJ A;  2BNG A;  4K90 B;  1BGS A;  2R4V A;  1MWS A;  5A5K A;  2H76 A;  2IMK A;  3GAX A;  1J0F A;  3GZR A;  4MMY B;  3FCS B;  2R0C A;  3EWL A;  3D79 A;  4BL3 A;  1UUW B;  3VFI A;  5KN3 A;  1FUT A;  4FYC A;  4GQF A;  4KCA A;  1RNB A;  1OE7 A;  3R2Q A;  2N5B A;  4ECI A;  1Q86 4;  1JZW A;  2KLX A;  4XRD A;  1XZO A;  3CQF A;  1BQ7 A;  1FGM A;  2AUV A;  3SWL A;  2CQ9 A;  2R4I A;  3UEM A;  14GS A;  4F0C A;  4V2M A;  1GUK A;  2VD1 A;  4N6O B;  3K7C A;  2DJ2 A;  4LZI A;  3F4S A;  3U6V A;  2YFI B;  4CY6 A;  4WR5 A;  4HQS A;  5ELA A;  3UVH A;  1S3D A;  2W2C A;  1UA5 A;  2IYJ A;  5AN1 A;  4O5R A;  1X0R A;  4YAP A;  1V74 A;  1Q81 4;  3VWW A;  2P38 A;  3OWS A;  2L1S A;  1PX7 A;  1OGZ A;  2VD0 A;  2LST A;  3SED A;  19GS A;  1XFL A;  1VF3 A;  1FG4 A;  3I43 A;  5EVH A;  5G31 A;  4L8O A;  4EVM A;  1RSN A;  3QAW A;  2ZA4 A;  6GSU A;  3M1G A;  1F9M A;  2G0F A;  1BRI A;  4MZW A;  4RQR A;  1SJW A;  4DVC A;  4ZB8 A;  3CPW 2;  4O8S A;  2LJK A;  2AYT A;  3M9J A;  2LRC A;  5CRD A;  2B5E A;  3AGN A;  3CCV 3;  2OCT A;  5ECN B;  1Q40 A;  2HZE B;  3TKS E;  2X8G A;  4WHA A;  2KP2 A;  3IHQ A;  1B9X C;  1VQP 3;  2B24 B;  1LNH A;  2WB9 A;  2GT6 A;  1WJK A;  1YF1 A;  2HNL A;  5GSS A;  4TOP A;  1SKR B;  1MD4 A;  1AR0 A;  1BNF A;  1GWC A;  1OAZ A;  3O76 A;  3EJV A;  3KGK A;  1QAF A;  3GX0 A;  3P2A A;  3M3M A;  3A5E A;  2P5R A;  5EY6 A;  1SYR A;  4TX4 A;  2JAD A;  3KSP A;  2P0G A;  3TRX A;  2Y74 A;  5KN0 A;  2FHE A;  2C1Y A;  3SOA A;  2BJX A;  2JZR A;  3D22 A;  3IOS A;  3TJB A;  4MAB A;  2C4B A;  2I1U A;  3UNL A;  4MZC A;  3ZL5 A;  1O7M B;  1SD8 A;  4TR1 B;  4YKG A;  3CXG A;  1FOH A;  2IFQ A;  4XS6 A;  1V2A A;  4K5S A;  2OWP A;  4BL7 B;  2W56 B;  2E2U A;  4MMX B;  5RNT A;  3WD6 A;  2MF7 A;  1LQM B;  5HFI A;  2H6Z A;  1BSC A;  2L4Q A;  4ORL A;  2HE3 A;  4OD7 A;  1UDI I;  3CBU A;  4R4K A;  3FZ4 A;  2CFL A;  3LT8 A;  3S29 A;  4KUN A;  4IT7 A;  4TN8 A;  1TK8 B;  1GL8 A;  4ZBB A;  4L8E A;  1OVN A;  5F0G A;  3CSI A;  4IQA A;  3GTU B;  4HM3 B;  1ZYE A;  1NO3 A;  2QGV A;  3D6I A;  3BND A;  2WOH A;  2LYX A;  2XH9 A;  1DMQ A;  4ZBD A;  1S5A A;  3J7Y d;  2OJL A;  1B27 A;  3H3H A;  1DE3 A;  4IGJ A;  3Q2P A;  3RGR A;  1SYX A;  4DSR A;  1URM A;  4HZ2 A;  1N8Q A;  2F4Y A;  4POB A;  1AVL A;  3RHB A;  3AGO A;  5HR2 A;  1XBS A;  3TJK A;  1M1K 4;  5COH A;  5IEP A;  3F63 A;  3P7X A;  3C7M A;  4EDZ A;  5HOH A;  2X8H A;  1O7U A;  2D42 A;  2BMQ B;  3VI7 A;  5STD A;  3GKX A;  1S3A A;  1W6C A;  16GS A;  5IG4 A;  2JSZ A;  3GIX A;  2OE1 A;  2PBJ A;  4MA9 A;  5KEJ A;  7GSP A;  3D5J A;  4WF5 A;  3V1W A;  1RJO A;  4PTS A;  1QVG 2;  3BOA A;  1Q7Y 4;  1SPU A;  1IYH A;  3TGZ A;  4IKH A;  1MWT A;  1RN7 A;  3GKK A;  3GNJ A;  4V2L A;  5IMF A;  2P05 A;  1A2P A;  1IT7 A;  4EC6 A;  1R4W A;  1V98 A;  4ML1 A;  3CCQ 3;  3RHC A;  3X41 A;  3LYP A;  4N0V A;  1FYS A;  4PXO A;  3OXA A;  3TJG A;  3E9J B;  1B8X A;  4ZXG A;  4XM4 A;  2RCD A;  2QA4 3;  1M99 A;  4BIR A;  4JRR A;  3HK4 A;  2ES7 A;  1Q4J A;  2VCX A;  1R5P A;  2WRT A;  1F8N A;  1G6W A;  3LQ7 A;  3F8U A;  1IYI A;  2HMO B;  4PQH A;  3L0H A;  4BWS A;  3GWR A;  3O8Y A;  2M72 A;  5B8A A;  4HM0 B;  3FR6 A;  1OH0 A;  4N6L A;  1NWW A;  5IMA A;  1G7O A;  1GSE A;  3NXJ A;  1QVF 2;  1Z7R A;  4EV5 A;  5CYY A;  3VGN A;  4USS A;  2NPB A;  4ZL8 A;  1RNT A;  1VF4 A;  5IMV A;  4L7K A;  3JUM A;  4KW6 A;  3MG2 A;  2VL2 A;  1JKG B;  3DXB A;  2AAE A;  3D4T A;  2AV4 A;  5F8B A;  3GUS A;  1QQ2 A;  2X8C A;  2HI7 A;  2FLS A;  3GKN A;  5D93 A;  2XHF A;  3KFQ C;  2L5L A;  2RBI A;  2PUK C;  1OC9 B;  1VQM 3;  1JN5 B;  1GUH A;  2I4A A;  1HYF A;  1VF1 A;  3PGT A;  2OQE A;  3AHS A;  1YHQ 3;  5D9T A;  4CY8 A;  5ECP B;  4U13 A;  5KOX A;  4K5R A;  2HSH A;  2V32 A;  5KOW A;  3LXZ A;  4HM1 B;  1ULI B;  2B1X B;  1X5D A;  4LMV A;  5IIZ A;  1YQ1 A;  2JQ5 A;  1T3B A;  2VCQ A;  4EXR A;  2QGU A;  3G8Z A;  3ZYW A;  3RPN A;  1GS3 A;  1TI1 A;  6STD A;  3B4P A;  5F05 A;  7RNT A;  3ZRE A;  4ID0 A;  3QPM A;  5DVB A;  1HKX A;  3IAM 2;  2CKF B;  3IAS 2;  5AEW B;  5ECI B;  2CFG A;  2IMD A;  4J56 E;  1W5Z A;  4XDV A;  3T8U A;  3PH9 A;  1BUQ A;  4F9Z A;  1TK0 B;  1JNQ A;  1H75 A;  5AIF A;  2A2P A;  2R2J A;  4IHU A;  1RGF A;  1SEN A;  5GSP A;  1TW9 A;  4TXV A;  1FO5 A;  4GSP A;  3GRD A;  3S28 A;  5AIH A;  4EXJ A;  3IK9 A;  1I2E A;  3HZ8 A;  2C11 A;  2LNT A;  1YGW A;  4K6X A;  2YWI A;  1YJW 3;  3A5I A;  3DRN A;  3I0Y A;  3RDW A;  1XW9 A;  1HZ1 A;  2WJU A;  3LTC A;  2GQM A;  1IDP A;  2VLV A;  3PS8 A;  4MJE A;  4JRF A;  3HJO A;  4K2D A;  4KSO A;  1IV9 A;  3SVA A;  1T1V A;  3QCP A;  1VGL A;  4WXT A;  3WGE A;  1VQO 3;  3MNG A;  4HM6 B;  3MPH A;  2L6D A;  3FZW A;  3P8W A;  1CH0 A;  2XPE A;  5J9C A;  2YOI A;  1OHO A;  3IRA A;  1AQW A;  5CRE A;  2MMA A;  1WMN A;  1GY5 A;  1OAC A;  1NHY A;  3CPO A;  4ECC A;  2C0E A;  5B6M A;  4NV2 A;  1K3L A;  1IVX A;  1RGH A;  1UVZ A;  2XRX B;  2QC7 A;  3DXO A;  4OFN A;  1SD9 A;  3OR5 A;  2JL4 A;  1L5G B;  1HU9 A;  3NV0 A;  2XC2 A;  2HFD A;  1E6B A;  1X5E A;  2CAQ A;  2WOF A;  1ZMA A;  1NDO B;  2F86 B;  2V41 A;  2RM6 A;  1OPY A;  2JDI H;  4CPK A;  3X42 A;  5DAK B;  1BAO A;  1A2V A;  2PZV A;  3LXU X;  1S3C A;  3GN3 A;  3ED3 A;  2W04 A;  4WYK B;  1N9J A;  3KH7 A;  5D8I A;  4N6U A;  1EWX A;  3FKA A;  3K5T A;  1GOU A;  3TRQ A;  2ZL8 A;  3DGQ A;  3LEF A;  2AAW A;  1B2X A;  1X1Y A;  4BIK A;  1N5P A;  3WOF B;  1IQ8 A;  1UI7 A;  3WOE B;  3EU3 A;  4IP1 A;  4YQU A;  5ECL B;  3SLU A;  1K0D A;  1YIT 3;  2E7P A;  1W02 A;  2A4H A;  3UMA A;  3CU3 A;  2KXG A;  5BMU A;  3D4A A;  3LTD A;  5DAL A;  5IO0 A;  2CT6 A;  3CCE 3;  2FA4 A;  1QGV A;  3DGO A;  1RLS A;  5HR3 A;  2DLX A;  1LU4 A;  1PQN A;  1KQS 2;  3O3T A;  2O8V B;  1R7H A;  4K61 A;  4CCV A;  1ACV A;  1XG8 A;  3C1S A;  2ML6 A;  1E97 A;  1VQ6 3;  2LRN A;  3BNC A;  3DVX A;  2CG1 A;  4BL2 A;  3HHV A;  4J2F A;  1WQL B;  4Q5N A;  1BYE A;  3ERF A;  3M9K A;  1RGG A;  4N6V 0;  3N9J A;  3CC7 3;  1PN9 A;  2YWO A;  5H5R A;  2W03 A;  4J8T A;  1DYU A;  4R1K A;  4ZBA A;  3L78 A;  1M9A A;  2DC5 A;  5KN2 A;  2CVB A;  1U88 A;  3C1R A;  2H6X A;  2FNQ A;  3GYK A;  5DJL A;  4LA1 A;  3SYU A;  3UL5 A;  1OE8 A;  3U97 A;  2H8L A;  2P0M A;  1KTE A;  1ON4 A;  4EYC A;  3DWV A;  5IG5 A;  4OO5 A;  3CTG A;  1PA3 A;  2GS3 A;  2DIY A;  1OCV A;  2CFW A;  2EIO A;  4L5O A;  4HS1 A;  1WP0 A;  1JB4 A;  3JVC A;  3D5I A;  1GUL A;  2IJY A;  4G0K A;  4GCI A;  3Q74 A;  4KZ1 A;  1BNJ A;  1YJ9 3;  4H61 A;  2ALB A;  1K0B A;  2DML A;  3F6D A;  1FVK A;  5B8B A;  1WOU A;  3MWZ A;  1K0A A;  3CSJ A;  1ROA A;  1G96 A;  4HYZ A;  3CD6 3;  1JHB A;  3GRX A;  18GS A;  1B4P A;  4GXZ A;  1E2Y A;  3WR2 A;  2LJA A;  5DRE A;  1U3A A;  3IXR A;  3DEX A;  1UCL A;  2L59 A;  2XF3 A;  1DMM A;  3X3Y A;  3ZG0 A;  3EVI A;  3G7I A;  1ILO A;  3ECF A;  5G2Z A;  5HFG A;  1A2M A;  3NX0 A;  3EC3 A;  4CW9 A;  6GSS A;  3ZIT A;  4O5U A;  4N11 A;  3DUK A;  1N8J A;  1U6T A;  2OAD A;  1JLW A;  2E2G A;  2PU9 C;  3K0Z A;  1GH2 A;  1Q9E A;  4Z2U A;  4EE0 A;  2YN1 A;  1M7T A;  1GSS A;  3K63 A;  1VQ8 3;  3FF2 A;  3C8E A;  4ZB6 A;  3DM8 A;  1OF5 B;  4FMA A;  4I97 A;  2ON5 A;  4FCJ A;  4POL A;  2PGT A;  4X2O A;  1GY6 A;  2OOV C;  4HJL B;  3F7S A;  2DKI A;  4XS4 B;  1D6Z A;  2CA8 A;  5IG3 A;  1EGO A;  4OO4 A;  2HMJ B;  2WGQ A;  4XBX A;  1U87 A;  2KAA A;  2FNO A;  4CDO A;  3LG6 A;  3AY8 A;  2ZCT A;  4XIH A;  1U5O A;  5EQL A;  3BNE A;  1B9Y C;  1FVJ A;  4RI7 A;  3BIR A;  1OKD A;  1E3V A;  4WKW A;  1T7P B;  2H74 A;  2MBT A;  2A4V A;  4MJA A;  1DVD A;  3WT1 A;  2HZE A;  2SBL A;  3BCI A;  5L71 A;  1JRQ A;  2VM2 A;  2FGT A;  4X43 A;  3ZFL A;  4JR4 A;  3BNB A;  3UB1 A;  4K7N A;  5CRH A;  1WMP A;  4XBY A;  4QL9 A;  1M1X B;  4IVF A;  1ZS7 A;  4KSM A;  3HVS A;  1O7W B;  1VQQ A;  2VCV A;  2YP6 A;  4OVM A;  5HR1 A;  4GWR A;  4FMC A;  4BVX A;  5ELJ A;  3ME8 A;  3SOY A;  2F51 A;  3LWA A;  4HM2 B;  10GS A;  3DIE A;  4GST A;  2IME A;  2GXF A;  1IVU A;  3QAG A;  4TXO B;  5JWR B;  2AJQ B;  3WYW A;  5INY A;  2HRA A;  3F8H A;  4HSC X;  5DQS A;  2O3O A;  2GSQ A;  2BIR A;  4EL1 A;  2HT9 A;  2GU1 A;  3RAZ A;  5IPH A;  3S5C A;  2CFK A;  1TTZ A;  2YJ7 A;  2KUC A;  1GSD A;  4TR1 A;  4LLR A;  4G9H A;  2MMZ A;  2YX9 A;  3U5R E;  3WGX A;  4EV2 A;  2CW9 A;  2C3T A;  2DIZ A;  4O32 A;  4BL7 A;  1RQM A;  2W56 A;  3X3Z A;  4HVN A;  3MAK A;  3RPP A;  1UI8 A;  5DQY A;  2LQO A;  1RMS A;  1BED A;  1ERV A;  2L5O A;  3D3L A;  3HXS A;  4LSO A;  4K2X A;  1WNH A;  2P0X A;  2BMX A;  3D5G A;  1Q82 4;  4OMV A;  1OC8 A;  2O85 A;  1GSQ A;  3CC4 3;  1KEB A;  4ZIJ A;  1YVB I;  1YNV X;  1XPV A;  1BSE A;  2TRX A;  1V9W A;  2L57 A;  4X4J A;  2GST A;  4DSQ A;  4KDX A;  3GTU A;  2DSA A;  2L4V A;  1HD2 A;  4N10 A;  3UL6 A;  4GRF A;  1MD3 A;  5GZZ B;  2XR8 B;  1JJ2 2;  3HY2 A;  3DGM A;  4HZ4 A;  2L4C A;  4RQX A;  1SL2 B;  4MPF A;  1RGA A;  1A2L A;  4GF0 A;  5LC6 A;  2GZY A;  2SAR A;  3HZ4 A;  4IN0 A;  4XCS A;  3GL3 A;  1AUC A;  1F37 A;  3VWU A;  5D9W A;  3H4K A;  2AAD A;  2H1D A;  4YKF A;  5LC7 A;  3NM7 A;  3IMA B;  4J9A A;  5FWG A;  3B8L A;  1WMJ A;  3TKP A;  3LML A;  4MJD A;  5KP3 A;  5HR0 A;  2FWH A;  4BWQ A;  3Q18 A;  3UBK A;  4GL6 A;  3TKS A;  2M46 A;  1LXE A;  2P31 A;  2CK3 H;  3EN1 B;  1MGW A;  3KKG A;  3MKI A;  2DKH A;  4HAA A;  1KSI A;  1V57 A;  4I2T A;  3BB9 A;  1HNC A;  1ISK A;  2H0I A;  3VWX A;  1T00 A;  4MPG A;  5G2G A;  5BVB A;  4HM7 B;  3CRU A;  1FB6 A;  4HEA 2;  2HYX A;  4JE1 A;  4PX1 A;  1RGE A;  5EL8 A;  3J7Y b;  5I97 A;  1WTH A;  1ABA A;  4ICY A;  4TW5 A;  4IPB A;  1TKD B;  2JAC A;  4BVX B;  3GSP A;  2WCI A;  5F06 A;  1D6U A;  3F3Q A;  2AHE A;  1DMN A;  2O9U X;  2GSR A;  4O7H A;  1YJN 3;  2RUF A;  4LL1 B;  1Y6E A;  3EPT A;  1G6Y A;  4PUF C;  2YNX A;  3GST A;  2UX0 A;  2W9Q A;  1EOH A;  2BU4 A;  4MNN A;  4BTW A;  2JZT A;  1Z6N A;  5G1L A;  1N5H A;  3S9F A;  1PRX A;  1PD2 1;  4N6N B;  1XWC A;  3BJ5 A;  2KRT A;  3V99 A;  3DKS A;  1ZOF A;  3IHG A;  4H86 A;  5FT3 A;  3KN4 A;  5G1K A;  2HRN A;  1EUI C;  1FGQ A;  1BNI A;  1BJX A;  1JB2 A;  1ERT A;  1W4N A;  2VAF A;  1JKG A;  1OHS A;  3EYT A;  3QOU A;  5IOX A;  3HZP A;  1SKS B;  4KGI A;  3LFL A;  1QAL A;  1OHP A;  1OC9 A;  5ECK B;  1JN5 A;  5D9V A;  22GS A;  4KFD A;  2V2G A;  4NHF A;  2XSO B;  4V1A g;  3G16 A;  4OCF A;  2N5F A;  1O81 A;  2H0G A;  5FGO A;  1B3S A;  1EOG A;  3PGB A;  2CWV A;  1XOA A;  3KE7 A;  1HNB A;  3P90 A;  1M9G A;  1LOX A;  1DUG A;  1XXU A;  3APS A;  2X99 A;  2GQK A;  4MZB A;  2WS2 A;  3QRD A;  4ISD A;  3HYP A;  5ID2 B;  3HI7 A;  1YIJ 3;  2VO4 A;  3L0R A;  4N6T A;  2DJK A;  2LQQ A;  1BRJ A;  1JFU A;  1RK4 A;  1GNW A;  2IPA A;  3VF1 A;  2A2R A;  1VRS D;  5BXQ A;  1TRV A;  2YCD A;  2F99 A;  5D73 A;  4TRX A;  4HOH A;  4O2H A;  2HML B;  1UGI A;  2YFL B;  5CRG A;  3F4R A;  2F3M A;  1EEJ A;  4AKY A;  5DBQ A;  1QMA A;  1GMP A;  2R41 A;  5ECO B;  3DGN A;  3EF8 A;  2IUK A;  3TJF A;  7GSS A;  1K28 A;  2VUP A;  4KFF A;  3S27 A;  1A0F A;  1JB5 A;  3F8X A;  3KD0 A;  1XW5 A;  3KTL A;  1HNA A;  5H5S A;  4AEQ A;  1EQK A;  1Q98 A;  4HU9 A;  1UN2 A;  1W2Z A;  2O87 A;  3MG1 A;  2WGO A;  3ER7 A;  4KND A;  1TRQ A;  2E0Q A;  4FCZ A;  3EU4 A;  1GMR A;  2Y73 A;  2R5G A;  3S67 A;  3HDC A;  4I8B A;  3UJ1 A;  2PN8 A;  3AMO B;  5C00 A;  3WGD A;  5AIX A;  2OBK A;  1PFP A;  1LOW A;  4LEH A;  1R26 A;  3GZB A;  3FYG A;  5AGY A;  5A4U A;  3LXT A;  1W6Y A;  1SJI A;  2PPT A;  4F0B A;  1KBN A;  1N2A A;  3L4N A;  5HGR A;  1UGH I;  3NBB A;  1PSQ A;  1A24 A;  2OTJ 3;  4I5Q A;  2N5A A;  2CWU A;  3CMA 3;  3ZLP A;  4GTU A;  5J41 A;  3BCK A;  3J7Y k;  1XWK A;  5IF6 A;  2YV9 A;  1BX9 A;  3HVX A;  4MP4 A;  1ZYQ B;  5DAK A;  2H30 A;  2NTO A;  3RDE A;  2ON7 A;  3EE1 A;  3IV4 A;  4XRA A;  3LTA A;  2RGQ A;  4WYK A;  3HIG A;  1QJG A;  2V6O A;  3MHE A;  4H3U A;  4J5K A;  11GS A;  2FGX A;  1LBK A;  1K0C A;  1K73 4;  1YY7 A;  3IK7 A;  3H51 A;  2CX3 A;  1JV2 B;  3KMN A;  3ZVJ D;  1BOX A;  5JWO B;  1PX6 A;  2B7K A;  3WOD G;  4IP6 A;  4LYL B;  3M8N A;  4OFM A;  2WZ9 A;  1SII A;  1UCK A; 
#chains in the Genus database with same CATH homology
 1BAY A;  2YJH A;  1GTA A;  3GMF A;  4YQV A;  1TRS A;  2VL2 C;  5KN1 A;  3IDV A;  1JZD A;  2WGR A;  3H8Q A;  1EV4 A;  3PPU A;  2HLS A;  4V1A p;  2J23 A;  2E2M A;  1XW6 A;  4ZL9 A;  4K0N A;  4ZL7 A;  2B1L A;  3DYR A;  5CRW A;  3SBC A;  2FUG 2;  4J57 E;  1GTI A;  1TXX A;  2VL3 A;  1EZK A;  3F3R A;  2YWM A;  3IA1 A;  2DJJ A;  2LKU A;  1THO A;  2WUL A;  3US3 A;  4HI7 A;  1GTB A;  2GVP A;  1JLV A;  2KOK A;  1GSY A;  13GS A;  4KDU A;  2HSM A;  1SL1 B;  2KHP A;  1QXH A;  3TCO A;  1GLP A;  2IIY A;  1A23 A;  2OE0 A;  1B4Q A;  1A0R P;  1Z3E A;  3KP9 A;  3D4M A;  5HQP A;  1KNG A;  1R5A A;  2GZP A;  5B7C A;  4KF9 A;  4MLY A;  4FO5 A;  1O8W A;  2H66 A;  1YKC A;  1X9M B;  4EDY A;  2V1M A;  2CVD A;  1XIY A;  4FYB A;  5H5Q A;  2UZ8 A;  2B1K A;  3IR4 A;  1PMT A;  3GSS A;  1PKW A;  3GKM A;  4MJB A;  4G0L A;  4MDC A;  3ZTL A;  2PMT A;  3TOT A;  2OA7 A;  3CMI A;  2D2Z A;  1YEP A;  2MZC A;  1J08 A;  4NHZ A;  5HFK A;  2TIR A;  2PVQ A;  5LCZ A;  1C72 A;  5IOW A;  4XS4 A;  2MBS A;  1V40 A;  5JWQ B;  4WEY A;  3I69 A;  1XOB A;  2NDO A;  2EC4 A;  3W6G A;  3UAR A;  3EMP A;  5GAP D;  3GFK A;  3HJM A;  3BD2 A;  2R37 A;  4KAE A;  2LV3 A;  3IBH A;  4MK3 A;  2KP1 A;  3APO A;  4EO3 A;  2AB6 A;  3LJR A;  1A2J A;  4FIW A;  5G5F A;  1NSW A;  2IMF A;  4JBB A;  1CQH A;  1O85 A;  1AW9 A;  1Y25 A;  1EV9 A;  1TU7 A;  2XBI A;  1SU9 A;  1Z7P A;  2GT5 A;  1ZZY A;  2WFC A;  2F8A A;  1TRU A;  1Z9H A;  8GSS A;  3PR8 A;  1AC1 A;  3WT2 A;  2B6M A;  4NXI A;  2LS5 A;  3KH9 A;  1T4Y A;  4XS1 A;  1O8X A;  2B3S A;  1B48 A;  2M80 A;  2IWT A;  4CHS A;  4G10 A;  2VLU A;  2B5X A;  1X9S B;  3FW2 A;  1NM3 A;  4TXO A;  4Q5R A;  4WBJ A;  1F3A A;  5BRT A;  1GLQ A;  3I9V 2;  4AJ7 A;  4MCU A;  4P3Y B;  1WE0 A;  2YV7 A;  3HKR A;  2HZF A;  3F9U A;  4L0U A;  1SJ6 A;  1M2A A;  2PER A;  3A5W A;  1H4O A;  2RUE A;  4WR4 A;  3UAP A;  4K1F A;  3N5O A;  4IEL A;  1TOF A;  2O89 A;  1A8Y A;  2GGT A;  3UVT A;  4K9Z A;  3ZRD A;  2TRC P;  3MIX A;  3ISO A;  3FMW A;  2H19 A;  5LD0 A;  5GST A;  2I9H A;  2K9F A;  2H1G A;  4DSS B;  4XTS A;  3I6A A;  4NAX A;  20GS A;  1AXD A;  1YJ6 A;  4I6X A;  4TR4 A;  5A4V A;  4AGS A;  2YPM A;  4HDE A;  5CAX A;  5ENU A;  3VWV A;  2FD3 A;  3L9V A;  2BTO T;  2X4A A;  2YZH A;  4PQ1 A;  1PL2 A;  2K6V A;  5IPG A;  2CZ3 A;  2HSY A;  1AIU A;  4WF4 A;  4BVY B;  1SK2 A;  3GHA A;  1ZYP A;  3TRP A;  3TOU A;  1ZYN A;  4FH8 A;  1GNE A;  2OKA A;  4X0X A;  5ELG A;  4ULX A;  1FAA A;  3EE2 A;  4N30 A;  1GP1 A;  1GSU A;  1OKT A;  3ZIV A;  6GSX A;  5DCH A;  1XVQ A;  4HJ2 A;  3G9B A;  1I9D A;  4HU7 A;  1Z5Y E;  2LTK A;  6GSW A;  2DJ1 A;  2JZS A;  1J9B A;  4X1U A;  2IL3 A;  5D9X A;  3IPZ A;  5E4W A;  1QK8 A;  4GLT A;  4DEJ A;  3NIV A;  2LEG A;  1F6M C;  3D0Z A;  4G19 A;  5FHI A;  3QFA C;  3QMX A;  1ZL9 A;  5GAN D;  1PN0 A;  4EIP A;  5ID2 A;  1Z6M A;  1PGT A;  2CVK A;  4EF0 A;  4BPY A;  4E8E A;  1WIK A;  3W8S A;  1F2E A;  4PGT A;  17GS A;  4TR3 A;  4GQC A;  4QQ7 A;  1AQV A;  3C71 A;  2LRT A;  4IW9 A;  4G0I A;  2J9H A;  3CSH A;  5D96 A;  3KEB A;  4PUR A;  3FR9 A;  2H01 A;  2H1B A;  1VF2 A;  1HQO A;  2FWE A;  2O7K A;  2H70 A;  2V6K A;  2F9S A;  2GZZ A;  3ME7 A;  4NWY A;  2EIR A;  1WRY A;  4Z2T A;  4EC0 A;  4BA7 A;  3KZQ A;  5DJM A;  2CAI A;  3UIW A;  3FHK A;  2QA2 A;  4LMW A;  2H75 A;  3TKS C;  1LJR A;  2FY6 A;  1U3I A;  4RI6 A;  1F3B A;  1X9W B;  1NHO A;  4D73 B;  5J4U A;  1PL1 A;  2MYG A;  3H79 A;  4I2U A;  1FOV A;  1AQX A;  3GL5 A;  2DJ0 A;  1T4Z A;  4YAV A;  5IM9 A;  2H72 A;  3FZ9 A;  1EP8 A;  3IC4 A;  2VCT A;  3ZVJ A;  5DDL A;  4PQI A;  2IMI A;  3H1N A;  4K8M A;  1K3O A;  2B5Y A;  9GSS A;  3DVW A;  1DE2 A;  1ST9 A;  4O5Q A;  2R3X A;  2F8F A;  3DD3 A;  3L9S A;  2H73 A;  2Z9S A;  4Q5Q A;  2L6C A;  4JED A;  3QD9 A;  4POK A;  4F82 A;  3ERW A;  2PVO C;  4KX4 A;  4GSS A;  5J9B A;  1ERU A;  1RW1 A;  4K7O A;  3KJY A;  2GDR A;  2LJR A;  4L5L A;  5G30 A;  4KCE A;  1G7E A;  4MF6 A;  3G7Y A;  1EGR A;  4MF5 A;  1HYU A;  3ZZX A;  1ERW A;  3APQ A;  3EUR A;  3CYN A;  4IJ3 A;  4IS0 A;  5IMD A;  2MMO A;  2YZU A;  4MJC A;  3E3E A;  4WBR D;  5ECQ B;  1O73 A;  1M9B A;  1SKW B;  2A2S A;  4G2E A;  3M0F A;  1FW1 A;  4NHW A;  5LNK e;  3KIJ A;  2H1A A;  1EP7 A;  2XBQ A;  4EIQ A;  4EUY A;  1MDK A;  5J5N A;  4KA0 A;  3F6F A;  3VPQ A;  4JZQ A;  4ILF A;  2QA1 A;  6GSV A;  2VCW A;  4FYU A;  2K8S A;  2H0H A;  2GTU A;  3GUR A;  2JU5 A;  3C73 A;  2C3Q A;  12GS A;  1DBY A;  3VI5 A;  2IFQ B;  1X5C A;  5ECS A;  4E8H A;  3LOR A;  3PIN A;  2I3Y A;  5G5E A;  2MMN A;  1ZGN A;  2WDU A;  1GUM A;  5EVO A;  3HJP A;  3H93 A;  2C4J A;  2GLR A;  3FEU A;  3VK9 A;  4TKY A;  3F0I A;  5CO3 A;  1K3Y A;  4MMM A;  5DCG A;  1MDJ A;  5JCW A;  3TJJ A;  1GTU A;  1XWG A;  3JCM L;  3LSZ A;  3LYK A;  3A2V A;  3FKF A;  1FB0 A;  1QFN A;  2H71 A;  1UC7 A;  3MDK A;  1WWJ A;  4NPB A;  2R0P A;  4POM A;  1JZO A;  1TK5 B;  4PNF A;  4Q5F A;  1TP9 A;  1A8L A;  1MDI A;  3KM6 A;  4MH3 A;  1MTC A;  2VLT A;  3UBL A;  2HXK A;  3GX8 A;  2C80 A;  4ZIL A;  1W4V A;  4XHM A;  2DBC A;  3LGC A;  3ERG A;  4HOJ A;  4F03 A;  5IQY A;  2K18 A;  3CRT A;  1T8E B;  4ECB A;  5A4W A;  5J3R A;  3FZ5 A;  2GSS A;  5ECR B;  2G2Q A;  3EIN A;  3QR6 A;  4JR6 A;  2VIM A;  4LL4 B;  2FWF A;  2ZUP A;  1THX A;  3D21 A;  3W8J A;  1W89 A;  4MH2 A;  3KP8 A;  2ZNM A;  3DML A;  4IBP A;  3BBY A;  3FZA A;  1ML6 A;  4MF7 A;  3MWH A;  1GSF A;  3GA4 A;  2K8V A;  5B6N A;  3UOM A;  3ZML A;  1YEX A;  1OC3 A;  5AIV A;  1K0O A;  1O6J A;  5E59 A;  1XCC A;  1QMV A;  4JU5 A;  5IMC A;  3R3E A;  4HJM A;  3TDG A;  1BG5 A;  1FHE A;  5F07 A;  4QL7 A;  4EKZ A;  2OBI A;  2FA8 A;  1SJZ A;  3UL3 A;  3LW9 A;  1M0U A;  1OYJ A;  4PUA A;  5ABR A;  3HCZ A;  3FR3 A;  2C0F A;  3FRC A;  3EMX A;  4HQZ A;  2VM1 A;  3GH9 A;  2CX4 A;  4YH2 A;  1USB A;  4PNG A;  2NVL A;  2QSI A;  4DSS A;  3A3T A;  4IJI A;  1NW2 A;  2RM5 A;  1TJD A;  1GRX A;  3ZMK A;  5IO2 A;  1TRW A;  1XWB A;  2OE3 A;  4K7I A;  4V2N A;  1MEK A;  1M2B A;  1TU8 A;  1XWA A;  3QDN A;  4KB3 A;  3HA9 A;  4FQU A;  1PKZ A;  2VCZ A;  2R0G A;  2I81 A;  2LUS A;  2IY2 A;  5IMZ A;  5C04 A;  3A2X A;  2RLI A;  4BVY A;  2YAN A;  2C0D A;  4HUA A;  2CZ2 A;  2DJ3 A;  2HRF A;  1EEM A;  1K0M A;  3VPT A;  3IE3 A;  5ECM B;  3MSZ A;  3GV1 A;  4L0W A;  2XPD A;  2H6Y A;  3E0U A;  4O92 A;  1DE1 A;  4ML6 A;  4RUV A;  4AJ8 A;  4ECJ A;  2C0G A;  1CQG A;  3HD5 A;  4WET A;  3GH6 A;  3MYD A;  4OCE A;  1M2D A;  2C8U A;  4OWY A;  1V58 A;  1YDK A;  1TDI A;  3TKR A;  4N0Z A;  1G0T A;  4Z7X A;  5AIS A;  2B7J A;  2NBS A;  4TVE A;  4K0G A;  6GSY A;  2X64 A;  1JZR A;  4NMU A;  1DSB A;  1AAZ A;  2FCH A;  3G7J A;  4KE3 A;  4F2I A;  2JSY A;  3CTF A;  3VLN A;  1SK0 A;  2P5Q A;  5JCG A;  3TKQ A;  1SL0 B;  5JCU A;  1YF0 A;  3KCM A;  5DAL B;  3TB2 A;  4GSN A;  4AF2 A;  3IC8 A;  3KXO A;  3KMO A;  3NZN A;  4NV5 A;  4ZB9 A;  4Z2R A;  2C3N A;  3QAV A;  4ACS A;  5CP1 A;  1XVW A;  2FWG A;  1WPI A;  2EIQ A;  3RBT A;  3VUR A;  2VL9 A;  4TR0 A;  4IQ1 A;  6GST A;  4OFT A;  1ZCP A;  4YQM A;  3F4T A;  1YKA A;  2LNS A;  2QKE A;  2X49 A;  2REM A;  3K8N A;  3Q6O A;  2DMM A;  3FK8 A;  2HRK A;  3FY7 A;  2OAC A;  4AJ6 A;  1TI3 A;  2GQL A;  4KDY A;  3KTB A;  1K0N A;  3TUE A;  2IN3 A;  2YWN A;  3L9U A;  5EPF A;  3O6T A;  2CV4 A;  3Q19 A;  1I5G A;  3NOF A;  5ECH B;  2RII A;  1SK1 A;  3HVV A;  3ZIJ A;  5CNW A;  4D73 A;  3ZFB A;  2R6K A;  3A2W A;  4KH7 A;  1YZX A;  2VOC A;  4A5P A;  1QUW A;  3QFB C;  2PWJ A;  2R4V A;  5A5K A;  2H76 A;  2IMK A;  1J0F A;  2R0C A;  3EWL A;  3VFI A;  5KN3 A;  4FYC A;  4GQF A;  4KCA A;  1OE7 A;  3R2Q A;  2N5B A;  4ECI A;  1JZW A;  2KLX A;  4XRD A;  1XZO A;  1BQ7 A;  2AUV A;  3SWL A;  2CQ9 A;  3UEM A;  14GS A;  4F0C A;  4V2M A;  1GUK A;  2VD1 A;  2DJ2 A;  3F4S A;  3U6V A;  4CY6 A;  4WR5 A;  4HQS A;  5ELA A;  3UVH A;  1S3D A;  1UA5 A;  5AN1 A;  2IYJ A;  4O5R A;  1X0R A;  4YAP A;  3VWW A;  1PX7 A;  2VD0 A;  2LST A;  19GS A;  1XFL A;  1VF3 A;  1FG4 A;  3I43 A;  5G31 A;  4EVM A;  3QAW A;  6GSU A;  3M1G A;  1F9M A;  2G0F A;  4MZW A;  4RQR A;  4DVC A;  4ZB8 A;  2LJK A;  2AYT A;  3M9J A;  2LRC A;  5CRD A;  2B5E A;  5ECN B;  2HZE B;  3TKS E;  2X8G A;  2KP2 A;  3IHQ A;  1B9X C;  2WB9 A;  2GT6 A;  1WJK A;  1YF1 A;  2HNL A;  5GSS A;  4TOP A;  1SKR B;  1MD4 A;  1GWC A;  1OAZ A;  3O76 A;  3KGK A;  3GX0 A;  3P2A A;  3M3M A;  2P5R A;  5EY6 A;  1SYR A;  2JAD A;  2P0G A;  3TRX A;  5KN0 A;  2FHE A;  2C1Y A;  2BJX A;  2JZR A;  3D22 A;  3IOS A;  3TJB A;  4MAB A;  2I1U A;  4MZC A;  3ZL5 A;  1SD8 A;  4TR1 B;  4YKG A;  3CXG A;  1FOH A;  2IFQ A;  4XS6 A;  1V2A A;  4K5S A;  4BL7 B;  3WD6 A;  5HFI A;  2H6Z A;  2L4Q A;  2HE3 A;  4OD7 A;  3CBU A;  3FZ4 A;  4KUN A;  4TN8 A;  1TK8 B;  1GL8 A;  4ZBB A;  4L8E A;  1OVN A;  5F0G A;  3CSI A;  4IQA A;  3GTU B;  1ZYE A;  2QGV A;  3D6I A;  4ZBD A;  2OJL A;  4IGJ A;  1SYX A;  4DSR A;  1URM A;  4HZ2 A;  4POB A;  3RHB A;  5HR2 A;  1XBS A;  3TJK A;  5COH A;  3F63 A;  3P7X A;  3C7M A;  4EDZ A;  2X8H A;  1O7U A;  3VI7 A;  3GKX A;  1S3A A;  16GS A;  2JSZ A;  3GIX A;  2OE1 A;  2PBJ A;  4MA9 A;  5KEJ A;  3D5J A;  4WF5 A;  3V1W A;  4PTS A;  3BOA A;  3TGZ A;  1IYH A;  4IKH A;  3GNJ A;  3GKK A;  4V2L A;  5IMF A;  1R4W A;  1V98 A;  4ML1 A;  3RHC A;  3LYP A;  4N0V A;  4PXO A;  3TJG A;  3E9J B;  1B8X A;  4ZXG A;  4JRR A;  1M99 A;  2ES7 A;  1Q4J A;  2VCX A;  1R5P A;  2WRT A;  1G6W A;  3LQ7 A;  3F8U A;  1IYI A;  4PQH A;  3L0H A;  4BWS A;  2M72 A;  5B8A A;  3FR6 A;  5IMA A;  1G7O A;  1GSE A;  1Z7R A;  5CYY A;  4USS A;  2NPB A;  4ZL8 A;  1VF4 A;  5IMV A;  4KW6 A;  2VL2 A;  3DXB A;  3D4T A;  2AV4 A;  5F8B A;  3GUS A;  1QQ2 A;  2X8C A;  2HI7 A;  2FLS A;  3GKN A;  5D93 A;  2XHF A;  2L5L A;  2PUK C;  1OC9 B;  1GUH A;  2I4A A;  1VF1 A;  3PGT A;  5D9T A;  4CY8 A;  5ECP B;  5KOX A;  4K5R A;  2HSH A;  2V32 A;  5KOW A;  3LXZ A;  1X5D A;  4LMV A;  5IIZ A;  1YQ1 A;  1T3B A;  2VCQ A;  3ZYW A;  3RPN A;  1TI1 A;  5F05 A;  3ZRE A;  4ID0 A;  3QPM A;  5DVB A;  3IAS 2;  3IAM 2;  5ECI B;  2IMD A;  4J56 E;  3PH9 A;  4F9Z A;  1TK0 B;  1H75 A;  2A2P A;  2R2J A;  4IHU A;  1TW9 A;  1SEN A;  4TXV A;  1FO5 A;  4EXJ A;  3IK9 A;  3HZ8 A;  2LNT A;  4K6X A;  2YWI A;  3A5I A;  3DRN A;  3RDW A;  1XW9 A;  2WJU A;  2GQM A;  2VLV A;  4MJE A;  3HJO A;  4K2D A;  4KSO A;  1T1V A;  3QCP A;  1VGL A;  4WXT A;  3WGE A;  3MNG A;  2L6D A;  3P8W A;  2XPE A;  5J9C A;  2YOI A;  3IRA A;  1AQW A;  5CRE A;  2MMA A;  1NHY A;  4ECC A;  2C0E A;  5B6M A;  4NV2 A;  1K3L A;  1UVZ A;  2QC7 A;  4OFN A;  1SD9 A;  3OR5 A;  2JL4 A;  2XC2 A;  2HFD A;  1E6B A;  1X5E A;  2CAQ A;  1ZMA A;  2V41 A;  2RM6 A;  5DAK B;  1S3C A;  3GN3 A;  3ED3 A;  3KH7 A;  5D8I A;  1EWX A;  3TRQ A;  3DGQ A;  3LEF A;  2AAW A;  4YQU A;  3EU3 A;  4IP1 A;  5ECL B;  1K0D A;  2E7P A;  2A4H A;  3UMA A;  5BMU A;  5DAL A;  5IO0 A;  2CT6 A;  2FA4 A;  1QGV A;  5HR3 A;  2DLX A;  1LU4 A;  1PQN A;  3O3T A;  2O8V B;  1R7H A;  1ACV A;  3C1S A;  2LRN A;  3DVX A;  3HHV A;  4J2F A;  4Q5N A;  1BYE A;  3ERF A;  3M9K A;  3N9J A;  1PN9 A;  2YWO A;  5H5R A;  4ZBA A;  3L78 A;  1M9A A;  2DC5 A;  5KN2 A;  2CVB A;  1U88 A;  3C1R A;  2H6X A;  3GYK A;  5DJL A;  4LA1 A;  1OE8 A;  2H8L A;  1KTE A;  1ON4 A;  3DWV A;  4OO5 A;  3CTG A;  1PA3 A;  2GS3 A;  2DIY A;  2EIO A;  4L5O A;  4HS1 A;  1WP0 A;  1GUL A;  2IJY A;  4G0K A;  4GCI A;  3Q74 A;  2ALB A;  1K0B A;  2DML A;  3F6D A;  1FVK A;  5B8B A;  1WOU A;  1K0A A;  3CSJ A;  1JHB A;  3GRX A;  18GS A;  1B4P A;  4GXZ A;  1E2Y A;  2LJA A;  1U3A A;  3IXR A;  3DEX A;  2L59 A;  3EVI A;  3G7I A;  1ILO A;  5G2Z A;  5HFG A;  1A2M A;  3EC3 A;  4CW9 A;  6GSS A;  3ZIT A;  4O5U A;  4N11 A;  1N8J A;  1U6T A;  2OAD A;  1JLW A;  2E2G A;  2PU9 C;  1GH2 A;  4Z2U A;  4EE0 A;  2YN1 A;  1M7T A;  1GSS A;  3C8E A;  4ZB6 A;  4I97 A;  2ON5 A;  4POL A;  2PGT A;  4XS4 B;  2DKI A;  2CA8 A;  1EGO A;  4OO4 A;  1U87 A;  2FNO A;  4CDO A;  3LG6 A;  3AY8 A;  2ZCT A;  4XIH A;  1B9Y C;  1FVJ A;  4RI7 A;  1OKD A;  4WKW A;  1T7P B;  2H74 A;  2MBT A;  2A4V A;  4MJA A;  3WT1 A;  2HZE A;  3BCI A;  5L71 A;  2VM2 A;  4X43 A;  3ZFL A;  4JR4 A;  4K7N A;  5CRH A;  4QL9 A;  4IVF A;  4KSM A;  3HVS A;  2VCV A;  2YP6 A;  5HR1 A;  4GWR A;  4BVX A;  3ME8 A;  2F51 A;  3LWA A;  10GS A;  3DIE A;  4GST A;  2IME A;  3QAG A;  4TXO B;  5JWR B;  2AJQ B;  3WYW A;  5INY A;  2HRA A;  5DQS A;  4EL1 A;  2GSQ A;  2HT9 A;  3RAZ A;  5IPH A;  1TTZ A;  2YJ7 A;  2KUC A;  1GSD A;  4TR1 A;  4LLR A;  4G9H A;  2MMZ A;  3U5R E;  3WGX A;  2DIZ A;  4O32 A;  2C3T A;  4BL7 A;  1RQM A;  3MAK A;  3RPP A;  5DQY A;  2LQO A;  1ERV A;  1BED A;  2L5O A;  3HXS A;  4K2X A;  2BMX A;  4OMV A;  1OC8 A;  2O85 A;  1GSQ A;  1KEB A;  4ZIJ A;  1XPV A;  2TRX A;  1V9W A;  2L57 A;  4X4J A;  2GST A;  4DSQ A;  4KDX A;  3GTU A;  2DSA A;  1HD2 A;  4N10 A;  4GRF A;  1MD3 A;  5GZZ B;  3HY2 A;  4HZ4 A;  2L4C A;  4RQX A;  1SL2 B;  4MPF A;  1A2L A;  4GF0 A;  2GZY A;  3HZ4 A;  4IN0 A;  4XCS A;  3GL3 A;  1AUC A;  1F37 A;  3VWU A;  5D9W A;  3H4K A;  2H1D A;  4YKF A;  5FWG A;  1WMJ A;  3TKP A;  5HR0 A;  2FWH A;  4BWQ A;  3Q18 A;  3UBK A;  3TKS A;  2M46 A;  2P31 A;  2DKH A;  1V57 A;  4I2T A;  1HNC A;  2H0I A;  3VWX A;  1T00 A;  4MPG A;  3CRU A;  1FB6 A;  4HEA 2;  2HYX A;  4JE1 A;  4PX1 A;  5EL8 A;  3J7Y b;  4ICY A;  1ABA A;  4TW5 A;  1TKD B;  2JAC A;  4BVX B;  2WCI A;  5F06 A;  3F3Q A;  2AHE A;  2GSR A;  4O7H A;  2RUF A;  4LL1 B;  1Y6E A;  3EPT A;  1G6Y A;  4PUF C;  2YNX A;  3GST A;  1EOH A;  4MNN A;  2JZT A;  1Z6N A;  5G1L A;  3S9F A;  1PRX A;  1PD2 1;  1XWC A;  3BJ5 A;  3IHG A;  5FT3 A;  3DKS A;  1ZOF A;  4H86 A;  5G1K A;  2HRN A;  1BJX A;  1ERT A;  2VAF A;  3EYT A;  3QOU A;  5IOX A;  1SKS B;  4KGI A;  3LFL A;  1OC9 A;  5ECK B;  5D9V A;  22GS A;  2V2G A;  4V1A g;  4OCF A;  2N5F A;  2H0G A;  1O81 A;  1EOG A;  1XOA A;  1HNB A;  3P90 A;  1DUG A;  1XXU A;  3APS A;  2X99 A;  2GQK A;  4MZB A;  2WS2 A;  4ISD A;  3HYP A;  5ID2 B;  2VO4 A;  2DJK A;  2LQQ A;  1JFU A;  1RK4 A;  1GNW A;  2IPA A;  2A2R A;  1VRS D;  1TRV A;  2YCD A;  5D73 A;  4TRX A;  5CRG A;  3F4R A;  2F3M A;  1EEJ A;  5DBQ A;  5ECO B;  3TJF A;  7GSS A;  2VUP A;  1A0F A;  3KD0 A;  1XW5 A;  3KTL A;  1HNA A;  5H5S A;  4HU9 A;  1Q98 A;  1UN2 A;  2O87 A;  4KND A;  3EU4 A;  2E0Q A;  2R5G A;  3HDC A;  4I8B A;  3UJ1 A;  2PN8 A;  5C00 A;  3WGD A;  5AIX A;  2OBK A;  1R26 A;  3FYG A;  5AGY A;  5A4U A;  3LXT A;  1SJI A;  2PPT A;  4F0B A;  1KBN A;  1N2A A;  3L4N A;  1PSQ A;  1A24 A;  4I5Q A;  2N5A A;  3ZLP A;  4GTU A;  5J41 A;  3BCK A;  3J7Y k;  1XWK A;  2YV9 A;  1BX9 A;  3HVX A;  4MP4 A;  1ZYQ B;  5DAK A;  2H30 A;  2NTO A;  2ON7 A;  3IV4 A;  4XRA A;  2V6O A;  11GS A;  2FGX A;  1LBK A;  1K0C A;  1YY7 A;  3IK7 A;  2CX3 A;  3KMN A;  3ZVJ D;  5JWO B;  1PX6 A;  2B7K A;  4IP6 A;  3M8N A;  4OFM A;  2WZ9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...