2H1BA

Resa e80q
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
138
structure length
138
Chain Sequence
EGSDAPNFVLEDTNGKRIELSDLKGKGVFLNFWGTWCEPCKKQFPYMANQYKHFKSQGVEIVAVNVGESKIAVHNFMKSYGVNFPVVLDTDRQVLDAYDVSPLPTTFLINPEGKVVKVVTGTMTESMIHDYMNLIKPG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Thiol-disulfide oxidoreductase resA
publication title Molecular Basis for Specificity of the Extracytoplasmic Thioredoxin ResA.
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Oxidoreductase
total genus 43
structure length 138
sequence length 138
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2006-05-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00578 AhpC-TSA AhpC/TSA family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 2h1bA00
3F3RA 2HYXA 3NOFA 1PGTA 4ZIJA 1SL1B 2JADA 5LD0A 1EEMA 1A0RP 1ZMAA 2OJLA 2DLXA 2LQOA 3CSHA 4GQFA 5FWGA 2VCZA 2H19A 3CYNA 3ERFA 2B6MA 17GSA 3GUSA 5IMFA 4BWQA 4X0XA 3KH7A 1X5CA 1XOAA 3TRPA 2EIOA 2DBCA 6GSSA 4IW9A 5DAKA 1Y25A 2PGTA 3ZREA 4EUYA 1AQVA 4KA0A 3LFLA 3ZYWA 5L71A 3TJGA 2WULA 3GH9A 4HEA2 3F0IA 1JZOA 2V41A 2PPTA 4TXOA 3I69A 2LUSA 2CVDA 2I3YA 4MZWA 5B8BA 4KUNA 4ECIA 1OKTA 5HR1A 6GSXA 1WIKA 2IMDA 4XIHA 1VRSD 3K8NA 3LG6A 3SBCA 2X8GA 4QL7A 1GSYA 4YQUA 4LL4B 3V1WA 2HRFA 2TRXA 1WMJA 3I43A 2WGRA 1O85A 5DJLA 5EVOA 3H8QA 3IE3A 1XWBA 1E6BA 3ZIVA 1DUGA 4FYUA 1U6TA 4F9ZA 5DCGA 3HVSA 2A2RA 3KM6A 3D4MA 2V32A 1YZXA 1J9BA 4Q5NA 1TK8B 5ECIB 3F6FA 2H74A 3FYGA 4K9ZA 4V2NA 3OR5A 1W4VA 4N11A 1S3DA 3GTUA 1ABAA 2O89A 3LQ7A 3DEXA 2GS3A 4ML6A 6GSWA 1GTBA 3D22A 2Z9SA 3QCPA 1USBA 2LEGA 5COHA 1ERWA 1RQMA 1ACVA 2MMAA 5D9VA 1BEDA 4V2LA 3A2VA 3GNJA 5ECPB 2ON5A 4GSNA 5IMDA 4ECCA 1Z5YE 1OE7A 2MBTA 3CTGA 1G6WA 1QUWA 1SKWB 2GSTA 2LS5A 1Q98A 3GKXA 1K3YA 5CRWA 2ZNMA 4GSSA 2VLTA 3ZRDA 2HLSA 4PNGA 5G1LA 2FLSA 1BAYA 3EURA 5D9XA 2VLVA 3MAKA 2R2JA 2CQ9A 1ERTA 22GSA 3SWLA 3UVTA 3RAZA 1FB6A 3FZ5A 4L5OA 3WT2A 11GSA 5E59A 2YN1A 1XPVA 3IR4A 4PQIA 4ZB6A 3EC3A 4I8BA 4YAPA 4O92A 4DEJA 4NXIA 2R37A 16GSA 3QPMA 4RQRA 5ENUA 4K8MA 1WOUA 2CA8A 3M3MA 2OE0A 2B7JA 3GRXA 2WDUA 1Z7RA 4ECBA 1TI3A 1V40A 4BVYA 2KLXA 3DD3A 3FZAA 3J7Yk 1PL1A 3FR9A 2H8LA 2JU5A 1DE1A 1PKWA 2H1DA 4HQSA 4ID0A 2CX4A 1T8EB 2VUPA 2PVQA 1NSWA 3M9JA 3ERWA 3QR6A 3GFKA 2VD0A 4ISDA 2HFDA 4RQXA 2DC5A 3CSIA 3I6AA 3LWAA 2AB6A 4XS1A 5ECHB 4ULXA 1UA5A 5IO2A 2H66A 2LRTA 3ZFBA 2F3MA 4F0BA 3Q6OA 4HU7A 4MABA 1EOHA 1YEPA 5IM9A 4K2DA 3UBKA 3LSZA 2GQMA 4L0UA 3F3QA 3FZ9A 4GTUA 4HZ4A 2HZEB 2C0GA 1FVKA 1S3CA 3KJYA 3KGKA 4ZILA 2B7KA 4MZCA 1URMA 4XRAA 2OADA 2GZZA 4Q5FA 4TOPA 1TKDB 3HJPA 1K0AA 4HU9A 1SKRB 4IKHA 5GZZB 3JCML 4EF0A 1SJZA 1SJ6A 3ZMKA 3TGZA 2DJJA 2YPMA 1AIUA 1OE8A 2H71A 4KCAA 3TKSC 4IHUA 3VFIA 1WPIA 1K3OA 4WXTA 3UARA 2CAQA 12GSA 4HQZA 4JR4A 2WRTA 5ELGA 1TXXA 3EWLA 4TRXA 4GRFA 2EIRA 4V1Ag 2OACA 2K9FA 3TOUA 3FEUA 1TOFA 2MYGA 3EINA 4Z7XA 1B4QA 3D5JA 4TR1B 4ZBDA 1QXHA 1ERUA 2ZCTA 2A2SA 2VCQA 2GDRA 1GTUA 1NW2A 2H75A 2YZUA 4TR4A 3LXTA 1V9WA 3E0UA 1FG4A 1XWGA 1GTIA 3GN3A 4J2FA 1YJ6A 2GSSA 1T1VA 2R4VA 3RBTA 3Q19A 1GSSA 4NAXA 1B9XC 3UL3A 2EC4A 2X8HA 4WEYA 1YKAA 1Y6EA 2IMKA 4WBRD 2IJYA 3BCKA 3QOUA 3TRXA 2K6VA 1ZGNA 5IO0A 3D4TA 2J9HA 1K0CA 1AQXA 4PUAA 4POKA 3TDGA 3ZVJD 1TK0B 3FZ4A 3HD5A 4YAVA 4G9HA 4OFNA 1LJRA 1FB0A 2RM5A 1PX7A 2R6KA 2OE3A 4Q5QA 1I9DA 3VK9A 3KXOA 1TRVA 4DSQA 4KW6A 2R3XA 1V57A 2C8UA 2DIYA 3ZMLA 3RPNA 1G7OA 2FD3A 2HSHA 3MNGA 3UEMA 5DQYA 3TJJA 3VPQA 3EYTA 4LMWA 2BMXA 2VO4A 1GLQA 2X8CA 1LU4A 3KIJA 3HJMA 5J9CA 4EC0A 4JU5A 4KX4A 2YOIA 5A4WA 3UVHA 4PX1A 4MA9A 1GSQA 2FWFA 1GUHA 2AYTA 3GH6A 4E8HA 2TRCP 2CZ2A 3IHQA 3TKPA 3WD6A 4PUFC 3EMXA 2GSQA 2C3NA 2O87A 1ZCPA 3MWHA 3ZLPA 3BD2A 4HS1A 5G31A 3KMNA 4LMVA 3APQA 4ZBAA 4CHSA 4BWSA 2YJ7A 1B48A 1QMVA 3EE2A 1PSQA 1FOVA 4I2TA 4ZL8A 2G2QA 1BYEA 4IBPA 3G7IA 1TU7A 3KMOA 4IQ1A 4D73B 5J5NA 4MF6A 3HVVA 2LRCA 3DWVA 2VM2A 5H5QA 1A23A 4TW5A 5JCGA 3FKFA 5F0GA 2CT6A 5HFIA 3RHCA 2C0FA 5CAXA 2L6CA 3QDNA 1XOBA 2RLIA 4PXOA 1I5GA 1YF0A 2C80A 5DALB 1H75A 5IMVA 1WP0A 3UIWA 1QK8A 1DE2A 1SK0A 4G19A 4MH3A 4NV5A 5H5SA 3GKNA 5JWRB 1DBYA 1T4ZA 3ZTLA 5DQSA 4ZBBA 5ECRB 1TRWA 2HI7A 1JZRA 1GSDA 3WGXA 3A3TA 4OO5A 1GLPA 1EOGA 5C00A 4F2IA 1ZZYA 2GZPA 1GP1A 2CAIA 1R4WA 4PURA 2YZHA 1GWCA 1J0FA 3QFBC 3IPZA 1T7PB 4OFMA 4N0VA 3M0FA 4NHZA 3VURA 2N5BA 3HY2A 3E9JB 3IK9A 5IPGA 4TR1A 2DIZA 5HFGA 2RM6A 1KEBA 3L9SA 4XS6A 1OC3A 3UOMA 4XS4B 2F51A 2GT5A 2YJHA 2XPDA 1SL0B 4AJ8A 1K0OA 5DJMA 3H4KA 3HA9A 1MEKA 3TB2A 4K0GA 3M8NA 3TKSE 5D73A 4KAEA 1TW9A 4KGIA 1FAAA 4N0ZA 1WWJA 3QAGA 3PINA 2H70A 2I4AA 2HRNA 4GCIA 5IIZA 2FA8A 2OBIA 1EGOA 1Z7PA 1X9SB 4QL9A 1U88A 4KE3A 2VAFA 3FR3A 2B5XA 3ISOA 3DRNA 4MF7A 3UMAA 4ML1A 2F8AA 2DJ1A 5JWOB 2HXKA 3CXGA 4QQ7A 5LCZA 1A24A 3FRCA 1UN2A 4HZ2A 3VPTA 1NM3A 2L4QA 1KBNA 1M9BA 4MPGA 1F2EA 5D9WA 5CREA 3F8UA 4HOJA 5CRHA 1B8XA 1SD8A 1AXDA 10GSA 1MD3A 4EO3A 2YV7A 1O7UA 3BCIA 3EVIA 1HNBA 3GURA 2FNOA 4YH2A 1XW5A 3RPPA 5A4UA 3ZFLA 4MJEA 2E2GA 3MSZA 4RI7A 1KNGA 3DIEA 5ID2B 2YWOA 4KH7A 1PQNA 3WGEA 1Q4JA 5G5FA 2PBJA 3L9VA 5KN2A 1QFNA 1ILOA 2QC7A 3R2QA 1VF2A 1SENA 1SYRA 4EL1A 2YWIA 2GQLA 1M2AA 1TI1A 1VF1A 1GUKA 4POBA 2D2ZA 4H86A 2BTOT 4BVXA 2QKEA 4NV2A 1EV4A 3LGCA 5GSSA 2LKUA 4GF0A 1AQWA 1ML6A 2VCXA 1AC1A 1F6MC 3KH9A 4OWYA 3F4SA 1PA3A 2QSIA 2L5OA 2LJRA 2DJ2A 2K8VA 3O76A 4CDOA 1ON4A 3CTFA 4ZXGA 2H0IA 3VLNA 4ZB8A 2GLRA 2VL3A 4NPBA 4RI6A 5CNWA 1WJKA 2GTUA 4D73A 1HYUA 2LV3A 2AV4A 3I9V2 2B5EA 1YKCA 1Z3EA 2YWNA 1UC7A 2GSRA 4L0WA 1M2BA 2H72A 3HJOA 1XW9A 4EVMA 3APOA 1OC8A 1EP7A 2HZFA 2H6YA 4K0NA 4G10A 5DALA 4IS0A 2YV9A 2G0FA 4WKWA 4BPYA 5GAPD 2IIYA 1R7HA 1TTZA 2M72A 2FWEA 4NMUA 1K0BA 1FHEA 5KN0A 2V1MA 1XCCA 3CMIA 4KDXA 3TUEA 2L57A 3H1NA 3VWXA 5G1KA 3C71A 4WETA 4ACSA 4LLRA 2VM1A 1F37A 1PMTA 1KTEA 1XWCA 5IOWA 5AIVA 1PX6A 3TJKA 1B4PA 1JLVA 4WF4A 2HNLA 1V58A 1YQ1A 4MJBA 2B3SA 2AUVA 3HZ8A 4OCEA 1GSUA 3FK8A 4POMA 5G30A 4XS4A 5G5EA 5C04A 2KUCA 6GSTA 4EDZA 1RW1A 2YANA 2ES7A 4KNDA 2AAWA 2H0HA 2JZTA 5E4WA 3ME8A 1MDIA 2H0GA 2IN3A 5D8IA 2KP2A 3QAVA 3G7YA 2VCTA 3IC4A 3HCZA 5B6MA 2PUKC 4L5LA 2N5AA 4IP1A 3NZNA 6GSYA 2MZCA 5HR0A 3F6DA 2OKAA 4F0CA 1T00A 1IYIA 1FVJA 3C8EA 4MK3A 2EIQA 3ZVJA 1C72A 4MP4A 3LXZA 4TR0A 1AW9A 2ZUPA 3GKKA 4K6XA 5J4UA 4MF5A 3D6IA 2X64A 1O8WA 5CO3A 3U6VA 1TDIA 5H5RA 3IDVA 4EXJA 1XIYA 2XHFA 1GULA 2XBIA 3IOSA 4KB3A 1A2JA 4XCSA 1X5EA 5ECKB 2MMNA 3ZL5A 5HR3A 2LNTA 4IVFA 1OC9B 7GSSA 2V2GA 5ID2A 3L78A 1GL8A 4K7OA 2PU9C 2M46A 3APSA 1Z6MA 5CP1A 5DDLA 4N30A 4PQ1A 4X43A 2O7KA 4NHWA 1GSEA 1VGLA 4IN0A 1F3AA 3H93A 3IRAA 1HNCA 1PN9A 1OVNA 3IV4A 3A2XA 4IP6A 5ECMB 2H73A 5EPFA 5LNKe 2AJQB 2LTKA 3VWUA 3RHBA 1U87A 1DSBA 1VF4A 2LJAA 2ALBA 2F8FA 3F4TA 3P2AA 2J23A 1LBKA 2XPEA 8GSSA 1B9YC 3IK7A 2YCDA 3HZ4A 5HQPA 1EWXA 1T3BA 1UVZA 2VCWA 5FT3A 1BQ7A 4OMVA 1MDKA 1TRUA 5JCWA 2P5QA 2AHEA 3P8WA 4DSSB 4K7NA 3MDKA 3TRQA 3HKRA 3QFAC 1TJDA 3F4RA 4KDUA 3TKRA 1MD4A 5CRGA 1CQGA 3EU3A 4ZL9A 2C3QA 4GLTA 1X0RA 3GL5A 3TKSA 1G6YA 1XWKA 3TCOA 4EKZA 1PKZA 2DSAA 4IELA 1GRXA 1A8YA 4BL7A 2H1GA 2RUFA 4KSMA 1F3BA 4FO5A 4JE1A 2C4JA 4MCUA 4MJCA 3Q74A 1SJIA 5AISA 2HZEA 2LRNA 2C3TA 2P31A 1A0FA 1T4YA 4OO4A 1XZOA 2CZ3A 1ZYEA 4MLYA 4EE0A 4X1UA 2OA7A 1FO5A 4AGSA 2VL2A 3QAWA 2V6OA 5ABRA 2NPBA 4PNFA 3DYRA 2IMIA 2B5YA 3FY7A 2P0GA 3IA1A 4N10A 2DJ0A 2WZ9A 3VWWA 3W6GA 4JRRA 4FYCA 3DMLA 3IXRA 1M2DA 4FH8A 4JBBA 2CVKA 1HNAA 2WCIA 3HDCA 2WFCA 2FA4A 3WGDA 2C1YA 2FGXA 2WJUA 2IL3A 2RUEA 5INYA 2K18A 3G9BA 3A5WA 4I97A 4XTSA 3VWVA 3IAM2 3FW2A 4BA7A 2L5LA 1SD9A 4HJ2A 1R5AA 4V2MA 3GKMA 4KSOA 3CBUA 5HFKA 3KP9A 3UAPA 3UBLA 2L6DA 1OKDA 3ERGA 1K0NA 4WF5A 5J9BA 3LYPA 3GSSA 2FHEA 4ZB9A 14GSA 2NDOA 3PH9A 3HXSA 4FIWA 5D93A 1R5PA 4IGJA 3FHKA 4WR4A 3TKQA 1GUMA 5B7CA 4PGTA 2JSZA 1YEXA 5GSTA 20GSA 2FWGA 4XHMA 1BG5A 2IWTA 4XRDA 4IQAA 5KEJA 3EMPA 4YQMA 1OC9A 2FUG2 4CW9A 2GT6A 2O85A 1A2LA 2BJXA 4IJ3A 3C1SA 3PGTA 5EY6A 3DGQA 4K7IA 1EV9A 5B6NA 3GA4A 5FHIA 2E0QA 4NWYA 4MPFA 4K1FA 5F05A 1N2AA 1PRXA 1EGRA 3DVWA 4V1Ap 5IMZA 1NHOA 2H30A 1G7EA 3VI5A 4TKYA 3D21A 4O7HA 2MMZA 4DSRA 2GZYA 2JSYA 2REMA 4MH2A 2IPAA 3CRTA 4JEDA 5AIXA 1SYXA 4TVEA 3AY8A 3GMFA 1THXA 4ZL7A 1CQHA 1GNWA 3GHAA 1A2MA 3S9FA 2JZSA 4O32A 1ZYQB 2PN8A 4DSSA 1JFUA 3O3TA 1WE0A 2X99A 1SU9A 2CX3A 2IFQB 4WR5A 5IMCA 4J57E 3EU4A 1S3AA 3WYWA 2KHPA 1F9MA 1EP8A 4F82A 5KN3A 4J56E 5CYYA 2JACA 2QGVA 1SL2B 2I1UA 1GTAA 1VF3A 4LA1A 4GXZA 4TN8A 1XW6A 4GWRA 1ERVA 2YNXA 3KD0A 5J41A 4AF2A 3C73A 3J7Yb 4PQHA 3IBHA 2LJKA 2HSYA 4Q5RA 5A4VA 3BOAA 5GAND 5AN1A 1EZKA 2CV4A 3LORA 1XVQA 5CRDA 2FY6A 2HT9A 3LYKA 3P90A 4KDYA 2GQKA 3GYKA 3VI7A 5KN1A 4IJIA 1RK4A 1X9MB 3HVXA 3WT1A 2VCVA 5F8BA 2CVBA 4AJ6A 3GSTA 2MMOA 1IYHA 3GX0A 3LJRA 3DKSA 4I6XA 3W8SA 2VIMA 6GSUA 2VLUA 3L9UA 1JLWA 3DXBA 1X9WB 1W89A 5B8AA 19GSA 2FWHA 4GSTA 1PD21 1YDKA 1K0DA 13GSA 5D9TA 1QGVA 1R26A 2H1BA 1ZOFA 1A8LA 1O8XA 2ON7A 1AAZA 4ECJA 3U5RE 1BJXA 2C0EA 3HYPA 5ECNB 2H01A 4TXVA 1TP9A 3F9UA 2PMTA 4F03A 2DJ3A 4RUVA 1E2YA 5DCHA 3DVXA 2GGTA 2RIIA 3KP8A 1EEJA 4O5RA 2YP6A 3US3A 3A2WA 1M99A 2C0DA 1TRSA 2DMMA 1GNEA 2B1KA 4YQVA 1HQOA 3TOTA 1HD2A 3CSJA 3BJ5A 3N9JA 1TU8A 3LEFA 2OE1A 2JL4A 1M0UA 4MJAA 5G2ZA 3RDWA 4TR3A 3QMXA 1SK2A 2O8VB 2WB9A 4I2UA 5ECLB 2VOCA 2DMLA 3Q18A 5DAKB 3O6TA 4LL1B 5ECOB 3TJBA 1O6JA 3GIXA 1WRYA 3C1RA 3KZQA 2L4CA 1PL2A 9GSSA 2XC2A 2VL2C 4HI7A 4ILFA 4GQCA 2E7PA 1U3IA 4TXOB 4EDYA 5IPHA 3D0ZA 1V2AA 5HR2A 4P3YB 4MZBA 4G2EA 3M1GA 3GV1A 2N5FA 3KTBA 5IOXA 2GVPA 1NHYA 2DJKA 2XBQA 5IMAA 1ST9A 1K3LA 4KCEA 3IAS2 3GL3A 2FCHA 3FR6A 4E8EA 2LSTA 1M9AA 4POLA 2H1AA 5ELAA 2IFQA 1YF1A 1H4OA 5D96A 5AGYA 4OCFA 4I5QA 1OYJA 2LNSA 2PWJA 18GSA 2YWMA 5F06A 3KTLA 3UJ1A 4HUAA 2JZRA 3GTUB 2I9HA 4FYBA 4MMMA 1Z6NA 4HJMA 1M7TA 2P5RA 1GH2A 1XBSA 1G0TA 1BX9A 4WBJA 3N5OA 3F63A 3W8JA 3P7XA 5IQYA 1N8JA 3HHVA 5DVBA 2VD1A 4AJ7A 2PVOC 5EL8A 5JWQB 1Z9HA 1O81A 2HE3A 2NTOA 3TJFA 2B1LA 3G7JA 1MTCA 5ECQB 2PERA 1XWAA 1XXUA 2K8SA 1JZWA 5DBQA 4MDCA 2E2MA 2F9SA 1K0MA 5ECSA 1U3AA 4OD7A 3E3EA 3KEBA 5J3RA 2WS2A 1X5DA 2M80A 4L8EA 3BBYA 2I81A 3PR8A 3KCMA 2LQQA 1JHBA 2NVLA 1V98A 4JZQA 2L59A 3L4NA 3C7MA 1AUCA 2OBKA 1TK5B 1QQ2A 2R5GA 1GSFA 3ZIJA 1XFLA 5F07A 6GSVA 2A4VA 3GX8A 1MDJA 2KOKA 1OAZA 2H76A 3L0HA 4DVCA 3CRUA 2NBSA 3ED3A 2TIRA 1JZDA 1O73A 2H6XA 2V6KA 1FW1A 3M9KA 1YY7A 3H79A 2IMFA 4JR6A 4HDEA 1XVWA 2H6ZA 2VL9A 3ZZXA 3ME7A 4OFTA 1SKSB 1SK1A 5JCUA 3QD9A 2KP1A 1J08A 2IMEA 5A5KA 2MBSA 1ZL9A 3ZITA 1THOA 3NIVA
chains in the Genus database with same CATH superfamily
3F3RA 2HYXA 3NOFA 1PGTA 4ZIJA 1SL1B 2JADA 4EIQA 5LD0A 1EEMA 1A0RP 1ZMAA 2OJLA 2DLXA 2LQOA 3CSHA 4GQFA 5FWGA 2VCZA 2H19A 3CYNA 3ERFA 2B6MA 17GSA 3GUSA 5IMFA 4BWQA 4X0XA 3KH7A 1X5CA 1XOAA 3TRPA 2EIOA 2DBCA 6GSSA 4IW9A 5DAKA 1Y25A 2PGTA 3MYDA 3ZREA 4EUYA 1AQVA 4KA0A 3LFLA 3ZYWA 5L71A 3TJGA 2WULA 3GH9A 4HEA2 3F0IA 1JZOA 2V41A 2PPTA 4TXOA 3I69A 2LUSA 2CVDA 2I3YA 4MZWA 5B8BA 4KUNA 4ECIA 1OKTA 5HR1A 6GSXA 1WIKA 2IMDA 4XIHA 1VRSD 3K8NA 3LG6A 3SBCA 2X8GA 4QL7A 1GSYA 4YQUA 4LL4B 3V1WA 2HRFA 2TRXA 1WMJA 3I43A 2WGRA 1O85A 5DJLA 5EVOA 3H8QA 3IE3A 1XWBA 1E6BA 3ZIVA 1DUGA 4FYUA 1U6TA 4F9ZA 5DCGA 3HVSA 2A2RA 3KM6A 3D4MA 4YKGA 2V32A 1YZXA 1J9BA 4Q5NA 1TK8B 5ECIB 3F6FA 2H74A 3FYGA 4K9ZA 4V2NA 3OR5A 1W4VA 4N11A 1S3DA 3GTUA 1ABAA 2O89A 3LQ7A 3DEXA 2GS3A 4ML6A 6GSWA 1GTBA 3D22A 2Z9SA 3QCPA 1USBA 2LEGA 5COHA 1ERWA 1RQMA 1ACVA 2MMAA 4K5RA 5D9VA 1BEDA 4V2LA 3A2VA 3GNJA 5ECPB 2ON5A 4GSNA 5IMDA 4ECCA 1Z5YE 1OE7A 2MBTA 3CTGA 1G6WA 1QUWA 1SKWB 2GSTA 2LS5A 1Q98A 3GKXA 1K3YA 5CRWA 2ZNMA 4GSSA 2VLTA 3ZRDA 2HLSA 4PNGA 5G1LA 2FLSA 1BAYA 3EURA 5D9XA 2VLVA 4HSCX 3MAKA 2R2JA 2CQ9A 1ERTA 22GSA 3SWLA 3UVTA 3RAZA 1FB6A 3FZ5A 4L5OA 3WT2A 11GSA 5E59A 2YN1A 1XPVA 3IR4A 4PQIA 4ZB6A 1S3RA 3EC3A 4I8BA 4YAPA 4O92A 4DEJA 4NXIA 2R37A 16GSA 3QPMA 4RQRA 5ENUA 4K8MA 1WOUA 2CA8A 3M3MA 2OE0A 2B7JA 3GRXA 2WDUA 1Z7RA 2HRAA 4ECBA 1TI3A 1V40A 4BVYA 2KLXA 3DD3A 3FZAA 3J7Yk 1PL1A 3FR9A 2H8LA 2JU5A 1DE1A 1PKWA 2H1DA 4HQSA 4ID0A 2CX4A 1T8EB 2VUPA 2PVQA 4O5UA 1NSWA 3M9JA 3ERWA 3QR6A 3GFKA 2VD0A 4ISDA 2HFDA 4RQXA 2DC5A 3CSIA 3I6AA 3LWAA 2AB6A 4XS1A 5ECHB 4ULXA 1UA5A 2R0PA 5IO2A 2H66A 2LRTA 3ZFBA 2F3MA 4F0BA 3Q6OA 4HU7A 4MABA 1FOHA 1EOHA 1YEPA 5IM9A 4K2DA 3UBKA 3LSZA 2GQMA 4L0UA 3F3QA 3FZ9A 4GTUA 4HZ4A 2HZEB 2C0GA 1FVKA 1S3CA 3KJYA 3KGKA 4ZILA 2B7KA 4MZCA 1URMA 4XRAA 2OADA 2GZZA 4Q5FA 4TOPA 1TKDB 3HJPA 1K0AA 4HU9A 1SKRB 4IKHA 5GZZB 3JCML 4EF0A 1SJZA 5BMUA 1SJ6A 3ZMKA 3TGZA 2DJJA 2YPMA 1AIUA 1OE8A 2H71A 4KCAA 3TKSC 4IHUA 3VFIA 1WPIA 1K3OA 4WXTA 3UARA 2CAQA 12GSA 4HQZA 4JR4A 2WRTA 5ELGA 1TXXA 3EWLA 4TRXA 4GRFA 2EIRA 4V1Ag 2OACA 2K9FA 3TOUA 3FEUA 1TOFA 2MYGA 3EINA 4Z7XA 1B4QA 3HVNA 3D5JA 4TR1B 4ZBDA 1QXHA 1ERUA 2ZCTA 2A2SA 2VCQA 2GDRA 1GTUA 1NW2A 2H75A 2YZUA 4TR4A 3LXTA 1V9WA 3E0UA 1FG4A 1XWGA 1GTIA 3GN3A 4J2FA 1YJ6A 2GSSA 1T1VA 2R4VA 3RBTA 3Q19A 1GSSA 4NAXA 1B9XC 3UL3A 2EC4A 2X8HA 4WEYA 1YKAA 1Y6EA 2IMKA 4WBRD 2IJYA 3BCKA 3QOUA 3TRXA 2K6VA 1ZGNA 5IO0A 3D4TA 2J9HA 1K0CA 1AQXA 4PUAA 4POKA 2QA1A 3TDGA 3ZVJD 1TK0B 3FZ4A 3HD5A 4YAVA 4G9HA 4OFNA 1LJRA 1FB0A 2RM5A 1PX7A 2R6KA 2OE3A 4Q5QA 1I9DA 3VK9A 3KXOA 1TRVA 4DSQA 4KW6A 2R3XA 1V57A 2C8UA 2DIYA 3ZMLA 3RPNA 1G7OA 2FD3A 2HSHA 4YKFA 3MNGA 3UEMA 5DQYA 3TJJA 3VPQA 3EYTA 4LMWA 2BMXA 2VO4A 1GLQA 2X8CA 1LU4A 3KIJA 3HJMA 5J9CA 4EC0A 4JU5A 4KX4A 2YOIA 5A4WA 3UVHA 4PX1A 4MA9A 1GSQA 2FWFA 1GUHA 2AYTA 3GH6A 4E8HA 2TRCP 2CZ2A 3IHQA 3TKPA 3WD6A 4PUFC 3EMXA 2GSQA 2C3NA 2O87A 4BVXB 1ZCPA 3MWHA 3ZLPA 3BD2A 4HS1A 5G31A 3PPUA 3KMNA 4LMVA 3APQA 4ZBAA 4CHSA 4BWSA 2YJ7A 1B48A 1QMVA 3EE2A 1PSQA 1FOVA 4I2TA 4ZL8A 2G2QA 1BYEA 4MNNA 4IBPA 3G7IA 1TU7A 3KMOA 4IQ1A 4D73B 5J5NA 4MF6A 3HVVA 2LRCA 3DWVA 2VM2A 5H5QA 1A23A 4TW5A 5JCGA 2X49A 3FKFA 5F0GA 2CT6A 5HFIA 3RHCA 2C0FA 5CAXA 2L6CA 3QDNA 4A5PA 1XOBA 2RLIA 4PXOA 1I5GA 1YF0A 2C80A 5DALB 1H75A 5IMVA 1WP0A 3UIWA 1QK8A 1DE2A 1SK0A 4G19A 4MH3A 4NV5A 5H5SA 3GKNA 5JWRB 1DBYA 1T4ZA 3ZTLA 5DQSA 4ZBBA 5ECRB 1TRWA 2HI7A 1JZRA 1GSDA 3WGXA 3A3TA 4OO5A 1GLPA 1EOGA 5C00A 4F2IA 1ZZYA 2GZPA 1GP1A 2CAIA 1R4WA 4PURA 2YZHA 1GWCA 1J0FA 3QFBC 3IPZA 1T7PB 4OFMA 4N0VA 3M0FA 4NHZA 3VURA 2N5BA 3HY2A 3E9JB 3IK9A 5IPGA 4TR1A 2DIZA 5HFGA 2RM6A 1KEBA 3L9SA 4XS6A 1OC3A 3UOMA 4XS4B 2F51A 2GT5A 2YJHA 2HRKA 2XPDA 1SL0B 4AJ8A 1K0OA 5DJMA 3H4KA 3HA9A 1MEKA 3TB2A 4K0GA 3M8NA 3TKSE 5D73A 4KAEA 1TW9A 4KGIA 1FAAA 4N0ZA 1WWJA 3QAGA 3PINA 2H70A 2I4AA 2HRNA 4K5SA 4GCIA 5IIZA 2FA8A 2OBIA 1EGOA 1Z7PA 1X9SB 4QL9A 1U88A 4KE3A 2VAFA 3FR3A 2B5XA 3ISOA 3DRNA 4MF7A 3UMAA 4ML1A 2F8AA 2DJ1A 5JWOB 2HXKA 3CXGA 4QQ7A 5LCZA 1A24A 3FRCA 1UN2A 4HZ2A 3VPTA 1NM3A 2L4QA 1KBNA 1M3JA 1M9BA 4MPGA 1F2EA 5D9WA 5CREA 3F8UA 4HOJA 5CRHA 1B8XA 1SD8A 1AXDA 10GSA 1MD3A 4EO3A 2YV7A 1O7UA 3BCIA 3EVIA 1HNBA 3GURA 2FNOA 4YH2A 1XW5A 3RPPA 5A4UA 3ZFLA 4MJEA 2E2GA 3MSZA 4RI7A 1KNGA 3DIEA 4X4JA 5ID2B 2YWOA 2HSMA 4KH7A 1PQNA 3WGEA 1Q4JA 5G5FA 4CY6A 2PBJA 3L9VA 5KN2A 1QFNA 1ILOA 2QC7A 3R2QA 1VF2A 1SENA 1SYRA 4EL1A 2YWIA 3R3EA 2GQLA 1M2AA 2A2PA 1TI1A 1VF1A 1GUKA 4POBA 2D2ZA 4H86A 2BTOT 4BVXA 2QKEA 4NV2A 1EV4A 3LGCA 5GSSA 2LKUA 4GF0A 1AQWA 1ML6A 2VCXA 3MIXA 1AC1A 1F6MC 3KH9A 4OWYA 3F4SA 1PA3A 2QSIA 2L5OA 2LJRA 2DJ2A 2K8VA 3O76A 4CDOA 1ON4A 3CTFA 4ZXGA 2H0IA 3VLNA 4ZB8A 2GLRA 2VL3A 4NPBA 4RI6A 5CNWA 1WJKA 2GTUA 4D73A 1HYUA 2LV3A 2AV4A 3I9V2 2B5EA 1YKCA 1Z3EA 2YWNA 1UC7A 2GSRA 4L0WA 1M2BA 2H72A 3HJOA 1XW9A 4EVMA 3APOA 1OC8A 1EP7A 2HZFA 2H6YA 4K0NA 4G10A 5DALA 4IS0A 2YV9A 2G0FA 4WKWA 4BPYA 5GAPD 2IIYA 1R7HA 1TTZA 2M72A 2FWEA 4NMUA 1K0BA 1FHEA 4BL7B 5KN0A 2V1MA 1XCCA 3CMIA 4KDXA 3TUEA 2L57A 3H1NA 3VWXA 5G1KA 3C71A 4WETA 4ACSA 4LLRA 2VM1A 1F37A 1PMTA 1KTEA 1XWCA 5IOWA 5AIVA 1PX6A 3TJKA 1B4PA 1JLVA 4WF4A 2HNLA 1V58A 1YQ1A 4MJBA 2B3SA 2AUVA 3HZ8A 4OCEA 1GSUA 3FK8A 4POMA 5G30A 4XS4A 5G5EA 5C04A 2KUCA 6GSTA 4EDZA 1RW1A 2YANA 2ES7A 4KNDA 2AAWA 2H0HA 2JZTA 5E4WA 3ME8A 1MDIA 2H0GA 2IN3A 5D8IA 2KP2A 3QAVA 3G7YA 2VCTA 3IC4A 3HCZA 5B6MA 2PUKC 3EPTA 4L5LA 2N5AA 4IP1A 3NZNA 6GSYA 2MZCA 5HR0A 4Z2UA 3F6DA 2OKAA 4F0CA 1T00A 1IYIA 1FVJA 3C8EA 4MK3A 2EIQA 3ZVJA 1C72A 4MP4A 3LXZA 4TR0A 1AW9A 2ZUPA 3FMWA 3GKKA 4K6XA 5J4UA 4MF5A 3D6IA 2X64A 1O8WA 5CO3A 3U6VA 1TDIA 5H5RA 3IDVA 4EXJA 1XIYA 2XHFA 1GULA 2XBIA 3IOSA 4KB3A 1A2JA 4XCSA 1X5EA 5ECKB 2MMNA 3ZL5A 5HR3A 2LNTA 4IVFA 1OC9B 7GSSA 2V2GA 5ID2A 3L78A 1GL8A 4K7OA 2PU9C 2M46A 3LW9A 3APSA 1Z6MA 5CP1A 5DDLA 4N30A 4PQ1A 4X43A 2O7KA 4NHWA 1GSEA 1VGLA 4IN0A 1F3AA 3H93A 3IRAA 1HNCA 1PN9A 1OVNA 3IV4A 3A2XA 4IP6A 5ECMB 2H73A 5EPFA 5LNKe 2AJQB 2LTKA 3VWUA 3RHBA 1U87A 1DSBA 1VF4A 2LJAA 2ALBA 2F8FA 3F4TA 3P2AA 2J23A 1LBKA 2XPEA 8GSSA 1B9YC 3IK7A 2YCDA 3HZ4A 4EIPA 5HQPA 1EWXA 1T3BA 1UVZA 1ZYPA 2VCWA 5FT3A 4K2XA 1BQ7A 4OMVA 1MDKA 1TRUA 5JCWA 2P5QA 2AHEA 5KOXA 3P8WA 4DSSB 3A5IA 4K7NA 3MDKA 3TRQA 3HKRA 3QFAC 1TJDA 3F4RA 4KDUA 3TKRA 1MD4A 5CRGA 1CQGA 3EU3A 4ZL9A 2C3QA 4GLTA 1X0RA 3GL5A 3TKSA 1G6YA 1XWKA 3TCOA 4EKZA 1PKZA 2DSAA 4IELA 1GRXA 1A8YA 4BL7A 2H1GA 2RUFA 4KSMA 1F3BA 4FO5A 4JE1A 2C4JA 4MCUA 4MJCA 3Q74A 1SJIA 5AISA 2HZEA 2LRNA 2C3TA 2P31A 1A0FA 1T4YA 4OO4A 4CY8A 1XZOA 2CZ3A 1ZYEA 4MLYA 4EE0A 4X1UA 2OA7A 1FO5A 4AGSA 2VL2A 3QAWA 2V6OA 4G0IA 5ABRA 2NPBA 4PNFA 3DYRA 2IMIA 2B5YA 3FY7A 2P0GA 3IA1A 5BRTA 4N10A 2DJ0A 2WZ9A 3VWWA 3W6GA 4JRRA 4FYCA 3DMLA 3IXRA 1M2DA 4FH8A 4JBBA 2CVKA 1HNAA 2WCIA 3HDCA 2WFCA 2R0GA 2FA4A 3WGDA 2C1YA 2FGXA 2WJUA 5KOWA 2IL3A 2DKIA 2RUEA 5INYA 1PN0A 2K18A 3G9BA 3A5WA 4I97A 4XTSA 3VWVA 3IAM2 3FW2A 4BA7A 2L5LA 1SD9A 4HJ2A 1R5AA 4V2MA 3GKMA 4KSOA 3CBUA 5HFKA 3KP9A 3UAPA 3UBLA 2L6DA 1OKDA 3ERGA 1K0NA 4WF5A 5J9BA 3LYPA 3GSSA 2QA2A 3IHGA 2FHEA 4ZB9A 14GSA 2NDOA 3PH9A 2UZ8A 3HXSA 4FIWA 5D93A 1R5PA 4IGJA 3FHKA 4WR4A 3TKQA 1GUMA 5B7CA 4PGTA 2JSZA 1YEXA 5GSTA 20GSA 2FWGA 4XHMA 1BG5A 2IWTA 4XRDA 4IQAA 5KEJA 3EMPA 4YQMA 1OC9A 2FUG2 4CW9A 2GT6A 2O85A 1A2LA 2BJXA 4IJ3A 3C1SA 3PGTA 5EY6A 3DGQA 4K7IA 1EV9A 5B6NA 3GA4A 5FHIA 2E0QA 4ICYA 4NWYA 3CQFA 4MPFA 4USSA 4K1FA 5F05A 1N2AA 1PRXA 1EGRA 3DVWA 4V1Ap 5IMZA 1NHOA 2H30A 1G7EA 3VI5A 4TKYA 3D21A 4O7HA 2MMZA 4DSRA 2GZYA 2JSYA 2REMA 4MH2A 2IPAA 3CRTA 4JEDA 5AIXA 1SYXA 4TVEA 3AY8A 3GMFA 1THXA 4ZL7A 1CQHA 4Z2RA 1GNWA 3GHAA 1A2MA 3S9FA 2JZSA 4O32A 1ZYQB 2PN8A 4DSSA 1JFUA 3O3TA 1WE0A 2X99A 1SU9A 2CX3A 2IFQB 4WR5A 5IMCA 4J57E 3EU4A 1S3AA 3WYWA 2KHPA 1F9MA 1EP8A 4F82A 5KN3A 4J56E 5CYYA 2JACA 2QGVA 1SL2B 2I1UA 1GTAA 1VF3A 4LA1A 4GXZA 4TN8A 1XW6A 4GWRA 1ERVA 2YNXA 3KD0A 5J41A 4AF2A 3C73A 3J7Yb 4PQHA 3IBHA 2LJKA 2HSYA 4Q5RA 5A4VA 3BOAA 5GAND 5AN1A 1XG8A 1EZKA 2CV4A 3LORA 1XVQA 5CRDA 2FY6A 2HT9A 3LYKA 3P90A 4KDYA 2GQKA 3GYKA 3VI7A 5KN1A 4IJIA 1RK4A 1X9MB 3HVXA 3WT1A 2VCVA 5F8BA 2CVBA 4AJ6A 3GSTA 2MMOA 1IYHA 3GX0A 3LJRA 3DKSA 4I6XA 3W8SA 2VIMA 6GSUA 2VLUA 3L9UA 1JLWA 3DXBA 1X9WB 1W89A 5B8AA 3IC8A 19GSA 2FWHA 2X4AA 4G0KA 4GSTA 1PD21 4O5QA 1YDKA 1K0DA 13GSA 5D9TA 1QGVA 1R26A 2H1BA 1ZOFA 1A8LA 1O8XA 2ON7A 1AAZA 4ECJA 3U5RE 1BJXA 2C0EA 3HYPA 5ECNB 2H01A 4TXVA 1TP9A 3F9UA 2PMTA 4F03A 2DJ3A 4RUVA 1E2YA 5DCHA 3DVXA 2GGTA 2RIIA 3KP8A 1EEJA 4O5RA 2YP6A 3US3A 3A2WA 1M3IA 1M99A 2C0DA 1TRSA 2DMMA 4PTSA 1GNEA 2B1KA 1ZYNA 4YQVA 1HQOA 3TOTA 1HD2A 3CSJA 3BJ5A 3N9JA 4Z2TA 1TU8A 3LEFA 2OE1A 2JL4A 1M0UA 4MJAA 5G2ZA 3RDWA 4TR3A 3QMXA 1SK2A 2O8VB 2WB9A 4I2UA 5ECLB 2VOCA 2DMLA 3Q18A 5DAKB 3O6TA 4LL1B 5ECOB 3TJBA 1O6JA 3GIXA 1WRYA 3C1RA 3KZQA 2L4CA 1PL2A 9GSSA 2XC2A 2VL2C 4HI7A 4ILFA 4GQCA 2E7PA 1U3IA 4TXOB 4EDYA 5IPHA 3D0ZA 1V2AA 5HR2A 4P3YB 4MZBA 4G2EA 3M1GA 3GV1A 2N5FA 3KTBA 5IOXA 2GVPA 1NHYA 2DJKA 2XBQA 5IMAA 1ST9A 1K3LA 4KCEA 2R0CA 3IAS2 1PFOA 3GL3A 2FCHA 3FR6A 4E8EA 2LSTA 1M9AA 4POLA 2H1AA 5ELAA 2IFQA 1YF1A 4FQUA 1H4OA 5D96A 4KF9A 5AGYA 4OCFA 4I5QA 1OYJA 2LNSA 2PWJA 18GSA 2YWMA 5F06A 3KTLA 3UJ1A 4HUAA 2JZRA 3GTUB 2I9HA 4FYBA 4MMMA 1Z6NA 4HJMA 1M7TA 2P5RA 1GH2A 1XBSA 1G0TA 1BX9A 4WBJA 3N5OA 3F63A 3W8JA 3P7XA 5IQYA 1N8JA 3HHVA 5DVBA 4BIKA 2VD1A 4AJ7A 2PVOC 5EL8A 5JWQB 1Z9HA 1O81A 2HE3A 2NTOA 3TJFA 2A4HA 2B1LA 3G7JA 1MTCA 5ECQB 2PERA 1XWAA 1XXUA 2K8SA 1JZWA 5DBQA 4MDCA 2E2MA 2F9SA 1K0MA 5ECSA 1U3AA 4OD7A 3E3EA 3KEBA 5J3RA 2WS2A 1X5DA 2M80A 4L8EA 3BBYA 4G0LA 2I81A 3PR8A 3KCMA 2LQQA 1JHBA 2NVLA 1V98A 4JZQA 2L59A 3L4NA 3C7MA 1AUCA 2OBKA 1TK5B 1QQ2A 2R5GA 1GSFA 3ZIJA 1XFLA 5F07A 6GSVA 2A4VA 3GX8A 1MDJA 2KOKA 1OAZA 2H76A 3L0HA 4DVCA 3CRUA 2NBSA 3ED3A 2TIRA 1JZDA 1O73A 2H6XA 2V6KA 1FW1A 2DKHA 3M9KA 1YY7A 3H79A 2IMFA 4JR6A 4BVYB 4HDEA 1XVWA 2H6ZA 2VL9A 3ZZXA 3ME7A 4OFTA 1SKSB 1SK1A 5JCUA 3QD9A 2KP1A 1J08A 2IMEA 5A5KA 2MBSA 1ZL9A 3ZITA 1THOA 3NIVA
chains in the Genus database with same CATH topology
3F3RA 2HYXA 3NOFA 1PGTA 4ZIJA 1SL1B 2JADA 4EIQA 5LD0A 1EEMA 1A0RP 1ZMAA 2OJLA 2DLXA 2LQOA 3CSHA 4GQFA 5FWGA 2VCZA 2H19A 3CYNA 3ERFA 2B6MA 17GSA 3GUSA 5IMFA 4BWQA 4X0XA 3KH7A 1X5CA 1XOAA 3TRPA 2EIOA 2DBCA 6GSSA 4IW9A 5DAKA 1Y25A 2PGTA 3MYDA 3ZREA 4EUYA 1AQVA 4KA0A 3LFLA 3ZYWA 5L71A 3TJGA 2WULA 3GH9A 4HEA2 3F0IA 1JZOA 2V41A 2PPTA 4TXOA 3I69A 2LUSA 2CVDA 2I3YA 4MZWA 5B8BA 4KUNA 4ECIA 1OKTA 5HR1A 6GSXA 1WIKA 2IMDA 4XIHA 1VRSD 3K8NA 3LG6A 3SBCA 2X8GA 4QL7A 1GSYA 4YQUA 4LL4B 3V1WA 2HRFA 2TRXA 1WMJA 3I43A 2WGRA 1O85A 5DJLA 5EVOA 3H8QA 3IE3A 1XWBA 1E6BA 3ZIVA 1DUGA 4FYUA 1U6TA 4F9ZA 5DCGA 3HVSA 2A2RA 3KM6A 3D4MA 4YKGA 2V32A 1YZXA 1J9BA 4Q5NA 1TK8B 5ECIB 3F6FA 2H74A 3FYGA 4K9ZA 4V2NA 3OR5A 1W4VA 4N11A 1S3DA 3GTUA 1ABAA 2O89A 3LQ7A 3DEXA 2GS3A 4ML6A 6GSWA 1GTBA 3D22A 2Z9SA 3QCPA 1USBA 2LEGA 5COHA 1ERWA 1RQMA 1ACVA 2MMAA 4K5RA 5D9VA 1BEDA 4V2LA 3A2VA 3GNJA 5ECPB 2ON5A 4GSNA 5IMDA 4ECCA 1Z5YE 1OE7A 2MBTA 3CTGA 1G6WA 1QUWA 1SKWB 2GSTA 2LS5A 1Q98A 3GKXA 1K3YA 5CRWA 2ZNMA 4GSSA 2VLTA 3ZRDA 2HLSA 4PNGA 5G1LA 2FLSA 1BAYA 3EURA 5D9XA 2VLVA 3MAKA 2R2JA 2CQ9A 1ERTA 22GSA 3SWLA 3UVTA 3RAZA 1FB6A 3FZ5A 4L5OA 3WT2A 11GSA 5E59A 2YN1A 1XPVA 3IR4A 4PQIA 4ZB6A 3EC3A 4I8BA 4YAPA 4O92A 4DEJA 4NXIA 2R37A 16GSA 3QPMA 4RQRA 5ENUA 4K8MA 1WOUA 2CA8A 3M3MA 2OE0A 2B7JA 3GRXA 2WDUA 1Z7RA 2HRAA 4ECBA 1TI3A 1V40A 4BVYA 2KLXA 3DD3A 3FZAA 3J7Yk 1PL1A 3FR9A 2H8LA 2JU5A 1DE1A 1PKWA 2H1DA 4HQSA 4ID0A 2CX4A 1T8EB 2VUPA 2PVQA 4O5UA 1NSWA 3M9JA 3ERWA 3QR6A 3GFKA 2VD0A 4ISDA 2HFDA 4RQXA 2DC5A 3CSIA 3I6AA 3LWAA 2AB6A 4XS1A 5ECHB 4ULXA 1UA5A 2R0PA 5IO2A 2H66A 2LRTA 3ZFBA 2F3MA 4F0BA 3Q6OA 4HU7A 4MABA 1FOHA 1EOHA 1YEPA 5IM9A 4K2DA 3UBKA 3LSZA 2GQMA 4L0UA 3F3QA 3FZ9A 4GTUA 4HZ4A 2HZEB 2C0GA 1FVKA 1S3CA 3KJYA 3KGKA 4ZILA 2B7KA 4MZCA 1URMA 4XRAA 2OADA 2GZZA 4Q5FA 4TOPA 1TKDB 3HJPA 1K0AA 4HU9A 1SKRB 4IKHA 5GZZB 3JCML 4EF0A 1SJZA 5BMUA 1SJ6A 3ZMKA 3TGZA 2DJJA 2YPMA 1AIUA 1OE8A 2H71A 4KCAA 3TKSC 4IHUA 3VFIA 1WPIA 1K3OA 4WXTA 3UARA 2CAQA 12GSA 4HQZA 4JR4A 2WRTA 5ELGA 1TXXA 3EWLA 4TRXA 4GRFA 2EIRA 4V1Ag 2OACA 2K9FA 3TOUA 3FEUA 1TOFA 2MYGA 3EINA 4Z7XA 1B4QA 3D5JA 4TR1B 4ZBDA 1QXHA 1ERUA 2ZCTA 2A2SA 2VCQA 2GDRA 1GTUA 1NW2A 2H75A 2YZUA 4TR4A 3LXTA 1V9WA 3E0UA 1FG4A 1XWGA 1GTIA 3GN3A 4J2FA 1YJ6A 2GSSA 1T1VA 2R4VA 3RBTA 3Q19A 1GSSA 4NAXA 1B9XC 3UL3A 2EC4A 2X8HA 4WEYA 1YKAA 1Y6EA 2IMKA 4WBRD 2IJYA 3BCKA 3QOUA 3TRXA 2K6VA 1ZGNA 5IO0A 3D4TA 2J9HA 1K0CA 1AQXA 4PUAA 4POKA 2QA1A 3TDGA 3ZVJD 1TK0B 3FZ4A 3HD5A 4YAVA 4G9HA 4OFNA 1LJRA 1FB0A 2RM5A 1PX7A 2R6KA 2OE3A 4Q5QA 1I9DA 3VK9A 3KXOA 1TRVA 4DSQA 4KW6A 2R3XA 1V57A 2C8UA 2DIYA 3ZMLA 3RPNA 1G7OA 2FD3A 2HSHA 4YKFA 3MNGA 3UEMA 5DQYA 3TJJA 3VPQA 3EYTA 4LMWA 2BMXA 2VO4A 1GLQA 2X8CA 1LU4A 3KIJA 3HJMA 5J9CA 4EC0A 4JU5A 4KX4A 2YOIA 5A4WA 3UVHA 4PX1A 4MA9A 1GSQA 2FWFA 1GUHA 2AYTA 3GH6A 4E8HA 2TRCP 2CZ2A 3IHQA 3TKPA 3WD6A 4PUFC 3EMXA 2GSQA 2C3NA 2O87A 4BVXB 1ZCPA 3MWHA 3ZLPA 3BD2A 4HS1A 5G31A 3PPUA 3KMNA 4LMVA 3APQA 4ZBAA 4CHSA 4BWSA 2YJ7A 1B48A 1QMVA 3EE2A 1PSQA 1FOVA 4I2TA 4ZL8A 2G2QA 1BYEA 4MNNA 4IBPA 3G7IA 1TU7A 3KMOA 4IQ1A 4D73B 5J5NA 4MF6A 3HVVA 2LRCA 3DWVA 2VM2A 5H5QA 1A23A 4TW5A 5JCGA 2X49A 3FKFA 5F0GA 2CT6A 5HFIA 3RHCA 2C0FA 5CAXA 2L6CA 3QDNA 4A5PA 1XOBA 2RLIA 4PXOA 1I5GA 1YF0A 2C80A 5DALB 1H75A 5IMVA 1WP0A 3UIWA 1QK8A 1DE2A 1SK0A 4G19A 4MH3A 4NV5A 5H5SA 3GKNA 5JWRB 1DBYA 1T4ZA 3ZTLA 5DQSA 4ZBBA 5ECRB 1TRWA 2HI7A 1JZRA 1GSDA 3WGXA 3A3TA 4OO5A 1GLPA 1EOGA 5C00A 4F2IA 1ZZYA 2GZPA 1GP1A 2CAIA 1R4WA 4PURA 2YZHA 1GWCA 1J0FA 3QFBC 3IPZA 1T7PB 4OFMA 4N0VA 3M0FA 4NHZA 3VURA 2N5BA 3HY2A 3E9JB 3IK9A 5IPGA 4TR1A 2DIZA 5HFGA 2RM6A 1KEBA 3L9SA 4XS6A 1OC3A 3UOMA 4XS4B 2F51A 2GT5A 2YJHA 2HRKA 2XPDA 1SL0B 4AJ8A 1K0OA 5DJMA 3H4KA 3HA9A 1MEKA 3TB2A 4K0GA 3M8NA 3TKSE 5D73A 4KAEA 1TW9A 4KGIA 1FAAA 4N0ZA 1WWJA 3QAGA 3PINA 2H70A 2I4AA 2HRNA 4K5SA 4GCIA 5IIZA 2FA8A 2OBIA 1EGOA 1Z7PA 1X9SB 4QL9A 1U88A 4KE3A 2VAFA 3FR3A 2B5XA 3ISOA 3DRNA 4MF7A 3UMAA 4ML1A 2F8AA 2DJ1A 5JWOB 2HXKA 3CXGA 4QQ7A 5LCZA 1A24A 3FRCA 1UN2A 4HZ2A 3VPTA 1NM3A 2L4QA 1KBNA 1M9BA 4MPGA 1F2EA 5D9WA 5CREA 3F8UA 4HOJA 5CRHA 1B8XA 1SD8A 1AXDA 10GSA 1MD3A 4EO3A 2YV7A 1O7UA 3BCIA 3EVIA 1HNBA 3GURA 2FNOA 4YH2A 1XW5A 3RPPA 5A4UA 3ZFLA 4MJEA 2E2GA 3MSZA 4RI7A 1KNGA 3DIEA 4X4JA 5ID2B 2YWOA 2HSMA 4KH7A 1PQNA 3WGEA 1Q4JA 5G5FA 4CY6A 2PBJA 3L9VA 5KN2A 1QFNA 1ILOA 2QC7A 3R2QA 1VF2A 1SENA 1SYRA 4EL1A 2YWIA 3R3EA 2GQLA 1M2AA 2A2PA 1TI1A 1VF1A 1GUKA 4POBA 2D2ZA 4H86A 2BTOT 4BVXA 2QKEA 4NV2A 1EV4A 3LGCA 5GSSA 2LKUA 4GF0A 1AQWA 1ML6A 2VCXA 3MIXA 1AC1A 1F6MC 3KH9A 4OWYA 3F4SA 1PA3A 2QSIA 2L5OA 2LJRA 2DJ2A 2K8VA 3O76A 4CDOA 1ON4A 3CTFA 4ZXGA 2H0IA 3VLNA 4ZB8A 2GLRA 2VL3A 4NPBA 4RI6A 5CNWA 1WJKA 2GTUA 4D73A 1HYUA 2LV3A 2AV4A 3I9V2 2B5EA 1YKCA 1Z3EA 2YWNA 1UC7A 2GSRA 4L0WA 1M2BA 2H72A 3HJOA 1XW9A 4EVMA 3APOA 1OC8A 1EP7A 2HZFA 2H6YA 4K0NA 4G10A 5DALA 4IS0A 2YV9A 2G0FA 4WKWA 4BPYA 5GAPD 2IIYA 1R7HA 1TTZA 2M72A 2FWEA 4NMUA 1K0BA 1FHEA 4BL7B 5KN0A 2V1MA 1XCCA 3CMIA 4KDXA 3TUEA 2L57A 3H1NA 3VWXA 5G1KA 3C71A 4WETA 4ACSA 4LLRA 2VM1A 1F37A 1PMTA 1KTEA 1XWCA 5IOWA 5AIVA 1PX6A 3TJKA 1B4PA 1JLVA 4WF4A 2HNLA 1V58A 1YQ1A 4MJBA 2B3SA 2AUVA 3HZ8A 4OCEA 1GSUA 3FK8A 4POMA 5G30A 4XS4A 5G5EA 5C04A 2KUCA 6GSTA 4EDZA 1RW1A 2YANA 2ES7A 4KNDA 2AAWA 2H0HA 2JZTA 5E4WA 3ME8A 1MDIA 2H0GA 2IN3A 5D8IA 2KP2A 3QAVA 3G7YA 2VCTA 3IC4A 3HCZA 5B6MA 2PUKC 3EPTA 4L5LA 2N5AA 4IP1A 3NZNA 6GSYA 2MZCA 5HR0A 4Z2UA 3F6DA 2OKAA 4F0CA 1T00A 1IYIA 1FVJA 3C8EA 4MK3A 2EIQA 3ZVJA 1C72A 4MP4A 3LXZA 4TR0A 1AW9A 2ZUPA 3FMWA 3GKKA 4K6XA 5J4UA 4MF5A 3D6IA 2X64A 1O8WA 5CO3A 3U6VA 1TDIA 5H5RA 3IDVA 4EXJA 1XIYA 2XHFA 1GULA 2XBIA 3IOSA 4KB3A 1A2JA 4XCSA 1X5EA 5ECKB 2MMNA 3ZL5A 5HR3A 2LNTA 4IVFA 1OC9B 7GSSA 2V2GA 5ID2A 3L78A 1GL8A 4K7OA 2PU9C 2M46A 3LW9A 3APSA 1Z6MA 5CP1A 5DDLA 4N30A 4PQ1A 4X43A 2O7KA 4NHWA 1GSEA 1VGLA 4IN0A 1F3AA 3H93A 3IRAA 1HNCA 1PN9A 1OVNA 3IV4A 3A2XA 4IP6A 5ECMB 2H73A 5EPFA 5LNKe 2AJQB 2LTKA 3VWUA 3RHBA 1U87A 1DSBA 1VF4A 2LJAA 2ALBA 2F8FA 3F4TA 3P2AA 2J23A 1LBKA 2XPEA 8GSSA 1B9YC 3IK7A 2YCDA 3HZ4A 4EIPA 5HQPA 1EWXA 1T3BA 1UVZA 1ZYPA 2VCWA 5FT3A 4K2XA 1BQ7A 4OMVA 1MDKA 1TRUA 5JCWA 2P5QA 2AHEA 5KOXA 3P8WA 4DSSB 3A5IA 4K7NA 3MDKA 3TRQA 3HKRA 3QFAC 1TJDA 3F4RA 4KDUA 3TKRA 1MD4A 5CRGA 1CQGA 3EU3A 4ZL9A 2C3QA 4GLTA 1X0RA 3GL5A 3TKSA 1G6YA 1XWKA 3TCOA 4EKZA 1PKZA 2DSAA 4IELA 1GRXA 1A8YA 4BL7A 2H1GA 2RUFA 4KSMA 1F3BA 4FO5A 4JE1A 2C4JA 4MCUA 4MJCA 3Q74A 1SJIA 5AISA 2HZEA 2LRNA 2C3TA 2P31A 1A0FA 1T4YA 4OO4A 4CY8A 1XZOA 2CZ3A 1ZYEA 4MLYA 4EE0A 4X1UA 2OA7A 1FO5A 4AGSA 2VL2A 3QAWA 2V6OA 4G0IA 5ABRA 2NPBA 4PNFA 3DYRA 2IMIA 2B5YA 3FY7A 2P0GA 3IA1A 5BRTA 4N10A 2DJ0A 2WZ9A 3VWWA 3W6GA 4JRRA 4FYCA 3DMLA 3IXRA 1M2DA 4FH8A 4JBBA 2CVKA 1HNAA 2WCIA 3HDCA 2WFCA 2R0GA 2FA4A 3WGDA 2C1YA 2FGXA 2WJUA 5KOWA 2IL3A 2DKIA 2RUEA 5INYA 1PN0A 2K18A 3G9BA 3A5WA 4I97A 4XTSA 3VWVA 3IAM2 3FW2A 4BA7A 2L5LA 1SD9A 4HJ2A 1R5AA 4V2MA 3GKMA 4KSOA 3CBUA 5HFKA 3KP9A 3UAPA 3UBLA 2L6DA 1OKDA 3ERGA 1K0NA 4WF5A 5J9BA 3LYPA 3GSSA 2QA2A 3IHGA 2FHEA 4ZB9A 14GSA 2NDOA 3PH9A 2UZ8A 3HXSA 4FIWA 5D93A 1R5PA 4IGJA 3FHKA 4WR4A 3TKQA 1GUMA 5B7CA 4PGTA 2JSZA 1YEXA 5GSTA 20GSA 2FWGA 4XHMA 1BG5A 2IWTA 4XRDA 4IQAA 5KEJA 3EMPA 4YQMA 1OC9A 2FUG2 4CW9A 2GT6A 2O85A 1A2LA 2BJXA 4IJ3A 3C1SA 3PGTA 5EY6A 3DGQA 4K7IA 1EV9A 5B6NA 3GA4A 5FHIA 2E0QA 4ICYA 4NWYA 4MPFA 4USSA 4K1FA 5F05A 1N2AA 1PRXA 1EGRA 3DVWA 4V1Ap 5IMZA 1NHOA 2H30A 1G7EA 3VI5A 4TKYA 3D21A 4O7HA 2MMZA 4DSRA 2GZYA 2JSYA 2REMA 4MH2A 2IPAA 3CRTA 4JEDA 5AIXA 1SYXA 4TVEA 3AY8A 3GMFA 1THXA 4ZL7A 1CQHA 4Z2RA 1GNWA 3GHAA 1A2MA 3S9FA 2JZSA 4O32A 1ZYQB 2PN8A 4DSSA 1JFUA 3O3TA 1WE0A 2X99A 1SU9A 2CX3A 2IFQB 4WR5A 5IMCA 4J57E 3EU4A 1S3AA 3WYWA 2KHPA 1F9MA 1EP8A 4F82A 5KN3A 4J56E 5CYYA 2JACA 2QGVA 1SL2B 2I1UA 1GTAA 1VF3A 4LA1A 4GXZA 4TN8A 1XW6A 4GWRA 1ERVA 2YNXA 3KD0A 5J41A 4AF2A 3C73A 3J7Yb 4PQHA 3IBHA 2LJKA 2HSYA 4Q5RA 5A4VA 3BOAA 5GAND 5AN1A 1EZKA 2CV4A 3LORA 1XVQA 5CRDA 2FY6A 2HT9A 3LYKA 3P90A 4KDYA 2GQKA 3GYKA 3VI7A 5KN1A 4IJIA 1RK4A 1X9MB 3HVXA 3WT1A 2VCVA 5F8BA 2CVBA 4AJ6A 3GSTA 2MMOA 1IYHA 3GX0A 3LJRA 3DKSA 4I6XA 3W8SA 2VIMA 6GSUA 2VLUA 3L9UA 1JLWA 3DXBA 1X9WB 1W89A 5B8AA 3IC8A 19GSA 2FWHA 2X4AA 4G0KA 4GSTA 1PD21 4O5QA 1YDKA 1K0DA 13GSA 5D9TA 1QGVA 1R26A 2H1BA 1ZOFA 1A8LA 1O8XA 2ON7A 1AAZA 4ECJA 3U5RE 1BJXA 2C0EA 3HYPA 5ECNB 2H01A 4TXVA 1TP9A 3F9UA 2PMTA 4F03A 2DJ3A 4RUVA 1E2YA 5DCHA 3DVXA 2GGTA 2RIIA 3KP8A 1EEJA 4O5RA 2YP6A 3US3A 3A2WA 1M99A 2C0DA 1TRSA 2DMMA 4PTSA 1GNEA 2B1KA 1ZYNA 4YQVA 1HQOA 3TOTA 1HD2A 3CSJA 3BJ5A 3N9JA 4Z2TA 1TU8A 3LEFA 2OE1A 2JL4A 1M0UA 4MJAA 5G2ZA 3RDWA 4TR3A 3QMXA 1SK2A 2O8VB 2WB9A 4I2UA 5ECLB 2VOCA 2DMLA 3Q18A 5DAKB 3O6TA 4LL1B 5ECOB 3TJBA 1O6JA 3GIXA 1WRYA 3C1RA 3KZQA 2L4CA 1PL2A 9GSSA 2XC2A 2VL2C 4HI7A 4ILFA 4GQCA 2E7PA 1U3IA 4TXOB 4EDYA 5IPHA 3D0ZA 1V2AA 5HR2A 4P3YB 4MZBA 4G2EA 3M1GA 3GV1A 2N5FA 3KTBA 5IOXA 2GVPA 1NHYA 2DJKA 2XBQA 5IMAA 1ST9A 1K3LA 4KCEA 2R0CA 3IAS2 3GL3A 2FCHA 3FR6A 4E8EA 2LSTA 1M9AA 4POLA 2H1AA 5ELAA 2IFQA 1YF1A 4FQUA 1H4OA 5D96A 4KF9A 5AGYA 4OCFA 4I5QA 1OYJA 2LNSA 2PWJA 18GSA 2YWMA 5F06A 3KTLA 3UJ1A 4HUAA 2JZRA 3GTUB 2I9HA 4FYBA 4MMMA 1Z6NA 4HJMA 1M7TA 2P5RA 1GH2A 1XBSA 1G0TA 1BX9A 4WBJA 3N5OA 3F63A 3W8JA 3P7XA 5IQYA 1N8JA 3HHVA 5DVBA 2VD1A 4AJ7A 2PVOC 5EL8A 5JWQB 1Z9HA 1O81A 2HE3A 2NTOA 3TJFA 2A4HA 2B1LA 3G7JA 1MTCA 5ECQB 2PERA 1XWAA 1XXUA 2K8SA 1JZWA 5DBQA 4MDCA 2E2MA 2F9SA 1K0MA 5ECSA 1U3AA 4OD7A 3E3EA 3KEBA 5J3RA 2WS2A 1X5DA 2M80A 4L8EA 3BBYA 4G0LA 2I81A 3PR8A 3KCMA 2LQQA 1JHBA 2NVLA 1V98A 4JZQA 2L59A 3L4NA 3C7MA 1AUCA 2OBKA 1TK5B 1QQ2A 2R5GA 1GSFA 3ZIJA 1XFLA 5F07A 6GSVA 2A4VA 3GX8A 1MDJA 2KOKA 1OAZA 2H76A 3L0HA 4DVCA 3CRUA 2NBSA 3ED3A 2TIRA 1JZDA 1O73A 2H6XA 2V6KA 1FW1A 2DKHA 3M9KA 1YY7A 3H79A 2IMFA 4JR6A 4BVYB 4HDEA 1XVWA 2H6ZA 2VL9A 3ZZXA 3ME7A 4OFTA 1SKSB 1SK1A 5JCUA 3QD9A 2KP1A 1J08A 2IMEA 5A5KA 2MBSA 1ZL9A 3ZITA 1THOA 3NIVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3F3R A;  2HYX A;  3NOF A;  1PGT A;  4ZIJ A;  1SL1 B;  2JAD A;  5LD0 A;  1EEM A;  1A0R P;  1ZMA A;  2OJL A;  2DLX A;  2LQO A;  3CSH A;  4GQF A;  5FWG A;  2VCZ A;  2H19 A;  3CYN A;  3ERF A;  2B6M A;  17GS A;  3GUS A;  5IMF A;  4BWQ A;  4X0X A;  3KH7 A;  1X5C A;  1XOA A;  3TRP A;  2EIO A;  2DBC A;  6GSS A;  4IW9 A;  5DAK A;  1Y25 A;  2PGT A;  3ZRE A;  4EUY A;  1AQV A;  4KA0 A;  3LFL A;  3ZYW A;  5L71 A;  3TJG A;  2WUL A;  3GH9 A;  4HEA 2;  3F0I A;  1JZO A;  2V41 A;  2PPT A;  4TXO A;  3I69 A;  2LUS A;  2CVD A;  2I3Y A;  4MZW A;  5B8B A;  4KUN A;  4ECI A;  1OKT A;  5HR1 A;  6GSX A;  1WIK A;  2IMD A;  4XIH A;  1VRS D;  3K8N A;  3LG6 A;  3SBC A;  2X8G A;  4QL7 A;  1GSY A;  4YQU A;  4LL4 B;  3V1W A;  2HRF A;  2TRX A;  1WMJ A;  3I43 A;  2WGR A;  1O85 A;  5DJL A;  5EVO A;  3H8Q A;  3IE3 A;  1XWB A;  1E6B A;  3ZIV A;  1DUG A;  4FYU A;  1U6T A;  4F9Z A;  5DCG A;  3HVS A;  2A2R A;  3KM6 A;  3D4M A;  2V32 A;  1YZX A;  1J9B A;  4Q5N A;  1TK8 B;  5ECI B;  3F6F A;  2H74 A;  3FYG A;  4K9Z A;  4V2N A;  3OR5 A;  1W4V A;  4N11 A;  1S3D A;  3GTU A;  1ABA A;  2O89 A;  3LQ7 A;  3DEX A;  2GS3 A;  4ML6 A;  6GSW A;  1GTB A;  3D22 A;  2Z9S A;  3QCP A;  1USB A;  2LEG A;  5COH A;  1ERW A;  1RQM A;  1ACV A;  2MMA A;  5D9V A;  1BED A;  4V2L A;  3A2V A;  3GNJ A;  5ECP B;  2ON5 A;  4GSN A;  5IMD A;  4ECC A;  1Z5Y E;  1OE7 A;  2MBT A;  3CTG A;  1G6W A;  1QUW A;  1SKW B;  2GST A;  2LS5 A;  1Q98 A;  3GKX A;  1K3Y A;  5CRW A;  2ZNM A;  4GSS A;  2VLT A;  3ZRD A;  2HLS A;  4PNG A;  5G1L A;  2FLS A;  1BAY A;  3EUR A;  5D9X A;  2VLV A;  3MAK A;  2R2J A;  2CQ9 A;  1ERT A;  22GS A;  3SWL A;  3UVT A;  3RAZ A;  1FB6 A;  3FZ5 A;  4L5O A;  3WT2 A;  11GS A;  5E59 A;  2YN1 A;  1XPV A;  3IR4 A;  4PQI A;  4ZB6 A;  3EC3 A;  4I8B A;  4YAP A;  4O92 A;  4DEJ A;  4NXI A;  2R37 A;  16GS A;  3QPM A;  4RQR A;  5ENU A;  4K8M A;  1WOU A;  2CA8 A;  3M3M A;  2OE0 A;  2B7J A;  3GRX A;  2WDU A;  1Z7R A;  4ECB A;  1TI3 A;  1V40 A;  4BVY A;  2KLX A;  3DD3 A;  3FZA A;  3J7Y k;  1PL1 A;  3FR9 A;  2H8L A;  2JU5 A;  1DE1 A;  1PKW A;  2H1D A;  4HQS A;  4ID0 A;  2CX4 A;  1T8E B;  2VUP A;  2PVQ A;  1NSW A;  3M9J A;  3ERW A;  3QR6 A;  3GFK A;  2VD0 A;  4ISD A;  2HFD A;  4RQX A;  2DC5 A;  3CSI A;  3I6A A;  3LWA A;  2AB6 A;  4XS1 A;  5ECH B;  4ULX A;  1UA5 A;  5IO2 A;  2H66 A;  2LRT A;  3ZFB A;  2F3M A;  4F0B A;  3Q6O A;  4HU7 A;  4MAB A;  1EOH A;  1YEP A;  5IM9 A;  4K2D A;  3UBK A;  3LSZ A;  2GQM A;  4L0U A;  3F3Q A;  3FZ9 A;  4GTU A;  4HZ4 A;  2HZE B;  2C0G A;  1FVK A;  1S3C A;  3KJY A;  3KGK A;  4ZIL A;  2B7K A;  4MZC A;  1URM A;  4XRA A;  2OAD A;  2GZZ A;  4Q5F A;  4TOP A;  1TKD B;  3HJP A;  1K0A A;  4HU9 A;  1SKR B;  4IKH A;  5GZZ B;  3JCM L;  4EF0 A;  1SJZ A;  1SJ6 A;  3ZMK A;  3TGZ A;  2DJJ A;  2YPM A;  1AIU A;  1OE8 A;  2H71 A;  4KCA A;  3TKS C;  4IHU A;  3VFI A;  1WPI A;  1K3O A;  4WXT A;  3UAR A;  2CAQ A;  12GS A;  4HQZ A;  4JR4 A;  2WRT A;  5ELG A;  1TXX A;  3EWL A;  4TRX A;  4GRF A;  2EIR A;  4V1A g;  2OAC A;  2K9F A;  3TOU A;  3FEU A;  1TOF A;  2MYG A;  3EIN A;  4Z7X A;  1B4Q A;  3D5J A;  4TR1 B;  4ZBD A;  1QXH A;  1ERU A;  2ZCT A;  2A2S A;  2VCQ A;  2GDR A;  1GTU A;  1NW2 A;  2H75 A;  2YZU A;  4TR4 A;  3LXT A;  1V9W A;  3E0U A;  1FG4 A;  1XWG A;  1GTI A;  3GN3 A;  4J2F A;  1YJ6 A;  2GSS A;  1T1V A;  2R4V A;  3RBT A;  3Q19 A;  1GSS A;  4NAX A;  1B9X C;  3UL3 A;  2EC4 A;  2X8H A;  4WEY A;  1YKA A;  1Y6E A;  2IMK A;  4WBR D;  2IJY A;  3BCK A;  3QOU A;  3TRX A;  2K6V A;  1ZGN A;  5IO0 A;  3D4T A;  2J9H A;  1K0C A;  1AQX A;  4PUA A;  4POK A;  3TDG A;  3ZVJ D;  1TK0 B;  3FZ4 A;  3HD5 A;  4YAV A;  4G9H A;  4OFN A;  1LJR A;  1FB0 A;  2RM5 A;  1PX7 A;  2R6K A;  2OE3 A;  4Q5Q A;  1I9D A;  3VK9 A;  3KXO A;  1TRV A;  4DSQ A;  4KW6 A;  2R3X A;  1V57 A;  2C8U A;  2DIY A;  3ZML A;  3RPN A;  1G7O A;  2FD3 A;  2HSH A;  3MNG A;  3UEM A;  5DQY A;  3TJJ A;  3VPQ A;  3EYT A;  4LMW A;  2BMX A;  2VO4 A;  1GLQ A;  2X8C A;  1LU4 A;  3KIJ A;  3HJM A;  5J9C A;  4EC0 A;  4JU5 A;  4KX4 A;  2YOI A;  5A4W A;  3UVH A;  4PX1 A;  4MA9 A;  1GSQ A;  2FWF A;  1GUH A;  2AYT A;  3GH6 A;  4E8H A;  2TRC P;  2CZ2 A;  3IHQ A;  3TKP A;  3WD6 A;  4PUF C;  3EMX A;  2GSQ A;  2C3N A;  2O87 A;  1ZCP A;  3MWH A;  3ZLP A;  3BD2 A;  4HS1 A;  5G31 A;  3KMN A;  4LMV A;  3APQ A;  4ZBA A;  4CHS A;  4BWS A;  2YJ7 A;  1B48 A;  1QMV A;  3EE2 A;  1PSQ A;  1FOV A;  4I2T A;  4ZL8 A;  2G2Q A;  1BYE A;  4IBP A;  3G7I A;  1TU7 A;  3KMO A;  4IQ1 A;  4D73 B;  5J5N A;  4MF6 A;  3HVV A;  2LRC A;  3DWV A;  2VM2 A;  5H5Q A;  1A23 A;  4TW5 A;  5JCG A;  3FKF A;  5F0G A;  2CT6 A;  5HFI A;  3RHC A;  2C0F A;  5CAX A;  2L6C A;  3QDN A;  1XOB A;  2RLI A;  4PXO A;  1I5G A;  1YF0 A;  2C80 A;  5DAL B;  1H75 A;  5IMV A;  1WP0 A;  3UIW A;  1QK8 A;  1DE2 A;  1SK0 A;  4G19 A;  4MH3 A;  4NV5 A;  5H5S A;  3GKN A;  5JWR B;  1DBY A;  1T4Z A;  3ZTL A;  5DQS A;  4ZBB A;  5ECR B;  1TRW A;  2HI7 A;  1JZR A;  1GSD A;  3WGX A;  3A3T A;  4OO5 A;  1GLP A;  1EOG A;  5C00 A;  4F2I A;  1ZZY A;  2GZP A;  1GP1 A;  2CAI A;  1R4W A;  4PUR A;  2YZH A;  1GWC A;  1J0F A;  3QFB C;  3IPZ A;  1T7P B;  4OFM A;  4N0V A;  3M0F A;  4NHZ A;  3VUR A;  2N5B A;  3HY2 A;  3E9J B;  3IK9 A;  5IPG A;  4TR1 A;  2DIZ A;  5HFG A;  2RM6 A;  1KEB A;  3L9S A;  4XS6 A;  1OC3 A;  3UOM A;  4XS4 B;  2F51 A;  2GT5 A;  2YJH A;  2XPD A;  1SL0 B;  4AJ8 A;  1K0O A;  5DJM A;  3H4K A;  3HA9 A;  1MEK A;  3TB2 A;  4K0G A;  3M8N A;  3TKS E;  5D73 A;  4KAE A;  1TW9 A;  4KGI A;  1FAA A;  4N0Z A;  1WWJ A;  3QAG A;  3PIN A;  2H70 A;  2I4A A;  2HRN A;  4GCI A;  5IIZ A;  2FA8 A;  2OBI A;  1EGO A;  1Z7P A;  1X9S B;  4QL9 A;  1U88 A;  4KE3 A;  2VAF A;  3FR3 A;  2B5X A;  3ISO A;  3DRN A;  4MF7 A;  3UMA A;  4ML1 A;  2F8A A;  2DJ1 A;  5JWO B;  2HXK A;  3CXG A;  4QQ7 A;  5LCZ A;  1A24 A;  3FRC A;  1UN2 A;  4HZ2 A;  3VPT A;  1NM3 A;  2L4Q A;  1KBN A;  1M9B A;  4MPG A;  1F2E A;  5D9W A;  5CRE A;  3F8U A;  4HOJ A;  5CRH A;  1B8X A;  1SD8 A;  1AXD A;  10GS A;  1MD3 A;  4EO3 A;  2YV7 A;  1O7U A;  3BCI A;  3EVI A;  1HNB A;  3GUR A;  2FNO A;  4YH2 A;  1XW5 A;  3RPP A;  5A4U A;  3ZFL A;  4MJE A;  2E2G A;  3MSZ A;  4RI7 A;  1KNG A;  3DIE A;  5ID2 B;  2YWO A;  4KH7 A;  1PQN A;  3WGE A;  1Q4J A;  5G5F A;  2PBJ A;  3L9V A;  5KN2 A;  1QFN A;  1ILO A;  2QC7 A;  3R2Q A;  1VF2 A;  1SEN A;  1SYR A;  4EL1 A;  2YWI A;  2GQL A;  1M2A A;  1TI1 A;  1VF1 A;  1GUK A;  4POB A;  2D2Z A;  4H86 A;  2BTO T;  4BVX A;  2QKE A;  4NV2 A;  1EV4 A;  3LGC A;  5GSS A;  2LKU A;  4GF0 A;  1AQW A;  1ML6 A;  2VCX A;  1AC1 A;  1F6M C;  3KH9 A;  4OWY A;  3F4S A;  1PA3 A;  2QSI A;  2L5O A;  2LJR A;  2DJ2 A;  2K8V A;  3O76 A;  4CDO A;  1ON4 A;  3CTF A;  4ZXG A;  2H0I A;  3VLN A;  4ZB8 A;  2GLR A;  2VL3 A;  4NPB A;  4RI6 A;  5CNW A;  1WJK A;  2GTU A;  4D73 A;  1HYU A;  2LV3 A;  2AV4 A;  3I9V 2;  2B5E A;  1YKC A;  1Z3E A;  2YWN A;  1UC7 A;  2GSR A;  4L0W A;  1M2B A;  2H72 A;  3HJO A;  1XW9 A;  4EVM A;  3APO A;  1OC8 A;  1EP7 A;  2HZF A;  2H6Y A;  4K0N A;  4G10 A;  5DAL A;  4IS0 A;  2YV9 A;  2G0F A;  4WKW A;  4BPY A;  5GAP D;  2IIY A;  1R7H A;  1TTZ A;  2M72 A;  2FWE A;  4NMU A;  1K0B A;  1FHE A;  5KN0 A;  2V1M A;  1XCC A;  3CMI A;  4KDX A;  3TUE A;  2L57 A;  3H1N A;  3VWX A;  5G1K A;  3C71 A;  4WET A;  4ACS A;  4LLR A;  2VM1 A;  1F37 A;  1PMT A;  1KTE A;  1XWC A;  5IOW A;  5AIV A;  1PX6 A;  3TJK A;  1B4P A;  1JLV A;  4WF4 A;  2HNL A;  1V58 A;  1YQ1 A;  4MJB A;  2B3S A;  2AUV A;  3HZ8 A;  4OCE A;  1GSU A;  3FK8 A;  4POM A;  5G30 A;  4XS4 A;  5G5E A;  5C04 A;  2KUC A;  6GST A;  4EDZ A;  1RW1 A;  2YAN A;  2ES7 A;  4KND A;  2AAW A;  2H0H A;  2JZT A;  5E4W A;  3ME8 A;  1MDI A;  2H0G A;  2IN3 A;  5D8I A;  2KP2 A;  3QAV A;  3G7Y A;  2VCT A;  3IC4 A;  3HCZ A;  5B6M A;  2PUK C;  4L5L A;  2N5A A;  4IP1 A;  3NZN A;  6GSY A;  2MZC A;  5HR0 A;  3F6D A;  2OKA A;  4F0C A;  1T00 A;  1IYI A;  1FVJ A;  3C8E A;  4MK3 A;  2EIQ A;  3ZVJ A;  1C72 A;  4MP4 A;  3LXZ A;  4TR0 A;  1AW9 A;  2ZUP A;  3GKK A;  4K6X A;  5J4U A;  4MF5 A;  3D6I A;  2X64 A;  1O8W A;  5CO3 A;  3U6V A;  1TDI A;  5H5R A;  3IDV A;  4EXJ A;  1XIY A;  2XHF A;  1GUL A;  2XBI A;  3IOS A;  4KB3 A;  1A2J A;  4XCS A;  1X5E A;  5ECK B;  2MMN A;  3ZL5 A;  5HR3 A;  2LNT A;  4IVF A;  1OC9 B;  7GSS A;  2V2G A;  5ID2 A;  3L78 A;  1GL8 A;  4K7O A;  2PU9 C;  2M46 A;  3APS A;  1Z6M A;  5CP1 A;  5DDL A;  4N30 A;  4PQ1 A;  4X43 A;  2O7K A;  4NHW A;  1GSE A;  1VGL A;  4IN0 A;  1F3A A;  3H93 A;  3IRA A;  1HNC A;  1PN9 A;  1OVN A;  3IV4 A;  3A2X A;  4IP6 A;  5ECM B;  2H73 A;  5EPF A;  5LNK e;  2AJQ B;  2LTK A;  3VWU A;  3RHB A;  1U87 A;  1DSB A;  1VF4 A;  2LJA A;  2ALB A;  2F8F A;  3F4T A;  3P2A A;  2J23 A;  1LBK A;  2XPE A;  8GSS A;  1B9Y C;  3IK7 A;  2YCD A;  3HZ4 A;  5HQP A;  1EWX A;  1T3B A;  1UVZ A;  2VCW A;  5FT3 A;  1BQ7 A;  4OMV A;  1MDK A;  1TRU A;  5JCW A;  2P5Q A;  2AHE A;  3P8W A;  4DSS B;  4K7N A;  3MDK A;  3TRQ A;  3HKR A;  3QFA C;  1TJD A;  3F4R A;  4KDU A;  3TKR A;  1MD4 A;  5CRG A;  1CQG A;  3EU3 A;  4ZL9 A;  2C3Q A;  4GLT A;  1X0R A;  3GL5 A;  3TKS A;  1G6Y A;  1XWK A;  3TCO A;  4EKZ A;  1PKZ A;  2DSA A;  4IEL A;  1GRX A;  1A8Y A;  4BL7 A;  2H1G A;  2RUF A;  4KSM A;  1F3B A;  4FO5 A;  4JE1 A;  2C4J A;  4MCU A;  4MJC A;  3Q74 A;  1SJI A;  5AIS A;  2HZE A;  2LRN A;  2C3T A;  2P31 A;  1A0F A;  1T4Y A;  4OO4 A;  1XZO A;  2CZ3 A;  1ZYE A;  4MLY A;  4EE0 A;  4X1U A;  2OA7 A;  1FO5 A;  4AGS A;  2VL2 A;  3QAW A;  2V6O A;  5ABR A;  2NPB A;  4PNF A;  3DYR A;  2IMI A;  2B5Y A;  3FY7 A;  2P0G A;  3IA1 A;  4N10 A;  2DJ0 A;  2WZ9 A;  3VWW A;  3W6G A;  4JRR A;  4FYC A;  3DML A;  3IXR A;  1M2D A;  4FH8 A;  4JBB A;  2CVK A;  1HNA A;  2WCI A;  3HDC A;  2WFC A;  2FA4 A;  3WGD A;  2C1Y A;  2FGX A;  2WJU A;  2IL3 A;  2RUE A;  5INY A;  2K18 A;  3G9B A;  3A5W A;  4I97 A;  4XTS A;  3VWV A;  3IAM 2;  3FW2 A;  4BA7 A;  2L5L A;  1SD9 A;  4HJ2 A;  1R5A A;  4V2M A;  3GKM A;  4KSO A;  3CBU A;  5HFK A;  3KP9 A;  3UAP A;  3UBL A;  2L6D A;  1OKD A;  3ERG A;  1K0N A;  4WF5 A;  5J9B A;  3LYP A;  3GSS A;  2FHE A;  4ZB9 A;  14GS A;  2NDO A;  3PH9 A;  3HXS A;  4FIW A;  5D93 A;  1R5P A;  4IGJ A;  3FHK A;  4WR4 A;  3TKQ A;  1GUM A;  5B7C A;  4PGT A;  2JSZ A;  1YEX A;  5GST A;  20GS A;  2FWG A;  4XHM A;  1BG5 A;  2IWT A;  4XRD A;  4IQA A;  5KEJ A;  3EMP A;  4YQM A;  1OC9 A;  2FUG 2;  4CW9 A;  2GT6 A;  2O85 A;  1A2L A;  2BJX A;  4IJ3 A;  3C1S A;  3PGT A;  5EY6 A;  3DGQ A;  4K7I A;  1EV9 A;  5B6N A;  3GA4 A;  5FHI A;  2E0Q A;  4NWY A;  4MPF A;  4K1F A;  5F05 A;  1N2A A;  1PRX A;  1EGR A;  3DVW A;  4V1A p;  5IMZ A;  1NHO A;  2H30 A;  1G7E A;  3VI5 A;  4TKY A;  3D21 A;  4O7H A;  2MMZ A;  4DSR A;  2GZY A;  2JSY A;  2REM A;  4MH2 A;  2IPA A;  3CRT A;  4JED A;  5AIX A;  1SYX A;  4TVE A;  3AY8 A;  3GMF A;  1THX A;  4ZL7 A;  1CQH A;  1GNW A;  3GHA A;  1A2M A;  3S9F A;  2JZS A;  4O32 A;  1ZYQ B;  2PN8 A;  4DSS A;  1JFU A;  3O3T A;  1WE0 A;  2X99 A;  1SU9 A;  2CX3 A;  2IFQ B;  4WR5 A;  5IMC A;  4J57 E;  3EU4 A;  1S3A A;  3WYW A;  2KHP A;  1F9M A;  1EP8 A;  4F82 A;  5KN3 A;  4J56 E;  5CYY A;  2JAC A;  2QGV A;  1SL2 B;  2I1U A;  1GTA A;  1VF3 A;  4LA1 A;  4GXZ A;  4TN8 A;  1XW6 A;  4GWR A;  1ERV A;  2YNX A;  3KD0 A;  5J41 A;  4AF2 A;  3C73 A;  3J7Y b;  4PQH A;  3IBH A;  2LJK A;  2HSY A;  4Q5R A;  5A4V A;  3BOA A;  5GAN D;  5AN1 A;  1EZK A;  2CV4 A;  3LOR A;  1XVQ A;  5CRD A;  2FY6 A;  2HT9 A;  3LYK A;  3P90 A;  4KDY A;  2GQK A;  3GYK A;  3VI7 A;  5KN1 A;  4IJI A;  1RK4 A;  1X9M B;  3HVX A;  3WT1 A;  2VCV A;  5F8B A;  2CVB A;  4AJ6 A;  3GST A;  2MMO A;  1IYH A;  3GX0 A;  3LJR A;  3DKS A;  4I6X A;  3W8S A;  2VIM A;  6GSU A;  2VLU A;  3L9U A;  1JLW A;  3DXB A;  1X9W B;  1W89 A;  5B8A A;  19GS A;  2FWH A;  4GST A;  1PD2 1;  1YDK A;  1K0D A;  13GS A;  5D9T A;  1QGV A;  1R26 A;  2H1B A;  1ZOF A;  1A8L A;  1O8X A;  2ON7 A;  1AAZ A;  4ECJ A;  3U5R E;  1BJX A;  2C0E A;  3HYP A;  5ECN B;  2H01 A;  4TXV A;  1TP9 A;  3F9U A;  2PMT A;  4F03 A;  2DJ3 A;  4RUV A;  1E2Y A;  5DCH A;  3DVX A;  2GGT A;  2RII A;  3KP8 A;  1EEJ A;  4O5R A;  2YP6 A;  3US3 A;  3A2W A;  1M99 A;  2C0D A;  1TRS A;  2DMM A;  1GNE A;  2B1K A;  4YQV A;  1HQO A;  3TOT A;  1HD2 A;  3CSJ A;  3BJ5 A;  3N9J A;  1TU8 A;  3LEF A;  2OE1 A;  2JL4 A;  1M0U A;  4MJA A;  5G2Z A;  3RDW A;  4TR3 A;  3QMX A;  1SK2 A;  2O8V B;  2WB9 A;  4I2U A;  5ECL B;  2VOC A;  2DML A;  3Q18 A;  5DAK B;  3O6T A;  4LL1 B;  5ECO B;  3TJB A;  1O6J A;  3GIX A;  1WRY A;  3C1R A;  3KZQ A;  2L4C A;  1PL2 A;  9GSS A;  2XC2 A;  2VL2 C;  4HI7 A;  4ILF A;  4GQC A;  2E7P A;  1U3I A;  4TXO B;  4EDY A;  5IPH A;  3D0Z A;  1V2A A;  5HR2 A;  4P3Y B;  4MZB A;  4G2E A;  3M1G A;  3GV1 A;  2N5F A;  3KTB A;  5IOX A;  2GVP A;  1NHY A;  2DJK A;  2XBQ A;  5IMA A;  1ST9 A;  1K3L A;  4KCE A;  3IAS 2;  3GL3 A;  2FCH A;  3FR6 A;  4E8E A;  2LST A;  1M9A A;  4POL A;  2H1A A;  5ELA A;  2IFQ A;  1YF1 A;  1H4O A;  5D96 A;  5AGY A;  4OCF A;  4I5Q A;  1OYJ A;  2LNS A;  2PWJ A;  18GS A;  2YWM A;  5F06 A;  3KTL A;  3UJ1 A;  4HUA A;  2JZR A;  3GTU B;  2I9H A;  4FYB A;  4MMM A;  1Z6N A;  4HJM A;  1M7T A;  2P5R A;  1GH2 A;  1XBS A;  1G0T A;  1BX9 A;  4WBJ A;  3N5O A;  3F63 A;  3W8J A;  3P7X A;  5IQY A;  1N8J A;  3HHV A;  5DVB A;  2VD1 A;  4AJ7 A;  2PVO C;  5EL8 A;  5JWQ B;  1Z9H A;  1O81 A;  2HE3 A;  2NTO A;  3TJF A;  2B1L A;  3G7J A;  1MTC A;  5ECQ B;  2PER A;  1XWA A;  1XXU A;  2K8S A;  1JZW A;  5DBQ A;  4MDC A;  2E2M A;  2F9S A;  1K0M A;  5ECS A;  1U3A A;  4OD7 A;  3E3E A;  3KEB A;  5J3R A;  2WS2 A;  1X5D A;  2M80 A;  4L8E A;  3BBY A;  2I81 A;  3PR8 A;  3KCM A;  2LQQ A;  1JHB A;  2NVL A;  1V98 A;  4JZQ A;  2L59 A;  3L4N A;  3C7M A;  1AUC A;  2OBK A;  1TK5 B;  1QQ2 A;  2R5G A;  1GSF A;  3ZIJ A;  1XFL A;  5F07 A;  6GSV A;  2A4V A;  3GX8 A;  1MDJ A;  2KOK A;  1OAZ A;  2H76 A;  3L0H A;  4DVC A;  3CRU A;  2NBS A;  3ED3 A;  2TIR A;  1JZD A;  1O73 A;  2H6X A;  2V6K A;  1FW1 A;  3M9K A;  1YY7 A;  3H79 A;  2IMF A;  4JR6 A;  4HDE A;  1XVW A;  2H6Z A;  2VL9 A;  3ZZX A;  3ME7 A;  4OFT A;  1SKS B;  1SK1 A;  5JCU A;  3QD9 A;  2KP1 A;  1J08 A;  2IME A;  5A5K A;  2MBS A;  1ZL9 A;  3ZIT A;  1THO A;  3NIV A; 
#chains in the Genus database with same CATH topology
 3F3R A;  2HYX A;  3NOF A;  1PGT A;  4ZIJ A;  1SL1 B;  2JAD A;  4EIQ A;  5LD0 A;  1EEM A;  1A0R P;  1ZMA A;  2OJL A;  2DLX A;  2LQO A;  3CSH A;  4GQF A;  5FWG A;  2VCZ A;  2H19 A;  3CYN A;  3ERF A;  2B6M A;  17GS A;  3GUS A;  5IMF A;  4BWQ A;  4X0X A;  3KH7 A;  1X5C A;  1XOA A;  3TRP A;  2EIO A;  2DBC A;  6GSS A;  4IW9 A;  5DAK A;  1Y25 A;  2PGT A;  3MYD A;  3ZRE A;  4EUY A;  1AQV A;  4KA0 A;  3LFL A;  3ZYW A;  5L71 A;  3TJG A;  2WUL A;  3GH9 A;  4HEA 2;  3F0I A;  1JZO A;  2V41 A;  2PPT A;  4TXO A;  3I69 A;  2LUS A;  2CVD A;  2I3Y A;  4MZW A;  5B8B A;  4KUN A;  4ECI A;  1OKT A;  5HR1 A;  6GSX A;  1WIK A;  2IMD A;  4XIH A;  1VRS D;  3K8N A;  3LG6 A;  3SBC A;  2X8G A;  4QL7 A;  1GSY A;  4YQU A;  4LL4 B;  3V1W A;  2HRF A;  2TRX A;  1WMJ A;  3I43 A;  2WGR A;  1O85 A;  5DJL A;  5EVO A;  3H8Q A;  3IE3 A;  1XWB A;  1E6B A;  3ZIV A;  1DUG A;  4FYU A;  1U6T A;  4F9Z A;  5DCG A;  3HVS A;  2A2R A;  3KM6 A;  3D4M A;  4YKG A;  2V32 A;  1YZX A;  1J9B A;  4Q5N A;  1TK8 B;  5ECI B;  3F6F A;  2H74 A;  3FYG A;  4K9Z A;  4V2N A;  3OR5 A;  1W4V A;  4N11 A;  1S3D A;  3GTU A;  1ABA A;  2O89 A;  3LQ7 A;  3DEX A;  2GS3 A;  4ML6 A;  6GSW A;  1GTB A;  3D22 A;  2Z9S A;  3QCP A;  1USB A;  2LEG A;  5COH A;  1ERW A;  1RQM A;  1ACV A;  2MMA A;  4K5R A;  5D9V A;  1BED A;  4V2L A;  3A2V A;  3GNJ A;  5ECP B;  2ON5 A;  4GSN A;  5IMD A;  4ECC A;  1Z5Y E;  1OE7 A;  2MBT A;  3CTG A;  1G6W A;  1QUW A;  1SKW B;  2GST A;  2LS5 A;  1Q98 A;  3GKX A;  1K3Y A;  5CRW A;  2ZNM A;  4GSS A;  2VLT A;  3ZRD A;  2HLS A;  4PNG A;  5G1L A;  2FLS A;  1BAY A;  3EUR A;  5D9X A;  2VLV A;  4HSC X;  3MAK A;  2R2J A;  2CQ9 A;  1ERT A;  22GS A;  3SWL A;  3UVT A;  3RAZ A;  1FB6 A;  3FZ5 A;  4L5O A;  3WT2 A;  11GS A;  5E59 A;  2YN1 A;  1XPV A;  3IR4 A;  4PQI A;  4ZB6 A;  1S3R A;  3EC3 A;  4I8B A;  4YAP A;  4O92 A;  4DEJ A;  4NXI A;  2R37 A;  16GS A;  3QPM A;  4RQR A;  5ENU A;  4K8M A;  1WOU A;  2CA8 A;  3M3M A;  2OE0 A;  2B7J A;  3GRX A;  2WDU A;  1Z7R A;  2HRA A;  4ECB A;  1TI3 A;  1V40 A;  4BVY A;  2KLX A;  3DD3 A;  3FZA A;  3J7Y k;  1PL1 A;  3FR9 A;  2H8L A;  2JU5 A;  1DE1 A;  1PKW A;  2H1D A;  4HQS A;  4ID0 A;  2CX4 A;  1T8E B;  2VUP A;  2PVQ A;  4O5U A;  1NSW A;  3M9J A;  3ERW A;  3QR6 A;  3GFK A;  2VD0 A;  4ISD A;  2HFD A;  4RQX A;  2DC5 A;  3CSI A;  3I6A A;  3LWA A;  2AB6 A;  4XS1 A;  5ECH B;  4ULX A;  1UA5 A;  2R0P A;  5IO2 A;  2H66 A;  2LRT A;  3ZFB A;  2F3M A;  4F0B A;  3Q6O A;  4HU7 A;  4MAB A;  1FOH A;  1EOH A;  1YEP A;  5IM9 A;  4K2D A;  3UBK A;  3LSZ A;  2GQM A;  4L0U A;  3F3Q A;  3FZ9 A;  4GTU A;  4HZ4 A;  2HZE B;  2C0G A;  1FVK A;  1S3C A;  3KJY A;  3KGK A;  4ZIL A;  2B7K A;  4MZC A;  1URM A;  4XRA A;  2OAD A;  2GZZ A;  4Q5F A;  4TOP A;  1TKD B;  3HJP A;  1K0A A;  4HU9 A;  1SKR B;  4IKH A;  5GZZ B;  3JCM L;  4EF0 A;  1SJZ A;  5BMU A;  1SJ6 A;  3ZMK A;  3TGZ A;  2DJJ A;  2YPM A;  1AIU A;  1OE8 A;  2H71 A;  4KCA A;  3TKS C;  4IHU A;  3VFI A;  1WPI A;  1K3O A;  4WXT A;  3UAR A;  2CAQ A;  12GS A;  4HQZ A;  4JR4 A;  2WRT A;  5ELG A;  1TXX A;  3EWL A;  4TRX A;  4GRF A;  2EIR A;  4V1A g;  2OAC A;  2K9F A;  3TOU A;  3FEU A;  1TOF A;  2MYG A;  3EIN A;  4Z7X A;  1B4Q A;  3HVN A;  3D5J A;  4TR1 B;  4ZBD A;  1QXH A;  1ERU A;  2ZCT A;  2A2S A;  2VCQ A;  2GDR A;  1GTU A;  1NW2 A;  2H75 A;  2YZU A;  4TR4 A;  3LXT A;  1V9W A;  3E0U A;  1FG4 A;  1XWG A;  1GTI A;  3GN3 A;  4J2F A;  1YJ6 A;  2GSS A;  1T1V A;  2R4V A;  3RBT A;  3Q19 A;  1GSS A;  4NAX A;  1B9X C;  3UL3 A;  2EC4 A;  2X8H A;  4WEY A;  1YKA A;  1Y6E A;  2IMK A;  4WBR D;  2IJY A;  3BCK A;  3QOU A;  3TRX A;  2K6V A;  1ZGN A;  5IO0 A;  3D4T A;  2J9H A;  1K0C A;  1AQX A;  4PUA A;  4POK A;  2QA1 A;  3TDG A;  3ZVJ D;  1TK0 B;  3FZ4 A;  3HD5 A;  4YAV A;  4G9H A;  4OFN A;  1LJR A;  1FB0 A;  2RM5 A;  1PX7 A;  2R6K A;  2OE3 A;  4Q5Q A;  1I9D A;  3VK9 A;  3KXO A;  1TRV A;  4DSQ A;  4KW6 A;  2R3X A;  1V57 A;  2C8U A;  2DIY A;  3ZML A;  3RPN A;  1G7O A;  2FD3 A;  2HSH A;  4YKF A;  3MNG A;  3UEM A;  5DQY A;  3TJJ A;  3VPQ A;  3EYT A;  4LMW A;  2BMX A;  2VO4 A;  1GLQ A;  2X8C A;  1LU4 A;  3KIJ A;  3HJM A;  5J9C A;  4EC0 A;  4JU5 A;  4KX4 A;  2YOI A;  5A4W A;  3UVH A;  4PX1 A;  4MA9 A;  1GSQ A;  2FWF A;  1GUH A;  2AYT A;  3GH6 A;  4E8H A;  2TRC P;  2CZ2 A;  3IHQ A;  3TKP A;  3WD6 A;  4PUF C;  3EMX A;  2GSQ A;  2C3N A;  2O87 A;  4BVX B;  1ZCP A;  3MWH A;  3ZLP A;  3BD2 A;  4HS1 A;  5G31 A;  3PPU A;  3KMN A;  4LMV A;  3APQ A;  4ZBA A;  4CHS A;  4BWS A;  2YJ7 A;  1B48 A;  1QMV A;  3EE2 A;  1PSQ A;  1FOV A;  4I2T A;  4ZL8 A;  2G2Q A;  1BYE A;  4MNN A;  4IBP A;  3G7I A;  1TU7 A;  3KMO A;  4IQ1 A;  4D73 B;  5J5N A;  4MF6 A;  3HVV A;  2LRC A;  3DWV A;  2VM2 A;  5H5Q A;  1A23 A;  4TW5 A;  5JCG A;  2X49 A;  3FKF A;  5F0G A;  2CT6 A;  5HFI A;  3RHC A;  2C0F A;  5CAX A;  2L6C A;  3QDN A;  4A5P A;  1XOB A;  2RLI A;  4PXO A;  1I5G A;  1YF0 A;  2C80 A;  5DAL B;  1H75 A;  5IMV A;  1WP0 A;  3UIW A;  1QK8 A;  1DE2 A;  1SK0 A;  4G19 A;  4MH3 A;  4NV5 A;  5H5S A;  3GKN A;  5JWR B;  1DBY A;  1T4Z A;  3ZTL A;  5DQS A;  4ZBB A;  5ECR B;  1TRW A;  2HI7 A;  1JZR A;  1GSD A;  3WGX A;  3A3T A;  4OO5 A;  1GLP A;  1EOG A;  5C00 A;  4F2I A;  1ZZY A;  2GZP A;  1GP1 A;  2CAI A;  1R4W A;  4PUR A;  2YZH A;  1GWC A;  1J0F A;  3QFB C;  3IPZ A;  1T7P B;  4OFM A;  4N0V A;  3M0F A;  4NHZ A;  3VUR A;  2N5B A;  3HY2 A;  3E9J B;  3IK9 A;  5IPG A;  4TR1 A;  2DIZ A;  5HFG A;  2RM6 A;  1KEB A;  3L9S A;  4XS6 A;  1OC3 A;  3UOM A;  4XS4 B;  2F51 A;  2GT5 A;  2YJH A;  2HRK A;  2XPD A;  1SL0 B;  4AJ8 A;  1K0O A;  5DJM A;  3H4K A;  3HA9 A;  1MEK A;  3TB2 A;  4K0G A;  3M8N A;  3TKS E;  5D73 A;  4KAE A;  1TW9 A;  4KGI A;  1FAA A;  4N0Z A;  1WWJ A;  3QAG A;  3PIN A;  2H70 A;  2I4A A;  2HRN A;  4K5S A;  4GCI A;  5IIZ A;  2FA8 A;  2OBI A;  1EGO A;  1Z7P A;  1X9S B;  4QL9 A;  1U88 A;  4KE3 A;  2VAF A;  3FR3 A;  2B5X A;  3ISO A;  3DRN A;  4MF7 A;  3UMA A;  4ML1 A;  2F8A A;  2DJ1 A;  5JWO B;  2HXK A;  3CXG A;  4QQ7 A;  5LCZ A;  1A24 A;  3FRC A;  1UN2 A;  4HZ2 A;  3VPT A;  1NM3 A;  2L4Q A;  1KBN A;  1M3J A;  1M9B A;  4MPG A;  1F2E A;  5D9W A;  5CRE A;  3F8U A;  4HOJ A;  5CRH A;  1B8X A;  1SD8 A;  1AXD A;  10GS A;  1MD3 A;  4EO3 A;  2YV7 A;  1O7U A;  3BCI A;  3EVI A;  1HNB A;  3GUR A;  2FNO A;  4YH2 A;  1XW5 A;  3RPP A;  5A4U A;  3ZFL A;  4MJE A;  2E2G A;  3MSZ A;  4RI7 A;  1KNG A;  3DIE A;  4X4J A;  5ID2 B;  2YWO A;  2HSM A;  4KH7 A;  1PQN A;  3WGE A;  1Q4J A;  5G5F A;  4CY6 A;  2PBJ A;  3L9V A;  5KN2 A;  1QFN A;  1ILO A;  2QC7 A;  3R2Q A;  1VF2 A;  1SEN A;  1SYR A;  4EL1 A;  2YWI A;  3R3E A;  2GQL A;  1M2A A;  2A2P A;  1TI1 A;  1VF1 A;  1GUK A;  4POB A;  2D2Z A;  4H86 A;  2BTO T;  4BVX A;  2QKE A;  4NV2 A;  1EV4 A;  3LGC A;  5GSS A;  2LKU A;  4GF0 A;  1AQW A;  1ML6 A;  2VCX A;  3MIX A;  1AC1 A;  1F6M C;  3KH9 A;  4OWY A;  3F4S A;  1PA3 A;  2QSI A;  2L5O A;  2LJR A;  2DJ2 A;  2K8V A;  3O76 A;  4CDO A;  1ON4 A;  3CTF A;  4ZXG A;  2H0I A;  3VLN A;  4ZB8 A;  2GLR A;  2VL3 A;  4NPB A;  4RI6 A;  5CNW A;  1WJK A;  2GTU A;  4D73 A;  1HYU A;  2LV3 A;  2AV4 A;  3I9V 2;  2B5E A;  1YKC A;  1Z3E A;  2YWN A;  1UC7 A;  2GSR A;  4L0W A;  1M2B A;  2H72 A;  3HJO A;  1XW9 A;  4EVM A;  3APO A;  1OC8 A;  1EP7 A;  2HZF A;  2H6Y A;  4K0N A;  4G10 A;  5DAL A;  4IS0 A;  2YV9 A;  2G0F A;  4WKW A;  4BPY A;  5GAP D;  2IIY A;  1R7H A;  1TTZ A;  2M72 A;  2FWE A;  4NMU A;  1K0B A;  1FHE A;  4BL7 B;  5KN0 A;  2V1M A;  1XCC A;  3CMI A;  4KDX A;  3TUE A;  2L57 A;  3H1N A;  3VWX A;  5G1K A;  3C71 A;  4WET A;  4ACS A;  4LLR A;  2VM1 A;  1F37 A;  1PMT A;  1KTE A;  1XWC A;  5IOW A;  5AIV A;  1PX6 A;  3TJK A;  1B4P A;  1JLV A;  4WF4 A;  2HNL A;  1V58 A;  1YQ1 A;  4MJB A;  2B3S A;  2AUV A;  3HZ8 A;  4OCE A;  1GSU A;  3FK8 A;  4POM A;  5G30 A;  4XS4 A;  5G5E A;  5C04 A;  2KUC A;  6GST A;  4EDZ A;  1RW1 A;  2YAN A;  2ES7 A;  4KND A;  2AAW A;  2H0H A;  2JZT A;  5E4W A;  3ME8 A;  1MDI A;  2H0G A;  2IN3 A;  5D8I A;  2KP2 A;  3QAV A;  3G7Y A;  2VCT A;  3IC4 A;  3HCZ A;  5B6M A;  2PUK C;  3EPT A;  4L5L A;  2N5A A;  4IP1 A;  3NZN A;  6GSY A;  2MZC A;  5HR0 A;  4Z2U A;  3F6D A;  2OKA A;  4F0C A;  1T00 A;  1IYI A;  1FVJ A;  3C8E A;  4MK3 A;  2EIQ A;  3ZVJ A;  1C72 A;  4MP4 A;  3LXZ A;  4TR0 A;  1AW9 A;  2ZUP A;  3FMW A;  3GKK A;  4K6X A;  5J4U A;  4MF5 A;  3D6I A;  2X64 A;  1O8W A;  5CO3 A;  3U6V A;  1TDI A;  5H5R A;  3IDV A;  4EXJ A;  1XIY A;  2XHF A;  1GUL A;  2XBI A;  3IOS A;  4KB3 A;  1A2J A;  4XCS A;  1X5E A;  5ECK B;  2MMN A;  3ZL5 A;  5HR3 A;  2LNT A;  4IVF A;  1OC9 B;  7GSS A;  2V2G A;  5ID2 A;  3L78 A;  1GL8 A;  4K7O A;  2PU9 C;  2M46 A;  3LW9 A;  3APS A;  1Z6M A;  5CP1 A;  5DDL A;  4N30 A;  4PQ1 A;  4X43 A;  2O7K A;  4NHW A;  1GSE A;  1VGL A;  4IN0 A;  1F3A A;  3H93 A;  3IRA A;  1HNC A;  1PN9 A;  1OVN A;  3IV4 A;  3A2X A;  4IP6 A;  5ECM B;  2H73 A;  5EPF A;  5LNK e;  2AJQ B;  2LTK A;  3VWU A;  3RHB A;  1U87 A;  1DSB A;  1VF4 A;  2LJA A;  2ALB A;  2F8F A;  3F4T A;  3P2A A;  2J23 A;  1LBK A;  2XPE A;  8GSS A;  1B9Y C;  3IK7 A;  2YCD A;  3HZ4 A;  4EIP A;  5HQP A;  1EWX A;  1T3B A;  1UVZ A;  1ZYP A;  2VCW A;  5FT3 A;  4K2X A;  1BQ7 A;  4OMV A;  1MDK A;  1TRU A;  5JCW A;  2P5Q A;  2AHE A;  5KOX A;  3P8W A;  4DSS B;  3A5I A;  4K7N A;  3MDK A;  3TRQ A;  3HKR A;  3QFA C;  1TJD A;  3F4R A;  4KDU A;  3TKR A;  1MD4 A;  5CRG A;  1CQG A;  3EU3 A;  4ZL9 A;  2C3Q A;  4GLT A;  1X0R A;  3GL5 A;  3TKS A;  1G6Y A;  1XWK A;  3TCO A;  4EKZ A;  1PKZ A;  2DSA A;  4IEL A;  1GRX A;  1A8Y A;  4BL7 A;  2H1G A;  2RUF A;  4KSM A;  1F3B A;  4FO5 A;  4JE1 A;  2C4J A;  4MCU A;  4MJC A;  3Q74 A;  1SJI A;  5AIS A;  2HZE A;  2LRN A;  2C3T A;  2P31 A;  1A0F A;  1T4Y A;  4OO4 A;  4CY8 A;  1XZO A;  2CZ3 A;  1ZYE A;  4MLY A;  4EE0 A;  4X1U A;  2OA7 A;  1FO5 A;  4AGS A;  2VL2 A;  3QAW A;  2V6O A;  4G0I A;  5ABR A;  2NPB A;  4PNF A;  3DYR A;  2IMI A;  2B5Y A;  3FY7 A;  2P0G A;  3IA1 A;  5BRT A;  4N10 A;  2DJ0 A;  2WZ9 A;  3VWW A;  3W6G A;  4JRR A;  4FYC A;  3DML A;  3IXR A;  1M2D A;  4FH8 A;  4JBB A;  2CVK A;  1HNA A;  2WCI A;  3HDC A;  2WFC A;  2R0G A;  2FA4 A;  3WGD A;  2C1Y A;  2FGX A;  2WJU A;  5KOW A;  2IL3 A;  2DKI A;  2RUE A;  5INY A;  1PN0 A;  2K18 A;  3G9B A;  3A5W A;  4I97 A;  4XTS A;  3VWV A;  3IAM 2;  3FW2 A;  4BA7 A;  2L5L A;  1SD9 A;  4HJ2 A;  1R5A A;  4V2M A;  3GKM A;  4KSO A;  3CBU A;  5HFK A;  3KP9 A;  3UAP A;  3UBL A;  2L6D A;  1OKD A;  3ERG A;  1K0N A;  4WF5 A;  5J9B A;  3LYP A;  3GSS A;  2QA2 A;  3IHG A;  2FHE A;  4ZB9 A;  14GS A;  2NDO A;  3PH9 A;  2UZ8 A;  3HXS A;  4FIW A;  5D93 A;  1R5P A;  4IGJ A;  3FHK A;  4WR4 A;  3TKQ A;  1GUM A;  5B7C A;  4PGT A;  2JSZ A;  1YEX A;  5GST A;  20GS A;  2FWG A;  4XHM A;  1BG5 A;  2IWT A;  4XRD A;  4IQA A;  5KEJ A;  3EMP A;  4YQM A;  1OC9 A;  2FUG 2;  4CW9 A;  2GT6 A;  2O85 A;  1A2L A;  2BJX A;  4IJ3 A;  3C1S A;  3PGT A;  5EY6 A;  3DGQ A;  4K7I A;  1EV9 A;  5B6N A;  3GA4 A;  5FHI A;  2E0Q A;  4ICY A;  4NWY A;  3CQF A;  4MPF A;  4USS A;  4K1F A;  5F05 A;  1N2A A;  1PRX A;  1EGR A;  3DVW A;  4V1A p;  5IMZ A;  1NHO A;  2H30 A;  1G7E A;  3VI5 A;  4TKY A;  3D21 A;  4O7H A;  2MMZ A;  4DSR A;  2GZY A;  2JSY A;  2REM A;  4MH2 A;  2IPA A;  3CRT A;  4JED A;  5AIX A;  1SYX A;  4TVE A;  3AY8 A;  3GMF A;  1THX A;  4ZL7 A;  1CQH A;  4Z2R A;  1GNW A;  3GHA A;  1A2M A;  3S9F A;  2JZS A;  4O32 A;  1ZYQ B;  2PN8 A;  4DSS A;  1JFU A;  3O3T A;  1WE0 A;  2X99 A;  1SU9 A;  2CX3 A;  2IFQ B;  4WR5 A;  5IMC A;  4J57 E;  3EU4 A;  1S3A A;  3WYW A;  2KHP A;  1F9M A;  1EP8 A;  4F82 A;  5KN3 A;  4J56 E;  5CYY A;  2JAC A;  2QGV A;  1SL2 B;  2I1U A;  1GTA A;  1VF3 A;  4LA1 A;  4GXZ A;  4TN8 A;  1XW6 A;  4GWR A;  1ERV A;  2YNX A;  3KD0 A;  5J41 A;  4AF2 A;  3C73 A;  3J7Y b;  4PQH A;  3IBH A;  2LJK A;  2HSY A;  4Q5R A;  5A4V A;  3BOA A;  5GAN D;  5AN1 A;  1XG8 A;  1EZK A;  2CV4 A;  3LOR A;  1XVQ A;  5CRD A;  2FY6 A;  2HT9 A;  3LYK A;  3P90 A;  4KDY A;  2GQK A;  3GYK A;  3VI7 A;  5KN1 A;  4IJI A;  1RK4 A;  1X9M B;  3HVX A;  3WT1 A;  2VCV A;  5F8B A;  2CVB A;  4AJ6 A;  3GST A;  2MMO A;  1IYH A;  3GX0 A;  3LJR A;  3DKS A;  4I6X A;  3W8S A;  2VIM A;  6GSU A;  2VLU A;  3L9U A;  1JLW A;  3DXB A;  1X9W B;  1W89 A;  5B8A A;  3IC8 A;  19GS A;  2FWH A;  2X4A A;  4G0K A;  4GST A;  1PD2 1;  4O5Q A;  1YDK A;  1K0D A;  13GS A;  5D9T A;  1QGV A;  1R26 A;  2H1B A;  1ZOF A;  1A8L A;  1O8X A;  2ON7 A;  1AAZ A;  4ECJ A;  3U5R E;  1BJX A;  2C0E A;  3HYP A;  5ECN B;  2H01 A;  4TXV A;  1TP9 A;  3F9U A;  2PMT A;  4F03 A;  2DJ3 A;  4RUV A;  1E2Y A;  5DCH A;  3DVX A;  2GGT A;  2RII A;  3KP8 A;  1EEJ A;  4O5R A;  2YP6 A;  3US3 A;  3A2W A;  1M3I A;  1M99 A;  2C0D A;  1TRS A;  2DMM A;  4PTS A;  1GNE A;  2B1K A;  1ZYN A;  4YQV A;  1HQO A;  3TOT A;  1HD2 A;  3CSJ A;  3BJ5 A;  3N9J A;  4Z2T A;  1TU8 A;  3LEF A;  2OE1 A;  2JL4 A;  1M0U A;  4MJA A;  5G2Z A;  3RDW A;  4TR3 A;  3QMX A;  1SK2 A;  2O8V B;  2WB9 A;  4I2U A;  5ECL B;  2VOC A;  2DML A;  3Q18 A;  5DAK B;  3O6T A;  4LL1 B;  5ECO B;  3TJB A;  1O6J A;  3GIX A;  1WRY A;  3C1R A;  3KZQ A;  2L4C A;  1PL2 A;  9GSS A;  2XC2 A;  2VL2 C;  4HI7 A;  4ILF A;  4GQC A;  2E7P A;  1U3I A;  4TXO B;  4EDY A;  5IPH A;  3D0Z A;  1V2A A;  5HR2 A;  4P3Y B;  4MZB A;  4G2E A;  3M1G A;  3GV1 A;  2N5F A;  3KTB A;  5IOX A;  2GVP A;  1NHY A;  2DJK A;  2XBQ A;  5IMA A;  1ST9 A;  1K3L A;  4KCE A;  2R0C A;  3IAS 2;  1PFO A;  3GL3 A;  2FCH A;  3FR6 A;  4E8E A;  2LST A;  1M9A A;  4POL A;  2H1A A;  5ELA A;  2IFQ A;  1YF1 A;  4FQU A;  1H4O A;  5D96 A;  4KF9 A;  5AGY A;  4OCF A;  4I5Q A;  1OYJ A;  2LNS A;  2PWJ A;  18GS A;  2YWM A;  5F06 A;  3KTL A;  3UJ1 A;  4HUA A;  2JZR A;  3GTU B;  2I9H A;  4FYB A;  4MMM A;  1Z6N A;  4HJM A;  1M7T A;  2P5R A;  1GH2 A;  1XBS A;  1G0T A;  1BX9 A;  4WBJ A;  3N5O A;  3F63 A;  3W8J A;  3P7X A;  5IQY A;  1N8J A;  3HHV A;  5DVB A;  4BIK A;  2VD1 A;  4AJ7 A;  2PVO C;  5EL8 A;  5JWQ B;  1Z9H A;  1O81 A;  2HE3 A;  2NTO A;  3TJF A;  2A4H A;  2B1L A;  3G7J A;  1MTC A;  5ECQ B;  2PER A;  1XWA A;  1XXU A;  2K8S A;  1JZW A;  5DBQ A;  4MDC A;  2E2M A;  2F9S A;  1K0M A;  5ECS A;  1U3A A;  4OD7 A;  3E3E A;  3KEB A;  5J3R A;  2WS2 A;  1X5D A;  2M80 A;  4L8E A;  3BBY A;  4G0L A;  2I81 A;  3PR8 A;  3KCM A;  2LQQ A;  1JHB A;  2NVL A;  1V98 A;  4JZQ A;  2L59 A;  3L4N A;  3C7M A;  1AUC A;  2OBK A;  1TK5 B;  1QQ2 A;  2R5G A;  1GSF A;  3ZIJ A;  1XFL A;  5F07 A;  6GSV A;  2A4V A;  3GX8 A;  1MDJ A;  2KOK A;  1OAZ A;  2H76 A;  3L0H A;  4DVC A;  3CRU A;  2NBS A;  3ED3 A;  2TIR A;  1JZD A;  1O73 A;  2H6X A;  2V6K A;  1FW1 A;  2DKH A;  3M9K A;  1YY7 A;  3H79 A;  2IMF A;  4JR6 A;  4BVY B;  4HDE A;  1XVW A;  2H6Z A;  2VL9 A;  3ZZX A;  3ME7 A;  4OFT A;  1SKS B;  1SK1 A;  5JCU A;  3QD9 A;  2KP1 A;  1J08 A;  2IME A;  5A5K A;  2MBS A;  1ZL9 A;  3ZIT A;  1THO A;  3NIV A; 
#chains in the Genus database with same CATH homology
 3F3R A;  2HYX A;  3NOF A;  1PGT A;  4ZIJ A;  1SL1 B;  2JAD A;  4EIQ A;  5LD0 A;  1EEM A;  1A0R P;  1ZMA A;  2OJL A;  2DLX A;  2LQO A;  3CSH A;  4GQF A;  5FWG A;  2VCZ A;  2H19 A;  3CYN A;  3ERF A;  2B6M A;  17GS A;  3GUS A;  5IMF A;  4BWQ A;  4X0X A;  3KH7 A;  1X5C A;  1XOA A;  3TRP A;  2EIO A;  2DBC A;  6GSS A;  4IW9 A;  5DAK A;  1Y25 A;  2PGT A;  3MYD A;  3ZRE A;  4EUY A;  1AQV A;  4KA0 A;  3LFL A;  3ZYW A;  5L71 A;  3TJG A;  2WUL A;  3GH9 A;  4HEA 2;  3F0I A;  1JZO A;  2V41 A;  2PPT A;  4TXO A;  3I69 A;  2LUS A;  2CVD A;  2I3Y A;  4MZW A;  5B8B A;  4KUN A;  4ECI A;  1OKT A;  5HR1 A;  6GSX A;  1WIK A;  2IMD A;  4XIH A;  1VRS D;  3K8N A;  3LG6 A;  3SBC A;  2X8G A;  4QL7 A;  1GSY A;  4YQU A;  4LL4 B;  3V1W A;  2HRF A;  2TRX A;  1WMJ A;  3I43 A;  2WGR A;  1O85 A;  5DJL A;  5EVO A;  3H8Q A;  3IE3 A;  1XWB A;  1E6B A;  3ZIV A;  1DUG A;  4FYU A;  1U6T A;  4F9Z A;  5DCG A;  3HVS A;  2A2R A;  3KM6 A;  3D4M A;  4YKG A;  2V32 A;  1YZX A;  1J9B A;  4Q5N A;  1TK8 B;  5ECI B;  3F6F A;  2H74 A;  3FYG A;  4K9Z A;  4V2N A;  3OR5 A;  1W4V A;  4N11 A;  1S3D A;  3GTU A;  1ABA A;  2O89 A;  3LQ7 A;  3DEX A;  2GS3 A;  4ML6 A;  6GSW A;  1GTB A;  3D22 A;  2Z9S A;  3QCP A;  1USB A;  2LEG A;  5COH A;  1ERW A;  1RQM A;  1ACV A;  2MMA A;  4K5R A;  5D9V A;  1BED A;  4V2L A;  3A2V A;  3GNJ A;  5ECP B;  2ON5 A;  4GSN A;  5IMD A;  4ECC A;  1Z5Y E;  1OE7 A;  2MBT A;  3CTG A;  1G6W A;  1QUW A;  1SKW B;  2GST A;  2LS5 A;  1Q98 A;  3GKX A;  1K3Y A;  5CRW A;  2ZNM A;  4GSS A;  2VLT A;  3ZRD A;  2HLS A;  4PNG A;  5G1L A;  2FLS A;  1BAY A;  3EUR A;  5D9X A;  2VLV A;  3MAK A;  2R2J A;  2CQ9 A;  1ERT A;  22GS A;  3SWL A;  3UVT A;  3RAZ A;  1FB6 A;  3FZ5 A;  4L5O A;  3WT2 A;  11GS A;  5E59 A;  2YN1 A;  1XPV A;  3IR4 A;  4PQI A;  4ZB6 A;  3EC3 A;  4I8B A;  4YAP A;  4O92 A;  4DEJ A;  4NXI A;  2R37 A;  16GS A;  3QPM A;  4RQR A;  5ENU A;  4K8M A;  1WOU A;  2CA8 A;  3M3M A;  2OE0 A;  2B7J A;  3GRX A;  2WDU A;  1Z7R A;  2HRA A;  4ECB A;  1TI3 A;  1V40 A;  4BVY A;  2KLX A;  3DD3 A;  3FZA A;  3J7Y k;  1PL1 A;  3FR9 A;  2H8L A;  2JU5 A;  1DE1 A;  1PKW A;  2H1D A;  4HQS A;  4ID0 A;  2CX4 A;  1T8E B;  2VUP A;  2PVQ A;  4O5U A;  1NSW A;  3M9J A;  3ERW A;  3QR6 A;  3GFK A;  2VD0 A;  4ISD A;  2HFD A;  4RQX A;  2DC5 A;  3CSI A;  3I6A A;  3LWA A;  2AB6 A;  4XS1 A;  5ECH B;  4ULX A;  1UA5 A;  2R0P A;  5IO2 A;  2H66 A;  2LRT A;  3ZFB A;  2F3M A;  4F0B A;  3Q6O A;  4HU7 A;  4MAB A;  1FOH A;  1EOH A;  1YEP A;  5IM9 A;  4K2D A;  3UBK A;  3LSZ A;  2GQM A;  4L0U A;  3F3Q A;  3FZ9 A;  4GTU A;  4HZ4 A;  2HZE B;  2C0G A;  1FVK A;  1S3C A;  3KJY A;  3KGK A;  4ZIL A;  2B7K A;  4MZC A;  1URM A;  4XRA A;  2OAD A;  2GZZ A;  4Q5F A;  4TOP A;  1TKD B;  3HJP A;  1K0A A;  4HU9 A;  1SKR B;  4IKH A;  5GZZ B;  3JCM L;  4EF0 A;  1SJZ A;  5BMU A;  1SJ6 A;  3ZMK A;  3TGZ A;  2DJJ A;  2YPM A;  1AIU A;  1OE8 A;  2H71 A;  4KCA A;  3TKS C;  4IHU A;  3VFI A;  1WPI A;  1K3O A;  4WXT A;  3UAR A;  2CAQ A;  12GS A;  4HQZ A;  4JR4 A;  2WRT A;  5ELG A;  1TXX A;  3EWL A;  4TRX A;  4GRF A;  2EIR A;  4V1A g;  2OAC A;  2K9F A;  3TOU A;  3FEU A;  1TOF A;  2MYG A;  3EIN A;  4Z7X A;  1B4Q A;  3D5J A;  4TR1 B;  4ZBD A;  1QXH A;  1ERU A;  2ZCT A;  2A2S A;  2VCQ A;  2GDR A;  1GTU A;  1NW2 A;  2H75 A;  2YZU A;  4TR4 A;  3LXT A;  1V9W A;  3E0U A;  1FG4 A;  1XWG A;  1GTI A;  3GN3 A;  4J2F A;  1YJ6 A;  2GSS A;  1T1V A;  2R4V A;  3RBT A;  3Q19 A;  1GSS A;  4NAX A;  1B9X C;  3UL3 A;  2EC4 A;  2X8H A;  4WEY A;  1YKA A;  1Y6E A;  2IMK A;  4WBR D;  2IJY A;  3BCK A;  3QOU A;  3TRX A;  2K6V A;  1ZGN A;  5IO0 A;  3D4T A;  2J9H A;  1K0C A;  1AQX A;  4PUA A;  4POK A;  2QA1 A;  3TDG A;  3ZVJ D;  1TK0 B;  3FZ4 A;  3HD5 A;  4YAV A;  4G9H A;  4OFN A;  1LJR A;  1FB0 A;  2RM5 A;  1PX7 A;  2R6K A;  2OE3 A;  4Q5Q A;  1I9D A;  3VK9 A;  3KXO A;  1TRV A;  4DSQ A;  4KW6 A;  2R3X A;  1V57 A;  2C8U A;  2DIY A;  3ZML A;  3RPN A;  1G7O A;  2FD3 A;  2HSH A;  4YKF A;  3MNG A;  3UEM A;  5DQY A;  3TJJ A;  3VPQ A;  3EYT A;  4LMW A;  2BMX A;  2VO4 A;  1GLQ A;  2X8C A;  1LU4 A;  3KIJ A;  3HJM A;  5J9C A;  4EC0 A;  4JU5 A;  4KX4 A;  2YOI A;  5A4W A;  3UVH A;  4PX1 A;  4MA9 A;  1GSQ A;  2FWF A;  1GUH A;  2AYT A;  3GH6 A;  4E8H A;  2TRC P;  2CZ2 A;  3IHQ A;  3TKP A;  3WD6 A;  4PUF C;  3EMX A;  2GSQ A;  2C3N A;  2O87 A;  4BVX B;  1ZCP A;  3MWH A;  3ZLP A;  3BD2 A;  4HS1 A;  5G31 A;  3PPU A;  3KMN A;  4LMV A;  3APQ A;  4ZBA A;  4CHS A;  4BWS A;  2YJ7 A;  1B48 A;  1QMV A;  3EE2 A;  1PSQ A;  1FOV A;  4I2T A;  4ZL8 A;  2G2Q A;  1BYE A;  4MNN A;  4IBP A;  3G7I A;  1TU7 A;  3KMO A;  4IQ1 A;  4D73 B;  5J5N A;  4MF6 A;  3HVV A;  2LRC A;  3DWV A;  2VM2 A;  5H5Q A;  1A23 A;  4TW5 A;  5JCG A;  2X49 A;  3FKF A;  5F0G A;  2CT6 A;  5HFI A;  3RHC A;  2C0F A;  5CAX A;  2L6C A;  3QDN A;  4A5P A;  1XOB A;  2RLI A;  4PXO A;  1I5G A;  1YF0 A;  2C80 A;  5DAL B;  1H75 A;  5IMV A;  1WP0 A;  3UIW A;  1QK8 A;  1DE2 A;  1SK0 A;  4G19 A;  4MH3 A;  4NV5 A;  5H5S A;  3GKN A;  5JWR B;  1DBY A;  1T4Z A;  3ZTL A;  5DQS A;  4ZBB A;  5ECR B;  1TRW A;  2HI7 A;  1JZR A;  1GSD A;  3WGX A;  3A3T A;  4OO5 A;  1GLP A;  1EOG A;  5C00 A;  4F2I A;  1ZZY A;  2GZP A;  1GP1 A;  2CAI A;  1R4W A;  4PUR A;  2YZH A;  1GWC A;  1J0F A;  3QFB C;  3IPZ A;  1T7P B;  4OFM A;  4N0V A;  3M0F A;  4NHZ A;  3VUR A;  2N5B A;  3HY2 A;  3E9J B;  3IK9 A;  5IPG A;  4TR1 A;  2DIZ A;  5HFG A;  2RM6 A;  1KEB A;  3L9S A;  4XS6 A;  1OC3 A;  3UOM A;  4XS4 B;  2F51 A;  2GT5 A;  2YJH A;  2HRK A;  2XPD A;  1SL0 B;  4AJ8 A;  1K0O A;  5DJM A;  3H4K A;  3HA9 A;  1MEK A;  3TB2 A;  4K0G A;  3M8N A;  3TKS E;  5D73 A;  4KAE A;  1TW9 A;  4KGI A;  1FAA A;  4N0Z A;  1WWJ A;  3QAG A;  3PIN A;  2H70 A;  2I4A A;  2HRN A;  4K5S A;  4GCI A;  5IIZ A;  2FA8 A;  2OBI A;  1EGO A;  1Z7P A;  1X9S B;  4QL9 A;  1U88 A;  4KE3 A;  2VAF A;  3FR3 A;  2B5X A;  3ISO A;  3DRN A;  4MF7 A;  3UMA A;  4ML1 A;  2F8A A;  2DJ1 A;  5JWO B;  2HXK A;  3CXG A;  4QQ7 A;  5LCZ A;  1A24 A;  3FRC A;  1UN2 A;  4HZ2 A;  3VPT A;  1NM3 A;  2L4Q A;  1KBN A;  1M9B A;  4MPG A;  1F2E A;  5D9W A;  5CRE A;  3F8U A;  4HOJ A;  5CRH A;  1B8X A;  1SD8 A;  1AXD A;  10GS A;  1MD3 A;  4EO3 A;  2YV7 A;  1O7U A;  3BCI A;  3EVI A;  1HNB A;  3GUR A;  2FNO A;  4YH2 A;  1XW5 A;  3RPP A;  5A4U A;  3ZFL A;  4MJE A;  2E2G A;  3MSZ A;  4RI7 A;  1KNG A;  3DIE A;  4X4J A;  5ID2 B;  2YWO A;  2HSM A;  4KH7 A;  1PQN A;  3WGE A;  1Q4J A;  5G5F A;  4CY6 A;  2PBJ A;  3L9V A;  5KN2 A;  1QFN A;  1ILO A;  2QC7 A;  3R2Q A;  1VF2 A;  1SEN A;  1SYR A;  4EL1 A;  2YWI A;  3R3E A;  2GQL A;  1M2A A;  2A2P A;  1TI1 A;  1VF1 A;  1GUK A;  4POB A;  2D2Z A;  4H86 A;  2BTO T;  4BVX A;  2QKE A;  4NV2 A;  1EV4 A;  3LGC A;  5GSS A;  2LKU A;  4GF0 A;  1AQW A;  1ML6 A;  2VCX A;  3MIX A;  1AC1 A;  1F6M C;  3KH9 A;  4OWY A;  3F4S A;  1PA3 A;  2QSI A;  2L5O A;  2LJR A;  2DJ2 A;  2K8V A;  3O76 A;  4CDO A;  1ON4 A;  3CTF A;  4ZXG A;  2H0I A;  3VLN A;  4ZB8 A;  2GLR A;  2VL3 A;  4NPB A;  4RI6 A;  5CNW A;  1WJK A;  2GTU A;  4D73 A;  1HYU A;  2LV3 A;  2AV4 A;  3I9V 2;  2B5E A;  1YKC A;  1Z3E A;  2YWN A;  1UC7 A;  2GSR A;  4L0W A;  1M2B A;  2H72 A;  3HJO A;  1XW9 A;  4EVM A;  3APO A;  1OC8 A;  1EP7 A;  2HZF A;  2H6Y A;  4K0N A;  4G10 A;  5DAL A;  4IS0 A;  2YV9 A;  2G0F A;  4WKW A;  4BPY A;  5GAP D;  2IIY A;  1R7H A;  1TTZ A;  2M72 A;  2FWE A;  4NMU A;  1K0B A;  1FHE A;  4BL7 B;  5KN0 A;  2V1M A;  1XCC A;  3CMI A;  4KDX A;  3TUE A;  2L57 A;  3H1N A;  3VWX A;  5G1K A;  3C71 A;  4WET A;  4ACS A;  4LLR A;  2VM1 A;  1F37 A;  1PMT A;  1KTE A;  1XWC A;  5IOW A;  5AIV A;  1PX6 A;  3TJK A;  1B4P A;  1JLV A;  4WF4 A;  2HNL A;  1V58 A;  1YQ1 A;  4MJB A;  2B3S A;  2AUV A;  3HZ8 A;  4OCE A;  1GSU A;  3FK8 A;  4POM A;  5G30 A;  4XS4 A;  5G5E A;  5C04 A;  2KUC A;  6GST A;  4EDZ A;  1RW1 A;  2YAN A;  2ES7 A;  4KND A;  2AAW A;  2H0H A;  2JZT A;  5E4W A;  3ME8 A;  1MDI A;  2H0G A;  2IN3 A;  5D8I A;  2KP2 A;  3QAV A;  3G7Y A;  2VCT A;  3IC4 A;  3HCZ A;  5B6M A;  2PUK C;  3EPT A;  4L5L A;  2N5A A;  4IP1 A;  3NZN A;  6GSY A;  2MZC A;  5HR0 A;  4Z2U A;  3F6D A;  2OKA A;  4F0C A;  1T00 A;  1IYI A;  1FVJ A;  3C8E A;  4MK3 A;  2EIQ A;  3ZVJ A;  1C72 A;  4MP4 A;  3LXZ A;  4TR0 A;  1AW9 A;  2ZUP A;  3FMW A;  3GKK A;  4K6X A;  5J4U A;  4MF5 A;  3D6I A;  2X64 A;  1O8W A;  5CO3 A;  3U6V A;  1TDI A;  5H5R A;  3IDV A;  4EXJ A;  1XIY A;  2XHF A;  1GUL A;  2XBI A;  3IOS A;  4KB3 A;  1A2J A;  4XCS A;  1X5E A;  5ECK B;  2MMN A;  3ZL5 A;  5HR3 A;  2LNT A;  4IVF A;  1OC9 B;  7GSS A;  2V2G A;  5ID2 A;  3L78 A;  1GL8 A;  4K7O A;  2PU9 C;  2M46 A;  3LW9 A;  3APS A;  1Z6M A;  5CP1 A;  5DDL A;  4N30 A;  4PQ1 A;  4X43 A;  2O7K A;  4NHW A;  1GSE A;  1VGL A;  4IN0 A;  1F3A A;  3H93 A;  3IRA A;  1HNC A;  1PN9 A;  1OVN A;  3IV4 A;  3A2X A;  4IP6 A;  5ECM B;  2H73 A;  5EPF A;  5LNK e;  2AJQ B;  2LTK A;  3VWU A;  3RHB A;  1U87 A;  1DSB A;  1VF4 A;  2LJA A;  2ALB A;  2F8F A;  3F4T A;  3P2A A;  2J23 A;  1LBK A;  2XPE A;  8GSS A;  1B9Y C;  3IK7 A;  2YCD A;  3HZ4 A;  4EIP A;  5HQP A;  1EWX A;  1T3B A;  1UVZ A;  1ZYP A;  2VCW A;  5FT3 A;  4K2X A;  1BQ7 A;  4OMV A;  1MDK A;  1TRU A;  5JCW A;  2P5Q A;  2AHE A;  5KOX A;  3P8W A;  4DSS B;  3A5I A;  4K7N A;  3MDK A;  3TRQ A;  3HKR A;  3QFA C;  1TJD A;  3F4R A;  4KDU A;  3TKR A;  1MD4 A;  5CRG A;  1CQG A;  3EU3 A;  4ZL9 A;  2C3Q A;  4GLT A;  1X0R A;  3GL5 A;  3TKS A;  1G6Y A;  1XWK A;  3TCO A;  4EKZ A;  1PKZ A;  2DSA A;  4IEL A;  1GRX A;  1A8Y A;  4BL7 A;  2H1G A;  2RUF A;  4KSM A;  1F3B A;  4FO5 A;  4JE1 A;  2C4J A;  4MCU A;  4MJC A;  3Q74 A;  1SJI A;  5AIS A;  2HZE A;  2LRN A;  2C3T A;  2P31 A;  1A0F A;  1T4Y A;  4OO4 A;  4CY8 A;  1XZO A;  2CZ3 A;  1ZYE A;  4MLY A;  4EE0 A;  4X1U A;  2OA7 A;  1FO5 A;  4AGS A;  2VL2 A;  3QAW A;  2V6O A;  4G0I A;  5ABR A;  2NPB A;  4PNF A;  3DYR A;  2IMI A;  2B5Y A;  3FY7 A;  2P0G A;  3IA1 A;  5BRT A;  4N10 A;  2DJ0 A;  2WZ9 A;  3VWW A;  3W6G A;  4JRR A;  4FYC A;  3DML A;  3IXR A;  1M2D A;  4FH8 A;  4JBB A;  2CVK A;  1HNA A;  2WCI A;  3HDC A;  2WFC A;  2R0G A;  2FA4 A;  3WGD A;  2C1Y A;  2FGX A;  2WJU A;  5KOW A;  2IL3 A;  2DKI A;  2RUE A;  5INY A;  1PN0 A;  2K18 A;  3G9B A;  3A5W A;  4I97 A;  4XTS A;  3VWV A;  3IAM 2;  3FW2 A;  4BA7 A;  2L5L A;  1SD9 A;  4HJ2 A;  1R5A A;  4V2M A;  3GKM A;  4KSO A;  3CBU A;  5HFK A;  3KP9 A;  3UAP A;  3UBL A;  2L6D A;  1OKD A;  3ERG A;  1K0N A;  4WF5 A;  5J9B A;  3LYP A;  3GSS A;  2QA2 A;  3IHG A;  2FHE A;  4ZB9 A;  14GS A;  2NDO A;  3PH9 A;  2UZ8 A;  3HXS A;  4FIW A;  5D93 A;  1R5P A;  4IGJ A;  3FHK A;  4WR4 A;  3TKQ A;  1GUM A;  5B7C A;  4PGT A;  2JSZ A;  1YEX A;  5GST A;  20GS A;  2FWG A;  4XHM A;  1BG5 A;  2IWT A;  4XRD A;  4IQA A;  5KEJ A;  3EMP A;  4YQM A;  1OC9 A;  2FUG 2;  4CW9 A;  2GT6 A;  2O85 A;  1A2L A;  2BJX A;  4IJ3 A;  3C1S A;  3PGT A;  5EY6 A;  3DGQ A;  4K7I A;  1EV9 A;  5B6N A;  3GA4 A;  5FHI A;  2E0Q A;  4ICY A;  4NWY A;  4MPF A;  4USS A;  4K1F A;  5F05 A;  1N2A A;  1PRX A;  1EGR A;  3DVW A;  4V1A p;  5IMZ A;  1NHO A;  2H30 A;  1G7E A;  3VI5 A;  4TKY A;  3D21 A;  4O7H A;  2MMZ A;  4DSR A;  2GZY A;  2JSY A;  2REM A;  4MH2 A;  2IPA A;  3CRT A;  4JED A;  5AIX A;  1SYX A;  4TVE A;  3AY8 A;  3GMF A;  1THX A;  4ZL7 A;  1CQH A;  4Z2R A;  1GNW A;  3GHA A;  1A2M A;  3S9F A;  2JZS A;  4O32 A;  1ZYQ B;  2PN8 A;  4DSS A;  1JFU A;  3O3T A;  1WE0 A;  2X99 A;  1SU9 A;  2CX3 A;  2IFQ B;  4WR5 A;  5IMC A;  4J57 E;  3EU4 A;  1S3A A;  3WYW A;  2KHP A;  1F9M A;  1EP8 A;  4F82 A;  5KN3 A;  4J56 E;  5CYY A;  2JAC A;  2QGV A;  1SL2 B;  2I1U A;  1GTA A;  1VF3 A;  4LA1 A;  4GXZ A;  4TN8 A;  1XW6 A;  4GWR A;  1ERV A;  2YNX A;  3KD0 A;  5J41 A;  4AF2 A;  3C73 A;  3J7Y b;  4PQH A;  3IBH A;  2LJK A;  2HSY A;  4Q5R A;  5A4V A;  3BOA A;  5GAN D;  5AN1 A;  1EZK A;  2CV4 A;  3LOR A;  1XVQ A;  5CRD A;  2FY6 A;  2HT9 A;  3LYK A;  3P90 A;  4KDY A;  2GQK A;  3GYK A;  3VI7 A;  5KN1 A;  4IJI A;  1RK4 A;  1X9M B;  3HVX A;  3WT1 A;  2VCV A;  5F8B A;  2CVB A;  4AJ6 A;  3GST A;  2MMO A;  1IYH A;  3GX0 A;  3LJR A;  3DKS A;  4I6X A;  3W8S A;  2VIM A;  6GSU A;  2VLU A;  3L9U A;  1JLW A;  3DXB A;  1X9W B;  1W89 A;  5B8A A;  3IC8 A;  19GS A;  2FWH A;  2X4A A;  4G0K A;  4GST A;  1PD2 1;  4O5Q A;  1YDK A;  1K0D A;  13GS A;  5D9T A;  1QGV A;  1R26 A;  2H1B A;  1ZOF A;  1A8L A;  1O8X A;  2ON7 A;  1AAZ A;  4ECJ A;  3U5R E;  1BJX A;  2C0E A;  3HYP A;  5ECN B;  2H01 A;  4TXV A;  1TP9 A;  3F9U A;  2PMT A;  4F03 A;  2DJ3 A;  4RUV A;  1E2Y A;  5DCH A;  3DVX A;  2GGT A;  2RII A;  3KP8 A;  1EEJ A;  4O5R A;  2YP6 A;  3US3 A;  3A2W A;  1M99 A;  2C0D A;  1TRS A;  2DMM A;  4PTS A;  1GNE A;  2B1K A;  1ZYN A;  4YQV A;  1HQO A;  3TOT A;  1HD2 A;  3CSJ A;  3BJ5 A;  3N9J A;  4Z2T A;  1TU8 A;  3LEF A;  2OE1 A;  2JL4 A;  1M0U A;  4MJA A;  5G2Z A;  3RDW A;  4TR3 A;  3QMX A;  1SK2 A;  2O8V B;  2WB9 A;  4I2U A;  5ECL B;  2VOC A;  2DML A;  3Q18 A;  5DAK B;  3O6T A;  4LL1 B;  5ECO B;  3TJB A;  1O6J A;  3GIX A;  1WRY A;  3C1R A;  3KZQ A;  2L4C A;  1PL2 A;  9GSS A;  2XC2 A;  2VL2 C;  4HI7 A;  4ILF A;  4GQC A;  2E7P A;  1U3I A;  4TXO B;  4EDY A;  5IPH A;  3D0Z A;  1V2A A;  5HR2 A;  4P3Y B;  4MZB A;  4G2E A;  3M1G A;  3GV1 A;  2N5F A;  3KTB A;  5IOX A;  2GVP A;  1NHY A;  2DJK A;  2XBQ A;  5IMA A;  1ST9 A;  1K3L A;  4KCE A;  2R0C A;  3IAS 2;  3GL3 A;  2FCH A;  3FR6 A;  4E8E A;  2LST A;  1M9A A;  4POL A;  2H1A A;  5ELA A;  2IFQ A;  1YF1 A;  4FQU A;  1H4O A;  5D96 A;  4KF9 A;  5AGY A;  4OCF A;  4I5Q A;  1OYJ A;  2LNS A;  2PWJ A;  18GS A;  2YWM A;  5F06 A;  3KTL A;  3UJ1 A;  4HUA A;  2JZR A;  3GTU B;  2I9H A;  4FYB A;  4MMM A;  1Z6N A;  4HJM A;  1M7T A;  2P5R A;  1GH2 A;  1XBS A;  1G0T A;  1BX9 A;  4WBJ A;  3N5O A;  3F63 A;  3W8J A;  3P7X A;  5IQY A;  1N8J A;  3HHV A;  5DVB A;  2VD1 A;  4AJ7 A;  2PVO C;  5EL8 A;  5JWQ B;  1Z9H A;  1O81 A;  2HE3 A;  2NTO A;  3TJF A;  2A4H A;  2B1L A;  3G7J A;  1MTC A;  5ECQ B;  2PER A;  1XWA A;  1XXU A;  2K8S A;  1JZW A;  5DBQ A;  4MDC A;  2E2M A;  2F9S A;  1K0M A;  5ECS A;  1U3A A;  4OD7 A;  3E3E A;  3KEB A;  5J3R A;  2WS2 A;  1X5D A;  2M80 A;  4L8E A;  3BBY A;  4G0L A;  2I81 A;  3PR8 A;  3KCM A;  2LQQ A;  1JHB A;  2NVL A;  1V98 A;  4JZQ A;  2L59 A;  3L4N A;  3C7M A;  1AUC A;  2OBK A;  1TK5 B;  1QQ2 A;  2R5G A;  1GSF A;  3ZIJ A;  1XFL A;  5F07 A;  6GSV A;  2A4V A;  3GX8 A;  1MDJ A;  2KOK A;  1OAZ A;  2H76 A;  3L0H A;  4DVC A;  3CRU A;  2NBS A;  3ED3 A;  2TIR A;  1JZD A;  1O73 A;  2H6X A;  2V6K A;  1FW1 A;  2DKH A;  3M9K A;  1YY7 A;  3H79 A;  2IMF A;  4JR6 A;  4BVY B;  4HDE A;  1XVW A;  2H6Z A;  2VL9 A;  3ZZX A;  3ME7 A;  4OFT A;  1SKS B;  1SK1 A;  5JCU A;  3QD9 A;  2KP1 A;  1J08 A;  2IME A;  5A5K A;  2MBS A;  1ZL9 A;  3ZIT A;  1THO A;  3NIV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...