2H0YA

Crystal structure of the m69v e166a double mutant of shv-1 b-lactamase complexed to sulbactam
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
265
structure length
265
Chain Sequence
SPQPLEQIKLSESQLSGRVGMIEMDLASGRTLTAWRADERFPMVSTFKVVLCGAVLARVDAGDEQLERKIHYRQQDLVDYSPVSEKHLADGMTVGELCAAAITMSDNSAANLLLATVGGPAGLTAFLRQIGDNVTRLDRWATELNEALPGDARDTTTPASMAATLRKLLTSQRLSARSQRQLLQWMVDDRVAGPLIRSVLPAGWFIADKTGAGERGARGIVALLGPNNKAERIVVIYLRDTPASMAERNQQIAGIGAALIEHWQR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Beta-lactamase SHV-1
publication title Effect of the inhibitor-resistant M69V substitution on the structures and populations of trans-enamine beta-lactamase intermediates.
pubmed doi rcsb
source organism Klebsiella pneumoniae
molecule tags Hydrolase
total genus 99
structure length 265
sequence length 265
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2006-05-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13354 Beta-lactamase2 Beta-lactamase enzyme family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 2h0yA00
2P9VB 1EROA 3PBRA 4HESA 3RJUA 3MZFA 4HEFA 3V50A 3NY4A 2IWBA 4DKIA 1JWVA 2Q9MA 5DVAA 5FQQA 3WWXA 4Z9QA 2XF3A 2J8YA 4DF6A 3Q7ZA 2XDMA 5CHMA 4MBFA 3FYZA 4KQQA 1XA1A 3N8LA 4OVDA 1K55C 3Q7VB 5DTSA 4NK3A 4BD1A 3SH7A 5DF8A 5HAPA 5CXWA 3QHYA 1KE3A 4X6TA 4DRTA 2ZQCA 3V39A 4QY5A 2FFFB 4P0MA 4MLLA 5CECA 3NBLA 4LCMA 3PBQA 1NZUA 2RCXA 4OLGA 2PBYA 5GLBA 3O86A 5EVID 1XKZA 2EFXA 2P9VA 2XK1A 2OLVA 1W8YA 3BFDA 1MY8A 3FKWA 4GZBA 3ZNTA 1PW8A 3DWKA 4KZ9A 1DJAA 5F1FA 5CERA 3UE3A 1L0FA 4E3NA 1ONGA 4C75A 3Q7VA 1XGIA 4QY6A 2VGJA 1N4OA 2WKHA 3ZHHA 5DF7A 3ZVWA 4WELA 3HLCA 5M1AA 1NY0A 5FDHA 3IH9A 3VP0A 1IKGA 1SDNA 5TGFA 5HL1A 1K38A 2E8IA 3W8KA 1FCNA 3GSGA 3OPPA 1RGZA 1HZOA 4Y0OA 5GLAA 2Y2MA 1LL9A 3PBNA 4RX3A 2HDSA 3CG5A 4DXCA 1ES4A 2ZC6B 1IKIA 4PM8A 4P87A 1KGEA 5M19A 3A3JA 1ESUA 2Y2LA 4CPKA 2WAEA 2Y2GA 3IQAA 1S0WA 5EVIC 2X01A 5A90A 1Q2QA 2J9PA 5EECA 3HUOA 1K54C 4FH2A 5E2EA 4XXRA 4R3JA 1NJ4A 5A92A 1FQGA 4S2NA 5AQ9A 1SKFA 4BD0A 4EBPA 3WRZA 2ZM2A 3IXHA 2WGIA 1IYPA 1JTDA 1ERMA 2EX2A 2HDUA 2JE5A 2Y2HA 4RVAA 3GQZA 1JWZA 3IH8A 5HARA 4QHCA 4DE3A 4UA7A 4M3KA 3IHAA 2ZD8A 5FI7A 4L0LA 4LENA 2A3UA 4Y0TA 3VMAA 4O7DA 3AGEA 4IVKA 5AQAA 3UDFA 1FR6A 3VOYA 3HREA 1L0EA 1PWCA 1CEGA 1XGJA 1YLPA 4K0XA 4LV3A 1YLWA 3V3SA 1O7EA 5I94A 5KSCA 1H5XA 3A3FA 2C5WB 2Q9NA 2XFSA 2ZC5B 3HLDA 4FD8A 2WYXA 1SDEA 5FAPA 4UAAA 1W7FA 1YLJA 3ZG5A 5EVLA 3BYDA 1K55A 1KE4A 5FQJA 3A3EA 5GHZA 3FV7A 4S2JA 4Y0UA 3HLWA 2EX9A 4DDYA 1GHPA 3Q1FA 2XFTA 1RP5A 2EX8A 4S2NC 5FQKA 5AQBA 3BFGA 4IBRA 3BM6A 1G6AA 3PBOA 5E2FA 4E3OA 4B4ZA 3Q82A 2Y2NA 2XQZA 3LY3A 3M6BA 4DXBA 4PM9A 4ZJ3A 1E4DA 5F82A 2H5SA 4R3BA 3A3IA 5JYOA 4GD8A 3JYIA 3HL9A 1BULA 1KVMA 2QZ6A 3OPHA 4KZ4A 4LCLA 5EVIB 5FI2A 4KZAA 3ZG8B 3BRMA 4BL2A 3MXRA 1NZOA 5JYPA 4MBKA 3ZG0A 5GL9A 3OCNA 4HBTA 5TFQA 1DY6A 2V2FF 2OV5A 2J7VA 1PZOA 4X53A 5A91A 1Z6FA 5D3OA 3VP3A 4OOMA 2ZQ9A 3I7JA 5BOHA 2ZC7A 1IELA 5FQIA 3IHBA 3WS5A 2WZXA 5HX9A 1K56D 3PTEA 3S1YA 4F94A 2ZC4B 4WZ5C 2Y2QA 3HLGA 5A93A 5GHXA 3ZDJA 4KZ7A 1NXYA 4OH0A 4U0XA 3ZG9B 3M2KA 4OPRA 4YFMA 4JXSA 1G68A 1LI0A 4NETA 3UE1A 1JWPA 3S4XA 3UPNA 1BLSA 1W79A 1PW1A 5EVIA 4H8RA 4WEKA 4EBLA 1Q2PA 3MFDA 1K54A 4YINA 3VP2A 3TSGA 4IVIA 4KZ8A 5J8XA 4OKPA 2JBFA 4QJGA 4XUZA 2ZM0A 1K4EA 3UPPA 3C4PA 3UY6A 5CEDA 1EWZA 5HFOA 5CGSA 3C7VA 5KSHA 2H0YA 3AGDA 3N8RA 2HP9A 4PMAA 2OSUA 4OQ0A 4U3TA 5TR7A 4X68A 1E3UD 4KG6A 1FCOA 4MEZA 4JF5A 5CEBA 4N9LA 3D4FA 4PM5A 1LHYA 1PWDA 4JXGA 5E43A 5EUAA 1IYQA 3WS4A 3G2ZA 5HAIA 3BEBA 4JLFA 4JF6A 4OPYA 4LV1A 3N4IA 1WE4A 3SH8A 3O87A 4JKTA 4R4SA 4EUZA 1C3BA 3IWIA 1BLHA 3GV9A 3NCKA 3VOZA 3W4OA 1L0DA 1DJCA 3O88A 3PAEA 4K0WA 5CHJA 1ALQA 3MKEA 5GLCA 1K6RA 3ISGA 4HBUA 1NYYA 2Y2JA 1KGFA 2IWCA 2ZC3B 3GMWA 4X55A 4E3IA 1YQSA 3PBSA 4KQRA 2PU2A 3V3RA 3HBRA 1BT5A 4ZDXA 4KZ3A 5EOEA 2C6WB 3HUMA 4KZ6A 1ESIA 4BENA 3S22A 4BQMA 4QB8A 2WK0A 1I2WA 2XGNA 4WBGA 2VGKA 4UA6A 4EBNA 3IF6C 5KMWA 1PI5A 4U0TA 1QMFA 2XLNA 3Q07A 5G18A 3WS0A 4Y7PA 4KZ5A 3ITBA 1KDWA 4N9KA 2ZQ8A 4GN2A 2Y2PA 3LO7A 5EPHA 3HLBA 4WEJA 5CRFA 1W8QA 2QPNA 3LEZA 1BZAA 2WAFA 4ZTKA 5EOOA 5DF9A 1PYYA 1YMXA 3DWZA 4ZBEA 1JVJA 1PIOA 4PM7A 1VM1A 1S6RA 4BL3A 3G30A 4E3JA 1K25A 1MWUA 1CI8A 5CGWA 2I72A 4MBHA 1XA7A 2A49A 3P98A 3BECA 4S2KA 4FSFA 4S2PA 4WZ5A 5FI6A 1ES3A 4JPMA 1K6SA 1GA9A 4JF4A 1I5QA 1MPLA 1U60A 2V20A 4OOLA 1CI9A 1M40A 4C6YA 5M18A 4E6WA 3NC8A 5CTMA 2DCFA 3G35A 3UE0A 4QD4A 3BFFA 1CK3A 4XUXA 3UDXA 4EQIA 2ZLYA 3UO9A 3E2LA 3WS1A 3FZCA 3VP1A 2PU4A 2R9XA 3ZFZA 4EV4A 4LV2A 2BG1A 2ZJ9A 3GTCA 3UNWA 2H0TA 4LV0A 1JTGA 3IXDA 2WGWB 3AGFA 5HW3A 3EQVA 3ZNYA 3C4OA 4Q8IA 4KG5A 1GHMA 4C3QA 3IXGA 1GA0A 1HVBA 1GCEA 2XH9A 4KG2A 3VSKA 4B88A 1XX2A 2GDNA 4ZAMA 1LL5A 4S2OA 4E6XA 1ZG4A 4OQIA 2HP6A 2X71A 5DTKA 3SS5A 1K56A 4OQHA 1ES2A 4K91A 2WKEA 3RXWA 1MKIA 3G4PA 2DRWA 1FCMA 3CJMA 3FKVA 4GD6A 2OLUA 4RX2A 3IF6B 1K57C 4S2IA 5GLDA 2XEPA 3G31A 1J9MA 3IWOA 4N1HA 1BLCA 2P74A 3FWLA 3GVBA 3C7UA 5FSRA 4OQGA 3TG9A 3O3VA 3CZDA 4OONA 3MXSA 3M2JA 1ZG6A 3B3XA 1XP4A 2WGWA 2G2WA 2DNSA 1NYMA 2XD1A 3M6HA 3IXBA 4JXVA 3SS3A 1KDSA 3LY4A 1AXBA 1BSGA 1YM1A 1SHVA 3OCLA 2Y59A 4IEDA 1OMEA 3SH9A 1PWGA 1HTZA 3N6IA 4GDNA 4S2MA 4R23A 1GHIA 3ZGAB 4P85A 2H10A 3NDGA 1WYBA 1XXMA 2ZQAA 3MKFA 3MZEA 1FSWA 1E3UA 1MXOA 3W4PA 4E3LA 1CEFA 3BFCA 3MBZA 5FQ9A 3BFEA 1YLZA 3EQUA 4KZBA 1KGGA 3IF6A 4B4XA 3IF5A 2ZMAA 3CMZA 4GDBA 4R4RA 3VFHA 1W5DA 3OPLA 3VP4A 4E3KA 1H8ZA 1MWSA 4OP5A 3WRTA 4BLMA 1FSYA 4E3MA 3SS4A 3ZCZA 2CC1A 1IYSA 1H8YA 1QMEA 2BLSA 3P09A 5FA7A 2Y2KA 4A5RA 1RCJA 3GRJA 3A3DA 3IT9A 1WYCA 4UHUA 3UDIA 5FASA 1PI4A 1Y54A 5EE8A 1YT4A 2HDRA 4RYEA 4ZJ1A 1TDGA 3NIAA 5F83A 1BLPA 4MNRA 1IEMA 1YLTA 4GB7A 3DTMA 2RL3A 5DTTA 1PZPA 1SCWA 5E2HA 2ZM8A 5F1GA 5U47A 1FR1A 3DW0A 3VFFA 5FATA 4P6BA 3ZG7B 5KZHA 1E25A 1DJBA 2Y2OA 3RXXA 3G32A 4WM9A 4WMCD 4WMCA 3HUNA 3QNCA 5AQ7A 4DE0A 1EI5A 4JXWA 1M6KA 5FQMA 4DE2A 4GKUA 3PAGA 4DDSA 4UA9A 3PBTA 2WZZA 1ONHA 4N1XA 4X56A 5CGXA 2JCHA 3ITAA 4ZJ2A 1ES5A 2WGVA 5FAQA 3GR2A 3G34A 4OP8A 2Y4AA 1TEMA 4OLDA 3SOIA 3BLMA 1N9BA 2JC7A 3NI9A 4RA7A 3HVFA 1BTLA 1YMSA 5IHVA 1BUEA 1ERQA 1I2SA 4OOYA 2ZQDA 4EWFA 2QMIA 3NDEA 4R1GA 1TVFA 4FH4A 2Z2MB 5GHYA 4BJPA 1NRFA 3G2YA 4S2LA 1MWTA 2J9OA 4PPRA 3UN7A 4FCFA 4PM6A 2G2UA 4CJNA 4ID4A 3W4QA 1ZKJA 2HDQA 1K57A 2HPBA 2IWDA 1ZC2A 4KQOA 3OC2A 4GOGA 2X02A 4WYYA 4IBXA 4R0QA 3HLEA 3UPOA 1L2SA 2EFUA 3E2KA 3N8SA 2Z2LB 3OPRA 1KE0A 2EXAA 2WKIA 3TOIA 3WS2A 5L2FA 1MWRA 1HD8A 2WUQA 2WADA 2XR0A 2R9WA 2XD5A 2ZQ7A 3BLSA 3IWQA 3ZVTA 4D2OA 4WZ4A 2B5RA 4N92A 1L0GA 4QU3A 5E2GA 1VQQA 2V1ZA 2Y2IA 4KENB 2Y91A 4JBFA 2EX6A 5CTNA 1XPBA 3V5MA 1IYOA 3N7WA 3OZHA 3VSLA 3MZDA 3Q81A 1KVLA 1LI9A 1MBLA 4OPZA 3HLFA 2HP5A 1O07A 2EXBA 1K4FA 1TDLA 4OPQA 5CHUA 1RGYA 1YLYA 5HAQA 4DE1A 1LLBA 3C5AA 2FFYA 1FOFA 4X69A 2UWXA 3LCEA 3QNBA 5FAOA 2Y55A 4GNUA
chains in the Genus database with same CATH superfamily
2PR6A 3JVVA 1EROA 3PBRA 4DKIA 3V50A 4HEFA 3Q7ZA 5FL3A 3UB9A 2OAP1 4OVDA 1XA1A 3N8LA 2VLGA 5DTSA 4HP4A 2EA9A 2IA2A 4BD1A 4E04A 2MJ6A 4X6TA 1KE3A 3BW6A 2ZQCA 4P0MA 4MLLA 3PBQA 1UGUA 3LR3A 3ZNTA 1PW8A 3B47A 1DJAA 5CERA 3UE3A 4E3NA 2VV8A 4ME4A 1ONGA 1LSVA 1XGIA 4QY6A 1N4OA 4WELA 1SDNA 1K38A 2E8IA 1FCNA 3GSGA 5FEFA 3D3OA 2Y2MA 3MS6A 2HZ5A 3CG5A 2Y2LA 2JKGA 4DJ3A 2WAEA 3IQAA 2X01A 5A90A 2WKQA 4I5SA 1NJ4A 5I5LA 4S2NA 5L07A 1VETA 3IXHA 2HDUA 3IH8A 5FI7A 4L0LA 5HL6A 3T4SA 3VMAA 4FUWA 5AQAA 2W0NA 1VEUB 2ZOIA 1PWCA 1CEGA 5J7EA 4LV3A 1YLWA 1O7EA 5KSCA 3JPUA 2Q9NA 4FD8A 2WYXA 1SDEA 2FZ0A 2XROA 4I3JA 3ZG5A 1K55A 2B18A 3ZYTA 4Y0UA 2EX9A 3R7WA 2XFTA 1RP5A 5FQKA 3KSFA 3BM6A 3PBOA 5E2FA 5F6AA 2JN7A 3Q82A 2CMNA 3LY3A 3DBAA 1E4DA 1TF1A 4B93A 4GD8A 3JYIA 4KZ4A 3OPHA 4GHIA 4BL2A 3MXRA 3UB8A 4L9FA 3E4OA 2JHEA 1DY6A 2J3TC 1PZOA 1Z6FA 3VP3A 3I7JA 1IELA 4F94A 3C30A 2VZWA 4U0XA 2M7UA 5L10A 4I3AA 3PYPA 4OPRA 4YFMA 4IUHA 3T1XA 3MQ0A 1G68A 4NETA 4Z1WA 3IX3A 4YINA 3VP2A 4OKPA 4XUZA 1SZVA 3UY6A 5CEDA 2BTFP 3QP1A 3N8RA 2HP9A 4U3TA 4XT2A 3V67A 4MEZA 5CEBA 3DTKA 3D4FA 1LHYA 4WL9A 4JXGA 2ZL1B 3WS4A 4ETZA 4EUZA 1C3BA 3GV9A 4R6LA 3FPWA 5CHJA 1P97A 2OWJA 2ZMVA 3MKEA 3MQOA 5TBMB 1NYYA 1KGFA 3PR6A 1G28A 1AWIA 2C6WB 2K2NA 4KZ6A 1ESIA 3S22A 2HV1A 4QB8A 5C5KA 3QP5A 5IU1A 3KX0X 5KMWA 4UA6A 3IF6C 5G4ZA 2XLNA 4Y13A 3Q07A 5G18A 4Y7PA 2VEAA 4UQIS 4WEJA 5CRFA 3LEZA 3S7QA 5DF9A 1YMXA 1OTDA 4BL3A 3VOLA 1MWUA 2I72A 4MBHA 4WZ5A 4L9GA 3RH8B 4E6WA 1IOUA 4HHDA 2HF6A 3G35A 3KSHA 3BFFA 2ZBBA 4EQIA 3WS1A 3FZCA 2PU4A 1OJGA 2ZJ9A 3GTCA 3UNWA 4LV0A 1JTGA 5HW3A 1GA0A 3MXQA 4KG2A 5J3WA 1XX2A 4ZAMA 3L9KA 3H7WA 4S2OA 1ZG4A 4NXEA 2QKPA 2X71A 4K91A 2DRWA 5FEGA 1FCMA 3IF6B 2PAVP 1K57C 4S2IA 5GLDA 1DRMA 2P74A 2VX8A 3GVBA 3C7UA 4LRYC 3O3VA 3CZDA 4OONA 3MXSA 4LRXC 3B3XA 1XP4A 4LRZE 2XD1A 3M6HA 1AXBA 3T4LA 1PWGA 1HTZA 3MFXA 5EFWA 4R23A 4P85A 3NDGA 1WYBA 3MKFA 4FOFA 3BFCA 3MBZA 5FQ9A 3BY8A 4KZBA 4EUVA 4R4RA 1W5DA 3OPLA 3VP4A 1H8ZA 4GW9A 4E3MA 2BASA 3TRCA 3ZCZA 1QMEA 2BLSA 1PI4A 2W1TA 1YT4A 5LBRA 3NIAA 1YLTA 4GB7A 1D1JA 3GECA 1PZPA 2ZM8A 5FATA 4WM9A 4WMCA 1EI5A 1D7EA 5FQMA 4DDSA 4UA9A 4X56A 1ONHA 4ZJ2A 4EETB 3SOIA 2OAQ1 3KSIA 4FH4A 2Z2MB 3CLOA 4BJPA 2L1MA 3L7HA 3UN7A 1XFQA 4ID4A 2JKFA 2HDQA 2HPBA 1ZC2A 2Z6DA 2JKRM 3UPOA 3A0SA 1L2SA 5L2FA 3OPRA 2WKIA 3WS2A 1MWRA 2ZQ7A 3CHWP 4N92A 1S4SA 2H28A 4HJ4A 2Y91A 1A0KA 3DTIA 3SW1A 1MBLA 3IS2B 4FTXA 1TDLA 4DE1A 1LLBA 1FOFA 3LI8A 3T12B 2KOIA 2P9VB 3OBFA 1T18A 1JWVA 3WWXA 2XF3A 2XDMA 3OLOA 3FYZA 4MBFA 3Q7VB 4F3LA 2B02A 1IFQA 2EWVA 3KYEA 3EGXC 4DRTA 3CUEA 5CECA 3E4QA 2RCXA 4HNBA 2PBYA 4OLGA 5GLBA 3O86A 2EFXA 2OLVA 3H82A 3ULFA 4GZBA 4EXOA 4UQIM 1L0FA 2PYRA 2VGJA 3ZHHA 5M1AA 3VP0A 3W8KA 1UWNX 4X25A 3OPPA 1HZOA 1LL9A 2PR5A 3PBNA 4RX3A 1ES4A 2YKHA 4H6JB 2Y2GA 1S0WA 2J9PA 3F1PB 1K54C 5A92A 2GJ3A 5AQ9A 1SKFA 3WRZA 2O9AA 1IYPA 2JE5A 4RVAA 4QHCA 4UA7A 3IHAA 2ZD8A 1BYWA 2A3UA 3MR0A 4Y0TA 1F9IA 3AGEA 3UDFA 3VOYA 3HREA 1XGJA 1YLPA 3A3FA 2Q0OA 2C5WB 1YSQA 1W7FA 5HWVA 1LL8A 3BYDA 1S1YA 2HGVA 4GS9B 3HLWA 3K3DA 3O5YA 4K08A 2W3GA 3CITA 2D01A 3F1OA 3T4JA 4ZJ3A 1SKOB 3A3IA 5JYOA 4G3WA 2QZ6A 3ZG8B 3LIFA 5JYPA 3MJQA 3OCNA 4HBTA 2W27A 5TFQA 2OV5A 2J7VA 2V1AA 4X53A 4BBVA 3NHQA 5A91A 5D3OA 5EM1A 4M4XA 2ZQ9A 1DP6A 1T19A 3IHBA 1W63M 3PTEA 2ZC4B 5A8BA 5A93A 3UMEA 3QP6A 1NXYA 4KZ7A 4YOFA 3UE1A 1JWPA 1BLSA 5EVIA 4H8RA 4EBLA 1OTBA 3TSGA 4IVIA 2GZAA 2JBFA 1K4EA 5HFOA 1H8MA 3C7VA 2O9BA 3D9YA 5KSHA 2H0YA 4PMAA 4X68A 3UMDA 1F2KA 4N9LA 5E43A 5EUAA 1IYQA 2PT7A 4JF6A 1WE4A 4LGWA 3O87A 2PYPA 3C38A 4JGRA 3IWIA 1G5UA 1L0DA 3SZTA 2QWSA 3W2ZA 1K6RA 3S7NA 2IWCA 4E3IA 2LB5A 3HBRA 4YNRA 4WN5A 4PKYA 4CLCA 5G4YA 2WK0A 1I2WA 2VV6A 2VGKA 4WBGA 4EBNA 1QMFA 3WS0A 4N9KA 2ZQ8A 3LO7A 1BZAA 2WAFA 1P0ZA 2D02A 1W63Q 4E3JA 5CGWA 2B95A 5HX9A 1XA7A 4S2PA 3BECA 4FSFA 4JPMA 2Y8HA 4EERA 2V0WA 1GA9A 1MPLA 1TS8A 3CPTA 5M18A 3NC8A 5CTMA 4QD4A 5HDSA 2ZLYA 1T1CA 3E2LA 3BY9A 3VP1A 2R9XA 4LPZA 4LV2A 1XJ6A 1PRQA 1S66L 3AGFA 4Q8IA 3ZNYA 3C4OA 4MN5A 1GHMA 3HJKA 3JVUA 4JGPA 1DP8A 2GDNA 2JKTM 1LL5A 4E6XA 1WA9A 1K56A 4OQHA 3LI9A 1MKIA 3FKVA 2L0WA 3TW8A 1J9MA 3IWOA 1Z09A 4HP9A 1T1AA 5FSRA 1S67L 2NUTC 3M2JA 3LR5A 2WGWA 2DNSA 3IXBA 3VE4A 1YM1A 3BQAA 5L09A 4IEDA 3SH9A 4S2MA 1MKMA 3ZGAB 1XXMA 2ZQAA 1E3UA 1MXOA 2O9CA 2VV7A 3BFEA 1YLZA 3IX8A 3IF5A 2ZMAA 4GDBA 4O01A 4E3KA 2VGLS 4OP5A 2QHKA 1FSYA 1TS6A 4Y2FA 4R70A 2DMWA 4AFIA 3IT9A 1WYCA 5HDCA 1Y54A 1TDGA 1OT6A 4KUOA 4QPRA 4B9OA 4MNRA 2QYBA 1IEMA 3LR0A 3DTMA 2XRNA 5F1GA 5KZHA 4P6BA 3RXXA 3HUNA 3QNCA 4DE0A 4JXWA 3PAGA 2WZZA 5HPIA 4NXBA 5FAQA 3G34A 2PD7A 4OLDA 1YSPA 3BLMA 1N9BA 4RA7A 2W1RA 1BUEA 1I2SA 2ZQDA 1STZA 3NDEA 2VK3A 4R1GA 2M1CA 5GHYA 3A0VA 4Y5FA 2J3WA 4YWZA 3G2YA 2J9OA 1V9ZA 4ARZB 4QWOA 1ZKJA 4G3VA 5F69A 2A24A 2X02A 4WYYA 4H6JA 2EFUA 1HLUP 3EEHA 2WUQA 3IWQA 1V9YA 3BLSA 3B33A 4D2OA 1L3LA 2W3EA 1L0GA 4QU3A 5E2GA 2V1ZA 4KENB 2EX6A 5F5YA 1IYOA 3N7WA 4R38A 3LR4A 3Q81A 1LI9A 4OPZA 2HP5A 1OTAA 1RGYA 1YLYA 2ZMFA 1G6OA 3LIEA 2UWXA 2Y55A 4HESA 5FQQA 4Z9QA 4DF6A 4JGOA 4KQQA 5DKLA 1CF0A 1K55C 3TE8A 4MMNA 5HPFA 2NUPC 3F1NA 3B42A 3SH7A 5DF8A 1NLYA 4CQHA 3QHYA 3V39A 2FFFB 1SKOA 2UV0E 3NBLA 4LCMA 1NZUA 3NULA 5EVID 1XKZA 3BQ8A 1ZHHB 2W3FA 3BFDA 3FKWA 3DWKA 1VETB 2VKSA 3T4QA 4C75A 5FDSA 2XA7S 5DF7A 3ZVWA 3HLCA 1NY0A 5FDHA 4PAUA 1IKGA 5HDDA 1RGZA 4Y0OA 1YKDA 4HOIA 4DXCA 1IKIA 4P87A 1KGEA 3IBRA 4IUKA 5M19A 1ESUA 4CPKA 3LFVA 1Q2QA 5EECA 5E2EA 4XXRA 4R3JA 4EBPA 3R7WB 2ZM2A 4NKPA 1DP9A 1ERMA 1JTDA 2EX2A 1JWZA 1JNUA 5HARA 4DE3A 4M3KA 3C2WA 4LENA 4HJ3A 4O7DA 3RTYA 1FR6A 4EQ1A 5EVEA 2JKRI 3T4TA 4G3KA 4GHIB 1VB6A 3HLDA 2ZC5B 1CJFA 1UWPX 5FQJA 3E4PA 3FV7A 4S2JA 5DFYA 1LSWA 4LLOB 2EX8A 4GCZA 3BFGA 4JGQA 3T4KA 2XQZA 4DXBA 3S7OA 4PM9A 4X1LA 5F82A 2H5SA 4R3BA 1VEUA 5IHVA 1BULA 1KVMA 2KX6A 3LYXA 5HWTA 5IT5A 2VGLM 1NZOA 4MBKA 2V8FA 4NEED 4OOMA 1NWZA 5BOHA 3CAXA 4XT2B 3WS5A 1K56D 4WZ5C 4L9EA 2Y2QA 3HLGA 5GHXA 3QP2A 4Y15A 3M2KA 4JXSA 1LI0A 1ODVA 3S4XA 5TJJA 1W79A 3MFDA 2ACGA 4KZ8A 2ZM0A 3C4PA 1EWZA 3AGDA 2PD8A 4OQ0A 5TR7A 1E3UD 4KG6A 4JF5A 2V0UA 1XFNA 5HAIA 3BEBA 4OPYA 4LV1A 3N4IA 2A2LA 4JKTA 1DJCA 3PAEA 5KIZA 5GLCA 2Y2JA 2ZC3B 1OTIA 4II7A 1J3WA 2PU2A 4KQRA 2M7VA 4I38A 4KZ3A 5EOEA 2E8JA 3HUMA 4Q0HA 5L8MA 2ZL1A 2XGNA 4WF0A 2P08A 1PI5A 4U0TA 3T50A 4KZ5A 4PHTA 1KDWA 3NJAA 3A0RA 3HLBA 4HIAA 1W8QA 2QPNA 4ZTKA 5EOOA 4D60A 3MMHA 1PYYA 5TBMA 1Y4OA 1JVJA 1PIOA 2O99A 2P7JA 3G30A 1K25A 1CI8A 3H7WB 5DJTA 1ES3A 2V9AA 4OOLA 1M40A 4C6YA 2P04A 2GNXA 3T1RA 2DCFA 3HCYA 3UE0A 3IBJA 5IS1A 1CK3A 4XUXA 3UDXA 3UO9A 4EV4A 2H0TA 4HI4A 3RFBA 4I3IA 1FILA 3OOVA 4KG5A 4C3QA 3IXGA 1OJ5A 3DAVA 5HSQA 2XA7M 4DN0A 3VSKA 2XH9A 1MZUA 1X0OA 2HP6A 1ES2A 3G4PA 3CJMA 4RX2A 2XEPA 5AVEA 3U4LP 4P6ZS 3TG9A 3LGOA 5F68A 3CI6A 1ZG6A 2G2WA 2W1TB 3BJNA 4GJ4A 1BSGA 4I39A 1OMEA 3NOPC 1GHIA 3MZEA 3W4PA 1TD5A 3EQUA 3IF6A 1P9WA 2HJ9C 1MWSA 3WRTA 3SS4A 3P09A 4A5RA 2Y2KA 3P01A 4UHUA 4EU0A 5EE8A 1PNEA 4RYEA 3UB5P 2W3HA 2EWWA 4MCWA 1BLPA 5J4EA 2O0YA 2RL3A 1SCWA 3VFFA 1GSWA 3DW0A 1MC0A 1DJBA 2LB9A 2Y2OA 4WMCD 2J80A 5EV0A 3CUEC 2W3DA 3KO6A 1CQAA 4GKUA 3PBTA 4N1XA 5CGXA 2OOLA 3T1SA 1TEMA 4HJ6A 1TS0A 3LEQA 2JC7A 1LSXA 1BTLA 3HVFA 4WLAA 4Y3IA 2QMIA 1TVFA 4Y17A 4BMWA 1NRFA 4S2LA 1MWTA 2G2UA 2XSSA 3EGDC 1K57A 4KQOA 4GOGA 3HLEA 3E2KA 5MC7A 2Z2LB 2EXAA 1HD8A 2WADA 4WZ4A 3MSHA 3KYZA 2VA0A 3V5MA 4F3LB 1Y28A 3MQQA 5HD5A 3GDIA 1H3QA 2R78A 3MZDA 3VV4A 3HLFA 2JKTI 2Z6CA 1K4FA 4OPQA 2V1BA 3C8CA 2WKRA 5HAQA 5DFXA 1XJ4A 2Y79A 3LCEA 3QP8A 3ZG0A 4GNUA 2KLIA 1D06A 3H82B 3RJUA 3MZFA 3NY4A 2IWBA 2Q9MA 5DVAA 3T1QB 2J8YA 2K31A 5CHMA 2YKFA 4LFUA 3PXPA 4NK3A 3E0YA 2PDRA 5HAPA 5CXWA 2KDKA 4KQDA 3IS2A 4QY5A 4NXGA 1OT9A 4EEPA 4X1MA 4IHQA 2P9VA 2XK1A 4MDZA 1W8YA 1MY8A 3NECA 3PHYA 4HH3A 4HH2A 4KZ9A 5F1FA 5HZHA 4Q0IA 3Q7VA 2WKHA 1GSXA 1NLZA 3H9WA 3IH9A 5TGFA 5HL1A 1TS7A 5GLAA 2HDSA 3G6OA 3KYQA 2ZC6B 4PM8A 3UB7A 3A3JA 3LIBA 3CWFA 5EVIC 2OWHA 3HUOA 1H0MA 4FH2A 1FQGA 4BD0A 2PRFA 3FG8A 2WGIA 2Y2HA 1KOUA 3GQZA 2L4RA 2PBDP 3F1OB 4IVKA 4MN7A 1L0EA 4K0XA 3LUQA 3V3SA 2WKPA 5I94A 1H5XA 4P6ZM 2J3TD 4IJGA 2XFSA 5FAPA 1OPXA 4UAAA 1S4RA 1YLJA 5EVLA 3F1PA 1KE4A 4BBTA 3A3EA 5GHZA 3U2AA 4DDYA 1GHPA 3Q1FA 4Q0JA 2INWA 4S2NC 4O0PA 5AQBA 4IBRA 1N9LA 1G6AA 5AJGA 1N9NA 4E3OA 4B4ZA 3P7NA 4DMZA 4MN6A 4EEUA 2Y2NA 3M6BA 1YAXA 4CLCC 5FI2A 3HL9A 5EVIB 4LCLA 4KZAA 3MF0A 3BRMA 2AVXA 5GL9A 3ZQ5A 2V2FF 3LIDA 3EOIA 4GS9A 4BBUA 2ZC7A 5FQIA 1EW0A 2WZXA 3S1YA 4ETXA 5EM0A 3ZDJA 4OH0A 3S7PA 3ZG9B 4GLQA 1ACFA 3UPNA 1PW1A 2V8CA 4WEKA 1Q2PA 1K54A 5J8XA 3UPPA 5CGSA 2G7UA 4UEYA 3VE3A 2OSUA 1FCOA 4CLCB 4PM5A 1PWDA 2ZOHA 3G2ZA 4JLFA 3SH8A 4R4SA 1BLHA 3NCKA 3VOZA 3EEAA 3W4OA 3O88A 4K0WA 3NOTC 1ALQA 5K5BA 3ISGA 4HBUA 4EESA 3GMWA 4X55A 4PKYG 5AVFA 1YQSA 3PBSA 3UB6A 3V3RA 1BT5A 4ZDXA 3CPTB 4BENA 1LT0A 4CLCD 4ZRRA 4BQMA 4HY8A 3NOUC 3ITBA 1T1BA 4R3AA 4GN2A 2Y2PA 5EPHA 4EW7A 3IX4A 3ICYA 3KSGA 3DWZA 1OTEA 4NG2A 4ZBEA 4PM7A 1VM1A 1S6RA 1YPRA 1N9OA 3E98A 4QJGA 4S2KA 5FI6A 2A49A 3P98A 4WUJA 1K6SA 4JF4A 1I5QA 1U60A 2V20A 1CI9A 3LICA 3ZFZA 3HJIA 2BG1A 1PFLA 3IXDA 2WGWB 2FH5A 3EQVA 1VHMA 1HVBA 1GCEA 4B88A 4OQIA 3SS5A 5DTKA 2WKEA 3RXWA 1F5MA 4GD6A 2OLUA 1K0KA 1S1ZA 3G31A 4N1HA 1BLCA 3FWLA 1ZTUA 1XJ3A 4OQGA 2PHYA 3FC7A 2QJ7A 1FIKA 1NRJA 1NYMA 1P9RA 4JXVA 3SS3A 1KDSA 3LY4A 5HWWA 1SHVA 3OCLA 2Y59A 5CX7A 3N6IA 4GDNA 4ESPA 2H10A 1FSWA 4E3LA 2HJEA 1CEFA 3EWKA 5HD3A 1KGGA 4B4XA 2GX5A 4CLCE 3CMZA 3VFHA 4BLMA 2CC1A 1IYSA 1H8YA 5FA7A 1RCJA 3GRJA 4KUKA 3A3DA 5FASA 3UDIA 2I9VA 5DKKA 2QJ5A 2HDRA 3UE6A 4ZJ1A 4O8GA 5F83A 3BWLA 5DTTA 5E2HA 5U47A 1FR1A 3ZG7B 1E25A 3G32A 2A24B 5AQ7A 1M6KA 4DE2A 2JCHA 3ITAA 1ES5A 2WGVA 3GR2A 4BWIA 4OP8A 2Y4AA 2VJWA 3NI9A 1YMSA 1ERQA 4OOYA 4EWFA 3LIAA 3QP4A 4PPRA 1GSVA 4FCFA 4PM6A 4CJNA 4DJ2A 2K7SA 4RQ9A 3W4QA 3FPVA 2IWDA 3OC2A 3TJZC 1F98A 4IBXA 4R0QA 3N8SA 3TOIA 1KE0A 4NXFA 2XR0A 3K3CA 2R9WA 2XD5A 3K2NA 3ZVTA 2B5RA 1VQQA 2Y2IA 4JBFA 1XJ2A 5CTNA 1XPBA 5DJUA 3F1NB 3OZHA 3VSLA 1KVLA 1O07A 2EXBA 4HQAA 3T4OA 5CHUA 3DTEA 4ARZA 3D72A 3R4KA 3C5AA 2FFYA 4X69A 5FAOA 3QNBA
chains in the Genus database with same CATH topology
2P9VB 1EROA 3PBRA 4HESA 3RJUA 3MZFA 4HEFA 3V50A 3NY4A 2IWBA 4DKIA 1JWVA 2Q9MA 5DVAA 5FQQA 3WWXA 4Z9QA 2XF3A 2J8YA 4DF6A 3Q7ZA 2XDMA 5CHMA 4MBFA 3FYZA 4KQQA 1XA1A 3N8LA 4OVDA 1K55C 3Q7VB 5DTSA 4NK3A 4BD1A 3SH7A 5DF8A 5HAPA 5CXWA 3QHYA 1KE3A 4X6TA 4DRTA 2ZQCA 3V39A 4QY5A 2FFFB 4P0MA 4MLLA 5CECA 3NBLA 4LCMA 3PBQA 1NZUA 2RCXA 4OLGA 2PBYA 5GLBA 3O86A 5EVID 1XKZA 2EFXA 2P9VA 2XK1A 2OLVA 1W8YA 3BFDA 1MY8A 3FKWA 4GZBA 3ZNTA 1PW8A 3DWKA 4KZ9A 1DJAA 5F1FA 5CERA 3UE3A 1L0FA 4E3NA 1ONGA 4C75A 3Q7VA 1XGIA 4QY6A 2VGJA 1N4OA 2WKHA 3ZHHA 5DF7A 3ZVWA 4WELA 3HLCA 5M1AA 1NY0A 5FDHA 3IH9A 3VP0A 1IKGA 1SDNA 5TGFA 5HL1A 1K38A 2E8IA 3W8KA 1FCNA 3GSGA 3OPPA 1RGZA 1HZOA 4Y0OA 5GLAA 2Y2MA 1LL9A 3PBNA 4RX3A 2HDSA 3CG5A 4DXCA 1ES4A 2ZC6B 1IKIA 4PM8A 4P87A 1KGEA 5M19A 3A3JA 1ESUA 2Y2LA 4CPKA 2WAEA 2Y2GA 3IQAA 1S0WA 5EVIC 2X01A 5A90A 1Q2QA 2J9PA 5EECA 3HUOA 1K54C 4FH2A 5E2EA 4XXRA 4R3JA 1NJ4A 5A92A 1FQGA 4S2NA 5AQ9A 1SKFA 4BD0A 4EBPA 3WRZA 2ZM2A 3IXHA 2WGIA 1IYPA 1JTDA 1ERMA 2EX2A 2HDUA 2JE5A 2Y2HA 4RVAA 3GQZA 1JWZA 3IH8A 5HARA 4QHCA 4DE3A 4UA7A 4M3KA 3IHAA 2ZD8A 5FI7A 4L0LA 4LENA 2A3UA 4Y0TA 3VMAA 4O7DA 3AGEA 4IVKA 5AQAA 3UDFA 1FR6A 3VOYA 3HREA 1L0EA 1PWCA 1CEGA 1XGJA 1YLPA 4K0XA 4LV3A 1YLWA 3V3SA 1O7EA 5I94A 5KSCA 1H5XA 3A3FA 2C5WB 2Q9NA 2XFSA 2ZC5B 3HLDA 4FD8A 2WYXA 1SDEA 5FAPA 4UAAA 1W7FA 1YLJA 3ZG5A 5EVLA 3BYDA 1K55A 1KE4A 5FQJA 3A3EA 5GHZA 3FV7A 4S2JA 4Y0UA 3HLWA 2EX9A 4DDYA 1GHPA 3Q1FA 2XFTA 1RP5A 2EX8A 4S2NC 5FQKA 5AQBA 3BFGA 4IBRA 3BM6A 1G6AA 3PBOA 5E2FA 4E3OA 4B4ZA 3Q82A 2Y2NA 2XQZA 3LY3A 3M6BA 4DXBA 4PM9A 4ZJ3A 1E4DA 5F82A 2H5SA 4R3BA 3A3IA 5JYOA 4GD8A 3JYIA 3HL9A 1BULA 1KVMA 2QZ6A 3OPHA 4KZ4A 4LCLA 5EVIB 5FI2A 4KZAA 3ZG8B 3BRMA 4BL2A 3MXRA 1NZOA 5JYPA 4MBKA 3ZG0A 5GL9A 3OCNA 4HBTA 5TFQA 1DY6A 2V2FF 2OV5A 2J7VA 1PZOA 4X53A 5A91A 1Z6FA 5D3OA 3VP3A 4OOMA 2ZQ9A 3I7JA 5BOHA 2ZC7A 1IELA 5FQIA 3IHBA 3WS5A 2WZXA 5HX9A 1K56D 3PTEA 3S1YA 4F94A 2ZC4B 4WZ5C 2Y2QA 3HLGA 5A93A 5GHXA 3ZDJA 4KZ7A 1NXYA 4OH0A 4U0XA 3ZG9B 3M2KA 4OPRA 4YFMA 4JXSA 1G68A 1LI0A 4NETA 3UE1A 1JWPA 3S4XA 3UPNA 1BLSA 1W79A 1PW1A 5EVIA 4H8RA 4WEKA 4EBLA 1Q2PA 3MFDA 1K54A 4YINA 3VP2A 3TSGA 4IVIA 4KZ8A 5J8XA 4OKPA 2JBFA 4QJGA 4XUZA 2ZM0A 1K4EA 3UPPA 3C4PA 3UY6A 5CEDA 1EWZA 5HFOA 5CGSA 3C7VA 5KSHA 2H0YA 3AGDA 3N8RA 2HP9A 4PMAA 2OSUA 4OQ0A 4U3TA 5TR7A 4X68A 1E3UD 4KG6A 1FCOA 4MEZA 4JF5A 5CEBA 4N9LA 3D4FA 4PM5A 1LHYA 1PWDA 4JXGA 5E43A 5EUAA 1IYQA 3WS4A 3G2ZA 5HAIA 3BEBA 4JLFA 4JF6A 4OPYA 4LV1A 3N4IA 1WE4A 3SH8A 3O87A 4JKTA 4R4SA 4EUZA 1C3BA 3IWIA 1BLHA 3GV9A 3NCKA 3VOZA 3W4OA 1L0DA 1DJCA 3O88A 3PAEA 4K0WA 5CHJA 1ALQA 3MKEA 5GLCA 1K6RA 3ISGA 4HBUA 1NYYA 2Y2JA 1KGFA 2IWCA 2ZC3B 3GMWA 4X55A 4E3IA 1YQSA 3PBSA 4KQRA 2PU2A 3V3RA 3HBRA 1BT5A 4ZDXA 4KZ3A 5EOEA 2C6WB 3HUMA 4KZ6A 1ESIA 4BENA 3S22A 4BQMA 4QB8A 2WK0A 1I2WA 2XGNA 4WBGA 2VGKA 4UA6A 4EBNA 3IF6C 5KMWA 1PI5A 4U0TA 1QMFA 2XLNA 3Q07A 5G18A 3WS0A 4Y7PA 4KZ5A 3ITBA 1KDWA 4N9KA 2ZQ8A 4GN2A 2Y2PA 3LO7A 5EPHA 3HLBA 4WEJA 5CRFA 1W8QA 2QPNA 3LEZA 1BZAA 2WAFA 4ZTKA 5EOOA 5DF9A 1PYYA 1YMXA 3DWZA 4ZBEA 1JVJA 1PIOA 4PM7A 1VM1A 1S6RA 4BL3A 3G30A 4E3JA 1K25A 1MWUA 1CI8A 5CGWA 2I72A 4MBHA 1XA7A 2A49A 3P98A 3BECA 4S2KA 4FSFA 4S2PA 4WZ5A 5FI6A 1ES3A 4JPMA 1K6SA 1GA9A 4JF4A 1I5QA 1MPLA 1U60A 2V20A 4OOLA 1CI9A 1M40A 4C6YA 5M18A 4E6WA 3NC8A 5CTMA 2DCFA 3G35A 3UE0A 4QD4A 3BFFA 1CK3A 4XUXA 3UDXA 4EQIA 2ZLYA 3UO9A 3E2LA 3WS1A 3FZCA 3VP1A 2PU4A 2R9XA 3ZFZA 4EV4A 4LV2A 2BG1A 2ZJ9A 3GTCA 3UNWA 2H0TA 4LV0A 1JTGA 3IXDA 2WGWB 3AGFA 5HW3A 3EQVA 3ZNYA 3C4OA 4Q8IA 4KG5A 1GHMA 4C3QA 3IXGA 1GA0A 1HVBA 1GCEA 2XH9A 4KG2A 3VSKA 4B88A 1XX2A 2GDNA 4ZAMA 1LL5A 4S2OA 4E6XA 1ZG4A 4OQIA 2HP6A 2X71A 5DTKA 3SS5A 1K56A 4OQHA 1ES2A 4K91A 2WKEA 3RXWA 1MKIA 3G4PA 2DRWA 1FCMA 3CJMA 3FKVA 4GD6A 2OLUA 4RX2A 3IF6B 1K57C 4S2IA 5GLDA 2XEPA 3G31A 1J9MA 3IWOA 4N1HA 1BLCA 2P74A 3FWLA 3GVBA 3C7UA 5FSRA 4OQGA 3TG9A 3O3VA 3CZDA 4OONA 3MXSA 3M2JA 1ZG6A 3B3XA 1XP4A 2WGWA 2G2WA 2DNSA 1NYMA 2XD1A 3M6HA 3IXBA 4JXVA 3SS3A 1KDSA 3LY4A 1AXBA 1BSGA 1YM1A 1SHVA 3OCLA 2Y59A 4IEDA 1OMEA 3SH9A 1PWGA 1HTZA 3N6IA 4GDNA 4S2MA 4R23A 1GHIA 3ZGAB 4P85A 2H10A 3NDGA 1WYBA 1XXMA 2ZQAA 3MKFA 3MZEA 1FSWA 1E3UA 1MXOA 3W4PA 4E3LA 1CEFA 3BFCA 3MBZA 5FQ9A 3BFEA 1YLZA 3EQUA 4KZBA 1KGGA 3IF6A 4B4XA 3IF5A 2ZMAA 3CMZA 4GDBA 4R4RA 3VFHA 1W5DA 3OPLA 3VP4A 4E3KA 1H8ZA 1MWSA 4OP5A 3WRTA 4BLMA 1FSYA 4E3MA 3SS4A 3ZCZA 2CC1A 1IYSA 1H8YA 1QMEA 2BLSA 3P09A 5FA7A 2Y2KA 4A5RA 1RCJA 3GRJA 3A3DA 3IT9A 1WYCA 4UHUA 3UDIA 5FASA 1PI4A 1Y54A 5EE8A 1YT4A 2HDRA 4RYEA 4ZJ1A 1TDGA 3NIAA 5F83A 1BLPA 4MNRA 1IEMA 1YLTA 4GB7A 3DTMA 2RL3A 5DTTA 1PZPA 1SCWA 5E2HA 2ZM8A 5F1GA 5U47A 1FR1A 3DW0A 3VFFA 5FATA 4P6BA 3ZG7B 5KZHA 1E25A 1DJBA 2Y2OA 3RXXA 3G32A 4WM9A 4WMCD 4WMCA 3HUNA 3QNCA 5AQ7A 4DE0A 1EI5A 4JXWA 1M6KA 5FQMA 4DE2A 4GKUA 3PAGA 4DDSA 4UA9A 3PBTA 2WZZA 1ONHA 4N1XA 4X56A 5CGXA 2JCHA 3ITAA 4ZJ2A 1ES5A 2WGVA 5FAQA 3GR2A 3G34A 4OP8A 2Y4AA 1TEMA 4OLDA 3SOIA 3BLMA 1N9BA 2JC7A 3NI9A 4RA7A 3HVFA 1BTLA 1YMSA 5IHVA 1BUEA 1ERQA 1I2SA 4OOYA 2ZQDA 4EWFA 2QMIA 3NDEA 4R1GA 1TVFA 4FH4A 2Z2MB 5GHYA 4BJPA 1NRFA 3G2YA 4S2LA 1MWTA 2J9OA 4PPRA 3UN7A 4FCFA 4PM6A 2G2UA 4CJNA 4ID4A 3W4QA 1ZKJA 2HDQA 1K57A 2HPBA 2IWDA 1ZC2A 4KQOA 3OC2A 4GOGA 2X02A 4WYYA 4IBXA 4R0QA 3HLEA 3UPOA 1L2SA 2EFUA 3E2KA 3N8SA 2Z2LB 3OPRA 1KE0A 2EXAA 2WKIA 3TOIA 3WS2A 5L2FA 1MWRA 1HD8A 2WUQA 2WADA 2XR0A 2R9WA 2XD5A 2ZQ7A 3BLSA 3IWQA 3ZVTA 4D2OA 4WZ4A 2B5RA 4N92A 1L0GA 4QU3A 5E2GA 1VQQA 2V1ZA 2Y2IA 4KENB 2Y91A 4JBFA 2EX6A 5CTNA 1XPBA 3V5MA 1IYOA 3N7WA 3OZHA 3VSLA 3MZDA 3Q81A 1KVLA 1LI9A 1MBLA 4OPZA 3HLFA 2HP5A 1O07A 2EXBA 1K4FA 1TDLA 4OPQA 5CHUA 1RGYA 1YLYA 5HAQA 4DE1A 1LLBA 3C5AA 2FFYA 1FOFA 4X69A 2UWXA 3LCEA 3QNBA 5FAOA 2Y55A 4GNUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2P9V B;  1ERO A;  3PBR A;  4HES A;  3RJU A;  3MZF A;  4HEF A;  3V50 A;  3NY4 A;  2IWB A;  4DKI A;  1JWV A;  2Q9M A;  5DVA A;  5FQQ A;  3WWX A;  4Z9Q A;  2XF3 A;  2J8Y A;  4DF6 A;  3Q7Z A;  2XDM A;  5CHM A;  4MBF A;  3FYZ A;  4KQQ A;  1XA1 A;  3N8L A;  4OVD A;  1K55 C;  3Q7V B;  5DTS A;  4NK3 A;  4BD1 A;  3SH7 A;  5DF8 A;  5HAP A;  5CXW A;  3QHY A;  1KE3 A;  4X6T A;  4DRT A;  2ZQC A;  3V39 A;  4QY5 A;  2FFF B;  4P0M A;  4MLL A;  5CEC A;  3NBL A;  4LCM A;  3PBQ A;  1NZU A;  2RCX A;  4OLG A;  2PBY A;  5GLB A;  3O86 A;  5EVI D;  1XKZ A;  2EFX A;  2P9V A;  2XK1 A;  2OLV A;  1W8Y A;  3BFD A;  1MY8 A;  3FKW A;  4GZB A;  3ZNT A;  1PW8 A;  3DWK A;  4KZ9 A;  1DJA A;  5F1F A;  5CER A;  3UE3 A;  1L0F A;  4E3N A;  1ONG A;  4C75 A;  3Q7V A;  1XGI A;  4QY6 A;  2VGJ A;  1N4O A;  2WKH A;  3ZHH A;  5DF7 A;  3ZVW A;  4WEL A;  3HLC A;  5M1A A;  1NY0 A;  5FDH A;  3IH9 A;  3VP0 A;  1IKG A;  1SDN A;  5TGF A;  5HL1 A;  1K38 A;  2E8I A;  3W8K A;  1FCN A;  3GSG A;  3OPP A;  1RGZ A;  1HZO A;  4Y0O A;  5GLA A;  2Y2M A;  1LL9 A;  3PBN A;  4RX3 A;  2HDS A;  3CG5 A;  4DXC A;  1ES4 A;  2ZC6 B;  1IKI A;  4PM8 A;  4P87 A;  1KGE A;  5M19 A;  3A3J A;  1ESU A;  2Y2L A;  4CPK A;  2WAE A;  2Y2G A;  3IQA A;  1S0W A;  5EVI C;  2X01 A;  5A90 A;  1Q2Q A;  2J9P A;  5EEC A;  3HUO A;  1K54 C;  4FH2 A;  5E2E A;  4XXR A;  4R3J A;  1NJ4 A;  5A92 A;  1FQG A;  4S2N A;  5AQ9 A;  1SKF A;  4BD0 A;  4EBP A;  3WRZ A;  2ZM2 A;  3IXH A;  2WGI A;  1IYP A;  1JTD A;  1ERM A;  2EX2 A;  2HDU A;  2JE5 A;  2Y2H A;  4RVA A;  3GQZ A;  1JWZ A;  3IH8 A;  5HAR A;  4QHC A;  4DE3 A;  4UA7 A;  4M3K A;  3IHA A;  2ZD8 A;  5FI7 A;  4L0L A;  4LEN A;  2A3U A;  4Y0T A;  3VMA A;  4O7D A;  3AGE A;  4IVK A;  5AQA A;  3UDF A;  1FR6 A;  3VOY A;  3HRE A;  1L0E A;  1PWC A;  1CEG A;  1XGJ A;  1YLP A;  4K0X A;  4LV3 A;  1YLW A;  3V3S A;  1O7E A;  5I94 A;  5KSC A;  1H5X A;  3A3F A;  2C5W B;  2Q9N A;  2XFS A;  2ZC5 B;  3HLD A;  4FD8 A;  2WYX A;  1SDE A;  5FAP A;  4UAA A;  1W7F A;  1YLJ A;  3ZG5 A;  5EVL A;  3BYD A;  1K55 A;  1KE4 A;  5FQJ A;  3A3E A;  5GHZ A;  3FV7 A;  4S2J A;  4Y0U A;  3HLW A;  2EX9 A;  4DDY A;  1GHP A;  3Q1F A;  2XFT A;  1RP5 A;  2EX8 A;  4S2N C;  5FQK A;  5AQB A;  3BFG A;  4IBR A;  3BM6 A;  1G6A A;  3PBO A;  5E2F A;  4E3O A;  4B4Z A;  3Q82 A;  2Y2N A;  2XQZ A;  3LY3 A;  3M6B A;  4DXB A;  4PM9 A;  4ZJ3 A;  1E4D A;  5F82 A;  2H5S A;  4R3B A;  3A3I A;  5JYO A;  4GD8 A;  3JYI A;  3HL9 A;  1BUL A;  1KVM A;  2QZ6 A;  3OPH A;  4KZ4 A;  4LCL A;  5EVI B;  5FI2 A;  4KZA A;  3ZG8 B;  3BRM A;  4BL2 A;  3MXR A;  1NZO A;  5JYP A;  4MBK A;  3ZG0 A;  5GL9 A;  3OCN A;  4HBT A;  5TFQ A;  1DY6 A;  2V2F F;  2OV5 A;  2J7V A;  1PZO A;  4X53 A;  5A91 A;  1Z6F A;  5D3O A;  3VP3 A;  4OOM A;  2ZQ9 A;  3I7J A;  5BOH A;  2ZC7 A;  1IEL A;  5FQI A;  3IHB A;  3WS5 A;  2WZX A;  5HX9 A;  1K56 D;  3PTE A;  3S1Y A;  4F94 A;  2ZC4 B;  4WZ5 C;  2Y2Q A;  3HLG A;  5A93 A;  5GHX A;  3ZDJ A;  4KZ7 A;  1NXY A;  4OH0 A;  4U0X A;  3ZG9 B;  3M2K A;  4OPR A;  4YFM A;  4JXS A;  1G68 A;  1LI0 A;  4NET A;  3UE1 A;  1JWP A;  3S4X A;  3UPN A;  1BLS A;  1W79 A;  1PW1 A;  5EVI A;  4H8R A;  4WEK A;  4EBL A;  1Q2P A;  3MFD A;  1K54 A;  4YIN A;  3VP2 A;  3TSG A;  4IVI A;  4KZ8 A;  5J8X A;  4OKP A;  2JBF A;  4QJG A;  4XUZ A;  2ZM0 A;  1K4E A;  3UPP A;  3C4P A;  3UY6 A;  5CED A;  1EWZ A;  5HFO A;  5CGS A;  3C7V A;  5KSH A;  2H0Y A;  3AGD A;  3N8R A;  2HP9 A;  4PMA A;  2OSU A;  4OQ0 A;  4U3T A;  5TR7 A;  4X68 A;  1E3U D;  4KG6 A;  1FCO A;  4MEZ A;  4JF5 A;  5CEB A;  4N9L A;  3D4F A;  4PM5 A;  1LHY A;  1PWD A;  4JXG A;  5E43 A;  5EUA A;  1IYQ A;  3WS4 A;  3G2Z A;  5HAI A;  3BEB A;  4JLF A;  4JF6 A;  4OPY A;  4LV1 A;  3N4I A;  1WE4 A;  3SH8 A;  3O87 A;  4JKT A;  4R4S A;  4EUZ A;  1C3B A;  3IWI A;  1BLH A;  3GV9 A;  3NCK A;  3VOZ A;  3W4O A;  1L0D A;  1DJC A;  3O88 A;  3PAE A;  4K0W A;  5CHJ A;  1ALQ A;  3MKE A;  5GLC A;  1K6R A;  3ISG A;  4HBU A;  1NYY A;  2Y2J A;  1KGF A;  2IWC A;  2ZC3 B;  3GMW A;  4X55 A;  4E3I A;  1YQS A;  3PBS A;  4KQR A;  2PU2 A;  3V3R A;  3HBR A;  1BT5 A;  4ZDX A;  4KZ3 A;  5EOE A;  2C6W B;  3HUM A;  4KZ6 A;  1ESI A;  4BEN A;  3S22 A;  4BQM A;  4QB8 A;  2WK0 A;  1I2W A;  2XGN A;  4WBG A;  2VGK A;  4UA6 A;  4EBN A;  3IF6 C;  5KMW A;  1PI5 A;  4U0T A;  1QMF A;  2XLN A;  3Q07 A;  5G18 A;  3WS0 A;  4Y7P A;  4KZ5 A;  3ITB A;  1KDW A;  4N9K A;  2ZQ8 A;  4GN2 A;  2Y2P A;  3LO7 A;  5EPH A;  3HLB A;  4WEJ A;  5CRF A;  1W8Q A;  2QPN A;  3LEZ A;  1BZA A;  2WAF A;  4ZTK A;  5EOO A;  5DF9 A;  1PYY A;  1YMX A;  3DWZ A;  4ZBE A;  1JVJ A;  1PIO A;  4PM7 A;  1VM1 A;  1S6R A;  4BL3 A;  3G30 A;  4E3J A;  1K25 A;  1MWU A;  1CI8 A;  5CGW A;  2I72 A;  4MBH A;  1XA7 A;  2A49 A;  3P98 A;  3BEC A;  4S2K A;  4FSF A;  4S2P A;  4WZ5 A;  5FI6 A;  1ES3 A;  4JPM A;  1K6S A;  1GA9 A;  4JF4 A;  1I5Q A;  1MPL A;  1U60 A;  2V20 A;  4OOL A;  1CI9 A;  1M40 A;  4C6Y A;  5M18 A;  4E6W A;  3NC8 A;  5CTM A;  2DCF A;  3G35 A;  3UE0 A;  4QD4 A;  3BFF A;  1CK3 A;  4XUX A;  3UDX A;  4EQI A;  2ZLY A;  3UO9 A;  3E2L A;  3WS1 A;  3FZC A;  3VP1 A;  2PU4 A;  2R9X A;  3ZFZ A;  4EV4 A;  4LV2 A;  2BG1 A;  2ZJ9 A;  3GTC A;  3UNW A;  2H0T A;  4LV0 A;  1JTG A;  3IXD A;  2WGW B;  3AGF A;  5HW3 A;  3EQV A;  3ZNY A;  3C4O A;  4Q8I A;  4KG5 A;  1GHM A;  4C3Q A;  3IXG A;  1GA0 A;  1HVB A;  1GCE A;  2XH9 A;  4KG2 A;  3VSK A;  4B88 A;  1XX2 A;  2GDN A;  4ZAM A;  1LL5 A;  4S2O A;  4E6X A;  1ZG4 A;  4OQI A;  2HP6 A;  2X71 A;  5DTK A;  3SS5 A;  1K56 A;  4OQH A;  1ES2 A;  4K91 A;  2WKE A;  3RXW A;  1MKI A;  3G4P A;  2DRW A;  1FCM A;  3CJM A;  3FKV A;  4GD6 A;  2OLU A;  4RX2 A;  3IF6 B;  1K57 C;  4S2I A;  5GLD A;  2XEP A;  3G31 A;  1J9M A;  3IWO A;  4N1H A;  1BLC A;  2P74 A;  3FWL A;  3GVB A;  3C7U A;  5FSR A;  4OQG A;  3TG9 A;  3O3V A;  3CZD A;  4OON A;  3MXS A;  3M2J A;  1ZG6 A;  3B3X A;  1XP4 A;  2WGW A;  2G2W A;  2DNS A;  1NYM A;  2XD1 A;  3M6H A;  3IXB A;  4JXV A;  3SS3 A;  1KDS A;  3LY4 A;  1AXB A;  1BSG A;  1YM1 A;  1SHV A;  3OCL A;  2Y59 A;  4IED A;  1OME A;  3SH9 A;  1PWG A;  1HTZ A;  3N6I A;  4GDN A;  4S2M A;  4R23 A;  1GHI A;  3ZGA B;  4P85 A;  2H10 A;  3NDG A;  1WYB A;  1XXM A;  2ZQA A;  3MKF A;  3MZE A;  1FSW A;  1E3U A;  1MXO A;  3W4P A;  4E3L A;  1CEF A;  3BFC A;  3MBZ A;  5FQ9 A;  3BFE A;  1YLZ A;  3EQU A;  4KZB A;  1KGG A;  3IF6 A;  4B4X A;  3IF5 A;  2ZMA A;  3CMZ A;  4GDB A;  4R4R A;  3VFH A;  1W5D A;  3OPL A;  3VP4 A;  4E3K A;  1H8Z A;  1MWS A;  4OP5 A;  3WRT A;  4BLM A;  1FSY A;  4E3M A;  3SS4 A;  3ZCZ A;  2CC1 A;  1IYS A;  1H8Y A;  1QME A;  2BLS A;  3P09 A;  5FA7 A;  2Y2K A;  4A5R A;  1RCJ A;  3GRJ A;  3A3D A;  3IT9 A;  1WYC A;  4UHU A;  3UDI A;  5FAS A;  1PI4 A;  1Y54 A;  5EE8 A;  1YT4 A;  2HDR A;  4RYE A;  4ZJ1 A;  1TDG A;  3NIA A;  5F83 A;  1BLP A;  4MNR A;  1IEM A;  1YLT A;  4GB7 A;  3DTM A;  2RL3 A;  5DTT A;  1PZP A;  1SCW A;  5E2H A;  2ZM8 A;  5F1G A;  5U47 A;  1FR1 A;  3DW0 A;  3VFF A;  5FAT A;  4P6B A;  3ZG7 B;  5KZH A;  1E25 A;  1DJB A;  2Y2O A;  3RXX A;  3G32 A;  4WM9 A;  4WMC D;  4WMC A;  3HUN A;  3QNC A;  5AQ7 A;  4DE0 A;  1EI5 A;  4JXW A;  1M6K A;  5FQM A;  4DE2 A;  4GKU A;  3PAG A;  4DDS A;  4UA9 A;  3PBT A;  2WZZ A;  1ONH A;  4N1X A;  4X56 A;  5CGX A;  2JCH A;  3ITA A;  4ZJ2 A;  1ES5 A;  2WGV A;  5FAQ A;  3GR2 A;  3G34 A;  4OP8 A;  2Y4A A;  1TEM A;  4OLD A;  3SOI A;  3BLM A;  1N9B A;  2JC7 A;  3NI9 A;  4RA7 A;  3HVF A;  1BTL A;  1YMS A;  5IHV A;  1BUE A;  1ERQ A;  1I2S A;  4OOY A;  2ZQD A;  4EWF A;  2QMI A;  3NDE A;  4R1G A;  1TVF A;  4FH4 A;  2Z2M B;  5GHY A;  4BJP A;  1NRF A;  3G2Y A;  4S2L A;  1MWT A;  2J9O A;  4PPR A;  3UN7 A;  4FCF A;  4PM6 A;  2G2U A;  4CJN A;  4ID4 A;  3W4Q A;  1ZKJ A;  2HDQ A;  1K57 A;  2HPB A;  2IWD A;  1ZC2 A;  4KQO A;  3OC2 A;  4GOG A;  2X02 A;  4WYY A;  4IBX A;  4R0Q A;  3HLE A;  3UPO A;  1L2S A;  2EFU A;  3E2K A;  3N8S A;  2Z2L B;  3OPR A;  1KE0 A;  2EXA A;  2WKI A;  3TOI A;  3WS2 A;  5L2F A;  1MWR A;  1HD8 A;  2WUQ A;  2WAD A;  2XR0 A;  2R9W A;  2XD5 A;  2ZQ7 A;  3BLS A;  3IWQ A;  3ZVT A;  4D2O A;  4WZ4 A;  2B5R A;  4N92 A;  1L0G A;  4QU3 A;  5E2G A;  1VQQ A;  2V1Z A;  2Y2I A;  4KEN B;  2Y91 A;  4JBF A;  2EX6 A;  5CTN A;  1XPB A;  3V5M A;  1IYO A;  3N7W A;  3OZH A;  3VSL A;  3MZD A;  3Q81 A;  1KVL A;  1LI9 A;  1MBL A;  4OPZ A;  3HLF A;  2HP5 A;  1O07 A;  2EXB A;  1K4F A;  1TDL A;  4OPQ A;  5CHU A;  1RGY A;  1YLY A;  5HAQ A;  4DE1 A;  1LLB A;  3C5A A;  2FFY A;  1FOF A;  4X69 A;  2UWX A;  3LCE A;  3QNB A;  5FAO A;  2Y55 A;  4GNU A; 
#chains in the Genus database with same CATH topology
 2PR6 A;  3JVV A;  1ERO A;  3PBR A;  4DKI A;  3V50 A;  4HEF A;  3Q7Z A;  5FL3 A;  3UB9 A;  2OAP 1;  4OVD A;  1XA1 A;  3N8L A;  2VLG A;  5DTS A;  4HP4 A;  2EA9 A;  2IA2 A;  4BD1 A;  4E04 A;  2MJ6 A;  4X6T A;  1KE3 A;  3BW6 A;  2ZQC A;  4P0M A;  4MLL A;  3PBQ A;  1UGU A;  3LR3 A;  3ZNT A;  1PW8 A;  3B47 A;  1DJA A;  5CER A;  3UE3 A;  4E3N A;  2VV8 A;  4ME4 A;  1ONG A;  1LSV A;  1XGI A;  4QY6 A;  1N4O A;  4WEL A;  1SDN A;  1K38 A;  2E8I A;  1FCN A;  3GSG A;  5FEF A;  3D3O A;  2Y2M A;  3MS6 A;  2HZ5 A;  3CG5 A;  2Y2L A;  2JKG A;  4DJ3 A;  2WAE A;  3IQA A;  2X01 A;  5A90 A;  2WKQ A;  4I5S A;  1NJ4 A;  5I5L A;  4S2N A;  5L07 A;  1VET A;  3IXH A;  2HDU A;  3IH8 A;  5FI7 A;  4L0L A;  5HL6 A;  3T4S A;  3VMA A;  4FUW A;  5AQA A;  2W0N A;  1VEU B;  2ZOI A;  1PWC A;  1CEG A;  5J7E A;  4LV3 A;  1YLW A;  1O7E A;  5KSC A;  3JPU A;  2Q9N A;  4FD8 A;  2WYX A;  1SDE A;  2FZ0 A;  2XRO A;  4I3J A;  3ZG5 A;  1K55 A;  2B18 A;  3ZYT A;  4Y0U A;  2EX9 A;  3R7W A;  2XFT A;  1RP5 A;  5FQK A;  3KSF A;  3BM6 A;  3PBO A;  5E2F A;  5F6A A;  2JN7 A;  3Q82 A;  2CMN A;  3LY3 A;  3DBA A;  1E4D A;  1TF1 A;  4B93 A;  4GD8 A;  3JYI A;  4KZ4 A;  3OPH A;  4GHI A;  4BL2 A;  3MXR A;  3UB8 A;  4L9F A;  3E4O A;  2JHE A;  1DY6 A;  2J3T C;  1PZO A;  1Z6F A;  3VP3 A;  3I7J A;  1IEL A;  4F94 A;  3C30 A;  2VZW A;  4U0X A;  2M7U A;  5L10 A;  4I3A A;  3PYP A;  4OPR A;  4YFM A;  4IUH A;  3T1X A;  3MQ0 A;  1G68 A;  4NET A;  4Z1W A;  3IX3 A;  4YIN A;  3VP2 A;  4OKP A;  4XUZ A;  1SZV A;  3UY6 A;  5CED A;  2BTF P;  3QP1 A;  3N8R A;  2HP9 A;  4U3T A;  4XT2 A;  3V67 A;  4MEZ A;  5CEB A;  3DTK A;  3D4F A;  1LHY A;  4WL9 A;  4JXG A;  2ZL1 B;  3WS4 A;  4ETZ A;  4EUZ A;  1C3B A;  3GV9 A;  4R6L A;  3FPW A;  5CHJ A;  1P97 A;  2OWJ A;  2ZMV A;  3MKE A;  3MQO A;  5TBM B;  1NYY A;  1KGF A;  3PR6 A;  1G28 A;  1AWI A;  2C6W B;  2K2N A;  4KZ6 A;  1ESI A;  3S22 A;  2HV1 A;  4QB8 A;  5C5K A;  3QP5 A;  5IU1 A;  3KX0 X;  5KMW A;  4UA6 A;  3IF6 C;  5G4Z A;  2XLN A;  4Y13 A;  3Q07 A;  5G18 A;  4Y7P A;  2VEA A;  4UQI S;  4WEJ A;  5CRF A;  3LEZ A;  3S7Q A;  5DF9 A;  1YMX A;  1OTD A;  4BL3 A;  3VOL A;  1MWU A;  2I72 A;  4MBH A;  4WZ5 A;  4L9G A;  3RH8 B;  4E6W A;  1IOU A;  4HHD A;  2HF6 A;  3G35 A;  3KSH A;  3BFF A;  2ZBB A;  4EQI A;  3WS1 A;  3FZC A;  2PU4 A;  1OJG A;  2ZJ9 A;  3GTC A;  3UNW A;  4LV0 A;  1JTG A;  5HW3 A;  1GA0 A;  3MXQ A;  4KG2 A;  5J3W A;  1XX2 A;  4ZAM A;  3L9K A;  3H7W A;  4S2O A;  1ZG4 A;  4NXE A;  2QKP A;  2X71 A;  4K91 A;  2DRW A;  5FEG A;  1FCM A;  3IF6 B;  2PAV P;  1K57 C;  4S2I A;  5GLD A;  1DRM A;  2P74 A;  2VX8 A;  3GVB A;  3C7U A;  4LRY C;  3O3V A;  3CZD A;  4OON A;  3MXS A;  4LRX C;  3B3X A;  1XP4 A;  4LRZ E;  2XD1 A;  3M6H A;  1AXB A;  3T4L A;  1PWG A;  1HTZ A;  3MFX A;  5EFW A;  4R23 A;  4P85 A;  3NDG A;  1WYB A;  3MKF A;  4FOF A;  3BFC A;  3MBZ A;  5FQ9 A;  3BY8 A;  4KZB A;  4EUV A;  4R4R A;  1W5D A;  3OPL A;  3VP4 A;  1H8Z A;  4GW9 A;  4E3M A;  2BAS A;  3TRC A;  3ZCZ A;  1QME A;  2BLS A;  1PI4 A;  2W1T A;  1YT4 A;  5LBR A;  3NIA A;  1YLT A;  4GB7 A;  1D1J A;  3GEC A;  1PZP A;  2ZM8 A;  5FAT A;  4WM9 A;  4WMC A;  1EI5 A;  1D7E A;  5FQM A;  4DDS A;  4UA9 A;  4X56 A;  1ONH A;  4ZJ2 A;  4EET B;  3SOI A;  2OAQ 1;  3KSI A;  4FH4 A;  2Z2M B;  3CLO A;  4BJP A;  2L1M A;  3L7H A;  3UN7 A;  1XFQ A;  4ID4 A;  2JKF A;  2HDQ A;  2HPB A;  1ZC2 A;  2Z6D A;  2JKR M;  3UPO A;  3A0S A;  1L2S A;  5L2F A;  3OPR A;  2WKI A;  3WS2 A;  1MWR A;  2ZQ7 A;  3CHW P;  4N92 A;  1S4S A;  2H28 A;  4HJ4 A;  2Y91 A;  1A0K A;  3DTI A;  3SW1 A;  1MBL A;  3IS2 B;  4FTX A;  1TDL A;  4DE1 A;  1LLB A;  1FOF A;  3LI8 A;  3T12 B;  2KOI A;  2P9V B;  3OBF A;  1T18 A;  1JWV A;  3WWX A;  2XF3 A;  2XDM A;  3OLO A;  3FYZ A;  4MBF A;  3Q7V B;  4F3L A;  2B02 A;  1IFQ A;  2EWV A;  3KYE A;  3EGX C;  4DRT A;  3CUE A;  5CEC A;  3E4Q A;  2RCX A;  4HNB A;  2PBY A;  4OLG A;  5GLB A;  3O86 A;  2EFX A;  2OLV A;  3H82 A;  3ULF A;  4GZB A;  4EXO A;  4UQI M;  1L0F A;  2PYR A;  2VGJ A;  3ZHH A;  5M1A A;  3VP0 A;  3W8K A;  1UWN X;  4X25 A;  3OPP A;  1HZO A;  1LL9 A;  2PR5 A;  3PBN A;  4RX3 A;  1ES4 A;  2YKH A;  4H6J B;  2Y2G A;  1S0W A;  2J9P A;  3F1P B;  1K54 C;  5A92 A;  2GJ3 A;  5AQ9 A;  1SKF A;  3WRZ A;  2O9A A;  1IYP A;  2JE5 A;  4RVA A;  4QHC A;  4UA7 A;  3IHA A;  2ZD8 A;  1BYW A;  2A3U A;  3MR0 A;  4Y0T A;  1F9I A;  3AGE A;  3UDF A;  3VOY A;  3HRE A;  1XGJ A;  1YLP A;  3A3F A;  2Q0O A;  2C5W B;  1YSQ A;  1W7F A;  5HWV A;  1LL8 A;  3BYD A;  1S1Y A;  2HGV A;  4GS9 B;  3HLW A;  3K3D A;  3O5Y A;  4K08 A;  2W3G A;  3CIT A;  2D01 A;  3F1O A;  3T4J A;  4ZJ3 A;  1SKO B;  3A3I A;  5JYO A;  4G3W A;  2QZ6 A;  3ZG8 B;  3LIF A;  5JYP A;  3MJQ A;  3OCN A;  4HBT A;  2W27 A;  5TFQ A;  2OV5 A;  2J7V A;  2V1A A;  4X53 A;  4BBV A;  3NHQ A;  5A91 A;  5D3O A;  5EM1 A;  4M4X A;  2ZQ9 A;  1DP6 A;  1T19 A;  3IHB A;  1W63 M;  3PTE A;  2ZC4 B;  5A8B A;  5A93 A;  3UME A;  3QP6 A;  1NXY A;  4KZ7 A;  4YOF A;  3UE1 A;  1JWP A;  1BLS A;  5EVI A;  4H8R A;  4EBL A;  1OTB A;  3TSG A;  4IVI A;  2GZA A;  2JBF A;  1K4E A;  5HFO A;  1H8M A;  3C7V A;  2O9B A;  3D9Y A;  5KSH A;  2H0Y A;  4PMA A;  4X68 A;  3UMD A;  1F2K A;  4N9L A;  5E43 A;  5EUA A;  1IYQ A;  2PT7 A;  4JF6 A;  1WE4 A;  4LGW A;  3O87 A;  2PYP A;  3C38 A;  4JGR A;  3IWI A;  1G5U A;  1L0D A;  3SZT A;  2QWS A;  3W2Z A;  1K6R A;  3S7N A;  2IWC A;  4E3I A;  2LB5 A;  3HBR A;  4YNR A;  4WN5 A;  4PKY A;  4CLC A;  5G4Y A;  2WK0 A;  1I2W A;  2VV6 A;  2VGK A;  4WBG A;  4EBN A;  1QMF A;  3WS0 A;  4N9K A;  2ZQ8 A;  3LO7 A;  1BZA A;  2WAF A;  1P0Z A;  2D02 A;  1W63 Q;  4E3J A;  5CGW A;  2B95 A;  5HX9 A;  1XA7 A;  4S2P A;  3BEC A;  4FSF A;  4JPM A;  2Y8H A;  4EER A;  2V0W A;  1GA9 A;  1MPL A;  1TS8 A;  3CPT A;  5M18 A;  3NC8 A;  5CTM A;  4QD4 A;  5HDS A;  2ZLY A;  1T1C A;  3E2L A;  3BY9 A;  3VP1 A;  2R9X A;  4LPZ A;  4LV2 A;  1XJ6 A;  1PRQ A;  1S66 L;  3AGF A;  4Q8I A;  3ZNY A;  3C4O A;  4MN5 A;  1GHM A;  3HJK A;  3JVU A;  4JGP A;  1DP8 A;  2GDN A;  2JKT M;  1LL5 A;  4E6X A;  1WA9 A;  1K56 A;  4OQH A;  3LI9 A;  1MKI A;  3FKV A;  2L0W A;  3TW8 A;  1J9M A;  3IWO A;  1Z09 A;  4HP9 A;  1T1A A;  5FSR A;  1S67 L;  2NUT C;  3M2J A;  3LR5 A;  2WGW A;  2DNS A;  3IXB A;  3VE4 A;  1YM1 A;  3BQA A;  5L09 A;  4IED A;  3SH9 A;  4S2M A;  1MKM A;  3ZGA B;  1XXM A;  2ZQA A;  1E3U A;  1MXO A;  2O9C A;  2VV7 A;  3BFE A;  1YLZ A;  3IX8 A;  3IF5 A;  2ZMA A;  4GDB A;  4O01 A;  4E3K A;  2VGL S;  4OP5 A;  2QHK A;  1FSY A;  1TS6 A;  4Y2F A;  4R70 A;  2DMW A;  4AFI A;  3IT9 A;  1WYC A;  5HDC A;  1Y54 A;  1TDG A;  1OT6 A;  4KUO A;  4QPR A;  4B9O A;  4MNR A;  2QYB A;  1IEM A;  3LR0 A;  3DTM A;  2XRN A;  5F1G A;  5KZH A;  4P6B A;  3RXX A;  3HUN A;  3QNC A;  4DE0 A;  4JXW A;  3PAG A;  2WZZ A;  5HPI A;  4NXB A;  5FAQ A;  3G34 A;  2PD7 A;  4OLD A;  1YSP A;  3BLM A;  1N9B A;  4RA7 A;  2W1R A;  1BUE A;  1I2S A;  2ZQD A;  1STZ A;  3NDE A;  2VK3 A;  4R1G A;  2M1C A;  5GHY A;  3A0V A;  4Y5F A;  2J3W A;  4YWZ A;  3G2Y A;  2J9O A;  1V9Z A;  4ARZ B;  4QWO A;  1ZKJ A;  4G3V A;  5F69 A;  2A24 A;  2X02 A;  4WYY A;  4H6J A;  2EFU A;  1HLU P;  3EEH A;  2WUQ A;  3IWQ A;  1V9Y A;  3BLS A;  3B33 A;  4D2O A;  1L3L A;  2W3E A;  1L0G A;  4QU3 A;  5E2G A;  2V1Z A;  4KEN B;  2EX6 A;  5F5Y A;  1IYO A;  3N7W A;  4R38 A;  3LR4 A;  3Q81 A;  1LI9 A;  4OPZ A;  2HP5 A;  1OTA A;  1RGY A;  1YLY A;  2ZMF A;  1G6O A;  3LIE A;  2UWX A;  2Y55 A;  4HES A;  5FQQ A;  4Z9Q A;  4DF6 A;  4JGO A;  4KQQ A;  5DKL A;  1CF0 A;  1K55 C;  3TE8 A;  4MMN A;  5HPF A;  2NUP C;  3F1N A;  3B42 A;  3SH7 A;  5DF8 A;  1NLY A;  4CQH A;  3QHY A;  3V39 A;  2FFF B;  1SKO A;  2UV0 E;  3NBL A;  4LCM A;  1NZU A;  3NUL A;  5EVI D;  1XKZ A;  3BQ8 A;  1ZHH B;  2W3F A;  3BFD A;  3FKW A;  3DWK A;  1VET B;  2VKS A;  3T4Q A;  4C75 A;  5FDS A;  2XA7 S;  5DF7 A;  3ZVW A;  3HLC A;  1NY0 A;  5FDH A;  4PAU A;  1IKG A;  5HDD A;  1RGZ A;  4Y0O A;  1YKD A;  4HOI A;  4DXC A;  1IKI A;  4P87 A;  1KGE A;  3IBR A;  4IUK A;  5M19 A;  1ESU A;  4CPK A;  3LFV A;  1Q2Q A;  5EEC A;  5E2E A;  4XXR A;  4R3J A;  4EBP A;  3R7W B;  2ZM2 A;  4NKP A;  1DP9 A;  1ERM A;  1JTD A;  2EX2 A;  1JWZ A;  1JNU A;  5HAR A;  4DE3 A;  4M3K A;  3C2W A;  4LEN A;  4HJ3 A;  4O7D A;  3RTY A;  1FR6 A;  4EQ1 A;  5EVE A;  2JKR I;  3T4T A;  4G3K A;  4GHI B;  1VB6 A;  3HLD A;  2ZC5 B;  1CJF A;  1UWP X;  5FQJ A;  3E4P A;  3FV7 A;  4S2J A;  5DFY A;  1LSW A;  4LLO B;  2EX8 A;  4GCZ A;  3BFG A;  4JGQ A;  3T4K A;  2XQZ A;  4DXB A;  3S7O A;  4PM9 A;  4X1L A;  5F82 A;  2H5S A;  4R3B A;  1VEU A;  5IHV A;  1BUL A;  1KVM A;  2KX6 A;  3LYX A;  5HWT A;  5IT5 A;  2VGL M;  1NZO A;  4MBK A;  2V8F A;  4NEE D;  4OOM A;  1NWZ A;  5BOH A;  3CAX A;  4XT2 B;  3WS5 A;  1K56 D;  4WZ5 C;  4L9E A;  2Y2Q A;  3HLG A;  5GHX A;  3QP2 A;  4Y15 A;  3M2K A;  4JXS A;  1LI0 A;  1ODV A;  3S4X A;  5TJJ A;  1W79 A;  3MFD A;  2ACG A;  4KZ8 A;  2ZM0 A;  3C4P A;  1EWZ A;  3AGD A;  2PD8 A;  4OQ0 A;  5TR7 A;  1E3U D;  4KG6 A;  4JF5 A;  2V0U A;  1XFN A;  5HAI A;  3BEB A;  4OPY A;  4LV1 A;  3N4I A;  2A2L A;  4JKT A;  1DJC A;  3PAE A;  5KIZ A;  5GLC A;  2Y2J A;  2ZC3 B;  1OTI A;  4II7 A;  1J3W A;  2PU2 A;  4KQR A;  2M7V A;  4I38 A;  4KZ3 A;  5EOE A;  2E8J A;  3HUM A;  4Q0H A;  5L8M A;  2ZL1 A;  2XGN A;  4WF0 A;  2P08 A;  1PI5 A;  4U0T A;  3T50 A;  4KZ5 A;  4PHT A;  1KDW A;  3NJA A;  3A0R A;  3HLB A;  4HIA A;  1W8Q A;  2QPN A;  4ZTK A;  5EOO A;  4D60 A;  3MMH A;  1PYY A;  5TBM A;  1Y4O A;  1JVJ A;  1PIO A;  2O99 A;  2P7J A;  3G30 A;  1K25 A;  1CI8 A;  3H7W B;  5DJT A;  1ES3 A;  2V9A A;  4OOL A;  1M40 A;  4C6Y A;  2P04 A;  2GNX A;  3T1R A;  2DCF A;  3HCY A;  3UE0 A;  3IBJ A;  5IS1 A;  1CK3 A;  4XUX A;  3UDX A;  3UO9 A;  4EV4 A;  2H0T A;  4HI4 A;  3RFB A;  4I3I A;  1FIL A;  3OOV A;  4KG5 A;  4C3Q A;  3IXG A;  1OJ5 A;  3DAV A;  5HSQ A;  2XA7 M;  4DN0 A;  3VSK A;  2XH9 A;  1MZU A;  1X0O A;  2HP6 A;  1ES2 A;  3G4P A;  3CJM A;  4RX2 A;  2XEP A;  5AVE A;  3U4L P;  4P6Z S;  3TG9 A;  3LGO A;  5F68 A;  3CI6 A;  1ZG6 A;  2G2W A;  2W1T B;  3BJN A;  4GJ4 A;  1BSG A;  4I39 A;  1OME A;  3NOP C;  1GHI A;  3MZE A;  3W4P A;  1TD5 A;  3EQU A;  3IF6 A;  1P9W A;  2HJ9 C;  1MWS A;  3WRT A;  3SS4 A;  3P09 A;  4A5R A;  2Y2K A;  3P01 A;  4UHU A;  4EU0 A;  5EE8 A;  1PNE A;  4RYE A;  3UB5 P;  2W3H A;  2EWW A;  4MCW A;  1BLP A;  5J4E A;  2O0Y A;  2RL3 A;  1SCW A;  3VFF A;  1GSW A;  3DW0 A;  1MC0 A;  1DJB A;  2LB9 A;  2Y2O A;  4WMC D;  2J80 A;  5EV0 A;  3CUE C;  2W3D A;  3KO6 A;  1CQA A;  4GKU A;  3PBT A;  4N1X A;  5CGX A;  2OOL A;  3T1S A;  1TEM A;  4HJ6 A;  1TS0 A;  3LEQ A;  2JC7 A;  1LSX A;  1BTL A;  3HVF A;  4WLA A;  4Y3I A;  2QMI A;  1TVF A;  4Y17 A;  4BMW A;  1NRF A;  4S2L A;  1MWT A;  2G2U A;  2XSS A;  3EGD C;  1K57 A;  4KQO A;  4GOG A;  3HLE A;  3E2K A;  5MC7 A;  2Z2L B;  2EXA A;  1HD8 A;  2WAD A;  4WZ4 A;  3MSH A;  3KYZ A;  2VA0 A;  3V5M A;  4F3L B;  1Y28 A;  3MQQ A;  5HD5 A;  3GDI A;  1H3Q A;  2R78 A;  3MZD A;  3VV4 A;  3HLF A;  2JKT I;  2Z6C A;  1K4F A;  4OPQ A;  2V1B A;  3C8C A;  2WKR A;  5HAQ A;  5DFX A;  1XJ4 A;  2Y79 A;  3LCE A;  3QP8 A;  3ZG0 A;  4GNU A;  2KLI A;  1D06 A;  3H82 B;  3RJU A;  3MZF A;  3NY4 A;  2IWB A;  2Q9M A;  5DVA A;  3T1Q B;  2J8Y A;  2K31 A;  5CHM A;  2YKF A;  4LFU A;  3PXP A;  4NK3 A;  3E0Y A;  2PDR A;  5HAP A;  5CXW A;  2KDK A;  4KQD A;  3IS2 A;  4QY5 A;  4NXG A;  1OT9 A;  4EEP A;  4X1M A;  4IHQ A;  2P9V A;  2XK1 A;  4MDZ A;  1W8Y A;  1MY8 A;  3NEC A;  3PHY A;  4HH3 A;  4HH2 A;  4KZ9 A;  5F1F A;  5HZH A;  4Q0I A;  3Q7V A;  2WKH A;  1GSX A;  1NLZ A;  3H9W A;  3IH9 A;  5TGF A;  5HL1 A;  1TS7 A;  5GLA A;  2HDS A;  3G6O A;  3KYQ A;  2ZC6 B;  4PM8 A;  3UB7 A;  3A3J A;  3LIB A;  3CWF A;  5EVI C;  2OWH A;  3HUO A;  1H0M A;  4FH2 A;  1FQG A;  4BD0 A;  2PRF A;  3FG8 A;  2WGI A;  2Y2H A;  1KOU A;  3GQZ A;  2L4R A;  2PBD P;  3F1O B;  4IVK A;  4MN7 A;  1L0E A;  4K0X A;  3LUQ A;  3V3S A;  2WKP A;  5I94 A;  1H5X A;  4P6Z M;  2J3T D;  4IJG A;  2XFS A;  5FAP A;  1OPX A;  4UAA A;  1S4R A;  1YLJ A;  5EVL A;  3F1P A;  1KE4 A;  4BBT A;  3A3E A;  5GHZ A;  3U2A A;  4DDY A;  1GHP A;  3Q1F A;  4Q0J A;  2INW A;  4S2N C;  4O0P A;  5AQB A;  4IBR A;  1N9L A;  1G6A A;  5AJG A;  1N9N A;  4E3O A;  4B4Z A;  3P7N A;  4DMZ A;  4MN6 A;  4EEU A;  2Y2N A;  3M6B A;  1YAX A;  4CLC C;  5FI2 A;  3HL9 A;  5EVI B;  4LCL A;  4KZA A;  3MF0 A;  3BRM A;  2AVX A;  5GL9 A;  3ZQ5 A;  2V2F F;  3LID A;  3EOI A;  4GS9 A;  4BBU A;  2ZC7 A;  5FQI A;  1EW0 A;  2WZX A;  3S1Y A;  4ETX A;  5EM0 A;  3ZDJ A;  4OH0 A;  3S7P A;  3ZG9 B;  4GLQ A;  1ACF A;  3UPN A;  1PW1 A;  2V8C A;  4WEK A;  1Q2P A;  1K54 A;  5J8X A;  3UPP A;  5CGS A;  2G7U A;  4UEY A;  3VE3 A;  2OSU A;  1FCO A;  4CLC B;  4PM5 A;  1PWD A;  2ZOH A;  3G2Z A;  4JLF A;  3SH8 A;  4R4S A;  1BLH A;  3NCK A;  3VOZ A;  3EEA A;  3W4O A;  3O88 A;  4K0W A;  3NOT C;  1ALQ A;  5K5B A;  3ISG A;  4HBU A;  4EES A;  3GMW A;  4X55 A;  4PKY G;  5AVF A;  1YQS A;  3PBS A;  3UB6 A;  3V3R A;  1BT5 A;  4ZDX A;  3CPT B;  4BEN A;  1LT0 A;  4CLC D;  4ZRR A;  4BQM A;  4HY8 A;  3NOU C;  3ITB A;  1T1B A;  4R3A A;  4GN2 A;  2Y2P A;  5EPH A;  4EW7 A;  3IX4 A;  3ICY A;  3KSG A;  3DWZ A;  1OTE A;  4NG2 A;  4ZBE A;  4PM7 A;  1VM1 A;  1S6R A;  1YPR A;  1N9O A;  3E98 A;  4QJG A;  4S2K A;  5FI6 A;  2A49 A;  3P98 A;  4WUJ A;  1K6S A;  4JF4 A;  1I5Q A;  1U60 A;  2V20 A;  1CI9 A;  3LIC A;  3ZFZ A;  3HJI A;  2BG1 A;  1PFL A;  3IXD A;  2WGW B;  2FH5 A;  3EQV A;  1VHM A;  1HVB A;  1GCE A;  4B88 A;  4OQI A;  3SS5 A;  5DTK A;  2WKE A;  3RXW A;  1F5M A;  4GD6 A;  2OLU A;  1K0K A;  1S1Z A;  3G31 A;  4N1H A;  1BLC A;  3FWL A;  1ZTU A;  1XJ3 A;  4OQG A;  2PHY A;  3FC7 A;  2QJ7 A;  1FIK A;  1NRJ A;  1NYM A;  1P9R A;  4JXV A;  3SS3 A;  1KDS A;  3LY4 A;  5HWW A;  1SHV A;  3OCL A;  2Y59 A;  5CX7 A;  3N6I A;  4GDN A;  4ESP A;  2H10 A;  1FSW A;  4E3L A;  2HJE A;  1CEF A;  3EWK A;  5HD3 A;  1KGG A;  4B4X A;  2GX5 A;  4CLC E;  3CMZ A;  3VFH A;  4BLM A;  2CC1 A;  1IYS A;  1H8Y A;  5FA7 A;  1RCJ A;  3GRJ A;  4KUK A;  3A3D A;  5FAS A;  3UDI A;  2I9V A;  5DKK A;  2QJ5 A;  2HDR A;  3UE6 A;  4ZJ1 A;  4O8G A;  5F83 A;  3BWL A;  5DTT A;  5E2H A;  5U47 A;  1FR1 A;  3ZG7 B;  1E25 A;  3G32 A;  2A24 B;  5AQ7 A;  1M6K A;  4DE2 A;  2JCH A;  3ITA A;  1ES5 A;  2WGV A;  3GR2 A;  4BWI A;  4OP8 A;  2Y4A A;  2VJW A;  3NI9 A;  1YMS A;  1ERQ A;  4OOY A;  4EWF A;  3LIA A;  3QP4 A;  4PPR A;  1GSV A;  4FCF A;  4PM6 A;  4CJN A;  4DJ2 A;  2K7S A;  4RQ9 A;  3W4Q A;  3FPV A;  2IWD A;  3OC2 A;  3TJZ C;  1F98 A;  4IBX A;  4R0Q A;  3N8S A;  3TOI A;  1KE0 A;  4NXF A;  2XR0 A;  3K3C A;  2R9W A;  2XD5 A;  3K2N A;  3ZVT A;  2B5R A;  1VQQ A;  2Y2I A;  4JBF A;  1XJ2 A;  5CTN A;  1XPB A;  5DJU A;  3F1N B;  3OZH A;  3VSL A;  1KVL A;  1O07 A;  2EXB A;  4HQA A;  3T4O A;  5CHU A;  3DTE A;  4ARZ A;  3D72 A;  3R4K A;  3C5A A;  2FFY A;  4X69 A;  5FAO A;  3QNB A; 
#chains in the Genus database with same CATH homology
 2P9V B;  1ERO A;  3PBR A;  4HES A;  3RJU A;  3MZF A;  4HEF A;  3V50 A;  3NY4 A;  2IWB A;  4DKI A;  1JWV A;  2Q9M A;  5DVA A;  5FQQ A;  3WWX A;  4Z9Q A;  2XF3 A;  2J8Y A;  4DF6 A;  3Q7Z A;  2XDM A;  5CHM A;  4MBF A;  3FYZ A;  4KQQ A;  1XA1 A;  3N8L A;  4OVD A;  1K55 C;  3Q7V B;  5DTS A;  4NK3 A;  4BD1 A;  3SH7 A;  5DF8 A;  5HAP A;  5CXW A;  3QHY A;  1KE3 A;  4X6T A;  4DRT A;  2ZQC A;  3V39 A;  4QY5 A;  2FFF B;  4P0M A;  4MLL A;  5CEC A;  3NBL A;  4LCM A;  3PBQ A;  1NZU A;  2RCX A;  4OLG A;  2PBY A;  5GLB A;  3O86 A;  5EVI D;  1XKZ A;  2EFX A;  2P9V A;  2XK1 A;  2OLV A;  1W8Y A;  3BFD A;  1MY8 A;  3FKW A;  4GZB A;  3ZNT A;  1PW8 A;  3DWK A;  4KZ9 A;  1DJA A;  5F1F A;  5CER A;  3UE3 A;  1L0F A;  4E3N A;  1ONG A;  4C75 A;  3Q7V A;  1XGI A;  4QY6 A;  2VGJ A;  1N4O A;  2WKH A;  3ZHH A;  5DF7 A;  3ZVW A;  4WEL A;  3HLC A;  5M1A A;  1NY0 A;  5FDH A;  3IH9 A;  3VP0 A;  1IKG A;  1SDN A;  5TGF A;  5HL1 A;  1K38 A;  2E8I A;  3W8K A;  1FCN A;  3GSG A;  3OPP A;  1RGZ A;  1HZO A;  4Y0O A;  5GLA A;  2Y2M A;  1LL9 A;  3PBN A;  4RX3 A;  2HDS A;  3CG5 A;  4DXC A;  1ES4 A;  2ZC6 B;  1IKI A;  4PM8 A;  4P87 A;  1KGE A;  5M19 A;  3A3J A;  1ESU A;  2Y2L A;  4CPK A;  2WAE A;  2Y2G A;  3IQA A;  1S0W A;  5EVI C;  2X01 A;  5A90 A;  1Q2Q A;  2J9P A;  5EEC A;  3HUO A;  1K54 C;  4FH2 A;  5E2E A;  4XXR A;  4R3J A;  1NJ4 A;  5A92 A;  1FQG A;  4S2N A;  5AQ9 A;  1SKF A;  4BD0 A;  4EBP A;  3WRZ A;  2ZM2 A;  3IXH A;  2WGI A;  1IYP A;  1JTD A;  1ERM A;  2EX2 A;  2HDU A;  2JE5 A;  2Y2H A;  4RVA A;  3GQZ A;  1JWZ A;  3IH8 A;  5HAR A;  4QHC A;  4DE3 A;  4UA7 A;  4M3K A;  3IHA A;  2ZD8 A;  5FI7 A;  4L0L A;  4LEN A;  2A3U A;  4Y0T A;  3VMA A;  4O7D A;  3AGE A;  4IVK A;  5AQA A;  3UDF A;  1FR6 A;  3VOY A;  3HRE A;  1L0E A;  1PWC A;  1CEG A;  1XGJ A;  1YLP A;  4K0X A;  4LV3 A;  1YLW A;  3V3S A;  1O7E A;  5I94 A;  5KSC A;  1H5X A;  3A3F A;  2C5W B;  2Q9N A;  2XFS A;  2ZC5 B;  3HLD A;  4FD8 A;  2WYX A;  1SDE A;  5FAP A;  4UAA A;  1W7F A;  1YLJ A;  3ZG5 A;  5EVL A;  3BYD A;  1K55 A;  1KE4 A;  5FQJ A;  3A3E A;  5GHZ A;  3FV7 A;  4S2J A;  4Y0U A;  3HLW A;  2EX9 A;  4DDY A;  1GHP A;  3Q1F A;  2XFT A;  1RP5 A;  2EX8 A;  4S2N C;  5FQK A;  5AQB A;  3BFG A;  4IBR A;  3BM6 A;  1G6A A;  3PBO A;  5E2F A;  4E3O A;  4B4Z A;  3Q82 A;  2Y2N A;  2XQZ A;  3LY3 A;  3M6B A;  4DXB A;  4PM9 A;  4ZJ3 A;  1E4D A;  5F82 A;  2H5S A;  4R3B A;  3A3I A;  5JYO A;  4GD8 A;  3JYI A;  3HL9 A;  1BUL A;  1KVM A;  2QZ6 A;  3OPH A;  4KZ4 A;  4LCL A;  5EVI B;  5FI2 A;  4KZA A;  3ZG8 B;  3BRM A;  4BL2 A;  3MXR A;  1NZO A;  5JYP A;  4MBK A;  3ZG0 A;  5GL9 A;  3OCN A;  4HBT A;  5TFQ A;  1DY6 A;  2V2F F;  2OV5 A;  2J7V A;  1PZO A;  4X53 A;  5A91 A;  1Z6F A;  5D3O A;  3VP3 A;  4OOM A;  2ZQ9 A;  3I7J A;  5BOH A;  2ZC7 A;  1IEL A;  5FQI A;  3IHB A;  3WS5 A;  2WZX A;  5HX9 A;  1K56 D;  3PTE A;  3S1Y A;  4F94 A;  2ZC4 B;  4WZ5 C;  2Y2Q A;  3HLG A;  5A93 A;  5GHX A;  3ZDJ A;  4KZ7 A;  1NXY A;  4OH0 A;  4U0X A;  3ZG9 B;  3M2K A;  4OPR A;  4YFM A;  4JXS A;  1G68 A;  1LI0 A;  4NET A;  3UE1 A;  1JWP A;  3S4X A;  3UPN A;  1BLS A;  1W79 A;  1PW1 A;  5EVI A;  4H8R A;  4WEK A;  4EBL A;  1Q2P A;  3MFD A;  1K54 A;  4YIN A;  3VP2 A;  3TSG A;  4IVI A;  4KZ8 A;  5J8X A;  4OKP A;  2JBF A;  4QJG A;  4XUZ A;  2ZM0 A;  1K4E A;  3UPP A;  3C4P A;  3UY6 A;  5CED A;  1EWZ A;  5HFO A;  5CGS A;  3C7V A;  5KSH A;  2H0Y A;  3AGD A;  3N8R A;  2HP9 A;  4PMA A;  2OSU A;  4OQ0 A;  4U3T A;  5TR7 A;  4X68 A;  1E3U D;  4KG6 A;  1FCO A;  4MEZ A;  4JF5 A;  5CEB A;  4N9L A;  3D4F A;  4PM5 A;  1LHY A;  1PWD A;  4JXG A;  5E43 A;  5EUA A;  1IYQ A;  3WS4 A;  3G2Z A;  5HAI A;  3BEB A;  4JLF A;  4JF6 A;  4OPY A;  4LV1 A;  3N4I A;  1WE4 A;  3SH8 A;  3O87 A;  4JKT A;  4R4S A;  4EUZ A;  1C3B A;  3IWI A;  1BLH A;  3GV9 A;  3NCK A;  3VOZ A;  3W4O A;  1L0D A;  1DJC A;  3O88 A;  3PAE A;  4K0W A;  5CHJ A;  1ALQ A;  3MKE A;  5GLC A;  1K6R A;  3ISG A;  4HBU A;  1NYY A;  2Y2J A;  1KGF A;  2IWC A;  2ZC3 B;  3GMW A;  4X55 A;  4E3I A;  1YQS A;  3PBS A;  4KQR A;  2PU2 A;  3V3R A;  3HBR A;  1BT5 A;  4ZDX A;  4KZ3 A;  5EOE A;  2C6W B;  3HUM A;  4KZ6 A;  1ESI A;  4BEN A;  3S22 A;  4BQM A;  4QB8 A;  2WK0 A;  1I2W A;  2XGN A;  4WBG A;  2VGK A;  4UA6 A;  4EBN A;  3IF6 C;  5KMW A;  1PI5 A;  4U0T A;  1QMF A;  2XLN A;  3Q07 A;  5G18 A;  3WS0 A;  4Y7P A;  4KZ5 A;  3ITB A;  1KDW A;  4N9K A;  2ZQ8 A;  4GN2 A;  2Y2P A;  3LO7 A;  5EPH A;  3HLB A;  4WEJ A;  5CRF A;  1W8Q A;  2QPN A;  3LEZ A;  1BZA A;  2WAF A;  4ZTK A;  5EOO A;  5DF9 A;  1PYY A;  1YMX A;  3DWZ A;  4ZBE A;  1JVJ A;  1PIO A;  4PM7 A;  1VM1 A;  1S6R A;  4BL3 A;  3G30 A;  4E3J A;  1K25 A;  1MWU A;  1CI8 A;  5CGW A;  2I72 A;  4MBH A;  1XA7 A;  2A49 A;  3P98 A;  3BEC A;  4S2K A;  4FSF A;  4S2P A;  4WZ5 A;  5FI6 A;  1ES3 A;  4JPM A;  1K6S A;  1GA9 A;  4JF4 A;  1I5Q A;  1MPL A;  1U60 A;  2V20 A;  4OOL A;  1CI9 A;  1M40 A;  4C6Y A;  5M18 A;  4E6W A;  3NC8 A;  5CTM A;  2DCF A;  3G35 A;  3UE0 A;  4QD4 A;  3BFF A;  1CK3 A;  4XUX A;  3UDX A;  4EQI A;  2ZLY A;  3UO9 A;  3E2L A;  3WS1 A;  3FZC A;  3VP1 A;  2PU4 A;  2R9X A;  3ZFZ A;  4EV4 A;  4LV2 A;  2BG1 A;  2ZJ9 A;  3GTC A;  3UNW A;  2H0T A;  4LV0 A;  1JTG A;  3IXD A;  2WGW B;  3AGF A;  5HW3 A;  3EQV A;  3ZNY A;  3C4O A;  4Q8I A;  4KG5 A;  1GHM A;  4C3Q A;  3IXG A;  1GA0 A;  1HVB A;  1GCE A;  2XH9 A;  4KG2 A;  3VSK A;  4B88 A;  1XX2 A;  2GDN A;  4ZAM A;  1LL5 A;  4S2O A;  4E6X A;  1ZG4 A;  4OQI A;  2HP6 A;  2X71 A;  5DTK A;  3SS5 A;  1K56 A;  4OQH A;  1ES2 A;  4K91 A;  2WKE A;  3RXW A;  1MKI A;  3G4P A;  2DRW A;  1FCM A;  3CJM A;  3FKV A;  4GD6 A;  2OLU A;  4RX2 A;  3IF6 B;  1K57 C;  4S2I A;  5GLD A;  2XEP A;  3G31 A;  1J9M A;  3IWO A;  4N1H A;  1BLC A;  2P74 A;  3FWL A;  3GVB A;  3C7U A;  5FSR A;  4OQG A;  3TG9 A;  3O3V A;  3CZD A;  4OON A;  3MXS A;  3M2J A;  1ZG6 A;  3B3X A;  1XP4 A;  2WGW A;  2G2W A;  2DNS A;  1NYM A;  2XD1 A;  3M6H A;  3IXB A;  4JXV A;  3SS3 A;  1KDS A;  3LY4 A;  1AXB A;  1BSG A;  1YM1 A;  1SHV A;  3OCL A;  2Y59 A;  4IED A;  1OME A;  3SH9 A;  1PWG A;  1HTZ A;  3N6I A;  4GDN A;  4S2M A;  4R23 A;  1GHI A;  3ZGA B;  4P85 A;  2H10 A;  3NDG A;  1WYB A;  1XXM A;  2ZQA A;  3MKF A;  3MZE A;  1FSW A;  1E3U A;  1MXO A;  3W4P A;  4E3L A;  1CEF A;  3BFC A;  3MBZ A;  5FQ9 A;  3BFE A;  1YLZ A;  3EQU A;  4KZB A;  1KGG A;  3IF6 A;  4B4X A;  3IF5 A;  2ZMA A;  3CMZ A;  4GDB A;  4R4R A;  3VFH A;  1W5D A;  3OPL A;  3VP4 A;  4E3K A;  1H8Z A;  1MWS A;  4OP5 A;  3WRT A;  4BLM A;  1FSY A;  4E3M A;  3SS4 A;  3ZCZ A;  2CC1 A;  1IYS A;  1H8Y A;  1QME A;  2BLS A;  3P09 A;  5FA7 A;  2Y2K A;  4A5R A;  1RCJ A;  3GRJ A;  3A3D A;  3IT9 A;  1WYC A;  4UHU A;  3UDI A;  5FAS A;  1PI4 A;  1Y54 A;  5EE8 A;  1YT4 A;  2HDR A;  4RYE A;  4ZJ1 A;  1TDG A;  3NIA A;  5F83 A;  1BLP A;  4MNR A;  1IEM A;  1YLT A;  4GB7 A;  3DTM A;  2RL3 A;  5DTT A;  1PZP A;  1SCW A;  5E2H A;  2ZM8 A;  5F1G A;  5U47 A;  1FR1 A;  3DW0 A;  3VFF A;  5FAT A;  4P6B A;  3ZG7 B;  5KZH A;  1E25 A;  1DJB A;  2Y2O A;  3RXX A;  3G32 A;  4WM9 A;  4WMC D;  4WMC A;  3HUN A;  3QNC A;  5AQ7 A;  4DE0 A;  1EI5 A;  4JXW A;  1M6K A;  5FQM A;  4DE2 A;  4GKU A;  3PAG A;  4DDS A;  4UA9 A;  3PBT A;  2WZZ A;  1ONH A;  4N1X A;  4X56 A;  5CGX A;  2JCH A;  3ITA A;  4ZJ2 A;  1ES5 A;  2WGV A;  5FAQ A;  3GR2 A;  3G34 A;  4OP8 A;  2Y4A A;  1TEM A;  4OLD A;  3SOI A;  3BLM A;  1N9B A;  2JC7 A;  3NI9 A;  4RA7 A;  3HVF A;  1BTL A;  1YMS A;  5IHV A;  1BUE A;  1ERQ A;  1I2S A;  4OOY A;  2ZQD A;  4EWF A;  2QMI A;  3NDE A;  4R1G A;  1TVF A;  4FH4 A;  2Z2M B;  5GHY A;  4BJP A;  1NRF A;  3G2Y A;  4S2L A;  1MWT A;  2J9O A;  4PPR A;  3UN7 A;  4FCF A;  4PM6 A;  2G2U A;  4CJN A;  4ID4 A;  3W4Q A;  1ZKJ A;  2HDQ A;  1K57 A;  2HPB A;  2IWD A;  1ZC2 A;  4KQO A;  3OC2 A;  4GOG A;  2X02 A;  4WYY A;  4IBX A;  4R0Q A;  3HLE A;  3UPO A;  1L2S A;  2EFU A;  3E2K A;  3N8S A;  2Z2L B;  3OPR A;  1KE0 A;  2EXA A;  2WKI A;  3TOI A;  3WS2 A;  5L2F A;  1MWR A;  1HD8 A;  2WUQ A;  2WAD A;  2XR0 A;  2R9W A;  2XD5 A;  2ZQ7 A;  3BLS A;  3IWQ A;  3ZVT A;  4D2O A;  4WZ4 A;  2B5R A;  4N92 A;  1L0G A;  4QU3 A;  5E2G A;  1VQQ A;  2V1Z A;  2Y2I A;  4KEN B;  2Y91 A;  4JBF A;  2EX6 A;  5CTN A;  1XPB A;  3V5M A;  1IYO A;  3N7W A;  3OZH A;  3VSL A;  3MZD A;  3Q81 A;  1KVL A;  1LI9 A;  1MBL A;  4OPZ A;  3HLF A;  2HP5 A;  1O07 A;  2EXB A;  1K4F A;  1TDL A;  4OPQ A;  5CHU A;  1RGY A;  1YLY A;  5HAQ A;  4DE1 A;  1LLB A;  3C5A A;  2FFY A;  1FOF A;  4X69 A;  2UWX A;  3LCE A;  3QNB A;  5FAO A;  2Y55 A;  4GNU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...