2H0YA

Crystal structure of the m69v e166a double mutant of shv-1 b-lactamase complexed to sulbactam
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
265
structure length
265
Chain Sequence
b'SPQPLEQIKLSESQLSGRVGMIEMDLASGRTLTAWRADERFPMVSTFKVVLCGAVLARVDAGDEQLERKIHYRQQDLVDYSPVSEKHLADGMTVGELCAAAITMSDNSAANLLLATVGGPAGLTAFLRQIGDNVTRLDRWATELNEALPGDARDTTTPASMAATLRKLLTSQRLSARSQRQLLQWMVDDRVAGPLIRSVLPAGWFIADKTGAGERGARGIVALLGPNNKAERIVVIYLRDTPASMAERNQQIAGIGAALIEHWQR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Beta-lactamase SHV-1
publication title Effect of the inhibitor-resistant M69V substitution on the structures and populations of trans-enamine beta-lactamase intermediates.
pubmed doi rcsb
source organism Klebsiella pneumoniae
molecule tags Hydrolase
total genus 99
structure length 265
sequence length 265
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2006-05-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13354 Beta-lactamase2 Beta-lactamase enzyme family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 2h0yA00
5EOEA 2ZM0A 2A3UA 4UA9A 2QMIA 4R3JA 3VP3A 2XK1A 2H0TA 2R9WA 4BL3A 3UDIA 3S4XA 1CEGA 3HLFA 1W7FA 3VSKA 1ESIA 4U0TA 5FQQA 1KE0A 3UDXA 4ID4A 1W79A 2CC1A 2Y2IA 5F83A 3SS4A 3S22A 4DXBA 5TGFA 1SHVA 4PMAA 4DDYA 5EVIB 4BLMA 5IHVA 2DNSA 2WADA 2XH9A 4WZ5C 3UPPA 3BYDA 1YLPA 4DE3A 4RYEA 1YMSA 2I72A 3ZVTA 4R23A 3ZG9B 4C6YA 3TG9A 1EROA 2EX2A 4B4ZA 2C5WB 2BLSA 2EFXA 4X68A 5DVAA 3ZG7B 5CHUA 5JYPA 3C7UA 3SH9A 1YLWA 4OONA 5FQMA 3W4OA 4S2JA 3WRZA 2QZ6A 3Q1FA 5A92A 1XGJA 4KQOA 3NDEA 3MZFA 4DDSA 1LI9A 5TFQA 4PPRA 3C4PA 5D3OA 1MPLA 3DWKA 3BFCA 4E3MA 2WZXA 2WGVA 3OCLA 1JWPA 4MBKA 4K91A 4C3QA 3Q07A 3OCNA 1S0WA 2VGJA 3PBQA 4Z9QA 1JTDA 1KE3A 5A91A 1IYOA 3IXGA 1MKIA 2HP5A 3B3XA 3GQZA 1MXOA 5CHMA 3MFDA 3MXRA 4Y0TA 5CTNA 3O86A 4PM6A 3FYZA 2P9VA 2XD1A 1IYPA 3N4IA 2ZQAA 1CEFA 4OPYA 5E2EA 1JWZA 2RL3A 1TVFA 4JF4A 5GL9A 2IWBA 2ZJ9A 3HLCA 5FI6A 5EE8A 4XXRA 3O87A 2WK0A 1K54C 2V20A 4R3BA 4P6BA 4WZ5A 4QY5A 1ES5A 3PBTA 1M6KA 4OQHA 1ES2A 1K57C 3MKEA 3V5MA 4UA6A 1IKGA 3NY4A 2EX9A 1Q2PA 2VGKA 4WZ4A 3SS3A 5E2FA 5AQ7A 3JYIA 1H5XA 4RA7A 1PZPA 1GA0A 1NYMA 3G35A 4U0XA 2J9OA 1KDWA 3IT9A 3HLEA 3GMWA 5FAQA 4S2KA 1LHYA 3GR2A 4QU3A 2C6WB 1PYYA 4X55A 3VP1A 4RX2A 1RGZA 1BLCA 5I94A 3SH7A 1NYYA 1G68A 4KZ8A 1YLZA 3A3FA 3DWZA 5DTKA 1SDEA 5U47A 3RJUA 3OPRA 4MEZA 4BD1A 4BQMA 4N1HA 2Y2NA 1GHPA 2ZC4B 3WS5A 3BLSA 5CGXA 4X69A 4OOYA 2Y2MA 4ZTKA 1XPBA 1DY6A 3IF6B 5HAPA 3G2YA 3QNBA 4HBTA 3WS2A 4N92A 4Y0UA 2Y2GA 2WAFA 2ZQ8A 4S2MA 4BD0A 2PU2A 1NZOA 4FD8A 2WGWB 3C5AA 4Q8IA 5EUAA 1HTZA 2OSUA 3BFEA 5GLDA 4KG6A 3I7JA 1K54A 3MXSA 1CK3A 1PWDA 1XA7A 4N9LA 4XUXA 1KDSA 5EVLA 3ITBA 4LV3A 1PIOA 4X6TA 5FASA 3LY4A 1I2WA 1K57A 3P98A 4KZ6A 1SKFA 3VFHA 2ZD8A 1O7EA 3G30A 1XXMA 2ZQ7A 3N6IA 3QHYA 4OOLA 2UWXA 5EVIC 2Y2PA 4LV1A 5CECA 5DTTA 2Y2HA 4CJNA 2ZM8A 3IWOA 2ZC6B 5FATA 1GHMA 5GLCA 3UY6A 4DF6A 4GDBA 1I2SA 4EBLA 4HESA 2OLVA 4UAAA 1PWGA 1BULA 3N8SA 3BRMA 4P85A 4OP8A 4BJPA 4LV0A 2WKEA 1PW1A 1ES3A 3BEBA 3CJMA 4E6WA 1CI9A 3A3JA 3LEZA 1W5DA 2FFFB 3FZCA 2H10A 3OPLA 4EQIA 4NETA 4U3TA 4DE0A 3Q82A 3E2KA 1VQQA 2EXBA 3EQUA 3GVBA 1YT4A 1TDGA 1DJAA 5GHYA 3C7VA 3WS1A 1EI5A 2ZC7A 3IQAA 5TR7A 1FR6A 1MWSA 1MY8A 2GDNA 5EVID 3SH8A 3UE1A 2ZC3B 3S1YA 1K4FA 5E43A 3Q81A 1IELA 2WYXA 2PBYA 2V2FF 2H0YA 2WKIA 3ZG8B 1L0DA 2IWCA 3VMAA 4E3LA 1C3BA 4PM7A 5AQBA 2Y2KA 1YLYA 3IXBA 2Y2QA 4JF5A 1BLPA 5GLBA 4BL2A 3BM6A 3ZNTA 3LO7A 3GRJA 3HUMA 2XGNA 4ZDXA 1YQSA 1U60A 1BZAA 1IYQA 4MBHA 4DXCA 1XX2A 2Y2JA 3Q7ZA 3WWXA 4OQGA 1VM1A 2JCHA 3BFGA 3G31A 4JXSA 5HX9A 5CGSA 4OVDA 4PM9A 4WELA 1SCWA 3NCKA 4RX3A 2J7VA 1NRFA 3G4PA 4ZJ3A 4GKUA 5HAIA 4C75A 5EVIA 1FOFA 1Z6FA 3V3RA 1PWCA 4LV2A 1IKIA 3TSGA 4GZBA 4FSFA 1L0FA 4FH2A 1K6RA 2XD5A 4WEKA 1JVJA 3IH8A 3BLMA 3RXWA 1BT5A 3GSGA 3OPHA 4KZ5A 2WAEA 3Q7VB 5CGWA 4E3KA 1LI0A 4GD6A 3HLWA 4ZJ2A 5DF9A 3CMZA 5E2GA 4KG5A 3V39A 3V3SA 3QNCA 3HUOA 1K56D 5HAQA 4P87A 1BLHA 3ZG5A 4JF6A 4OPZA 1RGYA 3PTEA 5HARA 4E3NA 3UE0A 4NK3A 4DKIA 1DJCA 2FFYA 5DF7A 1ESUA 4KZBA 4WEJA 4X53A 4E6XA 4DE2A 4ZAMA 5M18A 3A3EA 2A49A 2ZQCA 5A93A 4IBXA 3OC2A 3VOYA 3O3VA 1XKZA 5CEBA 5GHXA 4Y0OA 3ISGA 1FCNA 3IF6C 4MLLA 1PW8A 1K4EA 1KGFA 4MNRA 1ERMA 5FQ9A 1KE4A 4WM9A 1LL5A 3N8LA 3HREA 4IVIA 1JWVA 4WYYA 1K56A 5CEDA 1KVMA 2Q9MA 3A3DA 3PBNA 2EXAA 3G34A 2Y2OA 4S2IA 1K38A 1KGEA 3HLBA 1BSGA 4HBUA 3HUNA 2P74A 5KZHA 1NXYA 3O88A 1M40A 1FCMA 1DJBA 2Z2LB 4Y7PA 2WGIA 2HP6A 3VP0A 3NI9A 1N9BA 3M2KA 1HZOA 3AGFA 4OLGA 1FSWA 1PI4A 1K55C 4R1GA 5CHJA 4GN2A 3E2LA 3PBSA 5CERA 4GB7A 2JBFA 4P0MA 4E3IA 5FQIA 1W8YA 2ZM2A 1BUEA 1RCJA 1WE4A 3OPPA 3G32A 2J9PA 4MBFA 3P09A 4OQ0A 4R0QA 2Q9NA 4JXGA 1AXBA 4GDNA 1ZKJA 4KZ4A 1L0EA 3W4QA 1E3UD 3HLGA 4WMCD 2HDSA 3W4PA 4LCMA 4PM5A 2ZQ9A 4M3KA 4X56A 1K25A 1IYSA 3D4FA 4KZ3A 5GHZA 3AGDA 3IF6A 5M19A 2OV5A 1YLTA 1I5QA 3V50A 3IH9A 1N4OA 5FA7A 3ZFZA 5DTSA 4L0LA 1Y54A 3EQVA 2WGWA 3IWIA 2E8IA 4KZ9A 5FDHA 3IHBA 5J8XA 1MWRA 3FV7A 4LCLA 4R4SA 5FSRA 3N7WA 5EOOA 1ZG4A 4B4XA 5CTMA 1MWUA 3HBRA 2XR0A 1BTLA 4FCFA 4EUZA 4WBGA 4BENA 3M2JA 3M6HA 5BOHA 5DF8A 5KSCA 3AGEA 3FWLA 1E3UA 3NBLA 5F1GA 4KZ7A 3MZEA 1BLSA 4IBRA 4WMCA 2Y55A 3ZDJA 1S6RA 2HP9A 1K55A 3SOIA 2XF3A 4KG2A 1ERQA 4JLFA 1ES4A 1SDNA 3WS4A 3C4OA 2WKHA 4UA7A 2P9VB 3DTMA 4QB8A 4EBNA 4YINA 5FAPA 4K0WA 1MWTA 1YM1A 3VP4A 2Z2MB 3GTCA 4GOGA 2BG1A 2EX8A 2PU4A 3NIAA 5EECA 1NJ4A 3GV9A 1XGIA 3IF5A 4ZBEA 4S2LA 4F94A 1PI5A 5FI7A 3UNWA 4HEFA 3ZHHA 5CXWA 3IXDA 5HW3A 5KSHA 2EX6A 1NY0A 1CI8A 2OLUA 1NZUA 5F82A 3VP2A 2ZLYA 1J9MA 3BFFA 1IEMA 3NC8A 1O07A 5FI2A 3VSLA 1H8ZA 1W8QA 3FKWA 4H8RA 4JKTA 5EPHA 1GHIA 4LENA 4OP5A 3RXXA 2R9XA 5HFOA 3BECA 3PAGA 3IWQA 3W8KA 2HDUA 4OKPA 1K6SA 1YLJA 4E3JA 1OMEA 1L2SA 4N9KA 4OH0A 3MZDA 5A90A 2RCXA 2XEPA 1RP5A 1ONGA 3WS0A 4E3OA 4S2OA 1E25A 2X01A 1WYBA 3HLDA 1L0GA 1KVLA 3NDGA 2XQZA 1ZC2A 1QMFA 2G2WA 1G6AA 4YFMA 3UPNA 1EWZA 3UE3A 2WZZA 4EWFA 4JBFA 3TOIA 2JC7A 2H5SA 3LY3A 5AQ9A 2DRWA 3DW0A 1TDLA 1TEMA 4CPKA 4S2NC 2XFTA 3Q7VA 3SS5A 1GA9A 2Y2LA 4JXWA 1HD8A 3PBRA 5E2HA 4OQIA 1FCOA 5L2FA 2ZQDA 4KENB 5G18A 1MBLA 3A3IA 4QJGA 1FQGA 4OPRA 3UPOA 1Q2QA 5GLAA 4DE1A 4A5RA 1ONHA 2WUQA 3BFDA 3ZG0A 4O7DA 3OZHA 2HDQA 4IVKA 5AQAA 1ZG6A 3HVFA 4OOMA 2XLNA 1YMXA 4RVAA 4JPMA 5HL1A 2DCFA 1E4DA 2J8YA 2XFSA 1FR1A 4B88A 3MKFA 4KQRA 4S2PA 5FQKA 4FH4A 1HVBA 1KGGA 3ZCZA 2XDMA 3CZDA 2JE5A 1JTGA 3ZNYA 5F1FA 3ZVWA 1PZOA 3ITAA 4OLDA 4KQQA 2V1ZA 3UO9A 3ZGAB 4IEDA 5KMWA 3UN7A 1LL9A 2X02A 3IHAA 3M6BA 3PBOA 3UDFA 4EBPA 4ZJ1A 3WRTA 3N8RA 1QMEA 2HPBA 2Y91A 3G2ZA 2ZC5B 5FQJA 3MBZA 4QD4A 4QY6A 3VOZA 4PM8A 1WYCA 4D2OA 2B5RA 2G2UA 4R4RA 1H8YA 2EFUA 3LCEA 4N1XA 4KZAA 3CG5A 4XUZA 1FSYA 4EV4A 1LLBA 2HDRA 1XP4A 3FKVA 4GNUA 2X71A 5CRFA 4OPQA 5JYOA 2QPNA 1GCEA 2IWDA 3VFFA 4QHCA 1XA1A 2Y59A 3IXHA 4JXVA 4UHUA 4GD8A 2ZMAA 3PAEA 4S2NA 4DRTA 5FAOA 1ALQA 3HL9A 5M1AA 4K0XA 2Y4AA
chains in the Genus database with same CATH superfamily
5EOEA 3TRCA 3VP3A 2H0TA 3VSKA 2J3TD 2FZ0A 4DDYA 4BLMA 2DNSA 2WADA 3UPPA 3BYDA 1XFQA 1YMSA 4R23A 3QP5A 1EROA 4B4ZA 2V0UA 2BLSA 5FQMA 4KQOA 4DDSA 2WKQA 3K3CA 3W2ZA 5TFQA 5D3OA 3DWKA 4QPRA 2O99A 3Q07A 1S0WA 1KOUA 3UMEA 1JTDA 4WN5A 2HP5A 2IA2A 3B3XA 1MXOA 4X25A 5CHMA 1V9ZA 3MXRA 4DJ2A 1OPXA 4PM6A 3FYZA 4MN7A 2XD1A 1IYPA 2A24B 4I3JA 3N4IA 3MS6A 1JWZA 2RL3A 5DFXA 2IWBA 2ZJ9A 3HLCA 4XXRA 3T12B 2V20A 2OAQ1 3HCYA 4QY5A 3JVVA 1LSXA 2NUTC 3V5MA 1NRJA 1GA0A 4U0XA 1TS8A 1Y28A 3GMWA 5G4ZA 4S2KA 1LHYA 4QU3A 4RX2A 3MMHA 2UV0E 1G68A 4KZ8A 3DWZA 1SDEA 3OPRA 4BQMA 4CLCC 5CGXA 2INWA 2VX8A 1DP6A 3TW8A 3IF6B 3FG8A 3G2YA 1W63Q 4N92A 1G6OA 2PU2A 4FD8A 3F1NA 4L9EA 1XJ2A 2OSUA 3BY9A 3I7JA 3BW6A 1KDSA 3ITBA 4X6TA 5FASA 2P08A 1I2WA 3T4OA 2J3WA 2VV8A 3P98A 2ZD8A 1O7EA 3G30A 2QWSA 2ZQ7A 5DTTA 2ZM8A 5FATA 5GLCA 1I2SA 5HL6A 4HESA 2OLVA 1PWGA 1BULA 4OP8A 1ZHHB 2WKEA 3CJMA 3LEZA 4O8GA 1W5DA 1L3LA 1FILA 4GW9A 5HPIA 5L07A 1T18A 1D06A 3T4TA 1EI5A 3IQAA 1MWSA 3A0RA 3EGXC 3UE1A 4LRXC 2V2FF 3BY8A 3ZG8B 4R3AA 1YLYA 5GLBA 4JF5A 1BLPA 4BL2A 2OWHA 3BJNA 1YQSA 1S4SA 2XSSA 3QP8A 2V8FA 3Q7ZA 3PHYA 3G31A 5HX9A 4OVDA 4RX3A 2J7VA 4ZJ3A 4LV2A 1L0FA 4FH2A 1JVJA 3CPTA 5KIZA 4GD6A 4ZJ2A 3B47A 4KG5A 3V39A 4MMNA 2GJ3A 4P87A 1BLHA 4JF6A 4OPZA 5HARA 2VJWA 1DJCA 4WEJA 2YKFA 4X53A 2JN7A 4E6XA 1PFLA 1LSWA 4DE2A 4ZAMA 2A49A 2W3HA 1OTEA 1XKZA 1FCNA 3HREA 4IVIA 4Y13A 2EXAA 2HJ9C 3LR0A 1K38A 3HLBA 4HBUA 1XFNA 4LPZA 3BWLA 1FCMA 4CQHA 2Z2LB 4EEUA 3P01A 3VP0A 3M2KA 4R1GA 4LRYC 3E2LA 3PBSA 4GB7A 2JBFA 5K5BA 4P0MA 2BASA 2ZM2A 1WE4A 3OPPA 2Q9NA 1L0EA 3HLGA 4M3KA 4I39A 3D72A 4I5SA 1I5QA 4ME4A 5DTSA 1Y54A 2E8IA 2V9AA 2PD7A 5FSRA 3E4OA 1MWUA 1HLUP 2XR0A 1N9LA 1DP8A 5DF8A 5KSCA 3FWLA 1BLSA 2Y55A 3ZDJA 3SOIA 1K0KA 3WS4A 2WKHA 4UA7A 4GHIA 4LRZE 4YINA 3VP4A 4GOGA 3CUEC 4E04A 3NIAA 3FPWA 1NJ4A 3GV9A 4S2LA 1PI5A 5HSQA 3UNWA 2W1RA 2JKFA 4YNRA 2OLUA 1TS6A 3BFFA 3C2WA 4H8RA 1W8QA 2R9XA 1WA9A 3W8KA 2HDUA 1K6SA 1S4RA 3LIEA 1RP5A 1G5UA 2WKPA 2M7UA 1F5MA 1KVLA 3NDGA 5FEFA 3HJIA 4Q0JA 5DKKA 4MN6A 4YFMA 3LICA 1EWZA 3UE3A 2WZZA 4S2NC 3Q7VA 2ZOIA 3CUEA 3F1NB 3R7WA 3PBRA 1XJ3A 4KENB 1MBLA 4ZRRA 1Q2QA 3T4KA 3ZG0A 3T1XA 3OZHA 4KQDA 1AWIA 2XLNA 4G3KA 1LL8A 2W3EA 1Z09A 1VB6A 4KQRA 3ZVWA 4OLDA 3UO9A 4KQQA 2V1ZA 3UN7A 5DJUA 3M6BA 3PBOA 4GCZA 2PR5A 3VOZA 2PAVP 4PM8A 1WYCA 4XUZA 4EV4A 2DMWA 2W27A 3C38A 4KUKA 3RFBA 4OPQA 2P04A 2QPNA 2Q0OA 3GECA 4JXVA 3PAEA 4S2NA 4K0XA 2Y4AA 5HDDA 4UA9A 3QP6A 1CEGA 3HLFA 1ESIA 4EXOA 3P7NA 4U0TA 5FQQA 1W79A 5F83A 3SS4A 4DXBA 5TGFA 5IHVA 4WZ5C 1YLPA 4NXBA 3MQ0A 2I72A 3CPTB 3ZVTA 3HJKA 2OOLA 3C7UA 1YLWA 4OONA 3W4OA 4ARZA 3Q1FA 3NDEA 3BFCA 4E3MA 2WZXA 2B95A 2WGVA 4C3QA 3UB7A 3OCNA 2VGJA 1F9IA 4EUVA 1KE3A 3EEAA 4CLCE 3GQZA 5AVEA 3O86A 2ZQAA 1CEFA 3C8CA 1TVFA 4O01A 1VETA 5FI6A 3O87A 4HHDA 2WK0A 3LEQA 2JKRI 4P6BA 4WZ5A 1M6KA 1ES2A 1K57C 3MKEA 5LBRA 4BENA 2VGKA 1Q2PA 5FL3A 3SS3A 2E8JA 4LLOB 2VZWA 1NYMA 3G35A 5IT5A 2J9OA 1KDWA 3HLEA 3GR2A 4MN5A 5I94A 1NYYA 5A8BA 1YLZA 3A3FA 5DTKA 5U47A 3U4LP 2Y2NA 4F3LA 4ZTKA 1UGUA 3QNBA 4HBTA 5G4YA 2HV1A 3WS2A 4Y0UA 2WAFA 1ACFA 2ZQ8A 1IFQA 4QWOA 3LR4A 1HTZA 3E4QA 4WUJA 2GX5A 1S67L 3ULFA 1Y4OA 4R6LA 4BWIA 1PIOA 1K57A 2HJEA 4PKYG 1SKFA 3VFHA 1XXMA 3QHYA 2UWXA 2L0WA 4LV1A 3UY6A 2ZC6B 4GHIB 4ETZA 1F98A 4UAAA 3VV4A 1YAXA 3BRMA 3LIFA 1CI9A 1D1JA 1GSWA 3FZCA 3KYEA 4EQIA 4NETA 4Q0IA 3Q82A 1VQQA 1YT4A 1DJAA 2PYPA 5HDSA 5GHYA 5HZHA 4K08A 2ZC7A 3PYPA 2VKSA 2PD8A 1MY8A 2GDNA 4D60A 1K4FA 1PRQA 2WKIA 4E3LA 3EGDC 3E98A 4PM7A 5AQBA 3IXBA 5F68A 3LO7A 4NKPA 2XGNA 1U60A 4MBHA 2Z6CA 3TJZC 1XX2A 4PKYA 3WWXA 3BFGA 5CGSA 3KSFA 1PNEA 3G4PA 5HAIA 3NULA 1A0KA 3NOTC 1PWCA 1IKIA 3TSGA 1K6RA 4KZ5A 3Q7VB 3R7WB 4EETB 4E3KA 2V1AA 1ODVA 5DF9A 3QNCA 1K56D 3PTEA 4HJ3A 4DKIA 2FFYA 3EEHA 5M18A 4BBUA 4IBXA 5CEBA 4MLLA 1KGFA 5HD5A 3CLOA 2HGVA 2PR6A 1K56A 5CEDA 2Q9MA 3NHQA 2Y2OA 4X1MA 1V9YA 4S2IA 5F5YA 3U2AA 1BSGA 3UB6A 3HUNA 2P74A 1EW0A 5KZHA 1S1ZA 3O88A 1M40A 3ZQ5A 2ZOHA 3H7WA 4IHQA 4OLGA 2O0YA 1PI4A 1K55C 5CHJA 4GN2A 1X0OA 4B9OA 4E3IA 1W8YA 1BUEA 2P7JA 3G32A 4CLCD 2J9PA 4XT2A 4OQ0A 4JXGA 4WL9A 1ZKJA 4GLQA 2K7SA 2ZBBA 5I5LA 1K25A 3D4FA 5EFWA 3S7NA 3AGDA 3BQ8A 5EM0A 3V50A 4ARZB 4HIAA 3ZFZA 3EQVA 3IX8A 2WGWA 2QKPA 1P9WA 3KX0X 5J8XA 2L4RA 3KSIA 4LCLA 3N7WA 4CLCA 2CMNA 1BTLA 4FCFA 1SZVA 1ZTUA 4II7A 3AGEA 1VEUA 3NBLA 2J80A 5F1GA 1K55A 2ZMVA 4KG2A 4JLFA 1T1AA 1VHMA 3T4JA 2GNXA 5IU1A 3GTCA 2HF6A 5F69A 3L7HA 2LB9A 5C5KA 2BG1A 2PU4A 1VETB 3IF5A 3ZHHA 5CXWA 3IXDA 4DN0A 2EX6A 1J9MA 4AFIA 2XROA 3FKWA 4JKTA 4ESPA 5EPHA 1GHIA 2Y8HA 2V0WA 3PAGA 1OMEA 4H6JA 4N9KA 3MZDA 2XEPA 4E3OA 2QHKA 1LT0A 2X01A 2XQZA 1ZC2A 1QMFA 5HWWA 4F3LB 1P0ZA 2JC7A 2EWVA 4MCWA 4P6ZM 3RTYA 1TEMA 4CPKA 2XFTA 1GA9A 4JXWA 3CI6A 4OQIA 5G18A 3A3IA 3OBFA 4QJGA 1FQGA 2L1MA 4X1LA 2WUQA 4EERA 1T19A 2HDQA 1ZG6A 1YMXA 4RVAA 3NOUC 2W1TA 5HL1A 1TS7A 2VGLS 3MKFA 5FQKA 1KGGA 2XDMA 2JE5A 3ZNYA 5F1FA 1NLZA 4IEDA 1GSXA 2X02A 3IHAA 2JKRM 3V67A 4BBTA 5HPFA 1H8YA 4N1XA 4KZAA 1LLBA 1XP4A 2FH5A 2QYBA 5JYOA 5F6AA 5J7EA 1W63M 1XA1A 2ZMAA 4DRTA 2O9CA 1ALQA 3HL9A 5M1AA 3S7PA 3DTKA 2A3UA 3PXPA 2Z6DA 4BL3A 3UDIA 1W7FA 3D9YA 5L09A 1KE0A 1XJ4A 4ID4A 3UDXA 3QP1A 3MFXA 4PMAA 2XH9A 4Y5FA 2VEAA 4DE3A 4G3WA 3TG9A 4IJGA 4LFUA 2C5WB 2EFXA 3ZG7B 5CHUA 5JYPA 2XRNA 3SW1A 4S2JA 1XGJA 1YPRA 4NXEA 1MKMA 1H3QA 3T4LA 4PPRA 3T50A 3PBQA 5A91A 1IYOA 3F1OA 1DRMA 3IXGA 1MC0A 1UWPX 1FIKA 1MKIA 3NOPC 3DAVA 3NECA 3MFDA 3VOLA 4Y0TA 4Z1WA 4NEED 5CTNA 2R78A 5EM1A 2PRFA 4OPYA 3B42A 4JF4A 5GL9A 1K54C 1UWNX 1ES5A 3MF0A 4UA6A 1IKGA 3H7WB 2VV6A 3NY4A 4WZ4A 2K31A 5E2FA 3JYIA 3OOVA 4RA7A 4FUWA 3IT9A 3UMDA 5FAQA 5MC7A 1PYYA 1S1YA 4HJ6A 4O0PA 3SZTA 3TE8A 2OAP1 1RGZA 5TJJA 2VGLM 1BLCA 2PDRA 4XT2B 3SH7A 3RJUA 4MEZA 3OLOA 4GS9A 1GHPA 3WS5A 4X69A 4DJ3A 1XPBA 5HAPA 2OWJA 4S2MA 4BD0A 2WGWB 2NUPC 4Q8IA 5GLDA 4KG6A 4IUHA 1K54A 5CX7A 1CK3A 4CLCB 1PWDA 4N9LA 4XUXA 5EVLA 4LV3A 3LY4A 1VEUB 2ZL1A 4KZ6A 3N6IA 2PHYA 5EVIC 2Y2PA 5CECA 2PBDP 2Y2HA 2JKTI 4DF6A 1GHMA 4GDBA 2XA7S 4LV0A 1PW1A 1ES3A 3T1QB 4YOFA 3LI8A 2FFFB 4DE0A 2YKHA 3EQUA 3KSHA 3GVBA 3C7VA 5TR7A 5EVID 3SH8A 2ZC3B 1OT9A 5E43A 1H8MA 1L0DA 1H0MA 1C3BA 2Y2KA 4H6JB 2Y2QA 3GRJA 3HUMA 2EA9A 4ZDXA 3MSHA 1VM1A 4WELA 1SCWA 3NCKA 1NRFA 4GKUA 4C75A 5EVIA 1FOFA 1Z6FA 3V3RA 1CQAA 4WEKA 3IH8A 3BLMA 3H82A 3GSGA 2WAEA 3CMZA 4E3NA 2O9AA 3UE0A 4NK3A 2M7VA 2W1TB 4KZBA 5DF7A 1IOUA 5HWTA 1MZUA 4I3AA 3LYXA 5A93A 3D3OA 3ISGA 1T1CA 1PW8A 3H9WA 1KE4A 1LL5A 3N8LA 3E0YA 4WYYA 1KVMA 3G34A 1KGEA 3IX3A 2W0NA 4WF0A 1DJBA 2HP6A 3O5YA 3F1PA 1RCJA 1OTDA 5DFYA 1AXBA 4KZ4A 3IS2A 2XA7M 4JGPA 1E3UD 2BTFP 4WMCD 3W4PA 2HZ5A 4PM5A 4X56A 1GSVA 4KZ3A 5GHZA 4Q0HA 3IH9A 1N4OA 5FA7A 3RH8B 2K2NA 4KZ9A 5FDHA 3IHBA 5J4EA 1MWRA 5EOOA 1ZG4A 4JGRA 3G6OA 4B4XA 4NXGA 4EUZA 4NG2A 4WBGA 3M6HA 3F1OB 2H28A 1E3UA 4KZ7A 4WMCA 2HP9A 3R4KA 1SDNA 3C4OA 4MDZA 4WLAA 3DTMA 4QB8A 4EBNA 1MWTA 3LR5A 2EX8A 2I9VA 4ZBEA 4JGOA 5FI7A 2WKRA 4HEFA 4KUOA 5KSHA 5HD3A 3VP2A 1CI8A 1N9NA 1NZUA 5F82A 3UB9A 2QJ7A 3NC8A 4IUKA 5FI2A 3VSLA 1P97A 4LENA 5EV0A 4I38A 3IWQA 3K3DA 1CJFA 4OKPA 1OJGA 1YLJA 2B02A 1L2SA 4G3VA 4OH0A 3B33A 2RCXA 5L8MA 1ONGA 2VA0A 1D7EA 4S2OA 1E25A 2G2WA 4GS9B 2EWWA 5FEGA 3UPNA 3CITA 4EWFA 4JBFA 5AQ9A 2H5SA 1TS0A 4P6ZS 1TDLA 1TD5A 4HI4A 3FC7A 3DTIA 2Y2LA 1HD8A 1FCOA 2ZQDA 1DP9A 3QP4A 4A5RA 1ONHA 3BFDA 3LGOA 2ZL1B 4HH2A 5AQAA 4OOMA 4JPMA 2DCFA 2J8YA 2XFSA 4B88A 4S2PA 1STZA 4Y2FA 4FH4A 1JTGA 2V8CA 1PZOA 4UQIS 3ZGAB 3JVUA 3UDFA 4EBPA 1QMEA 2Y91A 2MJ6A 3MR0A 4QY6A 5AJGA 2B5RA 2G2UA 3UB8A 2VLGA 2HDRA 2X71A 3JPUA 1GCEA 4QHCA 4UHUA 4GD8A 3L9KA 2ZM0A 2QMIA 4R3JA 3T1RA 2XK1A 2R9WA 3S4XA 5TBMA 3KYZA 1OT6A 1P9RA 2CC1A 2Y2IA 3S22A 4M4XA 4HQAA 1SHVA 5EVIB 4PAUA 4RYEA 3LIAA 1J3WA 4C6YA 3H82B 3ZG9B 4LGWA 2EX2A 5DVAA 4X68A 1LSVA 2D01A 3SH9A 5HDCA 3WRZA 2QZ6A 3LR3A 5A92A 3MZFA 1LI9A 4HH3A 2KDKA 3C4PA 1MPLA 4DMZA 3OCLA 1JWPA 4MBKA 4K91A 4Z9QA 2JKTM 1OTAA 4BBVA 4R70A 1YSPA 2P9VA 3LIDA 3LUQA 2M1CA 5E2EA 5EE8A 1SKOA 4R3BA 1F2KA 4GJ4A 4YWZA 4OQHA 3PBTA 2EX9A 5AQ7A 1H5XA 1BYWA 1PZPA 3LFVA 3NJAA 1CF0A 3F1PB 4X55A 2C6WB 3CWFA 3VP1A 4EQ1A 2ACGA 3MJQA 4BMWA 4EEPA 3IS2B 2O9BA 1TF1A 4UQIM 4BD1A 4N1HA 2ZC4B 3BLSA 4OOYA 2Y2MA 3LIBA 1G28A 1DY6A 1NLYA 2Y2GA 4FOFA 3KYQA 3GDIA 4I3IA 1NZOA 3C5AA 5EUAA 3BFEA 2GZAA 3IBRA 3MXSA 1XA7A 3T4SA 3C30A 3KO6A 4L9FA 2JHEA 4OOLA 5L10A 4CJNA 3IWOA 4PHTA 4EBLA 2W3FA 3N8SA 4BJPA 4P85A 3IX4A 3BEBA 3ICYA 4E6WA 3A3JA 3MQQA 5AVFA 2H10A 4RQ9A 3OPLA 4U3TA 3E2KA 2EXBA 5HWVA 1TDGA 1YSQA 3WS1A 3ZYTA 3EWKA 2G7UA 1FR6A 3A0SA 2KX6A 3S1YA 3T4QA 3Q81A 1IELA 2WYXA 2PBYA 2H0YA 2W3DA 2IWCA 3VMAA 1JNUA 3FPVA 3BM6A 3ZNTA 1XJ6A 3KSGA 1BZAA 1IYQA 4DXCA 2Y2JA 4Y15A 4OQGA 2JCHA 4JXSA 3VE3A 2KOIA 4PM9A 5IS1A 1OTBA 3QP2A 4GZBA 4FSFA 3CHWP 2XD5A 3RXWA 1BT5A 3OPHA 5CGWA 1LI0A 3HLWA 5E2GA 3V3SA 3HUOA 5HAQA 3ZG5A 1RGYA 2B18A 4B93A 5J3WA 1ESUA 2V1BA 3A3EA 2ZQCA 2A2LA 3OC2A 3VOYA 3O3VA 5GHXA 4Y0OA 3IF6C 1K4EA 4MNRA 2A24A 1ERMA 5FQ9A 4WM9A 4NXFA 2PT7A 1JWVA 2VK3A 3A3DA 3PBNA 1NXYA 4Y7PA 2WGIA 2PYRA 3NI9A 1N9BA 3BQAA 1HZOA 3AGFA 1FSWA 3S7OA 4R38A 5CERA 5FQIA 5TBMB 5FDSA 4MBFA 3P09A 4R0QA 4HP9A 4L9GA 4GDNA 2ZMFA 3VE4A 3W4QA 2HDSA 4LCMA 2ZQ9A 1IYSA 3DTEA 2JKGA 3IF6A 5M19A 2OV5A 1YLTA 4HP4A 4L0LA 3IWIA 2Y79A 4HY8A 4ETXA 3FV7A 4R4SA 5CTMA 3HBRA 4Y17A 3M2JA 3UE6A 5BOHA 4HOIA 3MZEA 4IBRA 3T1SA 1S6RA 2VV7A 2XF3A 1ERQA 1ES4A 5EVEA 2P9VB 5FAPA 4K0WA 1YM1A 2Z2MB 2KLIA 5EECA 5DKLA 4EU0A 1XGIA 1SKOB 4F94A 3E4PA 5HW3A 3MXQA 1NY0A 2ZLYA 1IEMA 1O07A 1H8ZA 3IBJA 4OP5A 3RXXA 5HFOA 3S7QA 3BECA 4HNBA 4E3JA 3UB5P 4UEYA 5A90A 3MQOA 1N9OA 3WS0A 1OJ5A 1WYBA 3HLDA 1L0GA 2QJ5A 1G6AA 3TOIA 3LY3A 2DRWA 3DW0A 1T1BA 1S66L 3SS5A 5L2FA 5E2HA 3LI9A 4OPRA 3UPOA 5GLAA 4DE1A 4Y3IA 4O7DA 4EESA 1NWZA 4IVKA 3HVFA 1YKDA 4EW7A 1E4DA 1FR1A 3ZCZA 1HVBA 3CZDA 3A0VA 3ITAA 2LB5A 5KMWA 2D02A 3PR6A 1LL9A 3DBAA 4ZJ1A 3WRTA 3N8RA 2W3GA 2HPBA 3G2ZA 2ZC5B 5FQJA 3MBZA 4QD4A 4FTXA 4D2OA 4R4RA 2AVXA 1OTIA 2EFUA 3LCEA 2J3TC 3CG5A 1FSYA 3K2NA 4HJ4A 3FKVA 4GNUA 5CRFA 4JGQA 5DJTA 2IWDA 3VFFA 2Y59A 3IXHA 3EOIA 3CAXA 5FAOA
chains in the Genus database with same CATH topology
5EOEA 2ZM0A 2A3UA 4UA9A 2QMIA 4R3JA 3VP3A 2XK1A 2H0TA 2R9WA 4BL3A 3UDIA 3S4XA 1CEGA 3HLFA 1W7FA 3VSKA 1ESIA 4U0TA 5FQQA 1KE0A 3UDXA 4ID4A 1W79A 2CC1A 2Y2IA 5F83A 3SS4A 3S22A 4DXBA 5TGFA 1SHVA 4PMAA 4DDYA 5EVIB 4BLMA 5IHVA 2DNSA 2WADA 2XH9A 4WZ5C 3UPPA 3BYDA 1YLPA 4DE3A 4RYEA 1YMSA 2I72A 3ZVTA 4R23A 3ZG9B 4C6YA 3TG9A 1EROA 2EX2A 4B4ZA 2C5WB 2BLSA 2EFXA 4X68A 5DVAA 3ZG7B 5CHUA 5JYPA 3C7UA 3SH9A 1YLWA 4OONA 5FQMA 3W4OA 4S2JA 3WRZA 2QZ6A 3Q1FA 5A92A 1XGJA 4KQOA 3NDEA 3MZFA 4DDSA 1LI9A 5TFQA 4PPRA 3C4PA 5D3OA 1MPLA 3DWKA 3BFCA 4E3MA 2WZXA 2WGVA 3OCLA 1JWPA 4MBKA 4K91A 4C3QA 3Q07A 3OCNA 1S0WA 2VGJA 3PBQA 4Z9QA 1JTDA 1KE3A 5A91A 1IYOA 3IXGA 1MKIA 2HP5A 3B3XA 3GQZA 1MXOA 5CHMA 3MFDA 3MXRA 4Y0TA 5CTNA 3O86A 4PM6A 3FYZA 2P9VA 2XD1A 1IYPA 3N4IA 2ZQAA 1CEFA 4OPYA 5E2EA 1JWZA 2RL3A 1TVFA 4JF4A 5GL9A 2IWBA 2ZJ9A 3HLCA 5FI6A 5EE8A 4XXRA 3O87A 2WK0A 1K54C 2V20A 4R3BA 4P6BA 4WZ5A 4QY5A 1ES5A 3PBTA 1M6KA 4OQHA 1ES2A 1K57C 3MKEA 3V5MA 4UA6A 1IKGA 3NY4A 2EX9A 1Q2PA 2VGKA 4WZ4A 3SS3A 5E2FA 5AQ7A 3JYIA 1H5XA 4RA7A 1PZPA 1GA0A 1NYMA 3G35A 4U0XA 2J9OA 1KDWA 3IT9A 3HLEA 3GMWA 5FAQA 4S2KA 1LHYA 3GR2A 4QU3A 2C6WB 1PYYA 4X55A 3VP1A 4RX2A 1RGZA 1BLCA 5I94A 3SH7A 1NYYA 1G68A 4KZ8A 1YLZA 3A3FA 3DWZA 5DTKA 1SDEA 5U47A 3RJUA 3OPRA 4MEZA 4BD1A 4BQMA 4N1HA 2Y2NA 1GHPA 2ZC4B 3WS5A 3BLSA 5CGXA 4X69A 4OOYA 2Y2MA 4ZTKA 1XPBA 1DY6A 3IF6B 5HAPA 3G2YA 3QNBA 4HBTA 3WS2A 4N92A 4Y0UA 2Y2GA 2WAFA 2ZQ8A 4S2MA 4BD0A 2PU2A 1NZOA 4FD8A 2WGWB 3C5AA 4Q8IA 5EUAA 1HTZA 2OSUA 3BFEA 5GLDA 4KG6A 3I7JA 1K54A 3MXSA 1CK3A 1PWDA 1XA7A 4N9LA 4XUXA 1KDSA 5EVLA 3ITBA 4LV3A 1PIOA 4X6TA 5FASA 3LY4A 1I2WA 1K57A 3P98A 4KZ6A 1SKFA 3VFHA 2ZD8A 1O7EA 3G30A 1XXMA 2ZQ7A 3N6IA 3QHYA 4OOLA 2UWXA 5EVIC 2Y2PA 4LV1A 5CECA 5DTTA 2Y2HA 4CJNA 2ZM8A 3IWOA 2ZC6B 5FATA 1GHMA 5GLCA 3UY6A 4DF6A 4GDBA 1I2SA 4EBLA 4HESA 2OLVA 4UAAA 1PWGA 1BULA 3N8SA 3BRMA 4P85A 4OP8A 4BJPA 4LV0A 2WKEA 1PW1A 1ES3A 3BEBA 3CJMA 4E6WA 1CI9A 3A3JA 3LEZA 1W5DA 2FFFB 3FZCA 2H10A 3OPLA 4EQIA 4NETA 4U3TA 4DE0A 3Q82A 3E2KA 1VQQA 2EXBA 3EQUA 3GVBA 1YT4A 1TDGA 1DJAA 5GHYA 3C7VA 3WS1A 1EI5A 2ZC7A 3IQAA 5TR7A 1FR6A 1MWSA 1MY8A 2GDNA 5EVID 3SH8A 3UE1A 2ZC3B 3S1YA 1K4FA 5E43A 3Q81A 1IELA 2WYXA 2PBYA 2V2FF 2H0YA 2WKIA 3ZG8B 1L0DA 2IWCA 3VMAA 4E3LA 1C3BA 4PM7A 5AQBA 2Y2KA 1YLYA 3IXBA 2Y2QA 4JF5A 1BLPA 5GLBA 4BL2A 3BM6A 3ZNTA 3LO7A 3GRJA 3HUMA 2XGNA 4ZDXA 1YQSA 1U60A 1BZAA 1IYQA 4MBHA 4DXCA 1XX2A 2Y2JA 3Q7ZA 3WWXA 4OQGA 1VM1A 2JCHA 3BFGA 3G31A 4JXSA 5HX9A 5CGSA 4OVDA 4PM9A 4WELA 1SCWA 3NCKA 4RX3A 2J7VA 1NRFA 3G4PA 4ZJ3A 4GKUA 5HAIA 4C75A 5EVIA 1FOFA 1Z6FA 3V3RA 1PWCA 4LV2A 1IKIA 3TSGA 4GZBA 4FSFA 1L0FA 4FH2A 1K6RA 2XD5A 4WEKA 1JVJA 3IH8A 3BLMA 3RXWA 1BT5A 3GSGA 3OPHA 4KZ5A 2WAEA 3Q7VB 5CGWA 4E3KA 1LI0A 4GD6A 3HLWA 4ZJ2A 5DF9A 3CMZA 5E2GA 4KG5A 3V39A 3V3SA 3QNCA 3HUOA 1K56D 5HAQA 4P87A 1BLHA 3ZG5A 4JF6A 4OPZA 1RGYA 3PTEA 5HARA 4E3NA 3UE0A 4NK3A 4DKIA 1DJCA 2FFYA 5DF7A 1ESUA 4KZBA 4WEJA 4X53A 4E6XA 4DE2A 4ZAMA 5M18A 3A3EA 2A49A 2ZQCA 5A93A 4IBXA 3OC2A 3VOYA 3O3VA 1XKZA 5CEBA 5GHXA 4Y0OA 3ISGA 1FCNA 3IF6C 4MLLA 1PW8A 1K4EA 1KGFA 4MNRA 1ERMA 5FQ9A 1KE4A 4WM9A 1LL5A 3N8LA 3HREA 4IVIA 1JWVA 4WYYA 1K56A 5CEDA 1KVMA 2Q9MA 3A3DA 3PBNA 2EXAA 3G34A 2Y2OA 4S2IA 1K38A 1KGEA 3HLBA 1BSGA 4HBUA 3HUNA 2P74A 5KZHA 1NXYA 3O88A 1M40A 1FCMA 1DJBA 2Z2LB 4Y7PA 2WGIA 2HP6A 3VP0A 3NI9A 1N9BA 3M2KA 1HZOA 3AGFA 4OLGA 1FSWA 1PI4A 1K55C 4R1GA 5CHJA 4GN2A 3E2LA 3PBSA 5CERA 4GB7A 2JBFA 4P0MA 4E3IA 5FQIA 1W8YA 2ZM2A 1BUEA 1RCJA 1WE4A 3OPPA 3G32A 2J9PA 4MBFA 3P09A 4OQ0A 4R0QA 2Q9NA 4JXGA 1AXBA 4GDNA 1ZKJA 4KZ4A 1L0EA 3W4QA 1E3UD 3HLGA 4WMCD 2HDSA 3W4PA 4LCMA 4PM5A 2ZQ9A 4M3KA 4X56A 1K25A 1IYSA 3D4FA 4KZ3A 5GHZA 3AGDA 3IF6A 5M19A 2OV5A 1YLTA 1I5QA 3V50A 3IH9A 1N4OA 5FA7A 3ZFZA 5DTSA 4L0LA 1Y54A 3EQVA 2WGWA 3IWIA 2E8IA 4KZ9A 5FDHA 3IHBA 5J8XA 1MWRA 3FV7A 4LCLA 4R4SA 5FSRA 3N7WA 5EOOA 1ZG4A 4B4XA 5CTMA 1MWUA 3HBRA 2XR0A 1BTLA 4FCFA 4EUZA 4WBGA 4BENA 3M2JA 3M6HA 5BOHA 5DF8A 5KSCA 3AGEA 3FWLA 1E3UA 3NBLA 5F1GA 4KZ7A 3MZEA 1BLSA 4IBRA 4WMCA 2Y55A 3ZDJA 1S6RA 2HP9A 1K55A 3SOIA 2XF3A 4KG2A 1ERQA 4JLFA 1ES4A 1SDNA 3WS4A 3C4OA 2WKHA 4UA7A 2P9VB 3DTMA 4QB8A 4EBNA 4YINA 5FAPA 4K0WA 1MWTA 1YM1A 3VP4A 2Z2MB 3GTCA 4GOGA 2BG1A 2EX8A 2PU4A 3NIAA 5EECA 1NJ4A 3GV9A 1XGIA 3IF5A 4ZBEA 4S2LA 4F94A 1PI5A 5FI7A 3UNWA 4HEFA 3ZHHA 5CXWA 3IXDA 5HW3A 5KSHA 2EX6A 1NY0A 1CI8A 2OLUA 1NZUA 5F82A 3VP2A 2ZLYA 1J9MA 3BFFA 1IEMA 3NC8A 1O07A 5FI2A 3VSLA 1H8ZA 1W8QA 3FKWA 4H8RA 4JKTA 5EPHA 1GHIA 4LENA 4OP5A 3RXXA 2R9XA 5HFOA 3BECA 3PAGA 3IWQA 3W8KA 2HDUA 4OKPA 1K6SA 1YLJA 4E3JA 1OMEA 1L2SA 4N9KA 4OH0A 3MZDA 5A90A 2RCXA 2XEPA 1RP5A 1ONGA 3WS0A 4E3OA 4S2OA 1E25A 2X01A 1WYBA 3HLDA 1L0GA 1KVLA 3NDGA 2XQZA 1ZC2A 1QMFA 2G2WA 1G6AA 4YFMA 3UPNA 1EWZA 3UE3A 2WZZA 4EWFA 4JBFA 3TOIA 2JC7A 2H5SA 3LY3A 5AQ9A 2DRWA 3DW0A 1TDLA 1TEMA 4CPKA 4S2NC 2XFTA 3Q7VA 3SS5A 1GA9A 2Y2LA 4JXWA 1HD8A 3PBRA 5E2HA 4OQIA 1FCOA 5L2FA 2ZQDA 4KENB 5G18A 1MBLA 3A3IA 4QJGA 1FQGA 4OPRA 3UPOA 1Q2QA 5GLAA 4DE1A 4A5RA 1ONHA 2WUQA 3BFDA 3ZG0A 4O7DA 3OZHA 2HDQA 4IVKA 5AQAA 1ZG6A 3HVFA 4OOMA 2XLNA 1YMXA 4RVAA 4JPMA 5HL1A 2DCFA 1E4DA 2J8YA 2XFSA 1FR1A 4B88A 3MKFA 4KQRA 4S2PA 5FQKA 4FH4A 1HVBA 1KGGA 3ZCZA 2XDMA 3CZDA 2JE5A 1JTGA 3ZNYA 5F1FA 3ZVWA 1PZOA 3ITAA 4OLDA 4KQQA 2V1ZA 3UO9A 3ZGAB 4IEDA 5KMWA 3UN7A 1LL9A 2X02A 3IHAA 3M6BA 3PBOA 3UDFA 4EBPA 4ZJ1A 3WRTA 3N8RA 1QMEA 2HPBA 2Y91A 3G2ZA 2ZC5B 5FQJA 3MBZA 4QD4A 4QY6A 3VOZA 4PM8A 1WYCA 4D2OA 2B5RA 2G2UA 4R4RA 1H8YA 2EFUA 3LCEA 4N1XA 4KZAA 3CG5A 4XUZA 1FSYA 4EV4A 1LLBA 2HDRA 1XP4A 3FKVA 4GNUA 2X71A 5CRFA 4OPQA 5JYOA 2QPNA 1GCEA 2IWDA 3VFFA 4QHCA 1XA1A 2Y59A 3IXHA 4JXVA 4UHUA 4GD8A 2ZMAA 3PAEA 4S2NA 4DRTA 5FAOA 1ALQA 3HL9A 5M1AA 4K0XA 2Y4AA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5EOE A;  2ZM0 A;  2A3U A;  4UA9 A;  2QMI A;  4R3J A;  3VP3 A;  2XK1 A;  2H0T A;  2R9W A;  4BL3 A;  3UDI A;  3S4X A;  1CEG A;  3HLF A;  1W7F A;  3VSK A;  1ESI A;  4U0T A;  5FQQ A;  1KE0 A;  3UDX A;  4ID4 A;  1W79 A;  2CC1 A;  2Y2I A;  5F83 A;  3SS4 A;  3S22 A;  4DXB A;  5TGF A;  1SHV A;  4PMA A;  4DDY A;  5EVI B;  4BLM A;  5IHV A;  2DNS A;  2WAD A;  2XH9 A;  4WZ5 C;  3UPP A;  3BYD A;  1YLP A;  4DE3 A;  4RYE A;  1YMS A;  2I72 A;  3ZVT A;  4R23 A;  3ZG9 B;  4C6Y A;  3TG9 A;  1ERO A;  2EX2 A;  4B4Z A;  2C5W B;  2BLS A;  2EFX A;  4X68 A;  5DVA A;  3ZG7 B;  5CHU A;  5JYP A;  3C7U A;  3SH9 A;  1YLW A;  4OON A;  5FQM A;  3W4O A;  4S2J A;  3WRZ A;  2QZ6 A;  3Q1F A;  5A92 A;  1XGJ A;  4KQO A;  3NDE A;  3MZF A;  4DDS A;  1LI9 A;  5TFQ A;  4PPR A;  3C4P A;  5D3O A;  1MPL A;  3DWK A;  3BFC A;  4E3M A;  2WZX A;  2WGV A;  3OCL A;  1JWP A;  4MBK A;  4K91 A;  4C3Q A;  3Q07 A;  3OCN A;  1S0W A;  2VGJ A;  3PBQ A;  4Z9Q A;  1JTD A;  1KE3 A;  5A91 A;  1IYO A;  3IXG A;  1MKI A;  2HP5 A;  3B3X A;  3GQZ A;  1MXO A;  5CHM A;  3MFD A;  3MXR A;  4Y0T A;  5CTN A;  3O86 A;  4PM6 A;  3FYZ A;  2P9V A;  2XD1 A;  1IYP A;  3N4I A;  2ZQA A;  1CEF A;  4OPY A;  5E2E A;  1JWZ A;  2RL3 A;  1TVF A;  4JF4 A;  5GL9 A;  2IWB A;  2ZJ9 A;  3HLC A;  5FI6 A;  5EE8 A;  4XXR A;  3O87 A;  2WK0 A;  1K54 C;  2V20 A;  4R3B A;  4P6B A;  4WZ5 A;  4QY5 A;  1ES5 A;  3PBT A;  1M6K A;  4OQH A;  1ES2 A;  1K57 C;  3MKE A;  3V5M A;  4UA6 A;  1IKG A;  3NY4 A;  2EX9 A;  1Q2P A;  2VGK A;  4WZ4 A;  3SS3 A;  5E2F A;  5AQ7 A;  3JYI A;  1H5X A;  4RA7 A;  1PZP A;  1GA0 A;  1NYM A;  3G35 A;  4U0X A;  2J9O A;  1KDW A;  3IT9 A;  3HLE A;  3GMW A;  5FAQ A;  4S2K A;  1LHY A;  3GR2 A;  4QU3 A;  2C6W B;  1PYY A;  4X55 A;  3VP1 A;  4RX2 A;  1RGZ A;  1BLC A;  5I94 A;  3SH7 A;  1NYY A;  1G68 A;  4KZ8 A;  1YLZ A;  3A3F A;  3DWZ A;  5DTK A;  1SDE A;  5U47 A;  3RJU A;  3OPR A;  4MEZ A;  4BD1 A;  4BQM A;  4N1H A;  2Y2N A;  1GHP A;  2ZC4 B;  3WS5 A;  3BLS A;  5CGX A;  4X69 A;  4OOY A;  2Y2M A;  4ZTK A;  1XPB A;  1DY6 A;  3IF6 B;  5HAP A;  3G2Y A;  3QNB A;  4HBT A;  3WS2 A;  4N92 A;  4Y0U A;  2Y2G A;  2WAF A;  2ZQ8 A;  4S2M A;  4BD0 A;  2PU2 A;  1NZO A;  4FD8 A;  2WGW B;  3C5A A;  4Q8I A;  5EUA A;  1HTZ A;  2OSU A;  3BFE A;  5GLD A;  4KG6 A;  3I7J A;  1K54 A;  3MXS A;  1CK3 A;  1PWD A;  1XA7 A;  4N9L A;  4XUX A;  1KDS A;  5EVL A;  3ITB A;  4LV3 A;  1PIO A;  4X6T A;  5FAS A;  3LY4 A;  1I2W A;  1K57 A;  3P98 A;  4KZ6 A;  1SKF A;  3VFH A;  2ZD8 A;  1O7E A;  3G30 A;  1XXM A;  2ZQ7 A;  3N6I A;  3QHY A;  4OOL A;  2UWX A;  5EVI C;  2Y2P A;  4LV1 A;  5CEC A;  5DTT A;  2Y2H A;  4CJN A;  2ZM8 A;  3IWO A;  2ZC6 B;  5FAT A;  1GHM A;  5GLC A;  3UY6 A;  4DF6 A;  4GDB A;  1I2S A;  4EBL A;  4HES A;  2OLV A;  4UAA A;  1PWG A;  1BUL A;  3N8S A;  3BRM A;  4P85 A;  4OP8 A;  4BJP A;  4LV0 A;  2WKE A;  1PW1 A;  1ES3 A;  3BEB A;  3CJM A;  4E6W A;  1CI9 A;  3A3J A;  3LEZ A;  1W5D A;  2FFF B;  3FZC A;  2H10 A;  3OPL A;  4EQI A;  4NET A;  4U3T A;  4DE0 A;  3Q82 A;  3E2K A;  1VQQ A;  2EXB A;  3EQU A;  3GVB A;  1YT4 A;  1TDG A;  1DJA A;  5GHY A;  3C7V A;  3WS1 A;  1EI5 A;  2ZC7 A;  3IQA A;  5TR7 A;  1FR6 A;  1MWS A;  1MY8 A;  2GDN A;  5EVI D;  3SH8 A;  3UE1 A;  2ZC3 B;  3S1Y A;  1K4F A;  5E43 A;  3Q81 A;  1IEL A;  2WYX A;  2PBY A;  2V2F F;  2H0Y A;  2WKI A;  3ZG8 B;  1L0D A;  2IWC A;  3VMA A;  4E3L A;  1C3B A;  4PM7 A;  5AQB A;  2Y2K A;  1YLY A;  3IXB A;  2Y2Q A;  4JF5 A;  1BLP A;  5GLB A;  4BL2 A;  3BM6 A;  3ZNT A;  3LO7 A;  3GRJ A;  3HUM A;  2XGN A;  4ZDX A;  1YQS A;  1U60 A;  1BZA A;  1IYQ A;  4MBH A;  4DXC A;  1XX2 A;  2Y2J A;  3Q7Z A;  3WWX A;  4OQG A;  1VM1 A;  2JCH A;  3BFG A;  3G31 A;  4JXS A;  5HX9 A;  5CGS A;  4OVD A;  4PM9 A;  4WEL A;  1SCW A;  3NCK A;  4RX3 A;  2J7V A;  1NRF A;  3G4P A;  4ZJ3 A;  4GKU A;  5HAI A;  4C75 A;  5EVI A;  1FOF A;  1Z6F A;  3V3R A;  1PWC A;  4LV2 A;  1IKI A;  3TSG A;  4GZB A;  4FSF A;  1L0F A;  4FH2 A;  1K6R A;  2XD5 A;  4WEK A;  1JVJ A;  3IH8 A;  3BLM A;  3RXW A;  1BT5 A;  3GSG A;  3OPH A;  4KZ5 A;  2WAE A;  3Q7V B;  5CGW A;  4E3K A;  1LI0 A;  4GD6 A;  3HLW A;  4ZJ2 A;  5DF9 A;  3CMZ A;  5E2G A;  4KG5 A;  3V39 A;  3V3S A;  3QNC A;  3HUO A;  1K56 D;  5HAQ A;  4P87 A;  1BLH A;  3ZG5 A;  4JF6 A;  4OPZ A;  1RGY A;  3PTE A;  5HAR A;  4E3N A;  3UE0 A;  4NK3 A;  4DKI A;  1DJC A;  2FFY A;  5DF7 A;  1ESU A;  4KZB A;  4WEJ A;  4X53 A;  4E6X A;  4DE2 A;  4ZAM A;  5M18 A;  3A3E A;  2A49 A;  2ZQC A;  5A93 A;  4IBX A;  3OC2 A;  3VOY A;  3O3V A;  1XKZ A;  5CEB A;  5GHX A;  4Y0O A;  3ISG A;  1FCN A;  3IF6 C;  4MLL A;  1PW8 A;  1K4E A;  1KGF A;  4MNR A;  1ERM A;  5FQ9 A;  1KE4 A;  4WM9 A;  1LL5 A;  3N8L A;  3HRE A;  4IVI A;  1JWV A;  4WYY A;  1K56 A;  5CED A;  1KVM A;  2Q9M A;  3A3D A;  3PBN A;  2EXA A;  3G34 A;  2Y2O A;  4S2I A;  1K38 A;  1KGE A;  3HLB A;  1BSG A;  4HBU A;  3HUN A;  2P74 A;  5KZH A;  1NXY A;  3O88 A;  1M40 A;  1FCM A;  1DJB A;  2Z2L B;  4Y7P A;  2WGI A;  2HP6 A;  3VP0 A;  3NI9 A;  1N9B A;  3M2K A;  1HZO A;  3AGF A;  4OLG A;  1FSW A;  1PI4 A;  1K55 C;  4R1G A;  5CHJ A;  4GN2 A;  3E2L A;  3PBS A;  5CER A;  4GB7 A;  2JBF A;  4P0M A;  4E3I A;  5FQI A;  1W8Y A;  2ZM2 A;  1BUE A;  1RCJ A;  1WE4 A;  3OPP A;  3G32 A;  2J9P A;  4MBF A;  3P09 A;  4OQ0 A;  4R0Q A;  2Q9N A;  4JXG A;  1AXB A;  4GDN A;  1ZKJ A;  4KZ4 A;  1L0E A;  3W4Q A;  1E3U D;  3HLG A;  4WMC D;  2HDS A;  3W4P A;  4LCM A;  4PM5 A;  2ZQ9 A;  4M3K A;  4X56 A;  1K25 A;  1IYS A;  3D4F A;  4KZ3 A;  5GHZ A;  3AGD A;  3IF6 A;  5M19 A;  2OV5 A;  1YLT A;  1I5Q A;  3V50 A;  3IH9 A;  1N4O A;  5FA7 A;  3ZFZ A;  5DTS A;  4L0L A;  1Y54 A;  3EQV A;  2WGW A;  3IWI A;  2E8I A;  4KZ9 A;  5FDH A;  3IHB A;  5J8X A;  1MWR A;  3FV7 A;  4LCL A;  4R4S A;  5FSR A;  3N7W A;  5EOO A;  1ZG4 A;  4B4X A;  5CTM A;  1MWU A;  3HBR A;  2XR0 A;  1BTL A;  4FCF A;  4EUZ A;  4WBG A;  4BEN A;  3M2J A;  3M6H A;  5BOH A;  5DF8 A;  5KSC A;  3AGE A;  3FWL A;  1E3U A;  3NBL A;  5F1G A;  4KZ7 A;  3MZE A;  1BLS A;  4IBR A;  4WMC A;  2Y55 A;  3ZDJ A;  1S6R A;  2HP9 A;  1K55 A;  3SOI A;  2XF3 A;  4KG2 A;  1ERQ A;  4JLF A;  1ES4 A;  1SDN A;  3WS4 A;  3C4O A;  2WKH A;  4UA7 A;  2P9V B;  3DTM A;  4QB8 A;  4EBN A;  4YIN A;  5FAP A;  4K0W A;  1MWT A;  1YM1 A;  3VP4 A;  2Z2M B;  3GTC A;  4GOG A;  2BG1 A;  2EX8 A;  2PU4 A;  3NIA A;  5EEC A;  1NJ4 A;  3GV9 A;  1XGI A;  3IF5 A;  4ZBE A;  4S2L A;  4F94 A;  1PI5 A;  5FI7 A;  3UNW A;  4HEF A;  3ZHH A;  5CXW A;  3IXD A;  5HW3 A;  5KSH A;  2EX6 A;  1NY0 A;  1CI8 A;  2OLU A;  1NZU A;  5F82 A;  3VP2 A;  2ZLY A;  1J9M A;  3BFF A;  1IEM A;  3NC8 A;  1O07 A;  5FI2 A;  3VSL A;  1H8Z A;  1W8Q A;  3FKW A;  4H8R A;  4JKT A;  5EPH A;  1GHI A;  4LEN A;  4OP5 A;  3RXX A;  2R9X A;  5HFO A;  3BEC A;  3PAG A;  3IWQ A;  3W8K A;  2HDU A;  4OKP A;  1K6S A;  1YLJ A;  4E3J A;  1OME A;  1L2S A;  4N9K A;  4OH0 A;  3MZD A;  5A90 A;  2RCX A;  2XEP A;  1RP5 A;  1ONG A;  3WS0 A;  4E3O A;  4S2O A;  1E25 A;  2X01 A;  1WYB A;  3HLD A;  1L0G A;  1KVL A;  3NDG A;  2XQZ A;  1ZC2 A;  1QMF A;  2G2W A;  1G6A A;  4YFM A;  3UPN A;  1EWZ A;  3UE3 A;  2WZZ A;  4EWF A;  4JBF A;  3TOI A;  2JC7 A;  2H5S A;  3LY3 A;  5AQ9 A;  2DRW A;  3DW0 A;  1TDL A;  1TEM A;  4CPK A;  4S2N C;  2XFT A;  3Q7V A;  3SS5 A;  1GA9 A;  2Y2L A;  4JXW A;  1HD8 A;  3PBR A;  5E2H A;  4OQI A;  1FCO A;  5L2F A;  2ZQD A;  4KEN B;  5G18 A;  1MBL A;  3A3I A;  4QJG A;  1FQG A;  4OPR A;  3UPO A;  1Q2Q A;  5GLA A;  4DE1 A;  4A5R A;  1ONH A;  2WUQ A;  3BFD A;  3ZG0 A;  4O7D A;  3OZH A;  2HDQ A;  4IVK A;  5AQA A;  1ZG6 A;  3HVF A;  4OOM A;  2XLN A;  1YMX A;  4RVA A;  4JPM A;  5HL1 A;  2DCF A;  1E4D A;  2J8Y A;  2XFS A;  1FR1 A;  4B88 A;  3MKF A;  4KQR A;  4S2P A;  5FQK A;  4FH4 A;  1HVB A;  1KGG A;  3ZCZ A;  2XDM A;  3CZD A;  2JE5 A;  1JTG A;  3ZNY A;  5F1F A;  3ZVW A;  1PZO A;  3ITA A;  4OLD A;  4KQQ A;  2V1Z A;  3UO9 A;  3ZGA B;  4IED A;  5KMW A;  3UN7 A;  1LL9 A;  2X02 A;  3IHA A;  3M6B A;  3PBO A;  3UDF A;  4EBP A;  4ZJ1 A;  3WRT A;  3N8R A;  1QME A;  2HPB A;  2Y91 A;  3G2Z A;  2ZC5 B;  5FQJ A;  3MBZ A;  4QD4 A;  4QY6 A;  3VOZ A;  4PM8 A;  1WYC A;  4D2O A;  2B5R A;  2G2U A;  4R4R A;  1H8Y A;  2EFU A;  3LCE A;  4N1X A;  4KZA A;  3CG5 A;  4XUZ A;  1FSY A;  4EV4 A;  1LLB A;  2HDR A;  1XP4 A;  3FKV A;  4GNU A;  2X71 A;  5CRF A;  4OPQ A;  5JYO A;  2QPN A;  1GCE A;  2IWD A;  3VFF A;  4QHC A;  1XA1 A;  2Y59 A;  3IXH A;  4JXV A;  4UHU A;  4GD8 A;  2ZMA A;  3PAE A;  4S2N A;  4DRT A;  5FAO A;  1ALQ A;  3HL9 A;  5M1A A;  4K0X A;  2Y4A A; 
#chains in the Genus database with same CATH topology
 5EOE A;  3TRC A;  3VP3 A;  2H0T A;  3VSK A;  2J3T D;  2FZ0 A;  4DDY A;  4BLM A;  2DNS A;  2WAD A;  3UPP A;  3BYD A;  1XFQ A;  1YMS A;  4R23 A;  3QP5 A;  1ERO A;  4B4Z A;  2V0U A;  2BLS A;  5FQM A;  4KQO A;  4DDS A;  2WKQ A;  3K3C A;  3W2Z A;  5TFQ A;  5D3O A;  3DWK A;  4QPR A;  2O99 A;  3Q07 A;  1S0W A;  1KOU A;  3UME A;  1JTD A;  4WN5 A;  2HP5 A;  2IA2 A;  3B3X A;  1MXO A;  4X25 A;  5CHM A;  1V9Z A;  3MXR A;  4DJ2 A;  1OPX A;  4PM6 A;  3FYZ A;  4MN7 A;  2XD1 A;  1IYP A;  2A24 B;  4I3J A;  3N4I A;  3MS6 A;  1JWZ A;  2RL3 A;  5DFX A;  2IWB A;  2ZJ9 A;  3HLC A;  4XXR A;  3T12 B;  2V20 A;  2OAQ 1;  3HCY A;  4QY5 A;  3JVV A;  1LSX A;  2NUT C;  3V5M A;  1NRJ A;  1GA0 A;  4U0X A;  1TS8 A;  1Y28 A;  3GMW A;  5G4Z A;  4S2K A;  1LHY A;  4QU3 A;  4RX2 A;  3MMH A;  2UV0 E;  1G68 A;  4KZ8 A;  3DWZ A;  1SDE A;  3OPR A;  4BQM A;  4CLC C;  5CGX A;  2INW A;  2VX8 A;  1DP6 A;  3TW8 A;  3IF6 B;  3FG8 A;  3G2Y A;  1W63 Q;  4N92 A;  1G6O A;  2PU2 A;  4FD8 A;  3F1N A;  4L9E A;  1XJ2 A;  2OSU A;  3BY9 A;  3I7J A;  3BW6 A;  1KDS A;  3ITB A;  4X6T A;  5FAS A;  2P08 A;  1I2W A;  3T4O A;  2J3W A;  2VV8 A;  3P98 A;  2ZD8 A;  1O7E A;  3G30 A;  2QWS A;  2ZQ7 A;  5DTT A;  2ZM8 A;  5FAT A;  5GLC A;  1I2S A;  5HL6 A;  4HES A;  2OLV A;  1PWG A;  1BUL A;  4OP8 A;  1ZHH B;  2WKE A;  3CJM A;  3LEZ A;  4O8G A;  1W5D A;  1L3L A;  1FIL A;  4GW9 A;  5HPI A;  5L07 A;  1T18 A;  1D06 A;  3T4T A;  1EI5 A;  3IQA A;  1MWS A;  3A0R A;  3EGX C;  3UE1 A;  4LRX C;  2V2F F;  3BY8 A;  3ZG8 B;  4R3A A;  1YLY A;  5GLB A;  4JF5 A;  1BLP A;  4BL2 A;  2OWH A;  3BJN A;  1YQS A;  1S4S A;  2XSS A;  3QP8 A;  2V8F A;  3Q7Z A;  3PHY A;  3G31 A;  5HX9 A;  4OVD A;  4RX3 A;  2J7V A;  4ZJ3 A;  4LV2 A;  1L0F A;  4FH2 A;  1JVJ A;  3CPT A;  5KIZ A;  4GD6 A;  4ZJ2 A;  3B47 A;  4KG5 A;  3V39 A;  4MMN A;  2GJ3 A;  4P87 A;  1BLH A;  4JF6 A;  4OPZ A;  5HAR A;  2VJW A;  1DJC A;  4WEJ A;  2YKF A;  4X53 A;  2JN7 A;  4E6X A;  1PFL A;  1LSW A;  4DE2 A;  4ZAM A;  2A49 A;  2W3H A;  1OTE A;  1XKZ A;  1FCN A;  3HRE A;  4IVI A;  4Y13 A;  2EXA A;  2HJ9 C;  3LR0 A;  1K38 A;  3HLB A;  4HBU A;  1XFN A;  4LPZ A;  3BWL A;  1FCM A;  4CQH A;  2Z2L B;  4EEU A;  3P01 A;  3VP0 A;  3M2K A;  4R1G A;  4LRY C;  3E2L A;  3PBS A;  4GB7 A;  2JBF A;  5K5B A;  4P0M A;  2BAS A;  2ZM2 A;  1WE4 A;  3OPP A;  2Q9N A;  1L0E A;  3HLG A;  4M3K A;  4I39 A;  3D72 A;  4I5S A;  1I5Q A;  4ME4 A;  5DTS A;  1Y54 A;  2E8I A;  2V9A A;  2PD7 A;  5FSR A;  3E4O A;  1MWU A;  1HLU P;  2XR0 A;  1N9L A;  1DP8 A;  5DF8 A;  5KSC A;  3FWL A;  1BLS A;  2Y55 A;  3ZDJ A;  3SOI A;  1K0K A;  3WS4 A;  2WKH A;  4UA7 A;  4GHI A;  4LRZ E;  4YIN A;  3VP4 A;  4GOG A;  3CUE C;  4E04 A;  3NIA A;  3FPW A;  1NJ4 A;  3GV9 A;  4S2L A;  1PI5 A;  5HSQ A;  3UNW A;  2W1R A;  2JKF A;  4YNR A;  2OLU A;  1TS6 A;  3BFF A;  3C2W A;  4H8R A;  1W8Q A;  2R9X A;  1WA9 A;  3W8K A;  2HDU A;  1K6S A;  1S4R A;  3LIE A;  1RP5 A;  1G5U A;  2WKP A;  2M7U A;  1F5M A;  1KVL A;  3NDG A;  5FEF A;  3HJI A;  4Q0J A;  5DKK A;  4MN6 A;  4YFM A;  3LIC A;  1EWZ A;  3UE3 A;  2WZZ A;  4S2N C;  3Q7V A;  2ZOI A;  3CUE A;  3F1N B;  3R7W A;  3PBR A;  1XJ3 A;  4KEN B;  1MBL A;  4ZRR A;  1Q2Q A;  3T4K A;  3ZG0 A;  3T1X A;  3OZH A;  4KQD A;  1AWI A;  2XLN A;  4G3K A;  1LL8 A;  2W3E A;  1Z09 A;  1VB6 A;  4KQR A;  3ZVW A;  4OLD A;  3UO9 A;  4KQQ A;  2V1Z A;  3UN7 A;  5DJU A;  3M6B A;  3PBO A;  4GCZ A;  2PR5 A;  3VOZ A;  2PAV P;  4PM8 A;  1WYC A;  4XUZ A;  4EV4 A;  2DMW A;  2W27 A;  3C38 A;  4KUK A;  3RFB A;  4OPQ A;  2P04 A;  2QPN A;  2Q0O A;  3GEC A;  4JXV A;  3PAE A;  4S2N A;  4K0X A;  2Y4A A;  5HDD A;  4UA9 A;  3QP6 A;  1CEG A;  3HLF A;  1ESI A;  4EXO A;  3P7N A;  4U0T A;  5FQQ A;  1W79 A;  5F83 A;  3SS4 A;  4DXB A;  5TGF A;  5IHV A;  4WZ5 C;  1YLP A;  4NXB A;  3MQ0 A;  2I72 A;  3CPT B;  3ZVT A;  3HJK A;  2OOL A;  3C7U A;  1YLW A;  4OON A;  3W4O A;  4ARZ A;  3Q1F A;  3NDE A;  3BFC A;  4E3M A;  2WZX A;  2B95 A;  2WGV A;  4C3Q A;  3UB7 A;  3OCN A;  2VGJ A;  1F9I A;  4EUV A;  1KE3 A;  3EEA A;  4CLC E;  3GQZ A;  5AVE A;  3O86 A;  2ZQA A;  1CEF A;  3C8C A;  1TVF A;  4O01 A;  1VET A;  5FI6 A;  3O87 A;  4HHD A;  2WK0 A;  3LEQ A;  2JKR I;  4P6B A;  4WZ5 A;  1M6K A;  1ES2 A;  1K57 C;  3MKE A;  5LBR A;  4BEN A;  2VGK A;  1Q2P A;  5FL3 A;  3SS3 A;  2E8J A;  4LLO B;  2VZW A;  1NYM A;  3G35 A;  5IT5 A;  2J9O A;  1KDW A;  3HLE A;  3GR2 A;  4MN5 A;  5I94 A;  1NYY A;  5A8B A;  1YLZ A;  3A3F A;  5DTK A;  5U47 A;  3U4L P;  2Y2N A;  4F3L A;  4ZTK A;  1UGU A;  3QNB A;  4HBT A;  5G4Y A;  2HV1 A;  3WS2 A;  4Y0U A;  2WAF A;  1ACF A;  2ZQ8 A;  1IFQ A;  4QWO A;  3LR4 A;  1HTZ A;  3E4Q A;  4WUJ A;  2GX5 A;  1S67 L;  3ULF A;  1Y4O A;  4R6L A;  4BWI A;  1PIO A;  1K57 A;  2HJE A;  4PKY G;  1SKF A;  3VFH A;  1XXM A;  3QHY A;  2UWX A;  2L0W A;  4LV1 A;  3UY6 A;  2ZC6 B;  4GHI B;  4ETZ A;  1F98 A;  4UAA A;  3VV4 A;  1YAX A;  3BRM A;  3LIF A;  1CI9 A;  1D1J A;  1GSW A;  3FZC A;  3KYE A;  4EQI A;  4NET A;  4Q0I A;  3Q82 A;  1VQQ A;  1YT4 A;  1DJA A;  2PYP A;  5HDS A;  5GHY A;  5HZH A;  4K08 A;  2ZC7 A;  3PYP A;  2VKS A;  2PD8 A;  1MY8 A;  2GDN A;  4D60 A;  1K4F A;  1PRQ A;  2WKI A;  4E3L A;  3EGD C;  3E98 A;  4PM7 A;  5AQB A;  3IXB A;  5F68 A;  3LO7 A;  4NKP A;  2XGN A;  1U60 A;  4MBH A;  2Z6C A;  3TJZ C;  1XX2 A;  4PKY A;  3WWX A;  3BFG A;  5CGS A;  3KSF A;  1PNE A;  3G4P A;  5HAI A;  3NUL A;  1A0K A;  3NOT C;  1PWC A;  1IKI A;  3TSG A;  1K6R A;  4KZ5 A;  3Q7V B;  3R7W B;  4EET B;  4E3K A;  2V1A A;  1ODV A;  5DF9 A;  3QNC A;  1K56 D;  3PTE A;  4HJ3 A;  4DKI A;  2FFY A;  3EEH A;  5M18 A;  4BBU A;  4IBX A;  5CEB A;  4MLL A;  1KGF A;  5HD5 A;  3CLO A;  2HGV A;  2PR6 A;  1K56 A;  5CED A;  2Q9M A;  3NHQ A;  2Y2O A;  4X1M A;  1V9Y A;  4S2I A;  5F5Y A;  3U2A A;  1BSG A;  3UB6 A;  3HUN A;  2P74 A;  1EW0 A;  5KZH A;  1S1Z A;  3O88 A;  1M40 A;  3ZQ5 A;  2ZOH A;  3H7W A;  4IHQ A;  4OLG A;  2O0Y A;  1PI4 A;  1K55 C;  5CHJ A;  4GN2 A;  1X0O A;  4B9O A;  4E3I A;  1W8Y A;  1BUE A;  2P7J A;  3G32 A;  4CLC D;  2J9P A;  4XT2 A;  4OQ0 A;  4JXG A;  4WL9 A;  1ZKJ A;  4GLQ A;  2K7S A;  2ZBB A;  5I5L A;  1K25 A;  3D4F A;  5EFW A;  3S7N A;  3AGD A;  3BQ8 A;  5EM0 A;  3V50 A;  4ARZ B;  4HIA A;  3ZFZ A;  3EQV A;  3IX8 A;  2WGW A;  2QKP A;  1P9W A;  3KX0 X;  5J8X A;  2L4R A;  3KSI A;  4LCL A;  3N7W A;  4CLC A;  2CMN A;  1BTL A;  4FCF A;  1SZV A;  1ZTU A;  4II7 A;  3AGE A;  1VEU A;  3NBL A;  2J80 A;  5F1G A;  1K55 A;  2ZMV A;  4KG2 A;  4JLF A;  1T1A A;  1VHM A;  3T4J A;  2GNX A;  5IU1 A;  3GTC A;  2HF6 A;  5F69 A;  3L7H A;  2LB9 A;  5C5K A;  2BG1 A;  2PU4 A;  1VET B;  3IF5 A;  3ZHH A;  5CXW A;  3IXD A;  4DN0 A;  2EX6 A;  1J9M A;  4AFI A;  2XRO A;  3FKW A;  4JKT A;  4ESP A;  5EPH A;  1GHI A;  2Y8H A;  2V0W A;  3PAG A;  1OME A;  4H6J A;  4N9K A;  3MZD A;  2XEP A;  4E3O A;  2QHK A;  1LT0 A;  2X01 A;  2XQZ A;  1ZC2 A;  1QMF A;  5HWW A;  4F3L B;  1P0Z A;  2JC7 A;  2EWV A;  4MCW A;  4P6Z M;  3RTY A;  1TEM A;  4CPK A;  2XFT A;  1GA9 A;  4JXW A;  3CI6 A;  4OQI A;  5G18 A;  3A3I A;  3OBF A;  4QJG A;  1FQG A;  2L1M A;  4X1L A;  2WUQ A;  4EER A;  1T19 A;  2HDQ A;  1ZG6 A;  1YMX A;  4RVA A;  3NOU C;  2W1T A;  5HL1 A;  1TS7 A;  2VGL S;  3MKF A;  5FQK A;  1KGG A;  2XDM A;  2JE5 A;  3ZNY A;  5F1F A;  1NLZ A;  4IED A;  1GSX A;  2X02 A;  3IHA A;  2JKR M;  3V67 A;  4BBT A;  5HPF A;  1H8Y A;  4N1X A;  4KZA A;  1LLB A;  1XP4 A;  2FH5 A;  2QYB A;  5JYO A;  5F6A A;  5J7E A;  1W63 M;  1XA1 A;  2ZMA A;  4DRT A;  2O9C A;  1ALQ A;  3HL9 A;  5M1A A;  3S7P A;  3DTK A;  2A3U A;  3PXP A;  2Z6D A;  4BL3 A;  3UDI A;  1W7F A;  3D9Y A;  5L09 A;  1KE0 A;  1XJ4 A;  4ID4 A;  3UDX A;  3QP1 A;  3MFX A;  4PMA A;  2XH9 A;  4Y5F A;  2VEA A;  4DE3 A;  4G3W A;  3TG9 A;  4IJG A;  4LFU A;  2C5W B;  2EFX A;  3ZG7 B;  5CHU A;  5JYP A;  2XRN A;  3SW1 A;  4S2J A;  1XGJ A;  1YPR A;  4NXE A;  1MKM A;  1H3Q A;  3T4L A;  4PPR A;  3T50 A;  3PBQ A;  5A91 A;  1IYO A;  3F1O A;  1DRM A;  3IXG A;  1MC0 A;  1UWP X;  1FIK A;  1MKI A;  3NOP C;  3DAV A;  3NEC A;  3MFD A;  3VOL A;  4Y0T A;  4Z1W A;  4NEE D;  5CTN A;  2R78 A;  5EM1 A;  2PRF A;  4OPY A;  3B42 A;  4JF4 A;  5GL9 A;  1K54 C;  1UWN X;  1ES5 A;  3MF0 A;  4UA6 A;  1IKG A;  3H7W B;  2VV6 A;  3NY4 A;  4WZ4 A;  2K31 A;  5E2F A;  3JYI A;  3OOV A;  4RA7 A;  4FUW A;  3IT9 A;  3UMD A;  5FAQ A;  5MC7 A;  1PYY A;  1S1Y A;  4HJ6 A;  4O0P A;  3SZT A;  3TE8 A;  2OAP 1;  1RGZ A;  5TJJ A;  2VGL M;  1BLC A;  2PDR A;  4XT2 B;  3SH7 A;  3RJU A;  4MEZ A;  3OLO A;  4GS9 A;  1GHP A;  3WS5 A;  4X69 A;  4DJ3 A;  1XPB A;  5HAP A;  2OWJ A;  4S2M A;  4BD0 A;  2WGW B;  2NUP C;  4Q8I A;  5GLD A;  4KG6 A;  4IUH A;  1K54 A;  5CX7 A;  1CK3 A;  4CLC B;  1PWD A;  4N9L A;  4XUX A;  5EVL A;  4LV3 A;  3LY4 A;  1VEU B;  2ZL1 A;  4KZ6 A;  3N6I A;  2PHY A;  5EVI C;  2Y2P A;  5CEC A;  2PBD P;  2Y2H A;  2JKT I;  4DF6 A;  1GHM A;  4GDB A;  2XA7 S;  4LV0 A;  1PW1 A;  1ES3 A;  3T1Q B;  4YOF A;  3LI8 A;  2FFF B;  4DE0 A;  2YKH A;  3EQU A;  3KSH A;  3GVB A;  3C7V A;  5TR7 A;  5EVI D;  3SH8 A;  2ZC3 B;  1OT9 A;  5E43 A;  1H8M A;  1L0D A;  1H0M A;  1C3B A;  2Y2K A;  4H6J B;  2Y2Q A;  3GRJ A;  3HUM A;  2EA9 A;  4ZDX A;  3MSH A;  1VM1 A;  4WEL A;  1SCW A;  3NCK A;  1NRF A;  4GKU A;  4C75 A;  5EVI A;  1FOF A;  1Z6F A;  3V3R A;  1CQA A;  4WEK A;  3IH8 A;  3BLM A;  3H82 A;  3GSG A;  2WAE A;  3CMZ A;  4E3N A;  2O9A A;  3UE0 A;  4NK3 A;  2M7V A;  2W1T B;  4KZB A;  5DF7 A;  1IOU A;  5HWT A;  1MZU A;  4I3A A;  3LYX A;  5A93 A;  3D3O A;  3ISG A;  1T1C A;  1PW8 A;  3H9W A;  1KE4 A;  1LL5 A;  3N8L A;  3E0Y A;  4WYY A;  1KVM A;  3G34 A;  1KGE A;  3IX3 A;  2W0N A;  4WF0 A;  1DJB A;  2HP6 A;  3O5Y A;  3F1P A;  1RCJ A;  1OTD A;  5DFY A;  1AXB A;  4KZ4 A;  3IS2 A;  2XA7 M;  4JGP A;  1E3U D;  2BTF P;  4WMC D;  3W4P A;  2HZ5 A;  4PM5 A;  4X56 A;  1GSV A;  4KZ3 A;  5GHZ A;  4Q0H A;  3IH9 A;  1N4O A;  5FA7 A;  3RH8 B;  2K2N A;  4KZ9 A;  5FDH A;  3IHB A;  5J4E A;  1MWR A;  5EOO A;  1ZG4 A;  4JGR A;  3G6O A;  4B4X A;  4NXG A;  4EUZ A;  4NG2 A;  4WBG A;  3M6H A;  3F1O B;  2H28 A;  1E3U A;  4KZ7 A;  4WMC A;  2HP9 A;  3R4K A;  1SDN A;  3C4O A;  4MDZ A;  4WLA A;  3DTM A;  4QB8 A;  4EBN A;  1MWT A;  3LR5 A;  2EX8 A;  2I9V A;  4ZBE A;  4JGO A;  5FI7 A;  2WKR A;  4HEF A;  4KUO A;  5KSH A;  5HD3 A;  3VP2 A;  1CI8 A;  1N9N A;  1NZU A;  5F82 A;  3UB9 A;  2QJ7 A;  3NC8 A;  4IUK A;  5FI2 A;  3VSL A;  1P97 A;  4LEN A;  5EV0 A;  4I38 A;  3IWQ A;  3K3D A;  1CJF A;  4OKP A;  1OJG A;  1YLJ A;  2B02 A;  1L2S A;  4G3V A;  4OH0 A;  3B33 A;  2RCX A;  5L8M A;  1ONG A;  2VA0 A;  1D7E A;  4S2O A;  1E25 A;  2G2W A;  4GS9 B;  2EWW A;  5FEG A;  3UPN A;  3CIT A;  4EWF A;  4JBF A;  5AQ9 A;  2H5S A;  1TS0 A;  4P6Z S;  1TDL A;  1TD5 A;  4HI4 A;  3FC7 A;  3DTI A;  2Y2L A;  1HD8 A;  1FCO A;  2ZQD A;  1DP9 A;  3QP4 A;  4A5R A;  1ONH A;  3BFD A;  3LGO A;  2ZL1 B;  4HH2 A;  5AQA A;  4OOM A;  4JPM A;  2DCF A;  2J8Y A;  2XFS A;  4B88 A;  4S2P A;  1STZ A;  4Y2F A;  4FH4 A;  1JTG A;  2V8C A;  1PZO A;  4UQI S;  3ZGA B;  3JVU A;  3UDF A;  4EBP A;  1QME A;  2Y91 A;  2MJ6 A;  3MR0 A;  4QY6 A;  5AJG A;  2B5R A;  2G2U A;  3UB8 A;  2VLG A;  2HDR A;  2X71 A;  3JPU A;  1GCE A;  4QHC A;  4UHU A;  4GD8 A;  3L9K A;  2ZM0 A;  2QMI A;  4R3J A;  3T1R A;  2XK1 A;  2R9W A;  3S4X A;  5TBM A;  3KYZ A;  1OT6 A;  1P9R A;  2CC1 A;  2Y2I A;  3S22 A;  4M4X A;  4HQA A;  1SHV A;  5EVI B;  4PAU A;  4RYE A;  3LIA A;  1J3W A;  4C6Y A;  3H82 B;  3ZG9 B;  4LGW A;  2EX2 A;  5DVA A;  4X68 A;  1LSV A;  2D01 A;  3SH9 A;  5HDC A;  3WRZ A;  2QZ6 A;  3LR3 A;  5A92 A;  3MZF A;  1LI9 A;  4HH3 A;  2KDK A;  3C4P A;  1MPL A;  4DMZ A;  3OCL A;  1JWP A;  4MBK A;  4K91 A;  4Z9Q A;  2JKT M;  1OTA A;  4BBV A;  4R70 A;  1YSP A;  2P9V A;  3LID A;  3LUQ A;  2M1C A;  5E2E A;  5EE8 A;  1SKO A;  4R3B A;  1F2K A;  4GJ4 A;  4YWZ A;  4OQH A;  3PBT A;  2EX9 A;  5AQ7 A;  1H5X A;  1BYW A;  1PZP A;  3LFV A;  3NJA A;  1CF0 A;  3F1P B;  4X55 A;  2C6W B;  3CWF A;  3VP1 A;  4EQ1 A;  2ACG A;  3MJQ A;  4BMW A;  4EEP A;  3IS2 B;  2O9B A;  1TF1 A;  4UQI M;  4BD1 A;  4N1H A;  2ZC4 B;  3BLS A;  4OOY A;  2Y2M A;  3LIB A;  1G28 A;  1DY6 A;  1NLY A;  2Y2G A;  4FOF A;  3KYQ A;  3GDI A;  4I3I A;  1NZO A;  3C5A A;  5EUA A;  3BFE A;  2GZA A;  3IBR A;  3MXS A;  1XA7 A;  3T4S A;  3C30 A;  3KO6 A;  4L9F A;  2JHE A;  4OOL A;  5L10 A;  4CJN A;  3IWO A;  4PHT A;  4EBL A;  2W3F A;  3N8S A;  4BJP A;  4P85 A;  3IX4 A;  3BEB A;  3ICY A;  4E6W A;  3A3J A;  3MQQ A;  5AVF A;  2H10 A;  4RQ9 A;  3OPL A;  4U3T A;  3E2K A;  2EXB A;  5HWV A;  1TDG A;  1YSQ A;  3WS1 A;  3ZYT A;  3EWK A;  2G7U A;  1FR6 A;  3A0S A;  2KX6 A;  3S1Y A;  3T4Q A;  3Q81 A;  1IEL A;  2WYX A;  2PBY A;  2H0Y A;  2W3D A;  2IWC A;  3VMA A;  1JNU A;  3FPV A;  3BM6 A;  3ZNT A;  1XJ6 A;  3KSG A;  1BZA A;  1IYQ A;  4DXC A;  2Y2J A;  4Y15 A;  4OQG A;  2JCH A;  4JXS A;  3VE3 A;  2KOI A;  4PM9 A;  5IS1 A;  1OTB A;  3QP2 A;  4GZB A;  4FSF A;  3CHW P;  2XD5 A;  3RXW A;  1BT5 A;  3OPH A;  5CGW A;  1LI0 A;  3HLW A;  5E2G A;  3V3S A;  3HUO A;  5HAQ A;  3ZG5 A;  1RGY A;  2B18 A;  4B93 A;  5J3W A;  1ESU A;  2V1B A;  3A3E A;  2ZQC A;  2A2L A;  3OC2 A;  3VOY A;  3O3V A;  5GHX A;  4Y0O A;  3IF6 C;  1K4E A;  4MNR A;  2A24 A;  1ERM A;  5FQ9 A;  4WM9 A;  4NXF A;  2PT7 A;  1JWV A;  2VK3 A;  3A3D A;  3PBN A;  1NXY A;  4Y7P A;  2WGI A;  2PYR A;  3NI9 A;  1N9B A;  3BQA A;  1HZO A;  3AGF A;  1FSW A;  3S7O A;  4R38 A;  5CER A;  5FQI A;  5TBM B;  5FDS A;  4MBF A;  3P09 A;  4R0Q A;  4HP9 A;  4L9G A;  4GDN A;  2ZMF A;  3VE4 A;  3W4Q A;  2HDS A;  4LCM A;  2ZQ9 A;  1IYS A;  3DTE A;  2JKG A;  3IF6 A;  5M19 A;  2OV5 A;  1YLT A;  4HP4 A;  4L0L A;  3IWI A;  2Y79 A;  4HY8 A;  4ETX A;  3FV7 A;  4R4S A;  5CTM A;  3HBR A;  4Y17 A;  3M2J A;  3UE6 A;  5BOH A;  4HOI A;  3MZE A;  4IBR A;  3T1S A;  1S6R A;  2VV7 A;  2XF3 A;  1ERQ A;  1ES4 A;  5EVE A;  2P9V B;  5FAP A;  4K0W A;  1YM1 A;  2Z2M B;  2KLI A;  5EEC A;  5DKL A;  4EU0 A;  1XGI A;  1SKO B;  4F94 A;  3E4P A;  5HW3 A;  3MXQ A;  1NY0 A;  2ZLY A;  1IEM A;  1O07 A;  1H8Z A;  3IBJ A;  4OP5 A;  3RXX A;  5HFO A;  3S7Q A;  3BEC A;  4HNB A;  4E3J A;  3UB5 P;  4UEY A;  5A90 A;  3MQO A;  1N9O A;  3WS0 A;  1OJ5 A;  1WYB A;  3HLD A;  1L0G A;  2QJ5 A;  1G6A A;  3TOI A;  3LY3 A;  2DRW A;  3DW0 A;  1T1B A;  1S66 L;  3SS5 A;  5L2F A;  5E2H A;  3LI9 A;  4OPR A;  3UPO A;  5GLA A;  4DE1 A;  4Y3I A;  4O7D A;  4EES A;  1NWZ A;  4IVK A;  3HVF A;  1YKD A;  4EW7 A;  1E4D A;  1FR1 A;  3ZCZ A;  1HVB A;  3CZD A;  3A0V A;  3ITA A;  2LB5 A;  5KMW A;  2D02 A;  3PR6 A;  1LL9 A;  3DBA A;  4ZJ1 A;  3WRT A;  3N8R A;  2W3G A;  2HPB A;  3G2Z A;  2ZC5 B;  5FQJ A;  3MBZ A;  4QD4 A;  4FTX A;  4D2O A;  4R4R A;  2AVX A;  1OTI A;  2EFU A;  3LCE A;  2J3T C;  3CG5 A;  1FSY A;  3K2N A;  4HJ4 A;  3FKV A;  4GNU A;  5CRF A;  4JGQ A;  5DJT A;  2IWD A;  3VFF A;  2Y59 A;  3IXH A;  3EOI A;  3CAX A;  5FAO A; 
#chains in the Genus database with same CATH homology
 5EOE A;  2ZM0 A;  2A3U A;  4UA9 A;  2QMI A;  4R3J A;  3VP3 A;  2XK1 A;  2H0T A;  2R9W A;  4BL3 A;  3UDI A;  3S4X A;  1CEG A;  3HLF A;  1W7F A;  3VSK A;  1ESI A;  4U0T A;  5FQQ A;  1KE0 A;  3UDX A;  4ID4 A;  1W79 A;  2CC1 A;  2Y2I A;  5F83 A;  3SS4 A;  3S22 A;  4DXB A;  5TGF A;  1SHV A;  4PMA A;  4DDY A;  5EVI B;  4BLM A;  5IHV A;  2DNS A;  2WAD A;  2XH9 A;  4WZ5 C;  3UPP A;  3BYD A;  1YLP A;  4DE3 A;  4RYE A;  1YMS A;  2I72 A;  3ZVT A;  4R23 A;  3ZG9 B;  4C6Y A;  3TG9 A;  1ERO A;  2EX2 A;  4B4Z A;  2C5W B;  2BLS A;  2EFX A;  4X68 A;  5DVA A;  3ZG7 B;  5CHU A;  5JYP A;  3C7U A;  3SH9 A;  1YLW A;  4OON A;  5FQM A;  3W4O A;  4S2J A;  3WRZ A;  2QZ6 A;  3Q1F A;  5A92 A;  1XGJ A;  4KQO A;  3NDE A;  3MZF A;  4DDS A;  1LI9 A;  5TFQ A;  4PPR A;  3C4P A;  5D3O A;  1MPL A;  3DWK A;  3BFC A;  4E3M A;  2WZX A;  2WGV A;  3OCL A;  1JWP A;  4MBK A;  4K91 A;  4C3Q A;  3Q07 A;  3OCN A;  1S0W A;  2VGJ A;  3PBQ A;  4Z9Q A;  1JTD A;  1KE3 A;  5A91 A;  1IYO A;  3IXG A;  1MKI A;  2HP5 A;  3B3X A;  3GQZ A;  1MXO A;  5CHM A;  3MFD A;  3MXR A;  4Y0T A;  5CTN A;  3O86 A;  4PM6 A;  3FYZ A;  2P9V A;  2XD1 A;  1IYP A;  3N4I A;  2ZQA A;  1CEF A;  4OPY A;  5E2E A;  1JWZ A;  2RL3 A;  1TVF A;  4JF4 A;  5GL9 A;  2IWB A;  2ZJ9 A;  3HLC A;  5FI6 A;  5EE8 A;  4XXR A;  3O87 A;  2WK0 A;  1K54 C;  2V20 A;  4R3B A;  4P6B A;  4WZ5 A;  4QY5 A;  1ES5 A;  3PBT A;  1M6K A;  4OQH A;  1ES2 A;  1K57 C;  3MKE A;  3V5M A;  4UA6 A;  1IKG A;  3NY4 A;  2EX9 A;  1Q2P A;  2VGK A;  4WZ4 A;  3SS3 A;  5E2F A;  5AQ7 A;  3JYI A;  1H5X A;  4RA7 A;  1PZP A;  1GA0 A;  1NYM A;  3G35 A;  4U0X A;  2J9O A;  1KDW A;  3IT9 A;  3HLE A;  3GMW A;  5FAQ A;  4S2K A;  1LHY A;  3GR2 A;  4QU3 A;  2C6W B;  1PYY A;  4X55 A;  3VP1 A;  4RX2 A;  1RGZ A;  1BLC A;  5I94 A;  3SH7 A;  1NYY A;  1G68 A;  4KZ8 A;  1YLZ A;  3A3F A;  3DWZ A;  5DTK A;  1SDE A;  5U47 A;  3RJU A;  3OPR A;  4MEZ A;  4BD1 A;  4BQM A;  4N1H A;  2Y2N A;  1GHP A;  2ZC4 B;  3WS5 A;  3BLS A;  5CGX A;  4X69 A;  4OOY A;  2Y2M A;  4ZTK A;  1XPB A;  1DY6 A;  3IF6 B;  5HAP A;  3G2Y A;  3QNB A;  4HBT A;  3WS2 A;  4N92 A;  4Y0U A;  2Y2G A;  2WAF A;  2ZQ8 A;  4S2M A;  4BD0 A;  2PU2 A;  1NZO A;  4FD8 A;  2WGW B;  3C5A A;  4Q8I A;  5EUA A;  1HTZ A;  2OSU A;  3BFE A;  5GLD A;  4KG6 A;  3I7J A;  1K54 A;  3MXS A;  1CK3 A;  1PWD A;  1XA7 A;  4N9L A;  4XUX A;  1KDS A;  5EVL A;  3ITB A;  4LV3 A;  1PIO A;  4X6T A;  5FAS A;  3LY4 A;  1I2W A;  1K57 A;  3P98 A;  4KZ6 A;  1SKF A;  3VFH A;  2ZD8 A;  1O7E A;  3G30 A;  1XXM A;  2ZQ7 A;  3N6I A;  3QHY A;  4OOL A;  2UWX A;  5EVI C;  2Y2P A;  4LV1 A;  5CEC A;  5DTT A;  2Y2H A;  4CJN A;  2ZM8 A;  3IWO A;  2ZC6 B;  5FAT A;  1GHM A;  5GLC A;  3UY6 A;  4DF6 A;  4GDB A;  1I2S A;  4EBL A;  4HES A;  2OLV A;  4UAA A;  1PWG A;  1BUL A;  3N8S A;  3BRM A;  4P85 A;  4OP8 A;  4BJP A;  4LV0 A;  2WKE A;  1PW1 A;  1ES3 A;  3BEB A;  3CJM A;  4E6W A;  1CI9 A;  3A3J A;  3LEZ A;  1W5D A;  2FFF B;  3FZC A;  2H10 A;  3OPL A;  4EQI A;  4NET A;  4U3T A;  4DE0 A;  3Q82 A;  3E2K A;  1VQQ A;  2EXB A;  3EQU A;  3GVB A;  1YT4 A;  1TDG A;  1DJA A;  5GHY A;  3C7V A;  3WS1 A;  1EI5 A;  2ZC7 A;  3IQA A;  5TR7 A;  1FR6 A;  1MWS A;  1MY8 A;  2GDN A;  5EVI D;  3SH8 A;  3UE1 A;  2ZC3 B;  3S1Y A;  1K4F A;  5E43 A;  3Q81 A;  1IEL A;  2WYX A;  2PBY A;  2V2F F;  2H0Y A;  2WKI A;  3ZG8 B;  1L0D A;  2IWC A;  3VMA A;  4E3L A;  1C3B A;  4PM7 A;  5AQB A;  2Y2K A;  1YLY A;  3IXB A;  2Y2Q A;  4JF5 A;  1BLP A;  5GLB A;  4BL2 A;  3BM6 A;  3ZNT A;  3LO7 A;  3GRJ A;  3HUM A;  2XGN A;  4ZDX A;  1YQS A;  1U60 A;  1BZA A;  1IYQ A;  4MBH A;  4DXC A;  1XX2 A;  2Y2J A;  3Q7Z A;  3WWX A;  4OQG A;  1VM1 A;  2JCH A;  3BFG A;  3G31 A;  4JXS A;  5HX9 A;  5CGS A;  4OVD A;  4PM9 A;  4WEL A;  1SCW A;  3NCK A;  4RX3 A;  2J7V A;  1NRF A;  3G4P A;  4ZJ3 A;  4GKU A;  5HAI A;  4C75 A;  5EVI A;  1FOF A;  1Z6F A;  3V3R A;  1PWC A;  4LV2 A;  1IKI A;  3TSG A;  4GZB A;  4FSF A;  1L0F A;  4FH2 A;  1K6R A;  2XD5 A;  4WEK A;  1JVJ A;  3IH8 A;  3BLM A;  3RXW A;  1BT5 A;  3GSG A;  3OPH A;  4KZ5 A;  2WAE A;  3Q7V B;  5CGW A;  4E3K A;  1LI0 A;  4GD6 A;  3HLW A;  4ZJ2 A;  5DF9 A;  3CMZ A;  5E2G A;  4KG5 A;  3V39 A;  3V3S A;  3QNC A;  3HUO A;  1K56 D;  5HAQ A;  4P87 A;  1BLH A;  3ZG5 A;  4JF6 A;  4OPZ A;  1RGY A;  3PTE A;  5HAR A;  4E3N A;  3UE0 A;  4NK3 A;  4DKI A;  1DJC A;  2FFY A;  5DF7 A;  1ESU A;  4KZB A;  4WEJ A;  4X53 A;  4E6X A;  4DE2 A;  4ZAM A;  5M18 A;  3A3E A;  2A49 A;  2ZQC A;  5A93 A;  4IBX A;  3OC2 A;  3VOY A;  3O3V A;  1XKZ A;  5CEB A;  5GHX A;  4Y0O A;  3ISG A;  1FCN A;  3IF6 C;  4MLL A;  1PW8 A;  1K4E A;  1KGF A;  4MNR A;  1ERM A;  5FQ9 A;  1KE4 A;  4WM9 A;  1LL5 A;  3N8L A;  3HRE A;  4IVI A;  1JWV A;  4WYY A;  1K56 A;  5CED A;  1KVM A;  2Q9M A;  3A3D A;  3PBN A;  2EXA A;  3G34 A;  2Y2O A;  4S2I A;  1K38 A;  1KGE A;  3HLB A;  1BSG A;  4HBU A;  3HUN A;  2P74 A;  5KZH A;  1NXY A;  3O88 A;  1M40 A;  1FCM A;  1DJB A;  2Z2L B;  4Y7P A;  2WGI A;  2HP6 A;  3VP0 A;  3NI9 A;  1N9B A;  3M2K A;  1HZO A;  3AGF A;  4OLG A;  1FSW A;  1PI4 A;  1K55 C;  4R1G A;  5CHJ A;  4GN2 A;  3E2L A;  3PBS A;  5CER A;  4GB7 A;  2JBF A;  4P0M A;  4E3I A;  5FQI A;  1W8Y A;  2ZM2 A;  1BUE A;  1RCJ A;  1WE4 A;  3OPP A;  3G32 A;  2J9P A;  4MBF A;  3P09 A;  4OQ0 A;  4R0Q A;  2Q9N A;  4JXG A;  1AXB A;  4GDN A;  1ZKJ A;  4KZ4 A;  1L0E A;  3W4Q A;  1E3U D;  3HLG A;  4WMC D;  2HDS A;  3W4P A;  4LCM A;  4PM5 A;  2ZQ9 A;  4M3K A;  4X56 A;  1K25 A;  1IYS A;  3D4F A;  4KZ3 A;  5GHZ A;  3AGD A;  3IF6 A;  5M19 A;  2OV5 A;  1YLT A;  1I5Q A;  3V50 A;  3IH9 A;  1N4O A;  5FA7 A;  3ZFZ A;  5DTS A;  4L0L A;  1Y54 A;  3EQV A;  2WGW A;  3IWI A;  2E8I A;  4KZ9 A;  5FDH A;  3IHB A;  5J8X A;  1MWR A;  3FV7 A;  4LCL A;  4R4S A;  5FSR A;  3N7W A;  5EOO A;  1ZG4 A;  4B4X A;  5CTM A;  1MWU A;  3HBR A;  2XR0 A;  1BTL A;  4FCF A;  4EUZ A;  4WBG A;  4BEN A;  3M2J A;  3M6H A;  5BOH A;  5DF8 A;  5KSC A;  3AGE A;  3FWL A;  1E3U A;  3NBL A;  5F1G A;  4KZ7 A;  3MZE A;  1BLS A;  4IBR A;  4WMC A;  2Y55 A;  3ZDJ A;  1S6R A;  2HP9 A;  1K55 A;  3SOI A;  2XF3 A;  4KG2 A;  1ERQ A;  4JLF A;  1ES4 A;  1SDN A;  3WS4 A;  3C4O A;  2WKH A;  4UA7 A;  2P9V B;  3DTM A;  4QB8 A;  4EBN A;  4YIN A;  5FAP A;  4K0W A;  1MWT A;  1YM1 A;  3VP4 A;  2Z2M B;  3GTC A;  4GOG A;  2BG1 A;  2EX8 A;  2PU4 A;  3NIA A;  5EEC A;  1NJ4 A;  3GV9 A;  1XGI A;  3IF5 A;  4ZBE A;  4S2L A;  4F94 A;  1PI5 A;  5FI7 A;  3UNW A;  4HEF A;  3ZHH A;  5CXW A;  3IXD A;  5HW3 A;  5KSH A;  2EX6 A;  1NY0 A;  1CI8 A;  2OLU A;  1NZU A;  5F82 A;  3VP2 A;  2ZLY A;  1J9M A;  3BFF A;  1IEM A;  3NC8 A;  1O07 A;  5FI2 A;  3VSL A;  1H8Z A;  1W8Q A;  3FKW A;  4H8R A;  4JKT A;  5EPH A;  1GHI A;  4LEN A;  4OP5 A;  3RXX A;  2R9X A;  5HFO A;  3BEC A;  3PAG A;  3IWQ A;  3W8K A;  2HDU A;  4OKP A;  1K6S A;  1YLJ A;  4E3J A;  1OME A;  1L2S A;  4N9K A;  4OH0 A;  3MZD A;  5A90 A;  2RCX A;  2XEP A;  1RP5 A;  1ONG A;  3WS0 A;  4E3O A;  4S2O A;  1E25 A;  2X01 A;  1WYB A;  3HLD A;  1L0G A;  1KVL A;  3NDG A;  2XQZ A;  1ZC2 A;  1QMF A;  2G2W A;  1G6A A;  4YFM A;  3UPN A;  1EWZ A;  3UE3 A;  2WZZ A;  4EWF A;  4JBF A;  3TOI A;  2JC7 A;  2H5S A;  3LY3 A;  5AQ9 A;  2DRW A;  3DW0 A;  1TDL A;  1TEM A;  4CPK A;  4S2N C;  2XFT A;  3Q7V A;  3SS5 A;  1GA9 A;  2Y2L A;  4JXW A;  1HD8 A;  3PBR A;  5E2H A;  4OQI A;  1FCO A;  5L2F A;  2ZQD A;  4KEN B;  5G18 A;  1MBL A;  3A3I A;  4QJG A;  1FQG A;  4OPR A;  3UPO A;  1Q2Q A;  5GLA A;  4DE1 A;  4A5R A;  1ONH A;  2WUQ A;  3BFD A;  3ZG0 A;  4O7D A;  3OZH A;  2HDQ A;  4IVK A;  5AQA A;  1ZG6 A;  3HVF A;  4OOM A;  2XLN A;  1YMX A;  4RVA A;  4JPM A;  5HL1 A;  2DCF A;  1E4D A;  2J8Y A;  2XFS A;  1FR1 A;  4B88 A;  3MKF A;  4KQR A;  4S2P A;  5FQK A;  4FH4 A;  1HVB A;  1KGG A;  3ZCZ A;  2XDM A;  3CZD A;  2JE5 A;  1JTG A;  3ZNY A;  5F1F A;  3ZVW A;  1PZO A;  3ITA A;  4OLD A;  4KQQ A;  2V1Z A;  3UO9 A;  3ZGA B;  4IED A;  5KMW A;  3UN7 A;  1LL9 A;  2X02 A;  3IHA A;  3M6B A;  3PBO A;  3UDF A;  4EBP A;  4ZJ1 A;  3WRT A;  3N8R A;  1QME A;  2HPB A;  2Y91 A;  3G2Z A;  2ZC5 B;  5FQJ A;  3MBZ A;  4QD4 A;  4QY6 A;  3VOZ A;  4PM8 A;  1WYC A;  4D2O A;  2B5R A;  2G2U A;  4R4R A;  1H8Y A;  2EFU A;  3LCE A;  4N1X A;  4KZA A;  3CG5 A;  4XUZ A;  1FSY A;  4EV4 A;  1LLB A;  2HDR A;  1XP4 A;  3FKV A;  4GNU A;  2X71 A;  5CRF A;  4OPQ A;  5JYO A;  2QPN A;  1GCE A;  2IWD A;  3VFF A;  4QHC A;  1XA1 A;  2Y59 A;  3IXH A;  4JXV A;  4UHU A;  4GD8 A;  2ZMA A;  3PAE A;  4S2N A;  4DRT A;  5FAO A;  1ALQ A;  3HL9 A;  5M1A A;  4K0X A;  2Y4A A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...