2H1GA

Resa c74a/c77a
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
136
structure length
136
Chain Sequence
SDAPNFVLEDTNGKRIELSDLKGKGVFLNFWGTWAEPAKKEFPYMANQYKHFKSQGVEIVAVNVGESKIAVHNFMKSYGVNFPVVLDTDRQVLDAYDVSPLPTTFLINPEGKVVKVVTGTMTESMIHDYMNLIKPG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Thiol-disulfide oxidoreductase resA
publication title Molecular Basis for Specificity of the Extracytoplasmic Thioredoxin ResA.
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Oxidoreductase
total genus 41
structure length 136
sequence length 136
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-05-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00578 AhpC-TSA AhpC/TSA family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 2h1gA00
5AIXA 3RDWA 2E2MA 3L0HA 4D73B 1GSEA 2HLSA 4GCIA 4IVFA 5ECMB 4ZL7A 1ZOFA 4HEA2 1X0RA 2AUVA 1XXUA 1TRVA 1V58A 2CV4A 3DRNA 5DJMA 3VI5A 2O85A 2V2GA 3TJKA 5J5NA 5KN0A 1F37A 2LNTA 3KEBA 3G7IA 3DMLA 4AJ7A 2E0QA 2OADA 4FYUA 4RI6A 4KB3A 1A0RP 2LSTA 2HE3A 4O5RA 3US3A 3IC4A 1ILOA 3U5RE 3CSJA 2OE0A 4MJAA 4EL1A 4TR3A 12GSA 4PUFC 1MDJA 3KM6A 3FZAA 4IQ1A 2IPAA 3GIXA 6GSXA 3GTUA 5F05A 4KAEA 2DLXA 3F4RA 5IMFA 4XIHA 3IAM2 1SYXA 1WMJA 3LXTA 5A5KA 3FR6A 1Z5YE 3J7Yk 4OD7A 5CNWA 4MZBA 2CAIA 4WR5A 2K9FA 4KSOA 3ERFA 3F4SA 2OBIA 5CRDA 2YV9A 3HHVA 2BTOT 1ACVA 4MLYA 4PURA 2JL4A 3TJJA 1JZOA 4F82A 1HD2A 2PGTA 3PGTA 1MTCA 1M2AA 3KTLA 4OFTA 3CSHA 4XRDA 3FW2A 1VF4A 3IBHA 1PL1A 1EV4A 1FVKA 4D73A 2YV7A 2JSYA 1THXA 3VWVA 1CQGA 2MMZA 5EPFA 2LNSA 3GRXA 1EP8A 3PINA 6GSSA 2E2GA 4KDXA 3FRCA 1QMVA 1F2EA 2VO4A 1HNAA 3GHAA 2MMOA 5DJLA 1OC8A 2B1LA 3KTBA 3QCPA 2GTUA 4WETA 2CAQA 2X99A 2DJ1A 3DVWA 3LYPA 1URMA 1QGVA 1A2LA 5GAND 1SL0B 2LV3A 1EGOA 5LCZA 2GSSA 1XWBA 1SENA 4YQMA 3GH9A 1XW6A 2B7KA 4IP1A 3TJFA 3DIEA 3N9JA 1PL2A 1AQXA 4HU9A 5IOWA 3TOUA 3WGXA 1AW9A 1F3AA 1YEPA 1TRWA 4AF2A 1JLVA 1GNWA 2X8GA 5IMDA 1ERWA 1G6WA 1T7PB 4MZCA 2N5AA 5B8BA 3KCMA 5B6NA 4L0UA 3KH7A 1AQVA 3IR4A 3HVVA 3HY2A 3GL5A 3FHKA 3IPZA 1BEDA 3IXRA 1GTIA 4Q5RA 3H1NA 3I9V2 3QAGA 3GKKA 1EZKA 5IPHA 2DMLA 2MBSA 4TXOB 1B48A 3F3RA 1J9BA 2MBTA 2AHEA 2FWHA 1GRXA 1EV9A 2L5LA 2YJ7A 1M9AA 3FEUA 1U3AA 1TRSA 3KJYA 5ECLB 1A2MA 2HXKA 3KZQA 1YY7A 1O6JA 1T4ZA 4IN0A 1WOUA 5C00A 4XRAA 2HT9A 1A0FA 2P0GA 1ZL9A 3QOUA 1E2YA 1OYJA 5ID2B 1NM3A 2R2JA 2BMXA 5EY6A 3ZL5A 3VPQA 4YQVA 4HS1A 2L6DA 1QQ2A 2PERA 4L5LA 1K3OA 1DE1A 2CVKA 1W89A 1DBYA 4HQSA 2K6VA 4K0NA 4RUVA 2L59A 3GX0A 5A4VA 4EF0A 5ECKB 2Z9SA 1FG4A 2HZEB 5A4WA 2YNXA 3M1GA 4I2TA 2FWFA 2H74A 1DE2A 1ERVA 3KP9A 1WRYA 3DXBA 1VF1A 1TRUA 1K0OA 3FZ9A 4ECJA 4TKYA 3TKSE 2AYTA 4X43A 4GQCA 4MMMA 2GQMA 1K3LA 5E59A 5HR3A 3E0UA 3AY8A 3KMNA 3M9KA 1HNCA 1XW5A 2HI7A 3J7Yb 3GNJA 4TXOA 2MZCA 3HD5A 4BVXA 1OC3A 1I5GA 2C0DA 1S3AA 4JZQA 2G0FA 4PUAA 2WCIA 17GSA 4CW9A 3H4KA 3F6FA 4K1FA 1AAZA 1K0NA 4IHUA 1U88A 2YWNA 3UMAA 1A23A 3A2WA 1BAYA 2CX3A 2VM1A 3TRXA 1PA3A 4MJBA 2ON5A 3C73A 5ID2A 4GQFA 3UL3A 2B7JA 2REMA 5J3RA 3FKFA 2GZYA 3HVXA 5JWQB 2FLSA 5D9WA 5D8IA 1GSQA 3F3QA 5JWRB 1B4QA 4N30A 1JFUA 2PVOC 5HR0A 2IWTA 3GKMA 1KTEA 3I43A 3CSIA 4HU7A 3EVIA 6GSWA 3U6VA 4O7HA 3UBKA 3FYGA 4JE1A 4NAXA 4TR4A 1GUKA 3D6IA 3DEXA 3BOAA 4TOPA 1FO5A 2OJLA 2HZEA 3HJMA 1T8EB 3KXOA 4V1Ap 1W4VA 4KX4A 1MEKA 4PGTA 2P31A 5FT3A 3EU4A 3VFIA 3VURA 2IIYA 4FO5A 5DVBA 5ECSA 3V1WA 4TW5A 5LD0A 2C8UA 5HFIA 4GRFA 1WJKA 2HNLA 3F0IA 3TKRA 4J2FA 4Q5NA 4H86A 8GSSA 3D4TA 1WIKA 2MMNA 3HZ4A 2I9HA 3TJGA 2RUFA 1IYHA 4KGIA 2LJKA 2IMFA 2YZHA 2LS5A 2GQLA 1R4WA 4IW9A 1YKAA 1BQ7A 2KOKA 1S3CA 3FZ5A 3HJPA 5ECRB 4ZB6A 3UIWA 3ZZXA 3RPNA 4HUAA 1ZCPA 1FB6A 2MYGA 3ZTLA 3FZ4A 3IDVA 4ZIJA 1Q4JA 4Q5FA 3QR6A 5FWGA 1G7EA 4X1UA 3L9SA 2AAWA 1M0UA 2VD0A 2ZNMA 3M9JA 5ELAA 3O3TA 1PGTA 2IN3A 4MF7A 5J4UA 14GSA 2ZUPA 1YEXA 1B8XA 1AC1A 2NBSA 4WF5A 2GSRA 3IE3A 1Y25A 3LYKA 2VL2C 1V40A 5F06A 4PQ1A 1XPVA 3KP8A 3APSA 1K0CA 1NW2A 2DSAA 2RUEA 5L71A 1E6BA 1PRXA 1G6YA 1NHYA 4BL7A 4P3YB 1Z3EA 4V2NA 2FA4A 2JACA 3BCIA 3EMPA 3P7XA 1ZYEA 5DDLA 2M80A 3BCKA 3KD0A 3A2XA 2C0GA 3PH9A 1OE8A 2LRTA 2RIIA 5ECNB 20GSA 3KH9A 3TDGA 1TW9A 4QL9A 2CVBA 3WGDA 3GV1A 1GTUA 5GAPD 3ERGA 4JEDA 2CT6A 4JRRA 1V98A 1AUCA 3L78A 3K8NA 1XWAA 3A2VA 3BD2A 4EDZA 2GZPA 4ACSA 2TRXA 1X5EA 4O92A 3GFKA 5DQYA 4XTSA 3UOMA 4MK3A 4LMWA 1BJXA 1PSQA 3VWWA 1SK0A 5CREA 4EUYA 5HR1A 3MNGA 6GSTA 2CVDA 1PKZA 2GQKA 4HJMA 5AGYA 2FUG2 2IL3A 4CHSA 2RLIA 2ZCTA 1O8WA 2FCHA 2IJYA 2K8VA 4TVEA 4EKZA 3TB2A 1A24A 2HYXA 1I9DA 3DWVA 2B5XA 5CRGA 5B6MA 2WJUA 2DIYA 2YCDA 3CTGA 1XWKA 1S3DA 3GURA 2G2QA 2VCVA 4MZWA 1ERTA 3HZ8A 1PN9A 1ST9A 1Z6NA 4RQRA 3UVTA 3HA9A 2LJRA 4EVMA 2VOCA 3GX8A 3C1RA 5ECPB 2OBKA 2N5BA 3D0ZA 5GSSA 3IK9A 2E7PA 2LQQA 4GSSA 1GSYA 2H66A 3LG6A 5ECQB 3GL3A 4BWSA 4O32A 4F0CA 2D2ZA 2PVQA 5CRHA 1J0FA 4K7NA 3P2AA 4TR1B 2NTOA 1M9BA 1QFNA 2XBQA 6GSYA 1GNEA 2M46A 4POKA 3IHQA 5EVOA 3EE2A 4OO5A 3O76A 2ON7A 1NHOA 4RQXA 4ECIA 2C0EA 3QD9A 1PX7A 10GSA 2ES7A 3LORA 4GSTA 5CO3A 3L9VA 4KUNA 1TKDB 4HJ2A 5AN1A 4K2DA 2PU9C 1PD21 1PMTA 2V32A 2IMKA 3OR5A 4WR4A 5F8BA 1TOFA 1AXDA 5ECHB 4KCEA 2F3MA 1SL2B 13GSA 3RBTA 2I3YA 4WF4A 2BJXA 2YOIA 5KN2A 19GSA 4E8HA 4F0BA 1M7TA 3RHBA 1MD3A 2GLRA 7GSSA 3JCML 3G9BA 2VM2A 1BG5A 1UA5A 3HCZA 4QL7A 4K7OA 2OKAA 2R37A 4MF6A 1TI1A 3CTFA 4XHMA 3TRQA 1Z9HA 4ZBAA 2YANA 3M8NA 1H4OA 4MJEA 1MDIA 1THOA 5DALB 3KMOA 3Q19A 1ML6A 4IJIA 1JZDA 1OKTA 1SYRA 3IK7A 5IMVA 4V2LA 1Z7RA 1EEJA 1LBKA 3UARA 3M3MA 4TR1A 4J56E 1ZYQB 3VPTA 1OVNA 3HXSA 5KN3A 3Q6OA 4NV5A 4PX1A 2JZRA 2HRNA 2H76A 2VL2A 1JHBA 2LUSA 4LA1A 1EWXA 2H1BA 1XZOA 3ME8A 2A2RA 2VD1A 1GLPA 3VK9A 1QUWA 4IKHA 5CAXA 1C72A 1O81A 1MD4A 2PMTA 1QK8A 2XC2A 2GT6A 1RW1A 3ZRDA 1UN2A 4N0ZA 1VRSD 4BVYA 2H01A 2VCWA 2YN1A 4ID0A 2QSIA 3KGKA 5J9BA 3LXZA 3E9JB 5IOXA 1YQ1A 4HZ4A 3TJBA 4Z7XA 3KIJA 2I81A 4QQ7A 2R4VA 3FK8A 5GSTA 2DIZA 2X8HA 4K8MA 2LQOA 1TI3A 1GULA 1R26A 2FGXA 4ZILA 3I6AA 3F63A 3L9UA 2AJQB 2C1YA 3C71A 5IPGA 3UEMA 1GSSA 1KNGA 4L8EA 2CQ9A 1GSFA 4XS6A 4ILFA 1EOHA 2DBCA 3GSSA 3QAWA 3O6TA 1O85A 4MABA 1GSUA 3W8JA 2QGVA 3L4NA 2R3XA 1XVWA 3EYTA 3FY7A 2C3TA 1T3BA 4J57E 2VLVA 4WEYA 2YJHA 3HJOA 4HI7A 5DALA 2V41A 4HZ2A 3MSZA 5D9VA 4MP4A 2B6MA 5COHA 1GP1A 5H5SA 3DVXA 1R5PA 2L4CA 2VL3A 2J9HA 4Q5QA 1DSBA 2H72A 3TKSC 3ERWA 2H73A 2OA7A 4ZL9A 5ECIB 3W6GA 4JBBA 3SWLA 4V2MA 2JZTA 3ZFBA 3ZFLA 2ALBA 1WP0A 2C0FA 4AJ6A 1K0AA 1SJ6A 2LJAA 3EMXA 5ABRA 2DC5A 1HNBA 1XW9A 4MPGA 4NMUA 2CZ2A 4GLTA 2JZSA 5IMCA 4BPYA 1GWCA 4EC0A 5HQPA 5ENUA 1O8XA 4DSSB 2R5GA 4IP6A 4N10A 3TOTA 2LTKA 5DCHA 1OAZA 2FNOA 4G10A 2TRCP 5A4UA 3G7YA 1XVQA 1YF1A 3ZYWA 1AIUA 3GN3A 1LJRA 4KA0A 5JCGA 4F2IA 1XOBA 1SK2A 1F3BA 2R6KA 2B1KA 2PWJA 4N11A 1IYIA 1RQMA 5JCUA 4I6XA 2HSHA 3C7MA 3D5JA 5H5RA 1FOVA 2HZFA 2KUCA 2CA8A 4L0WA 5JCWA 4YQUA 4TXVA 1PQNA 2VUPA 1ZGNA 3IA1A 3P90A 3Q18A 2O89A 1VF2A 2LEGA 1GUMA 3CRUA 4DSRA 1SJZA 3DYRA 3NOFA 2IMDA 4V1Ag 3EU3A 4JR4A 2WGRA 2JSZA 3HYPA 4KDYA 2NPBA 3GA4A 1GSDA 2X8CA 2KP1A 2H8LA 3HVSA 2HFDA 3ME7A 3TKPA 1FB0A 1K0BA 5GZZB 1AQWA 5KEJA 1SK1A 4K0GA 3UVHA 1EP7A 1GTAA 2H19A 2L6CA 3GUSA 1KBNA 2M72A 5IIZA 3PR8A 1HYUA 3F6DA 2EC4A 3ZVJA 4F9ZA 1GL8A 1V9WA 4DSSA 1ON4A 2A4VA 1K0MA 4YH2A 5DQSA 2J23A 1BYEA 4LMVA 2V6KA 5C04A 2AV4A 4ZL8A 4AJ8A 3LSZA 3Q74A 2VAFA 2KLXA 1X5DA 3ZMKA 3RPPA 2WS2A 1X9MB 1N8JA 1A8LA 2V6OA 3W8SA 4GWRA 1N2AA 1FHEA 3LJRA 1A2JA 1T4YA 5H5QA 5DBQA 3ZIVA 4NPBA 2WULA 2H70A 2DJ0A 4WKWA 4G9HA 1M2BA 3FR9A 3I69A 4POBA 1R7HA 4POLA 2OE3A 1SD9A 2EIOA 1B4PA 2H71A 1U6TA 2AB6A 1YZXA 4PNFA 5J41A 5G1KA 1WE0A 4JR6A 1EOGA 1YKCA 1WPIA 2WFCA 1ZMAA 2DJ3A 1XIYA 1YF0A 2L57A 2VCTA 3ZVJD 3DD3A 1TTZA 2VCQA 1F6MC 2L4QA 3WYWA 1J08A 1EGRA 2B3SA 4FH8A 1V57A 3D4MA 3MWHA 3DKSA 2TIRA 2YPMA 3HKRA 2H1AA 2VCZA 3TUEA 4BWQA 4EDYA 3GYKA 3H79A 2XPDA 5ELGA 2JADA 4ML1A 1VF3A 1KEBA 2FWEA 2IFQB 3IV4A 2H0HA 5IO0A 1JZWA 4ZBDA 1JLWA 1HQOA 2F8AA 4FYCA 1DUGA 5B7CA 3GKNA 3M0FA 4YAVA 3ZIJA 2B5YA 2QC7A 2GDRA 4E8EA 3D22A 3R2QA 2GVPA 3GSTA 4GSNA 3QFAC 2PPTA 4NV2A 2XPEA 3EWLA 4LLRA 3H8QA 1TK5B 2NDOA 4PQHA 3TKSA 5IMZA 3HDCA 4TN8A 4AGSA 1T00A 2B5EA 4OMVA 4MJCA 4L5OA 2C4JA 1USBA 2OACA 5HR2A 2RM5A 4KW6A 3S9FA 3APQA 1ZZYA 2VLTA 1XWCA 1VGLA 1TP9A 4MCUA 5IQYA 1LU4A 5KN1A 4KCAA 2H30A 2H6ZA 4KSMA 3N5OA 2FD3A 4MPFA 4ZBBA 4GXZA 3P8WA 5D93A 2JU5A 1XCCA 4GF0A 2WRTA 2WDUA 1QXHA 3QAVA 1UVZA 5IM9A 5D9TA 5JWOB 1XFLA 3RHCA 3ZITA 2X64A 2GSQA 3LWAA 1K3YA 5AIVA 2C80A 1SU9A 2A2SA 5D9XA 3UAPA 2VL9A 3IRAA 1TK8B 2DJ2A 4KNDA 2F9SA 3EINA 2P5QA 5G30A 1ABAA 2GT5A 2FY6A 3VWXA 3EURA 2IFQA 5D73A 3MAKA 4MF5A 2VCXA 1FVJA 3UBLA 2DMMA 4LL4B 1G0TA 4OFNA 2VLUA 22GSA 5AISA 1Z6MA 2KHPA 4WXTA 1TJDA 3ZLPA 2O7KA 3GMFA 2IMEA 1Q98A 6GSUA 1SKWB 3TRPA 1OC9B 4I2UA 3EC3A 4PQIA 1GTBA 5G1LA 3LEFA 3C1SA 4IGJA 3NIVA 5LNKe 2C3NA 1FAAA 1PKWA 3ZMLA 4G2EA 3BBYA 2IMIA 4IBPA 2LKUA 3GKXA 2GGTA 5FHIA 2QKEA 2P5RA 4YAPA 3FR3A 4G19A 5F0GA 4PNGA 3IOSA 4HDEA 2GS3A 1SJIA 4GTUA 3QDNA 4JU5A 1TK0B 4ECCA 3E3EA 5G5FA 3ZREA 4FYBA 4I5QA 4CDOA 2N5FA 1Z7PA 2H6YA 4EE0A 4ECBA 4IQAA 2L5OA 1XBSA 4F03A 3LFLA 5DAKB 3CXGA 5CP1A 4TRXA 5EL8A 1TXXA 2XBIA 3LGCA 4I8BA 2PBJA 2PUKC 3CBUA 4IS0A 2HRFA 4K7IA 2H1GA 1PX6A 1F9MA 2YWIA 2F51A 1H75A 1SKSB 2YP6A 1FW1A 2CZ3A 6GSVA 4HQZA 3ED3A 1OKDA 1A8YA 4ZB8A 1TDIA 1SKRB 4K6XA 3VWUA 4OWYA 1YDKA 1XWGA 3QMXA 1B9YC 2EIRA 1JZRA 3WD6A 2H6XA 1X9WB 2C3QA 4N0VA 3GH6A 1OC9A 3VI7A 1YJ6A 4MA9A 1B9XC 3CYNA 4BA7A 1G7OA 4POMA 4XCSA 18GSA 2H1DA 1X9SB 2F8FA 2K8SA 2MMAA 3H93A 3SBCA 4ZXGA 3LQ7A 2O87A 5G5EA 2FWGA 1M99A 2DJJA 4DVCA 1UC7A 3UJ1A 2XHFA 1T1VA 3NZNA 4IJ3A 2NVLA 3D21A 3MDKA 4MH3A 3CMIA 4XS4B 3WGEA 2FA8A 3TCOA 5HFKA 4TR0A 2VIMA 1CQHA 2PN8A 1O7UA 5DCGA 1X5CA 3A5WA 5DAKA 3VLNA 2LRNA 2H75A 9GSSA 1MDKA 4DSQA 1TU7A 1OE7A 2YZUA 5B8AA 2LRCA 1V2AA 4WBJA 4KE3A 4EO3A 2FHEA 4I97A 2H0IA 2H0GA 2WB9A 2YWOA 1XOAA 4K9ZA 4NHWA 1U87A 1GUHA 3F8UA 4ULXA 1SD8A 4NXIA 5E4WA 1TU8A 2K18A 2EIQA 1ERUA 1NSWA 1GLQA 3F4TA 3RAZA 4OCFA 2OE1A 1R5AA 4PXOA 5IO2A 3C8EA 4DEJA 5G2ZA 16GSA 3A3TA 5CYYA 5HFGA 4OO4A 4LL1B 11GSA 4KDUA 1SL1B 1BX9A 1WWJA 1EEMA 4EXJA 2GZZA 5F07A 3TKQA 1O73A 2WZ9A 4ISDA 4X0XA 1GH2A 3GTUB 3DGQA 2HSYA 3WT2A 4XS1A 2O8VB 3BJ5A 3IAS2 3APOA 5IMAA 4MH2A 4NWYA 2I4AA 4KH7A 1K0DA 4HOJA 1RK4A 1Y6EA 3ISOA 2DJKA 4XS4A 5D96A 4OFMA 4WBRD 4FIWA 4NHZA 3F9UA 1U3IA 2RM6A 3QFBC 3WT1A 5G31A 4OCEA 4MDCA 4RI7A 5J9CA 2I1UA 3QPMA 3TGZA 5INYA 5CRWA 2V1MA 1M2DA 3G7JA 4IELA 4ZB9A 2CX4A 2KP2A 3CRTA 2GSTA 2YWMA 5ECOB 4ML6A
chains in the Genus database with same CATH superfamily
5AIXA 3RDWA 2E2MA 3L0HA 4D73B 1GSEA 2HLSA 4GCIA 4IVFA 5ECMB 4ZL7A 1ZOFA 4HEA2 1X0RA 2AUVA 1XXUA 1TRVA 1V58A 2CV4A 3DRNA 5DJMA 3VI5A 2O85A 2V2GA 3TJKA 5J5NA 5KN0A 1F37A 2LNTA 3KEBA 3G7IA 3DMLA 4G0LA 2E0QA 4AJ7A 2OADA 4FYUA 4RI6A 4KB3A 1A0RP 2LSTA 2HE3A 4O5RA 3US3A 3IC4A 1ILOA 3U5RE 3CSJA 2OE0A 4MJAA 4EL1A 4TR3A 12GSA 4PUFC 1MDJA 3KM6A 4O5QA 3FZAA 4IQ1A 2IPAA 3GIXA 6GSXA 3GTUA 5F05A 4KAEA 2DLXA 3F4RA 5IMFA 1S3RA 4XIHA 3IAM2 1SYXA 1WMJA 3LXTA 5A5KA 3FR6A 1Z5YE 3J7Yk 3PPUA 4OD7A 5CNWA 4MZBA 2CAIA 4WR5A 2K9FA 4KSOA 3ERFA 3F4SA 2OBIA 5CRDA 2YV9A 3HHVA 2BTOT 1ACVA 4MLYA 4PURA 2JL4A 3TJJA 1JZOA 4F82A 1HD2A 2PGTA 3PGTA 1MTCA 1M2AA 3KTLA 4OFTA 3CSHA 4XRDA 3FW2A 1VF4A 3IBHA 1PL1A 1EV4A 4CY8A 1FVKA 4D73A 2YV7A 2JSYA 1THXA 3VWVA 1CQGA 2MMZA 5EPFA 2LNSA 3GRXA 1EP8A 3PINA 6GSSA 2E2GA 4KDXA 3FRCA 1QMVA 1F2EA 2VO4A 1HNAA 3GHAA 2MMOA 5DJLA 1OC8A 2B1LA 3KTBA 3QCPA 2GTUA 4WETA 2CAQA 2X99A 2DJ1A 3DVWA 3LYPA 1URMA 1QGVA 1A2LA 5GAND 1SL0B 2LV3A 1EGOA 5LCZA 2GSSA 1XWBA 1SENA 4YQMA 3GH9A 1XW6A 2B7KA 4IP1A 3TJFA 3DIEA 3N9JA 1PL2A 1AQXA 4HU9A 5IOWA 3TOUA 3WGXA 1AW9A 1F3AA 1YEPA 1TRWA 4AF2A 1JLVA 1GNWA 2X8GA 5IMDA 4K5SA 1ERWA 1G6WA 1T7PB 4MZCA 2N5AA 5B8BA 3KCMA 5B6NA 4L0UA 3KH7A 1AQVA 3IR4A 3HVVA 3HY2A 3GL5A 3FHKA 3IPZA 1BEDA 3IXRA 1GTIA 4Q5RA 3H1NA 3I9V2 3QAGA 3GKKA 1EZKA 5IPHA 4G0IA 2DMLA 2MBSA 4TXOB 1B48A 3F3RA 3IHGA 1J9BA 2MBTA 2AHEA 2FWHA 4BVXB 1GRXA 1EV9A 2L5LA 2YJ7A 1M9AA 3FEUA 1U3AA 1TRSA 3KJYA 5ECLB 1A2MA 2HXKA 3KZQA 1YY7A 1O6JA 1T4ZA 4IN0A 1WOUA 5C00A 4XRAA 2HT9A 5KOWA 1A0FA 2P0GA 1ZL9A 3QOUA 1E2YA 1OYJA 2QA2A 5ID2B 2HRKA 1NM3A 2R2JA 2BMXA 5EY6A 3ZL5A 3VPQA 4YQVA 4HS1A 2L6DA 1QQ2A 3IC8A 2PERA 4L5LA 1K3OA 1DE1A 2CVKA 1W89A 1DBYA 4HQSA 2K6VA 4K0NA 4RUVA 2L59A 3GX0A 5A4VA 4EF0A 5ECKB 2Z9SA 2R0GA 1FG4A 2HZEB 5A4WA 2YNXA 3M1GA 4I2TA 2FWFA 2H74A 1DE2A 1ERVA 3KP9A 4Z2UA 1WRYA 3DXBA 3A5IA 1VF1A 1TRUA 2HSMA 1K0OA 3FZ9A 4ECJA 4TKYA 3TKSE 2AYTA 4X43A 4GQCA 4MMMA 2GQMA 1K3LA 5E59A 5HR3A 3E0UA 3AY8A 3KMNA 3M9KA 4YKGA 1HNCA 1XW5A 2HI7A 3J7Yb 3GNJA 4TXOA 2MZCA 5BRTA 3HD5A 4BVXA 1OC3A 1I5GA 2C0DA 1S3AA 4JZQA 2G0FA 4PUAA 2WCIA 17GSA 4CW9A 3H4KA 3F6FA 4K1FA 1AAZA 1K0NA 4IHUA 1U88A 2X49A 2YWNA 3UMAA 1A23A 3A2WA 1BAYA 2CX3A 2VM1A 3TRXA 1PA3A 4MJBA 2ON5A 3C73A 5ID2A 4GQFA 3UL3A 2B7JA 2REMA 5J3RA 3FKFA 4MNNA 2GZYA 3HVXA 5JWQB 2FLSA 5D9WA 5D8IA 1GSQA 3F3QA 5JWRB 1B4QA 4N30A 1JFUA 2PVOC 5HR0A 2IWTA 3GKMA 1KTEA 3I43A 3CSIA 4HU7A 3EVIA 6GSWA 3U6VA 4O7HA 3UBKA 3FYGA 4JE1A 4NAXA 4TR4A 1GUKA 3D6IA 3DEXA 3BOAA 4TOPA 1FO5A 2OJLA 2HZEA 3HJMA 1T8EB 3KXOA 4V1Ap 1W4VA 4KX4A 1MEKA 4PGTA 2P31A 5FT3A 3EU4A 3VFIA 3VURA 2IIYA 4FO5A 5DVBA 5ECSA 2R0PA 3V1WA 4TW5A 5LD0A 2C8UA 5HFIA 4GRFA 1M3JA 4BL7B 1WJKA 4FQUA 2HNLA 3F0IA 3TKRA 4J2FA 4Q5NA 4K2XA 4H86A 8GSSA 3D4TA 1WIKA 2MMNA 3HZ4A 2I9HA 3TJGA 2RUFA 1IYHA 4KGIA 2LJKA 2IMFA 2YZHA 2LS5A 2GQLA 1R4WA 4IW9A 1YKAA 1BQ7A 2KOKA 1S3CA 3FZ5A 3HJPA 5ECRB 4ZB6A 3UIWA 3ZZXA 3RPNA 4HUAA 1ZCPA 1FB6A 2MYGA 3ZTLA 3FZ4A 3IDVA 4ZIJA 1Q4JA 4Q5FA 3QR6A 5FWGA 5KOXA 1G7EA 4X1UA 3L9SA 2AAWA 1M0UA 2VD0A 2ZNMA 3M9JA 3O3TA 5ELAA 1PGTA 2IN3A 4MF7A 5J4UA 14GSA 2ZUPA 1YEXA 1B8XA 1AC1A 2NBSA 4WF5A 2GSRA 3IE3A 1Y25A 3LYKA 2VL2C 1V40A 5F06A 4PQ1A 1XPVA 3KP8A 3APSA 1K0CA 1NW2A 2DSAA 2RUEA 5L71A 1E6BA 1PRXA 1G6YA 1NHYA 4BL7A 4P3YB 1Z3EA 4V2NA 2FA4A 2JACA 3BCIA 4K5RA 3EMPA 3P7XA 1ZYEA 5DDLA 2M80A 3BCKA 3KD0A 3A2XA 2C0GA 3PH9A 1OE8A 2LRTA 2RIIA 5ECNB 20GSA 3KH9A 3TDGA 1TW9A 4QL9A 2CVBA 3WGDA 3GV1A 1GTUA 5GAPD 3ERGA 4ICYA 4JEDA 2CT6A 4JRRA 1V98A 1AUCA 3L78A 4EIPA 3K8NA 1XWAA 3A2VA 3BD2A 4EDZA 2GZPA 4ACSA 2TRXA 1X5EA 4O92A 3GFKA 5DQYA 4XTSA 3UOMA 4MK3A 2HRAA 4LMWA 1BJXA 1PSQA 3VWWA 1SK0A 5CREA 4EUYA 5HR1A 3MNGA 6GSTA 2CVDA 1PKZA 2GQKA 4HJMA 5AGYA 2FUG2 2IL3A 4CHSA 4O5UA 2RLIA 2ZCTA 1O8WA 2FCHA 2IJYA 2K8VA 4TVEA 3EPTA 4EKZA 3TB2A 1A24A 2HYXA 1I9DA 3DWVA 2B5XA 5CRGA 5B6MA 2WJUA 2DIYA 2YCDA 3CTGA 1XWKA 1S3DA 3GURA 2G2QA 2VCVA 4MZWA 1ERTA 3HZ8A 1PN9A 1ST9A 1ZYPA 1Z6NA 4RQRA 3UVTA 3HA9A 2LJRA 4EVMA 2VOCA 3GX8A 3C1RA 5ECPB 2OBKA 2N5BA 3HVNA 3D0ZA 5GSSA 3IK9A 4A5PA 2E7PA 2LQQA 4GSSA 1GSYA 2H66A 3LG6A 5ECQB 3GL3A 4BWSA 4O32A 4F0CA 2D2ZA 2PVQA 5CRHA 1J0FA 4K7NA 3P2AA 4TR1B 2NTOA 1M9BA 1QFNA 2XBQA 6GSYA 1GNEA 2M46A 4POKA 3IHQA 5EVOA 3EE2A 2DKIA 4OO5A 3O76A 2ON7A 1NHOA 4RQXA 4ECIA 2C0EA 3QD9A 4BVYB 1PX7A 10GSA 2ES7A 3LORA 4GSTA 5CO3A 3L9VA 4KUNA 1TKDB 4HJ2A 5AN1A 4K2DA 2PU9C 1PD21 1PMTA 2V32A 2IMKA 3OR5A 4WR4A 5F8BA 1TOFA 1AXDA 5ECHB 4CY6A 4KCEA 2F3MA 1SL2B 13GSA 3RBTA 2I3YA 4WF4A 2BJXA 2YOIA 5KN2A 19GSA 4E8HA 4F0BA 1M7TA 3RHBA 1MD3A 2GLRA 7GSSA 3JCML 3G9BA 2VM2A 1BG5A 1UA5A 3HCZA 4QL7A 4K7OA 2OKAA 2R37A 4MF6A 1TI1A 3CTFA 4XHMA 3TRQA 4G0KA 1Z9HA 4ZBAA 2YANA 3M8NA 1H4OA 4MJEA 1MDIA 1THOA 3KMOA 5DALB 3Q19A 1ML6A 4IJIA 1JZDA 1OKTA 1SYRA 3IK7A 5IMVA 4V2LA 1Z7RA 1EEJA 1LBKA 3UARA 3M3MA 4TR1A 4J56E 1ZYQB 3VPTA 1OVNA 3HXSA 5KN3A 3Q6OA 4NV5A 4PX1A 2JZRA 2HRNA 2H76A 2VL2A 1JHBA 2LUSA 4LA1A 1EWXA 2H1BA 1XZOA 3ME8A 2A2RA 2VD1A 1GLPA 3VK9A 1QUWA 4IKHA 5CAXA 1C72A 1O81A 1MD4A 2PMTA 1XG8A 1QK8A 2XC2A 2X4AA 2GT6A 1RW1A 3ZRDA 1UN2A 4N0ZA 1VRSD 4BVYA 2H01A 4PTSA 2VCWA 2YN1A 4ID0A 2QSIA 3KGKA 5J9BA 3MYDA 3LXZA 3E9JB 5IOXA 1YQ1A 4HZ4A 3TJBA 4Z7XA 3KIJA 2I81A 4QQ7A 1PN0A 2R4VA 3FK8A 5GSTA 2DIZA 2X8HA 4K8MA 2LQOA 1TI3A 1GULA 1R26A 2FGXA 4ZILA 3I6AA 3F63A 3L9UA 2AJQB 2C1YA 3C71A 5IPGA 3UEMA 1GSSA 1KNGA 4L8EA 2CQ9A 1GSFA 4XS6A 4ILFA 1EOHA 2DBCA 3GSSA 3QAWA 3O6TA 1O85A 4MABA 1GSUA 3W8JA 2QGVA 3L4NA 2R3XA 1XVWA 3EYTA 3FY7A 2C3TA 1T3BA 4KF9A 4J57E 2VLVA 4WEYA 2YJHA 3HJOA 4HI7A 5DALA 2V41A 4HZ2A 3MSZA 5D9VA 4MP4A 2B6MA 5COHA 1GP1A 5H5SA 2R0CA 3DVXA 1R5PA 2L4CA 2VL3A 2J9HA 4Q5QA 1DSBA 2H72A 3TKSC 3ERWA 2H73A 2OA7A 4ZL9A 5ECIB 3W6GA 4JBBA 3SWLA 4V2MA 2JZTA 3ZFBA 3ZFLA 2ALBA 1WP0A 2C0FA 4AJ6A 1K0AA 2UZ8A 1SJ6A 2LJAA 3EMXA 5ABRA 2DC5A 1HNBA 1XW9A 4MPGA 4NMUA 2CZ2A 4GLTA 2JZSA 5IMCA 4BPYA 1GWCA 4EC0A 5HQPA 5ENUA 1O8XA 4DSSB 2R5GA 4IP6A 4N10A 3TOTA 2LTKA 5DCHA 1OAZA 2FNOA 4G10A 2TRCP 5A4UA 3G7YA 1XVQA 1YF1A 3ZYWA 1AIUA 4Z2RA 3GN3A 1LJRA 4KA0A 5JCGA 4F2IA 1XOBA 1SK2A 1F3BA 2R6KA 2B1KA 2PWJA 4N11A 1IYIA 1RQMA 5JCUA 4I6XA 2HSHA 3C7MA 3D5JA 5H5RA 3FMWA 1FOVA 2HZFA 2KUCA 4USSA 2CA8A 4L0WA 5JCWA 4YQUA 4TXVA 1PQNA 2VUPA 1ZGNA 3IA1A 3P90A 3Q18A 2O89A 1VF2A 2LEGA 1GUMA 3CRUA 4DSRA 1SJZA 3DYRA 3NOFA 2IMDA 4V1Ag 3EU3A 4JR4A 4BIKA 2WGRA 2JSZA 3HYPA 4KDYA 2NPBA 3GA4A 1GSDA 2X8CA 2KP1A 2H8LA 3HVSA 2HFDA 3ME7A 3TKPA 1FB0A 1K0BA 5GZZB 1AQWA 5KEJA 1SK1A 4K0GA 3UVHA 4X4JA 1EP7A 1GTAA 2H19A 2L6CA 3GUSA 1KBNA 2M72A 5IIZA 3PR8A 1HYUA 3F6DA 2EC4A 3ZVJA 4F9ZA 1GL8A 1V9WA 4DSSA 1ON4A 2A4VA 1K0MA 4YH2A 5DQSA 2J23A 1BYEA 4LMVA 2V6KA 5C04A 2AV4A 4ZL8A 4AJ8A 3LSZA 3Q74A 2VAFA 2KLXA 1X5DA 3ZMKA 3RPPA 2WS2A 1X9MB 1N8JA 1A8LA 2V6OA 3W8SA 4GWRA 1N2AA 1FHEA 3LJRA 1A2JA 1T4YA 5H5QA 5DBQA 3ZIVA 4NPBA 2WULA 2H70A 2DJ0A 4WKWA 4G9HA 1M2BA 3FR9A 3I69A 4POBA 1R7HA 4YKFA 4POLA 2OE3A 1SD9A 2EIOA 1B4PA 2H71A 1U6TA 2AB6A 1YZXA 4PNFA 5J41A 5G1KA 1WE0A 4JR6A 1EOGA 1YKCA 5BMUA 1WPIA 2WFCA 1ZMAA 2DJ3A 1XIYA 1YF0A 3R3EA 2L57A 2VCTA 3ZVJD 3DD3A 1TTZA 2VCQA 1F6MC 2L4QA 3WYWA 1PFOA 1J08A 1EGRA 2B3SA 4FH8A 1V57A 3D4MA 3MWHA 3DKSA 2TIRA 2YPMA 3HKRA 2H1AA 2VCZA 3TUEA 4BWQA 4EDYA 3GYKA 3H79A 2XPDA 5ELGA 2JADA 4ML1A 1VF3A 1KEBA 2FWEA 2IFQB 3IV4A 2H0HA 5IO0A 1JZWA 4ZBDA 1JLWA 1HQOA 2F8AA 4FYCA 1FOHA 1DUGA 5B7CA 3GKNA 3M0FA 4YAVA 3ZIJA 2B5YA 2QC7A 2GDRA 4E8EA 3D22A 3R2QA 2GVPA 3GSTA 4GSNA 3QFAC 2PPTA 4NV2A 2XPEA 3EWLA 4LLRA 3H8QA 1TK5B 2NDOA 4PQHA 3TKSA 5IMZA 3HDCA 4TN8A 4AGSA 1T00A 2B5EA 4OMVA 4MJCA 4L5OA 2C4JA 1USBA 2OACA 5HR2A 2RM5A 4KW6A 3S9FA 3APQA 1ZZYA 2VLTA 1XWCA 1VGLA 1TP9A 4MCUA 5IQYA 1LU4A 5KN1A 4KCAA 2H30A 2H6ZA 4KSMA 3N5OA 2FD3A 4MPFA 4ZBBA 4GXZA 3P8WA 5D93A 2JU5A 1XCCA 4GF0A 2WRTA 2WDUA 1QXHA 3MIXA 3QAVA 1M3IA 3CQFA 1UVZA 5IM9A 5D9TA 5JWOB 1XFLA 3RHCA 3ZITA 2X64A 2GSQA 3LWAA 1K3YA 5AIVA 2C80A 1SU9A 2A2SA 5D9XA 3UAPA 2VL9A 3IRAA 1TK8B 2DJ2A 4KNDA 2F9SA 3EINA 2P5QA 5G30A 1ABAA 2GT5A 2FY6A 3VWXA 3EURA 2IFQA 5D73A 3MAKA 4MF5A 2VCXA 1FVJA 3UBLA 2DMMA 2QA1A 4LL4B 1G0TA 4OFNA 2VLUA 22GSA 5AISA 1Z6MA 2KHPA 4WXTA 1TJDA 3ZLPA 2O7KA 3GMFA 2IMEA 1Q98A 6GSUA 1SKWB 3TRPA 1OC9B 4I2UA 3EC3A 4PQIA 1GTBA 5G1LA 3LEFA 3C1SA 4IGJA 3NIVA 5LNKe 2C3NA 2DKHA 1FAAA 1PKWA 3ZMLA 4G2EA 3BBYA 2IMIA 4IBPA 2LKUA 3GKXA 2GGTA 5FHIA 2QKEA 2P5RA 4YAPA 3FR3A 4G19A 5F0GA 4PNGA 3IOSA 4HDEA 2GS3A 1SJIA 4GTUA 3QDNA 4JU5A 1TK0B 4ECCA 3E3EA 5G5FA 3ZREA 4FYBA 4I5QA 4CDOA 2N5FA 1Z7PA 2H6YA 4EE0A 4ECBA 4IQAA 2L5OA 1XBSA 4F03A 3LFLA 5CP1A 3CXGA 5DAKB 4TRXA 5EL8A 1TXXA 2XBIA 3LGCA 4I8BA 2PBJA 2PUKC 3CBUA 4IS0A 2HRFA 4K7IA 2H1GA 1PX6A 1F9MA 2YWIA 2F51A 1ZYNA 1H75A 1SKSB 2YP6A 1FW1A 2CZ3A 6GSVA 4HQZA 3ED3A 1OKDA 1A8YA 4ZB8A 1TDIA 1SKRB 4K6XA 3VWUA 4OWYA 1YDKA 1XWGA 3QMXA 1B9YC 2EIRA 1JZRA 3WD6A 2H6XA 1X9WB 2C3QA 4N0VA 3GH6A 1OC9A 3VI7A 1YJ6A 4MA9A 1B9XC 3CYNA 4BA7A 1G7OA 4POMA 4XCSA 18GSA 2H1DA 1X9SB 2F8FA 2K8SA 2MMAA 3H93A 3SBCA 4ZXGA 3LQ7A 2O87A 5G5EA 4Z2TA 2FWGA 1M99A 2DJJA 4DVCA 1UC7A 3UJ1A 2XHFA 1T1VA 3NZNA 4IJ3A 2NVLA 3D21A 3MDKA 4MH3A 3CMIA 4XS4B 2A2PA 3WGEA 2FA8A 3TCOA 5HFKA 4TR0A 2VIMA 1CQHA 2PN8A 1O7UA 2A4HA 5DCGA 1X5CA 3A5WA 5DAKA 3VLNA 2LRNA 2H75A 9GSSA 1MDKA 4DSQA 1TU7A 1OE7A 2YZUA 5B8AA 2LRCA 1V2AA 4WBJA 4KE3A 4EO3A 2FHEA 4I97A 2H0IA 2H0GA 2WB9A 2YWOA 1XOAA 4K9ZA 4NHWA 1U87A 1GUHA 3F8UA 4ULXA 1SD8A 3LW9A 4NXIA 5E4WA 1TU8A 2K18A 2EIQA 1ERUA 1NSWA 1GLQA 3F4TA 3RAZA 4OCFA 2OE1A 1R5AA 4PXOA 5IO2A 3C8EA 4DEJA 5G2ZA 16GSA 3A3TA 5CYYA 5HFGA 4OO4A 4LL1B 11GSA 4KDUA 1SL1B 1BX9A 1WWJA 1EEMA 4EXJA 2GZZA 5F07A 3TKQA 1O73A 2WZ9A 4ISDA 4X0XA 1GH2A 3GTUB 3DGQA 4HSCX 2HSYA 3WT2A 4XS1A 2O8VB 3BJ5A 3IAS2 3APOA 5IMAA 4MH2A 4NWYA 2I4AA 4KH7A 1K0DA 4HOJA 1RK4A 1Y6EA 3ISOA 2DJKA 4XS4A 5D96A 4OFMA 4WBRD 4FIWA 4NHZA 3F9UA 1U3IA 2RM6A 3QFBC 3WT1A 5G31A 4OCEA 4MDCA 4RI7A 4EIQA 5J9CA 2I1UA 3QPMA 3TGZA 5INYA 5CRWA 2V1MA 1M2DA 3G7JA 4IELA 4ZB9A 2CX4A 2KP2A 3CRTA 2GSTA 2YWMA 5ECOB 4ML6A
chains in the Genus database with same CATH topology
5AIXA 3RDWA 2E2MA 3L0HA 4D73B 1GSEA 2HLSA 4GCIA 4IVFA 5ECMB 4ZL7A 1ZOFA 4HEA2 1X0RA 2AUVA 1XXUA 1TRVA 1V58A 2CV4A 3DRNA 5DJMA 3VI5A 2O85A 2V2GA 3TJKA 5J5NA 5KN0A 1F37A 2LNTA 3KEBA 3G7IA 3DMLA 4G0LA 2E0QA 4AJ7A 2OADA 4FYUA 4RI6A 4KB3A 1A0RP 2LSTA 2HE3A 4O5RA 3US3A 3IC4A 1ILOA 3U5RE 3CSJA 2OE0A 4MJAA 4EL1A 4TR3A 12GSA 4PUFC 1MDJA 3KM6A 4O5QA 3FZAA 4IQ1A 2IPAA 3GIXA 6GSXA 3GTUA 5F05A 4KAEA 2DLXA 3F4RA 5IMFA 4XIHA 3IAM2 1SYXA 1WMJA 3LXTA 5A5KA 3FR6A 1Z5YE 3J7Yk 3PPUA 4OD7A 5CNWA 4MZBA 2CAIA 4WR5A 2K9FA 4KSOA 3ERFA 3F4SA 2OBIA 5CRDA 2YV9A 3HHVA 2BTOT 1ACVA 4MLYA 4PURA 2JL4A 3TJJA 1JZOA 4F82A 1HD2A 2PGTA 3PGTA 1MTCA 1M2AA 3KTLA 4OFTA 3CSHA 4XRDA 3FW2A 1VF4A 3IBHA 1PL1A 1EV4A 4CY8A 1FVKA 4D73A 2YV7A 2JSYA 1THXA 3VWVA 1CQGA 2MMZA 5EPFA 2LNSA 3GRXA 1EP8A 3PINA 6GSSA 2E2GA 4KDXA 3FRCA 1QMVA 1F2EA 2VO4A 1HNAA 3GHAA 2MMOA 5DJLA 1OC8A 2B1LA 3KTBA 3QCPA 2GTUA 4WETA 2CAQA 2X99A 2DJ1A 3DVWA 3LYPA 1URMA 1QGVA 1A2LA 5GAND 1SL0B 2LV3A 1EGOA 5LCZA 2GSSA 1XWBA 1SENA 4YQMA 3GH9A 1XW6A 2B7KA 4IP1A 3TJFA 3DIEA 3N9JA 1PL2A 1AQXA 4HU9A 5IOWA 3TOUA 3WGXA 1AW9A 1F3AA 1YEPA 1TRWA 4AF2A 1JLVA 1GNWA 2X8GA 5IMDA 4K5SA 1ERWA 1G6WA 1T7PB 4MZCA 2N5AA 5B8BA 3KCMA 5B6NA 4L0UA 3KH7A 1AQVA 3IR4A 3HVVA 3HY2A 3GL5A 3FHKA 3IPZA 1BEDA 3IXRA 1GTIA 4Q5RA 3H1NA 3I9V2 3QAGA 3GKKA 1EZKA 5IPHA 4G0IA 2DMLA 2MBSA 4TXOB 1B48A 3F3RA 3IHGA 1J9BA 2MBTA 2AHEA 2FWHA 4BVXB 1GRXA 1EV9A 2L5LA 2YJ7A 1M9AA 3FEUA 1U3AA 1TRSA 3KJYA 5ECLB 1A2MA 2HXKA 3KZQA 1YY7A 1O6JA 1T4ZA 4IN0A 1WOUA 5C00A 4XRAA 2HT9A 5KOWA 1A0FA 2P0GA 1ZL9A 3QOUA 1E2YA 1OYJA 2QA2A 5ID2B 2HRKA 1NM3A 2R2JA 2BMXA 5EY6A 3ZL5A 3VPQA 4YQVA 4HS1A 2L6DA 1QQ2A 3IC8A 2PERA 4L5LA 1K3OA 1DE1A 2CVKA 1W89A 1DBYA 4HQSA 2K6VA 4K0NA 4RUVA 2L59A 3GX0A 5A4VA 4EF0A 5ECKB 2Z9SA 2R0GA 1FG4A 2HZEB 5A4WA 2YNXA 3M1GA 4I2TA 2FWFA 2H74A 1DE2A 1ERVA 3KP9A 4Z2UA 1WRYA 3DXBA 3A5IA 1VF1A 1TRUA 2HSMA 1K0OA 3FZ9A 4ECJA 4TKYA 3TKSE 2AYTA 4X43A 4GQCA 4MMMA 2GQMA 1K3LA 5E59A 5HR3A 3E0UA 3AY8A 3KMNA 3M9KA 4YKGA 1HNCA 1XW5A 2HI7A 3J7Yb 3GNJA 4TXOA 2MZCA 5BRTA 3HD5A 4BVXA 1OC3A 1I5GA 2C0DA 1S3AA 4JZQA 2G0FA 4PUAA 2WCIA 17GSA 4CW9A 3H4KA 3F6FA 4K1FA 1AAZA 1K0NA 4IHUA 1U88A 2X49A 2YWNA 3UMAA 1A23A 3A2WA 1BAYA 2CX3A 2VM1A 3TRXA 1PA3A 4MJBA 2ON5A 3C73A 5ID2A 4GQFA 3UL3A 2B7JA 2REMA 5J3RA 3FKFA 4MNNA 2GZYA 3HVXA 5JWQB 2FLSA 5D9WA 5D8IA 1GSQA 3F3QA 5JWRB 1B4QA 4N30A 1JFUA 2PVOC 5HR0A 2IWTA 3GKMA 1KTEA 3I43A 3CSIA 4HU7A 3EVIA 6GSWA 3U6VA 4O7HA 3UBKA 3FYGA 4JE1A 4NAXA 4TR4A 1GUKA 3D6IA 3DEXA 3BOAA 4TOPA 1FO5A 2OJLA 2HZEA 3HJMA 1T8EB 3KXOA 4V1Ap 1W4VA 4KX4A 1MEKA 4PGTA 2P31A 5FT3A 3EU4A 3VFIA 3VURA 2IIYA 4FO5A 5DVBA 5ECSA 2R0PA 3V1WA 4TW5A 5LD0A 2C8UA 5HFIA 4GRFA 4BL7B 1WJKA 4FQUA 2HNLA 3F0IA 3TKRA 4J2FA 4Q5NA 4K2XA 4H86A 8GSSA 3D4TA 1WIKA 2MMNA 3HZ4A 2I9HA 3TJGA 2RUFA 1IYHA 4KGIA 2LJKA 2IMFA 2YZHA 2LS5A 2GQLA 1R4WA 4IW9A 1YKAA 1BQ7A 2KOKA 1S3CA 3FZ5A 3HJPA 5ECRB 4ZB6A 3UIWA 3ZZXA 3RPNA 4HUAA 1ZCPA 1FB6A 2MYGA 3ZTLA 3FZ4A 3IDVA 4ZIJA 1Q4JA 4Q5FA 3QR6A 5FWGA 5KOXA 1G7EA 4X1UA 3L9SA 2AAWA 1M0UA 2VD0A 2ZNMA 3M9JA 3O3TA 5ELAA 1PGTA 2IN3A 4MF7A 5J4UA 14GSA 2ZUPA 1YEXA 1B8XA 1AC1A 2NBSA 4WF5A 2GSRA 3IE3A 1Y25A 3LYKA 2VL2C 1V40A 5F06A 4PQ1A 1XPVA 3KP8A 3APSA 1K0CA 1NW2A 2DSAA 2RUEA 5L71A 1E6BA 1PRXA 1G6YA 1NHYA 4BL7A 4P3YB 1Z3EA 4V2NA 2FA4A 2JACA 3BCIA 4K5RA 3EMPA 3P7XA 1ZYEA 5DDLA 2M80A 3BCKA 3KD0A 3A2XA 2C0GA 3PH9A 1OE8A 2LRTA 2RIIA 5ECNB 20GSA 3KH9A 3TDGA 1TW9A 4QL9A 2CVBA 3WGDA 3GV1A 1GTUA 5GAPD 3ERGA 4ICYA 4JEDA 2CT6A 4JRRA 1V98A 1AUCA 3L78A 4EIPA 3K8NA 1XWAA 3A2VA 3BD2A 4EDZA 2GZPA 4ACSA 2TRXA 1X5EA 4O92A 3GFKA 5DQYA 4XTSA 3UOMA 4MK3A 2HRAA 4LMWA 1BJXA 1PSQA 3VWWA 1SK0A 5CREA 4EUYA 5HR1A 3MNGA 6GSTA 2CVDA 1PKZA 2GQKA 4HJMA 5AGYA 2FUG2 2IL3A 4CHSA 4O5UA 2RLIA 2ZCTA 1O8WA 2FCHA 2IJYA 2K8VA 4TVEA 3EPTA 4EKZA 3TB2A 1A24A 2HYXA 1I9DA 3DWVA 2B5XA 5CRGA 5B6MA 2WJUA 2DIYA 2YCDA 3CTGA 1XWKA 1S3DA 3GURA 2G2QA 2VCVA 4MZWA 1ERTA 3HZ8A 1PN9A 1ST9A 1ZYPA 1Z6NA 4RQRA 3UVTA 3HA9A 2LJRA 4EVMA 2VOCA 3GX8A 3C1RA 5ECPB 2OBKA 2N5BA 3D0ZA 5GSSA 3IK9A 4A5PA 2E7PA 2LQQA 4GSSA 1GSYA 2H66A 3LG6A 5ECQB 3GL3A 4BWSA 4O32A 4F0CA 2D2ZA 2PVQA 5CRHA 1J0FA 4K7NA 3P2AA 4TR1B 2NTOA 1M9BA 1QFNA 2XBQA 6GSYA 1GNEA 2M46A 4POKA 3IHQA 5EVOA 3EE2A 2DKIA 4OO5A 3O76A 2ON7A 1NHOA 4RQXA 4ECIA 2C0EA 3QD9A 4BVYB 1PX7A 10GSA 2ES7A 3LORA 4GSTA 5CO3A 3L9VA 4KUNA 1TKDB 4HJ2A 5AN1A 4K2DA 2PU9C 1PD21 1PMTA 2V32A 2IMKA 3OR5A 4WR4A 5F8BA 1TOFA 1AXDA 5ECHB 4CY6A 4KCEA 2F3MA 1SL2B 13GSA 3RBTA 2I3YA 4WF4A 2BJXA 2YOIA 5KN2A 19GSA 4E8HA 4F0BA 1M7TA 3RHBA 1MD3A 2GLRA 7GSSA 3JCML 3G9BA 2VM2A 1BG5A 1UA5A 3HCZA 4QL7A 4K7OA 2OKAA 2R37A 4MF6A 1TI1A 3CTFA 4XHMA 3TRQA 4G0KA 1Z9HA 4ZBAA 2YANA 3M8NA 1H4OA 4MJEA 1MDIA 1THOA 3KMOA 5DALB 3Q19A 1ML6A 4IJIA 1JZDA 1OKTA 1SYRA 3IK7A 5IMVA 4V2LA 1Z7RA 1EEJA 1LBKA 3UARA 3M3MA 4TR1A 4J56E 1ZYQB 3VPTA 1OVNA 3HXSA 5KN3A 3Q6OA 4NV5A 4PX1A 2JZRA 2HRNA 2H76A 2VL2A 1JHBA 2LUSA 4LA1A 1EWXA 2H1BA 1XZOA 3ME8A 2A2RA 2VD1A 1GLPA 3VK9A 1QUWA 4IKHA 5CAXA 1C72A 1O81A 1MD4A 2PMTA 1QK8A 2XC2A 2X4AA 2GT6A 1RW1A 3ZRDA 1UN2A 4N0ZA 1VRSD 4BVYA 2H01A 4PTSA 2VCWA 2YN1A 4ID0A 2QSIA 3KGKA 5J9BA 3MYDA 3LXZA 3E9JB 5IOXA 1YQ1A 4HZ4A 3TJBA 4Z7XA 3KIJA 2I81A 4QQ7A 1PN0A 2R4VA 3FK8A 5GSTA 2DIZA 2X8HA 4K8MA 2LQOA 1TI3A 1GULA 1R26A 2FGXA 4ZILA 3I6AA 3F63A 3L9UA 2AJQB 2C1YA 3C71A 5IPGA 3UEMA 1GSSA 1KNGA 4L8EA 2CQ9A 1GSFA 4XS6A 4ILFA 1EOHA 2DBCA 3GSSA 3QAWA 3O6TA 1O85A 4MABA 1GSUA 3W8JA 2QGVA 3L4NA 2R3XA 1XVWA 3EYTA 3FY7A 2C3TA 1T3BA 4KF9A 4J57E 2VLVA 4WEYA 2YJHA 3HJOA 4HI7A 5DALA 2V41A 4HZ2A 3MSZA 5D9VA 4MP4A 2B6MA 5COHA 1GP1A 5H5SA 2R0CA 3DVXA 1R5PA 2L4CA 2VL3A 2J9HA 4Q5QA 1DSBA 2H72A 3TKSC 3ERWA 2H73A 2OA7A 4ZL9A 5ECIB 3W6GA 4JBBA 3SWLA 4V2MA 2JZTA 3ZFBA 3ZFLA 2ALBA 1WP0A 2C0FA 4AJ6A 1K0AA 2UZ8A 1SJ6A 2LJAA 3EMXA 5ABRA 2DC5A 1HNBA 1XW9A 4MPGA 4NMUA 2CZ2A 4GLTA 2JZSA 5IMCA 4BPYA 1GWCA 4EC0A 5HQPA 5ENUA 1O8XA 4DSSB 2R5GA 4IP6A 4N10A 3TOTA 2LTKA 5DCHA 1OAZA 2FNOA 4G10A 2TRCP 5A4UA 3G7YA 1XVQA 1YF1A 3ZYWA 1AIUA 4Z2RA 3GN3A 1LJRA 4KA0A 5JCGA 4F2IA 1XOBA 1SK2A 1F3BA 2R6KA 2B1KA 2PWJA 4N11A 1IYIA 1RQMA 5JCUA 4I6XA 2HSHA 3C7MA 3D5JA 5H5RA 3FMWA 1FOVA 2HZFA 2KUCA 4USSA 2CA8A 4L0WA 5JCWA 4YQUA 4TXVA 1PQNA 2VUPA 1ZGNA 3IA1A 3P90A 3Q18A 2O89A 1VF2A 2LEGA 1GUMA 3CRUA 4DSRA 1SJZA 3DYRA 3NOFA 2IMDA 4V1Ag 3EU3A 4JR4A 2WGRA 2JSZA 3HYPA 4KDYA 2NPBA 3GA4A 1GSDA 2X8CA 2KP1A 2H8LA 3HVSA 2HFDA 3ME7A 3TKPA 1FB0A 1K0BA 5GZZB 1AQWA 5KEJA 1SK1A 4K0GA 3UVHA 4X4JA 1EP7A 1GTAA 2H19A 2L6CA 3GUSA 1KBNA 2M72A 5IIZA 3PR8A 1HYUA 3F6DA 2EC4A 3ZVJA 4F9ZA 1GL8A 1V9WA 4DSSA 1ON4A 2A4VA 1K0MA 4YH2A 5DQSA 2J23A 1BYEA 4LMVA 2V6KA 5C04A 2AV4A 4ZL8A 4AJ8A 3LSZA 3Q74A 2VAFA 2KLXA 1X5DA 3ZMKA 3RPPA 2WS2A 1X9MB 1N8JA 1A8LA 2V6OA 3W8SA 4GWRA 1N2AA 1FHEA 3LJRA 1A2JA 1T4YA 5H5QA 5DBQA 3ZIVA 4NPBA 2WULA 2H70A 2DJ0A 4WKWA 4G9HA 1M2BA 3FR9A 3I69A 4POBA 1R7HA 4YKFA 4POLA 2OE3A 1SD9A 2EIOA 1B4PA 2H71A 1U6TA 2AB6A 1YZXA 4PNFA 5J41A 5G1KA 1WE0A 4JR6A 1EOGA 1YKCA 5BMUA 1WPIA 2WFCA 1ZMAA 2DJ3A 1XIYA 1YF0A 3R3EA 2L57A 2VCTA 3ZVJD 3DD3A 1TTZA 2VCQA 1F6MC 2L4QA 3WYWA 1J08A 1EGRA 2B3SA 4FH8A 1V57A 3D4MA 3MWHA 3DKSA 2TIRA 2YPMA 3HKRA 2H1AA 2VCZA 3TUEA 4BWQA 4EDYA 3GYKA 3H79A 2XPDA 5ELGA 2JADA 4ML1A 1VF3A 1KEBA 2FWEA 2IFQB 3IV4A 2H0HA 5IO0A 1JZWA 4ZBDA 1JLWA 1HQOA 2F8AA 4FYCA 1FOHA 1DUGA 5B7CA 3GKNA 3M0FA 4YAVA 3ZIJA 2B5YA 2QC7A 2GDRA 4E8EA 3D22A 3R2QA 2GVPA 3GSTA 4GSNA 3QFAC 2PPTA 4NV2A 2XPEA 3EWLA 4LLRA 3H8QA 1TK5B 2NDOA 4PQHA 3TKSA 5IMZA 3HDCA 4TN8A 4AGSA 1T00A 2B5EA 4OMVA 4MJCA 4L5OA 2C4JA 1USBA 2OACA 5HR2A 2RM5A 4KW6A 3S9FA 3APQA 1ZZYA 2VLTA 1XWCA 1VGLA 1TP9A 4MCUA 5IQYA 1LU4A 5KN1A 4KCAA 2H30A 2H6ZA 4KSMA 3N5OA 2FD3A 4MPFA 4ZBBA 4GXZA 3P8WA 5D93A 2JU5A 1XCCA 4GF0A 2WRTA 2WDUA 1QXHA 3MIXA 3QAVA 1UVZA 5IM9A 5D9TA 5JWOB 1XFLA 3RHCA 3ZITA 2X64A 2GSQA 3LWAA 1K3YA 5AIVA 2C80A 1SU9A 2A2SA 5D9XA 3UAPA 2VL9A 3IRAA 1TK8B 2DJ2A 4KNDA 2F9SA 3EINA 2P5QA 5G30A 1ABAA 2GT5A 2FY6A 3VWXA 3EURA 2IFQA 5D73A 3MAKA 4MF5A 2VCXA 1FVJA 3UBLA 2DMMA 2QA1A 4LL4B 1G0TA 4OFNA 2VLUA 22GSA 5AISA 1Z6MA 2KHPA 4WXTA 1TJDA 3ZLPA 2O7KA 3GMFA 2IMEA 1Q98A 6GSUA 1SKWB 3TRPA 1OC9B 4I2UA 3EC3A 4PQIA 1GTBA 5G1LA 3LEFA 3C1SA 4IGJA 3NIVA 5LNKe 2C3NA 2DKHA 1FAAA 1PKWA 3ZMLA 4G2EA 3BBYA 2IMIA 4IBPA 2LKUA 3GKXA 2GGTA 5FHIA 2QKEA 2P5RA 4YAPA 3FR3A 4G19A 5F0GA 4PNGA 3IOSA 4HDEA 2GS3A 1SJIA 4GTUA 3QDNA 4JU5A 1TK0B 4ECCA 3E3EA 5G5FA 3ZREA 4FYBA 4I5QA 4CDOA 2N5FA 1Z7PA 2H6YA 4EE0A 4ECBA 4IQAA 2L5OA 1XBSA 4F03A 3LFLA 5CP1A 3CXGA 5DAKB 4TRXA 5EL8A 1TXXA 2XBIA 3LGCA 4I8BA 2PBJA 2PUKC 3CBUA 4IS0A 2HRFA 4K7IA 2H1GA 1PX6A 1F9MA 2YWIA 2F51A 1ZYNA 1H75A 1SKSB 2YP6A 1FW1A 2CZ3A 6GSVA 4HQZA 3ED3A 1OKDA 1A8YA 4ZB8A 1TDIA 1SKRB 4K6XA 3VWUA 4OWYA 1YDKA 1XWGA 3QMXA 1B9YC 2EIRA 1JZRA 3WD6A 2H6XA 1X9WB 2C3QA 4N0VA 3GH6A 1OC9A 3VI7A 1YJ6A 4MA9A 1B9XC 3CYNA 4BA7A 1G7OA 4POMA 4XCSA 18GSA 2H1DA 1X9SB 2F8FA 2K8SA 2MMAA 3H93A 3SBCA 4ZXGA 3LQ7A 2O87A 5G5EA 4Z2TA 2FWGA 1M99A 2DJJA 4DVCA 1UC7A 3UJ1A 2XHFA 1T1VA 3NZNA 4IJ3A 2NVLA 3D21A 3MDKA 4MH3A 3CMIA 4XS4B 2A2PA 3WGEA 2FA8A 3TCOA 5HFKA 4TR0A 2VIMA 1CQHA 2PN8A 1O7UA 2A4HA 5DCGA 1X5CA 3A5WA 5DAKA 3VLNA 2LRNA 2H75A 9GSSA 1MDKA 4DSQA 1TU7A 1OE7A 2YZUA 5B8AA 2LRCA 1V2AA 4WBJA 4KE3A 4EO3A 2FHEA 4I97A 2H0IA 2H0GA 2WB9A 2YWOA 1XOAA 4K9ZA 4NHWA 1U87A 1GUHA 3F8UA 4ULXA 1SD8A 3LW9A 4NXIA 5E4WA 1TU8A 2K18A 2EIQA 1ERUA 1NSWA 1GLQA 3F4TA 3RAZA 4OCFA 2OE1A 1R5AA 4PXOA 5IO2A 3C8EA 4DEJA 5G2ZA 16GSA 3A3TA 5CYYA 5HFGA 4OO4A 4LL1B 11GSA 4KDUA 1SL1B 1BX9A 1WWJA 1EEMA 4EXJA 2GZZA 5F07A 3TKQA 1O73A 2WZ9A 4ISDA 4X0XA 1GH2A 3GTUB 3DGQA 2HSYA 3WT2A 4XS1A 2O8VB 3BJ5A 3IAS2 3APOA 5IMAA 4MH2A 4NWYA 2I4AA 4KH7A 1K0DA 4HOJA 1RK4A 1Y6EA 3ISOA 2DJKA 4XS4A 5D96A 4OFMA 4WBRD 4FIWA 4NHZA 3F9UA 1U3IA 2RM6A 3QFBC 3WT1A 5G31A 4OCEA 4MDCA 4RI7A 4EIQA 5J9CA 2I1UA 3QPMA 3TGZA 5INYA 5CRWA 2V1MA 1M2DA 3G7JA 4IELA 4ZB9A 2CX4A 2KP2A 3CRTA 2GSTA 2YWMA 5ECOB 4ML6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5AIX A;  3RDW A;  2E2M A;  3L0H A;  4D73 B;  1GSE A;  2HLS A;  4GCI A;  4IVF A;  5ECM B;  4ZL7 A;  1ZOF A;  4HEA 2;  1X0R A;  2AUV A;  1XXU A;  1TRV A;  1V58 A;  2CV4 A;  3DRN A;  5DJM A;  3VI5 A;  2O85 A;  2V2G A;  3TJK A;  5J5N A;  5KN0 A;  1F37 A;  2LNT A;  3KEB A;  3G7I A;  3DML A;  4AJ7 A;  2E0Q A;  2OAD A;  4FYU A;  4RI6 A;  4KB3 A;  1A0R P;  2LST A;  2HE3 A;  4O5R A;  3US3 A;  3IC4 A;  1ILO A;  3U5R E;  3CSJ A;  2OE0 A;  4MJA A;  4EL1 A;  4TR3 A;  12GS A;  4PUF C;  1MDJ A;  3KM6 A;  3FZA A;  4IQ1 A;  2IPA A;  3GIX A;  6GSX A;  3GTU A;  5F05 A;  4KAE A;  2DLX A;  3F4R A;  5IMF A;  4XIH A;  3IAM 2;  1SYX A;  1WMJ A;  3LXT A;  5A5K A;  3FR6 A;  1Z5Y E;  3J7Y k;  4OD7 A;  5CNW A;  4MZB A;  2CAI A;  4WR5 A;  2K9F A;  4KSO A;  3ERF A;  3F4S A;  2OBI A;  5CRD A;  2YV9 A;  3HHV A;  2BTO T;  1ACV A;  4MLY A;  4PUR A;  2JL4 A;  3TJJ A;  1JZO A;  4F82 A;  1HD2 A;  2PGT A;  3PGT A;  1MTC A;  1M2A A;  3KTL A;  4OFT A;  3CSH A;  4XRD A;  3FW2 A;  1VF4 A;  3IBH A;  1PL1 A;  1EV4 A;  1FVK A;  4D73 A;  2YV7 A;  2JSY A;  1THX A;  3VWV A;  1CQG A;  2MMZ A;  5EPF A;  2LNS A;  3GRX A;  1EP8 A;  3PIN A;  6GSS A;  2E2G A;  4KDX A;  3FRC A;  1QMV A;  1F2E A;  2VO4 A;  1HNA A;  3GHA A;  2MMO A;  5DJL A;  1OC8 A;  2B1L A;  3KTB A;  3QCP A;  2GTU A;  4WET A;  2CAQ A;  2X99 A;  2DJ1 A;  3DVW A;  3LYP A;  1URM A;  1QGV A;  1A2L A;  5GAN D;  1SL0 B;  2LV3 A;  1EGO A;  5LCZ A;  2GSS A;  1XWB A;  1SEN A;  4YQM A;  3GH9 A;  1XW6 A;  2B7K A;  4IP1 A;  3TJF A;  3DIE A;  3N9J A;  1PL2 A;  1AQX A;  4HU9 A;  5IOW A;  3TOU A;  3WGX A;  1AW9 A;  1F3A A;  1YEP A;  1TRW A;  4AF2 A;  1JLV A;  1GNW A;  2X8G A;  5IMD A;  1ERW A;  1G6W A;  1T7P B;  4MZC A;  2N5A A;  5B8B A;  3KCM A;  5B6N A;  4L0U A;  3KH7 A;  1AQV A;  3IR4 A;  3HVV A;  3HY2 A;  3GL5 A;  3FHK A;  3IPZ A;  1BED A;  3IXR A;  1GTI A;  4Q5R A;  3H1N A;  3I9V 2;  3QAG A;  3GKK A;  1EZK A;  5IPH A;  2DML A;  2MBS A;  4TXO B;  1B48 A;  3F3R A;  1J9B A;  2MBT A;  2AHE A;  2FWH A;  1GRX A;  1EV9 A;  2L5L A;  2YJ7 A;  1M9A A;  3FEU A;  1U3A A;  1TRS A;  3KJY A;  5ECL B;  1A2M A;  2HXK A;  3KZQ A;  1YY7 A;  1O6J A;  1T4Z A;  4IN0 A;  1WOU A;  5C00 A;  4XRA A;  2HT9 A;  1A0F A;  2P0G A;  1ZL9 A;  3QOU A;  1E2Y A;  1OYJ A;  5ID2 B;  1NM3 A;  2R2J A;  2BMX A;  5EY6 A;  3ZL5 A;  3VPQ A;  4YQV A;  4HS1 A;  2L6D A;  1QQ2 A;  2PER A;  4L5L A;  1K3O A;  1DE1 A;  2CVK A;  1W89 A;  1DBY A;  4HQS A;  2K6V A;  4K0N A;  4RUV A;  2L59 A;  3GX0 A;  5A4V A;  4EF0 A;  5ECK B;  2Z9S A;  1FG4 A;  2HZE B;  5A4W A;  2YNX A;  3M1G A;  4I2T A;  2FWF A;  2H74 A;  1DE2 A;  1ERV A;  3KP9 A;  1WRY A;  3DXB A;  1VF1 A;  1TRU A;  1K0O A;  3FZ9 A;  4ECJ A;  4TKY A;  3TKS E;  2AYT A;  4X43 A;  4GQC A;  4MMM A;  2GQM A;  1K3L A;  5E59 A;  5HR3 A;  3E0U A;  3AY8 A;  3KMN A;  3M9K A;  1HNC A;  1XW5 A;  2HI7 A;  3J7Y b;  3GNJ A;  4TXO A;  2MZC A;  3HD5 A;  4BVX A;  1OC3 A;  1I5G A;  2C0D A;  1S3A A;  4JZQ A;  2G0F A;  4PUA A;  2WCI A;  17GS A;  4CW9 A;  3H4K A;  3F6F A;  4K1F A;  1AAZ A;  1K0N A;  4IHU A;  1U88 A;  2YWN A;  3UMA A;  1A23 A;  3A2W A;  1BAY A;  2CX3 A;  2VM1 A;  3TRX A;  1PA3 A;  4MJB A;  2ON5 A;  3C73 A;  5ID2 A;  4GQF A;  3UL3 A;  2B7J A;  2REM A;  5J3R A;  3FKF A;  2GZY A;  3HVX A;  5JWQ B;  2FLS A;  5D9W A;  5D8I A;  1GSQ A;  3F3Q A;  5JWR B;  1B4Q A;  4N30 A;  1JFU A;  2PVO C;  5HR0 A;  2IWT A;  3GKM A;  1KTE A;  3I43 A;  3CSI A;  4HU7 A;  3EVI A;  6GSW A;  3U6V A;  4O7H A;  3UBK A;  3FYG A;  4JE1 A;  4NAX A;  4TR4 A;  1GUK A;  3D6I A;  3DEX A;  3BOA A;  4TOP A;  1FO5 A;  2OJL A;  2HZE A;  3HJM A;  1T8E B;  3KXO A;  4V1A p;  1W4V A;  4KX4 A;  1MEK A;  4PGT A;  2P31 A;  5FT3 A;  3EU4 A;  3VFI A;  3VUR A;  2IIY A;  4FO5 A;  5DVB A;  5ECS A;  3V1W A;  4TW5 A;  5LD0 A;  2C8U A;  5HFI A;  4GRF A;  1WJK A;  2HNL A;  3F0I A;  3TKR A;  4J2F A;  4Q5N A;  4H86 A;  8GSS A;  3D4T A;  1WIK A;  2MMN A;  3HZ4 A;  2I9H A;  3TJG A;  2RUF A;  1IYH A;  4KGI A;  2LJK A;  2IMF A;  2YZH A;  2LS5 A;  2GQL A;  1R4W A;  4IW9 A;  1YKA A;  1BQ7 A;  2KOK A;  1S3C A;  3FZ5 A;  3HJP A;  5ECR B;  4ZB6 A;  3UIW A;  3ZZX A;  3RPN A;  4HUA A;  1ZCP A;  1FB6 A;  2MYG A;  3ZTL A;  3FZ4 A;  3IDV A;  4ZIJ A;  1Q4J A;  4Q5F A;  3QR6 A;  5FWG A;  1G7E A;  4X1U A;  3L9S A;  2AAW A;  1M0U A;  2VD0 A;  2ZNM A;  3M9J A;  5ELA A;  3O3T A;  1PGT A;  2IN3 A;  4MF7 A;  5J4U A;  14GS A;  2ZUP A;  1YEX A;  1B8X A;  1AC1 A;  2NBS A;  4WF5 A;  2GSR A;  3IE3 A;  1Y25 A;  3LYK A;  2VL2 C;  1V40 A;  5F06 A;  4PQ1 A;  1XPV A;  3KP8 A;  3APS A;  1K0C A;  1NW2 A;  2DSA A;  2RUE A;  5L71 A;  1E6B A;  1PRX A;  1G6Y A;  1NHY A;  4BL7 A;  4P3Y B;  1Z3E A;  4V2N A;  2FA4 A;  2JAC A;  3BCI A;  3EMP A;  3P7X A;  1ZYE A;  5DDL A;  2M80 A;  3BCK A;  3KD0 A;  3A2X A;  2C0G A;  3PH9 A;  1OE8 A;  2LRT A;  2RII A;  5ECN B;  20GS A;  3KH9 A;  3TDG A;  1TW9 A;  4QL9 A;  2CVB A;  3WGD A;  3GV1 A;  1GTU A;  5GAP D;  3ERG A;  4JED A;  2CT6 A;  4JRR A;  1V98 A;  1AUC A;  3L78 A;  3K8N A;  1XWA A;  3A2V A;  3BD2 A;  4EDZ A;  2GZP A;  4ACS A;  2TRX A;  1X5E A;  4O92 A;  3GFK A;  5DQY A;  4XTS A;  3UOM A;  4MK3 A;  4LMW A;  1BJX A;  1PSQ A;  3VWW A;  1SK0 A;  5CRE A;  4EUY A;  5HR1 A;  3MNG A;  6GST A;  2CVD A;  1PKZ A;  2GQK A;  4HJM A;  5AGY A;  2FUG 2;  2IL3 A;  4CHS A;  2RLI A;  2ZCT A;  1O8W A;  2FCH A;  2IJY A;  2K8V A;  4TVE A;  4EKZ A;  3TB2 A;  1A24 A;  2HYX A;  1I9D A;  3DWV A;  2B5X A;  5CRG A;  5B6M A;  2WJU A;  2DIY A;  2YCD A;  3CTG A;  1XWK A;  1S3D A;  3GUR A;  2G2Q A;  2VCV A;  4MZW A;  1ERT A;  3HZ8 A;  1PN9 A;  1ST9 A;  1Z6N A;  4RQR A;  3UVT A;  3HA9 A;  2LJR A;  4EVM A;  2VOC A;  3GX8 A;  3C1R A;  5ECP B;  2OBK A;  2N5B A;  3D0Z A;  5GSS A;  3IK9 A;  2E7P A;  2LQQ A;  4GSS A;  1GSY A;  2H66 A;  3LG6 A;  5ECQ B;  3GL3 A;  4BWS A;  4O32 A;  4F0C A;  2D2Z A;  2PVQ A;  5CRH A;  1J0F A;  4K7N A;  3P2A A;  4TR1 B;  2NTO A;  1M9B A;  1QFN A;  2XBQ A;  6GSY A;  1GNE A;  2M46 A;  4POK A;  3IHQ A;  5EVO A;  3EE2 A;  4OO5 A;  3O76 A;  2ON7 A;  1NHO A;  4RQX A;  4ECI A;  2C0E A;  3QD9 A;  1PX7 A;  10GS A;  2ES7 A;  3LOR A;  4GST A;  5CO3 A;  3L9V A;  4KUN A;  1TKD B;  4HJ2 A;  5AN1 A;  4K2D A;  2PU9 C;  1PD2 1;  1PMT A;  2V32 A;  2IMK A;  3OR5 A;  4WR4 A;  5F8B A;  1TOF A;  1AXD A;  5ECH B;  4KCE A;  2F3M A;  1SL2 B;  13GS A;  3RBT A;  2I3Y A;  4WF4 A;  2BJX A;  2YOI A;  5KN2 A;  19GS A;  4E8H A;  4F0B A;  1M7T A;  3RHB A;  1MD3 A;  2GLR A;  7GSS A;  3JCM L;  3G9B A;  2VM2 A;  1BG5 A;  1UA5 A;  3HCZ A;  4QL7 A;  4K7O A;  2OKA A;  2R37 A;  4MF6 A;  1TI1 A;  3CTF A;  4XHM A;  3TRQ A;  1Z9H A;  4ZBA A;  2YAN A;  3M8N A;  1H4O A;  4MJE A;  1MDI A;  1THO A;  5DAL B;  3KMO A;  3Q19 A;  1ML6 A;  4IJI A;  1JZD A;  1OKT A;  1SYR A;  3IK7 A;  5IMV A;  4V2L A;  1Z7R A;  1EEJ A;  1LBK A;  3UAR A;  3M3M A;  4TR1 A;  4J56 E;  1ZYQ B;  3VPT A;  1OVN A;  3HXS A;  5KN3 A;  3Q6O A;  4NV5 A;  4PX1 A;  2JZR A;  2HRN A;  2H76 A;  2VL2 A;  1JHB A;  2LUS A;  4LA1 A;  1EWX A;  2H1B A;  1XZO A;  3ME8 A;  2A2R A;  2VD1 A;  1GLP A;  3VK9 A;  1QUW A;  4IKH A;  5CAX A;  1C72 A;  1O81 A;  1MD4 A;  2PMT A;  1QK8 A;  2XC2 A;  2GT6 A;  1RW1 A;  3ZRD A;  1UN2 A;  4N0Z A;  1VRS D;  4BVY A;  2H01 A;  2VCW A;  2YN1 A;  4ID0 A;  2QSI A;  3KGK A;  5J9B A;  3LXZ A;  3E9J B;  5IOX A;  1YQ1 A;  4HZ4 A;  3TJB A;  4Z7X A;  3KIJ A;  2I81 A;  4QQ7 A;  2R4V A;  3FK8 A;  5GST A;  2DIZ A;  2X8H A;  4K8M A;  2LQO A;  1TI3 A;  1GUL A;  1R26 A;  2FGX A;  4ZIL A;  3I6A A;  3F63 A;  3L9U A;  2AJQ B;  2C1Y A;  3C71 A;  5IPG A;  3UEM A;  1GSS A;  1KNG A;  4L8E A;  2CQ9 A;  1GSF A;  4XS6 A;  4ILF A;  1EOH A;  2DBC A;  3GSS A;  3QAW A;  3O6T A;  1O85 A;  4MAB A;  1GSU A;  3W8J A;  2QGV A;  3L4N A;  2R3X A;  1XVW A;  3EYT A;  3FY7 A;  2C3T A;  1T3B A;  4J57 E;  2VLV A;  4WEY A;  2YJH A;  3HJO A;  4HI7 A;  5DAL A;  2V41 A;  4HZ2 A;  3MSZ A;  5D9V A;  4MP4 A;  2B6M A;  5COH A;  1GP1 A;  5H5S A;  3DVX A;  1R5P A;  2L4C A;  2VL3 A;  2J9H A;  4Q5Q A;  1DSB A;  2H72 A;  3TKS C;  3ERW A;  2H73 A;  2OA7 A;  4ZL9 A;  5ECI B;  3W6G A;  4JBB A;  3SWL A;  4V2M A;  2JZT A;  3ZFB A;  3ZFL A;  2ALB A;  1WP0 A;  2C0F A;  4AJ6 A;  1K0A A;  1SJ6 A;  2LJA A;  3EMX A;  5ABR A;  2DC5 A;  1HNB A;  1XW9 A;  4MPG A;  4NMU A;  2CZ2 A;  4GLT A;  2JZS A;  5IMC A;  4BPY A;  1GWC A;  4EC0 A;  5HQP A;  5ENU A;  1O8X A;  4DSS B;  2R5G A;  4IP6 A;  4N10 A;  3TOT A;  2LTK A;  5DCH A;  1OAZ A;  2FNO A;  4G10 A;  2TRC P;  5A4U A;  3G7Y A;  1XVQ A;  1YF1 A;  3ZYW A;  1AIU A;  3GN3 A;  1LJR A;  4KA0 A;  5JCG A;  4F2I A;  1XOB A;  1SK2 A;  1F3B A;  2R6K A;  2B1K A;  2PWJ A;  4N11 A;  1IYI A;  1RQM A;  5JCU A;  4I6X A;  2HSH A;  3C7M A;  3D5J A;  5H5R A;  1FOV A;  2HZF A;  2KUC A;  2CA8 A;  4L0W A;  5JCW A;  4YQU A;  4TXV A;  1PQN A;  2VUP A;  1ZGN A;  3IA1 A;  3P90 A;  3Q18 A;  2O89 A;  1VF2 A;  2LEG A;  1GUM A;  3CRU A;  4DSR A;  1SJZ A;  3DYR A;  3NOF A;  2IMD A;  4V1A g;  3EU3 A;  4JR4 A;  2WGR A;  2JSZ A;  3HYP A;  4KDY A;  2NPB A;  3GA4 A;  1GSD A;  2X8C A;  2KP1 A;  2H8L A;  3HVS A;  2HFD A;  3ME7 A;  3TKP A;  1FB0 A;  1K0B A;  5GZZ B;  1AQW A;  5KEJ A;  1SK1 A;  4K0G A;  3UVH A;  1EP7 A;  1GTA A;  2H19 A;  2L6C A;  3GUS A;  1KBN A;  2M72 A;  5IIZ A;  3PR8 A;  1HYU A;  3F6D A;  2EC4 A;  3ZVJ A;  4F9Z A;  1GL8 A;  1V9W A;  4DSS A;  1ON4 A;  2A4V A;  1K0M A;  4YH2 A;  5DQS A;  2J23 A;  1BYE A;  4LMV A;  2V6K A;  5C04 A;  2AV4 A;  4ZL8 A;  4AJ8 A;  3LSZ A;  3Q74 A;  2VAF A;  2KLX A;  1X5D A;  3ZMK A;  3RPP A;  2WS2 A;  1X9M B;  1N8J A;  1A8L A;  2V6O A;  3W8S A;  4GWR A;  1N2A A;  1FHE A;  3LJR A;  1A2J A;  1T4Y A;  5H5Q A;  5DBQ A;  3ZIV A;  4NPB A;  2WUL A;  2H70 A;  2DJ0 A;  4WKW A;  4G9H A;  1M2B A;  3FR9 A;  3I69 A;  4POB A;  1R7H A;  4POL A;  2OE3 A;  1SD9 A;  2EIO A;  1B4P A;  2H71 A;  1U6T A;  2AB6 A;  1YZX A;  4PNF A;  5J41 A;  5G1K A;  1WE0 A;  4JR6 A;  1EOG A;  1YKC A;  1WPI A;  2WFC A;  1ZMA A;  2DJ3 A;  1XIY A;  1YF0 A;  2L57 A;  2VCT A;  3ZVJ D;  3DD3 A;  1TTZ A;  2VCQ A;  1F6M C;  2L4Q A;  3WYW A;  1J08 A;  1EGR A;  2B3S A;  4FH8 A;  1V57 A;  3D4M A;  3MWH A;  3DKS A;  2TIR A;  2YPM A;  3HKR A;  2H1A A;  2VCZ A;  3TUE A;  4BWQ A;  4EDY A;  3GYK A;  3H79 A;  2XPD A;  5ELG A;  2JAD A;  4ML1 A;  1VF3 A;  1KEB A;  2FWE A;  2IFQ B;  3IV4 A;  2H0H A;  5IO0 A;  1JZW A;  4ZBD A;  1JLW A;  1HQO A;  2F8A A;  4FYC A;  1DUG A;  5B7C A;  3GKN A;  3M0F A;  4YAV A;  3ZIJ A;  2B5Y A;  2QC7 A;  2GDR A;  4E8E A;  3D22 A;  3R2Q A;  2GVP A;  3GST A;  4GSN A;  3QFA C;  2PPT A;  4NV2 A;  2XPE A;  3EWL A;  4LLR A;  3H8Q A;  1TK5 B;  2NDO A;  4PQH A;  3TKS A;  5IMZ A;  3HDC A;  4TN8 A;  4AGS A;  1T00 A;  2B5E A;  4OMV A;  4MJC A;  4L5O A;  2C4J A;  1USB A;  2OAC A;  5HR2 A;  2RM5 A;  4KW6 A;  3S9F A;  3APQ A;  1ZZY A;  2VLT A;  1XWC A;  1VGL A;  1TP9 A;  4MCU A;  5IQY A;  1LU4 A;  5KN1 A;  4KCA A;  2H30 A;  2H6Z A;  4KSM A;  3N5O A;  2FD3 A;  4MPF A;  4ZBB A;  4GXZ A;  3P8W A;  5D93 A;  2JU5 A;  1XCC A;  4GF0 A;  2WRT A;  2WDU A;  1QXH A;  3QAV A;  1UVZ A;  5IM9 A;  5D9T A;  5JWO B;  1XFL A;  3RHC A;  3ZIT A;  2X64 A;  2GSQ A;  3LWA A;  1K3Y A;  5AIV A;  2C80 A;  1SU9 A;  2A2S A;  5D9X A;  3UAP A;  2VL9 A;  3IRA A;  1TK8 B;  2DJ2 A;  4KND A;  2F9S A;  3EIN A;  2P5Q A;  5G30 A;  1ABA A;  2GT5 A;  2FY6 A;  3VWX A;  3EUR A;  2IFQ A;  5D73 A;  3MAK A;  4MF5 A;  2VCX A;  1FVJ A;  3UBL A;  2DMM A;  4LL4 B;  1G0T A;  4OFN A;  2VLU A;  22GS A;  5AIS A;  1Z6M A;  2KHP A;  4WXT A;  1TJD A;  3ZLP A;  2O7K A;  3GMF A;  2IME A;  1Q98 A;  6GSU A;  1SKW B;  3TRP A;  1OC9 B;  4I2U A;  3EC3 A;  4PQI A;  1GTB A;  5G1L A;  3LEF A;  3C1S A;  4IGJ A;  3NIV A;  5LNK e;  2C3N A;  1FAA A;  1PKW A;  3ZML A;  4G2E A;  3BBY A;  2IMI A;  4IBP A;  2LKU A;  3GKX A;  2GGT A;  5FHI A;  2QKE A;  2P5R A;  4YAP A;  3FR3 A;  4G19 A;  5F0G A;  4PNG A;  3IOS A;  4HDE A;  2GS3 A;  1SJI A;  4GTU A;  3QDN A;  4JU5 A;  1TK0 B;  4ECC A;  3E3E A;  5G5F A;  3ZRE A;  4FYB A;  4I5Q A;  4CDO A;  2N5F A;  1Z7P A;  2H6Y A;  4EE0 A;  4ECB A;  4IQA A;  2L5O A;  1XBS A;  4F03 A;  3LFL A;  5DAK B;  3CXG A;  5CP1 A;  4TRX A;  5EL8 A;  1TXX A;  2XBI A;  3LGC A;  4I8B A;  2PBJ A;  2PUK C;  3CBU A;  4IS0 A;  2HRF A;  4K7I A;  2H1G A;  1PX6 A;  1F9M A;  2YWI A;  2F51 A;  1H75 A;  1SKS B;  2YP6 A;  1FW1 A;  2CZ3 A;  6GSV A;  4HQZ A;  3ED3 A;  1OKD A;  1A8Y A;  4ZB8 A;  1TDI A;  1SKR B;  4K6X A;  3VWU A;  4OWY A;  1YDK A;  1XWG A;  3QMX A;  1B9Y C;  2EIR A;  1JZR A;  3WD6 A;  2H6X A;  1X9W B;  2C3Q A;  4N0V A;  3GH6 A;  1OC9 A;  3VI7 A;  1YJ6 A;  4MA9 A;  1B9X C;  3CYN A;  4BA7 A;  1G7O A;  4POM A;  4XCS A;  18GS A;  2H1D A;  1X9S B;  2F8F A;  2K8S A;  2MMA A;  3H93 A;  3SBC A;  4ZXG A;  3LQ7 A;  2O87 A;  5G5E A;  2FWG A;  1M99 A;  2DJJ A;  4DVC A;  1UC7 A;  3UJ1 A;  2XHF A;  1T1V A;  3NZN A;  4IJ3 A;  2NVL A;  3D21 A;  3MDK A;  4MH3 A;  3CMI A;  4XS4 B;  3WGE A;  2FA8 A;  3TCO A;  5HFK A;  4TR0 A;  2VIM A;  1CQH A;  2PN8 A;  1O7U A;  5DCG A;  1X5C A;  3A5W A;  5DAK A;  3VLN A;  2LRN A;  2H75 A;  9GSS A;  1MDK A;  4DSQ A;  1TU7 A;  1OE7 A;  2YZU A;  5B8A A;  2LRC A;  1V2A A;  4WBJ A;  4KE3 A;  4EO3 A;  2FHE A;  4I97 A;  2H0I A;  2H0G A;  2WB9 A;  2YWO A;  1XOA A;  4K9Z A;  4NHW A;  1U87 A;  1GUH A;  3F8U A;  4ULX A;  1SD8 A;  4NXI A;  5E4W A;  1TU8 A;  2K18 A;  2EIQ A;  1ERU A;  1NSW A;  1GLQ A;  3F4T A;  3RAZ A;  4OCF A;  2OE1 A;  1R5A A;  4PXO A;  5IO2 A;  3C8E A;  4DEJ A;  5G2Z A;  16GS A;  3A3T A;  5CYY A;  5HFG A;  4OO4 A;  4LL1 B;  11GS A;  4KDU A;  1SL1 B;  1BX9 A;  1WWJ A;  1EEM A;  4EXJ A;  2GZZ A;  5F07 A;  3TKQ A;  1O73 A;  2WZ9 A;  4ISD A;  4X0X A;  1GH2 A;  3GTU B;  3DGQ A;  2HSY A;  3WT2 A;  4XS1 A;  2O8V B;  3BJ5 A;  3IAS 2;  3APO A;  5IMA A;  4MH2 A;  4NWY A;  2I4A A;  4KH7 A;  1K0D A;  4HOJ A;  1RK4 A;  1Y6E A;  3ISO A;  2DJK A;  4XS4 A;  5D96 A;  4OFM A;  4WBR D;  4FIW A;  4NHZ A;  3F9U A;  1U3I A;  2RM6 A;  3QFB C;  3WT1 A;  5G31 A;  4OCE A;  4MDC A;  4RI7 A;  5J9C A;  2I1U A;  3QPM A;  3TGZ A;  5INY A;  5CRW A;  2V1M A;  1M2D A;  3G7J A;  4IEL A;  4ZB9 A;  2CX4 A;  2KP2 A;  3CRT A;  2GST A;  2YWM A;  5ECO B;  4ML6 A; 
#chains in the Genus database with same CATH topology
 5AIX A;  3RDW A;  2E2M A;  3L0H A;  4D73 B;  1GSE A;  2HLS A;  4GCI A;  4IVF A;  5ECM B;  4ZL7 A;  1ZOF A;  4HEA 2;  1X0R A;  2AUV A;  1XXU A;  1TRV A;  1V58 A;  2CV4 A;  3DRN A;  5DJM A;  3VI5 A;  2O85 A;  2V2G A;  3TJK A;  5J5N A;  5KN0 A;  1F37 A;  2LNT A;  3KEB A;  3G7I A;  3DML A;  4G0L A;  2E0Q A;  4AJ7 A;  2OAD A;  4FYU A;  4RI6 A;  4KB3 A;  1A0R P;  2LST A;  2HE3 A;  4O5R A;  3US3 A;  3IC4 A;  1ILO A;  3U5R E;  3CSJ A;  2OE0 A;  4MJA A;  4EL1 A;  4TR3 A;  12GS A;  4PUF C;  1MDJ A;  3KM6 A;  4O5Q A;  3FZA A;  4IQ1 A;  2IPA A;  3GIX A;  6GSX A;  3GTU A;  5F05 A;  4KAE A;  2DLX A;  3F4R A;  5IMF A;  1S3R A;  4XIH A;  3IAM 2;  1SYX A;  1WMJ A;  3LXT A;  5A5K A;  3FR6 A;  1Z5Y E;  3J7Y k;  3PPU A;  4OD7 A;  5CNW A;  4MZB A;  2CAI A;  4WR5 A;  2K9F A;  4KSO A;  3ERF A;  3F4S A;  2OBI A;  5CRD A;  2YV9 A;  3HHV A;  2BTO T;  1ACV A;  4MLY A;  4PUR A;  2JL4 A;  3TJJ A;  1JZO A;  4F82 A;  1HD2 A;  2PGT A;  3PGT A;  1MTC A;  1M2A A;  3KTL A;  4OFT A;  3CSH A;  4XRD A;  3FW2 A;  1VF4 A;  3IBH A;  1PL1 A;  1EV4 A;  4CY8 A;  1FVK A;  4D73 A;  2YV7 A;  2JSY A;  1THX A;  3VWV A;  1CQG A;  2MMZ A;  5EPF A;  2LNS A;  3GRX A;  1EP8 A;  3PIN A;  6GSS A;  2E2G A;  4KDX A;  3FRC A;  1QMV A;  1F2E A;  2VO4 A;  1HNA A;  3GHA A;  2MMO A;  5DJL A;  1OC8 A;  2B1L A;  3KTB A;  3QCP A;  2GTU A;  4WET A;  2CAQ A;  2X99 A;  2DJ1 A;  3DVW A;  3LYP A;  1URM A;  1QGV A;  1A2L A;  5GAN D;  1SL0 B;  2LV3 A;  1EGO A;  5LCZ A;  2GSS A;  1XWB A;  1SEN A;  4YQM A;  3GH9 A;  1XW6 A;  2B7K A;  4IP1 A;  3TJF A;  3DIE A;  3N9J A;  1PL2 A;  1AQX A;  4HU9 A;  5IOW A;  3TOU A;  3WGX A;  1AW9 A;  1F3A A;  1YEP A;  1TRW A;  4AF2 A;  1JLV A;  1GNW A;  2X8G A;  5IMD A;  4K5S A;  1ERW A;  1G6W A;  1T7P B;  4MZC A;  2N5A A;  5B8B A;  3KCM A;  5B6N A;  4L0U A;  3KH7 A;  1AQV A;  3IR4 A;  3HVV A;  3HY2 A;  3GL5 A;  3FHK A;  3IPZ A;  1BED A;  3IXR A;  1GTI A;  4Q5R A;  3H1N A;  3I9V 2;  3QAG A;  3GKK A;  1EZK A;  5IPH A;  4G0I A;  2DML A;  2MBS A;  4TXO B;  1B48 A;  3F3R A;  3IHG A;  1J9B A;  2MBT A;  2AHE A;  2FWH A;  4BVX B;  1GRX A;  1EV9 A;  2L5L A;  2YJ7 A;  1M9A A;  3FEU A;  1U3A A;  1TRS A;  3KJY A;  5ECL B;  1A2M A;  2HXK A;  3KZQ A;  1YY7 A;  1O6J A;  1T4Z A;  4IN0 A;  1WOU A;  5C00 A;  4XRA A;  2HT9 A;  5KOW A;  1A0F A;  2P0G A;  1ZL9 A;  3QOU A;  1E2Y A;  1OYJ A;  2QA2 A;  5ID2 B;  2HRK A;  1NM3 A;  2R2J A;  2BMX A;  5EY6 A;  3ZL5 A;  3VPQ A;  4YQV A;  4HS1 A;  2L6D A;  1QQ2 A;  3IC8 A;  2PER A;  4L5L A;  1K3O A;  1DE1 A;  2CVK A;  1W89 A;  1DBY A;  4HQS A;  2K6V A;  4K0N A;  4RUV A;  2L59 A;  3GX0 A;  5A4V A;  4EF0 A;  5ECK B;  2Z9S A;  2R0G A;  1FG4 A;  2HZE B;  5A4W A;  2YNX A;  3M1G A;  4I2T A;  2FWF A;  2H74 A;  1DE2 A;  1ERV A;  3KP9 A;  4Z2U A;  1WRY A;  3DXB A;  3A5I A;  1VF1 A;  1TRU A;  2HSM A;  1K0O A;  3FZ9 A;  4ECJ A;  4TKY A;  3TKS E;  2AYT A;  4X43 A;  4GQC A;  4MMM A;  2GQM A;  1K3L A;  5E59 A;  5HR3 A;  3E0U A;  3AY8 A;  3KMN A;  3M9K A;  4YKG A;  1HNC A;  1XW5 A;  2HI7 A;  3J7Y b;  3GNJ A;  4TXO A;  2MZC A;  5BRT A;  3HD5 A;  4BVX A;  1OC3 A;  1I5G A;  2C0D A;  1S3A A;  4JZQ A;  2G0F A;  4PUA A;  2WCI A;  17GS A;  4CW9 A;  3H4K A;  3F6F A;  4K1F A;  1AAZ A;  1K0N A;  4IHU A;  1U88 A;  2X49 A;  2YWN A;  3UMA A;  1A23 A;  3A2W A;  1BAY A;  2CX3 A;  2VM1 A;  3TRX A;  1PA3 A;  4MJB A;  2ON5 A;  3C73 A;  5ID2 A;  4GQF A;  3UL3 A;  2B7J A;  2REM A;  5J3R A;  3FKF A;  4MNN A;  2GZY A;  3HVX A;  5JWQ B;  2FLS A;  5D9W A;  5D8I A;  1GSQ A;  3F3Q A;  5JWR B;  1B4Q A;  4N30 A;  1JFU A;  2PVO C;  5HR0 A;  2IWT A;  3GKM A;  1KTE A;  3I43 A;  3CSI A;  4HU7 A;  3EVI A;  6GSW A;  3U6V A;  4O7H A;  3UBK A;  3FYG A;  4JE1 A;  4NAX A;  4TR4 A;  1GUK A;  3D6I A;  3DEX A;  3BOA A;  4TOP A;  1FO5 A;  2OJL A;  2HZE A;  3HJM A;  1T8E B;  3KXO A;  4V1A p;  1W4V A;  4KX4 A;  1MEK A;  4PGT A;  2P31 A;  5FT3 A;  3EU4 A;  3VFI A;  3VUR A;  2IIY A;  4FO5 A;  5DVB A;  5ECS A;  2R0P A;  3V1W A;  4TW5 A;  5LD0 A;  2C8U A;  5HFI A;  4GRF A;  1M3J A;  4BL7 B;  1WJK A;  4FQU A;  2HNL A;  3F0I A;  3TKR A;  4J2F A;  4Q5N A;  4K2X A;  4H86 A;  8GSS A;  3D4T A;  1WIK A;  2MMN A;  3HZ4 A;  2I9H A;  3TJG A;  2RUF A;  1IYH A;  4KGI A;  2LJK A;  2IMF A;  2YZH A;  2LS5 A;  2GQL A;  1R4W A;  4IW9 A;  1YKA A;  1BQ7 A;  2KOK A;  1S3C A;  3FZ5 A;  3HJP A;  5ECR B;  4ZB6 A;  3UIW A;  3ZZX A;  3RPN A;  4HUA A;  1ZCP A;  1FB6 A;  2MYG A;  3ZTL A;  3FZ4 A;  3IDV A;  4ZIJ A;  1Q4J A;  4Q5F A;  3QR6 A;  5FWG A;  5KOX A;  1G7E A;  4X1U A;  3L9S A;  2AAW A;  1M0U A;  2VD0 A;  2ZNM A;  3M9J A;  3O3T A;  5ELA A;  1PGT A;  2IN3 A;  4MF7 A;  5J4U A;  14GS A;  2ZUP A;  1YEX A;  1B8X A;  1AC1 A;  2NBS A;  4WF5 A;  2GSR A;  3IE3 A;  1Y25 A;  3LYK A;  2VL2 C;  1V40 A;  5F06 A;  4PQ1 A;  1XPV A;  3KP8 A;  3APS A;  1K0C A;  1NW2 A;  2DSA A;  2RUE A;  5L71 A;  1E6B A;  1PRX A;  1G6Y A;  1NHY A;  4BL7 A;  4P3Y B;  1Z3E A;  4V2N A;  2FA4 A;  2JAC A;  3BCI A;  4K5R A;  3EMP A;  3P7X A;  1ZYE A;  5DDL A;  2M80 A;  3BCK A;  3KD0 A;  3A2X A;  2C0G A;  3PH9 A;  1OE8 A;  2LRT A;  2RII A;  5ECN B;  20GS A;  3KH9 A;  3TDG A;  1TW9 A;  4QL9 A;  2CVB A;  3WGD A;  3GV1 A;  1GTU A;  5GAP D;  3ERG A;  4ICY A;  4JED A;  2CT6 A;  4JRR A;  1V98 A;  1AUC A;  3L78 A;  4EIP A;  3K8N A;  1XWA A;  3A2V A;  3BD2 A;  4EDZ A;  2GZP A;  4ACS A;  2TRX A;  1X5E A;  4O92 A;  3GFK A;  5DQY A;  4XTS A;  3UOM A;  4MK3 A;  2HRA A;  4LMW A;  1BJX A;  1PSQ A;  3VWW A;  1SK0 A;  5CRE A;  4EUY A;  5HR1 A;  3MNG A;  6GST A;  2CVD A;  1PKZ A;  2GQK A;  4HJM A;  5AGY A;  2FUG 2;  2IL3 A;  4CHS A;  4O5U A;  2RLI A;  2ZCT A;  1O8W A;  2FCH A;  2IJY A;  2K8V A;  4TVE A;  3EPT A;  4EKZ A;  3TB2 A;  1A24 A;  2HYX A;  1I9D A;  3DWV A;  2B5X A;  5CRG A;  5B6M A;  2WJU A;  2DIY A;  2YCD A;  3CTG A;  1XWK A;  1S3D A;  3GUR A;  2G2Q A;  2VCV A;  4MZW A;  1ERT A;  3HZ8 A;  1PN9 A;  1ST9 A;  1ZYP A;  1Z6N A;  4RQR A;  3UVT A;  3HA9 A;  2LJR A;  4EVM A;  2VOC A;  3GX8 A;  3C1R A;  5ECP B;  2OBK A;  2N5B A;  3HVN A;  3D0Z A;  5GSS A;  3IK9 A;  4A5P A;  2E7P A;  2LQQ A;  4GSS A;  1GSY A;  2H66 A;  3LG6 A;  5ECQ B;  3GL3 A;  4BWS A;  4O32 A;  4F0C A;  2D2Z A;  2PVQ A;  5CRH A;  1J0F A;  4K7N A;  3P2A A;  4TR1 B;  2NTO A;  1M9B A;  1QFN A;  2XBQ A;  6GSY A;  1GNE A;  2M46 A;  4POK A;  3IHQ A;  5EVO A;  3EE2 A;  2DKI A;  4OO5 A;  3O76 A;  2ON7 A;  1NHO A;  4RQX A;  4ECI A;  2C0E A;  3QD9 A;  4BVY B;  1PX7 A;  10GS A;  2ES7 A;  3LOR A;  4GST A;  5CO3 A;  3L9V A;  4KUN A;  1TKD B;  4HJ2 A;  5AN1 A;  4K2D A;  2PU9 C;  1PD2 1;  1PMT A;  2V32 A;  2IMK A;  3OR5 A;  4WR4 A;  5F8B A;  1TOF A;  1AXD A;  5ECH B;  4CY6 A;  4KCE A;  2F3M A;  1SL2 B;  13GS A;  3RBT A;  2I3Y A;  4WF4 A;  2BJX A;  2YOI A;  5KN2 A;  19GS A;  4E8H A;  4F0B A;  1M7T A;  3RHB A;  1MD3 A;  2GLR A;  7GSS A;  3JCM L;  3G9B A;  2VM2 A;  1BG5 A;  1UA5 A;  3HCZ A;  4QL7 A;  4K7O A;  2OKA A;  2R37 A;  4MF6 A;  1TI1 A;  3CTF A;  4XHM A;  3TRQ A;  4G0K A;  1Z9H A;  4ZBA A;  2YAN A;  3M8N A;  1H4O A;  4MJE A;  1MDI A;  1THO A;  3KMO A;  5DAL B;  3Q19 A;  1ML6 A;  4IJI A;  1JZD A;  1OKT A;  1SYR A;  3IK7 A;  5IMV A;  4V2L A;  1Z7R A;  1EEJ A;  1LBK A;  3UAR A;  3M3M A;  4TR1 A;  4J56 E;  1ZYQ B;  3VPT A;  1OVN A;  3HXS A;  5KN3 A;  3Q6O A;  4NV5 A;  4PX1 A;  2JZR A;  2HRN A;  2H76 A;  2VL2 A;  1JHB A;  2LUS A;  4LA1 A;  1EWX A;  2H1B A;  1XZO A;  3ME8 A;  2A2R A;  2VD1 A;  1GLP A;  3VK9 A;  1QUW A;  4IKH A;  5CAX A;  1C72 A;  1O81 A;  1MD4 A;  2PMT A;  1XG8 A;  1QK8 A;  2XC2 A;  2X4A A;  2GT6 A;  1RW1 A;  3ZRD A;  1UN2 A;  4N0Z A;  1VRS D;  4BVY A;  2H01 A;  4PTS A;  2VCW A;  2YN1 A;  4ID0 A;  2QSI A;  3KGK A;  5J9B A;  3MYD A;  3LXZ A;  3E9J B;  5IOX A;  1YQ1 A;  4HZ4 A;  3TJB A;  4Z7X A;  3KIJ A;  2I81 A;  4QQ7 A;  1PN0 A;  2R4V A;  3FK8 A;  5GST A;  2DIZ A;  2X8H A;  4K8M A;  2LQO A;  1TI3 A;  1GUL A;  1R26 A;  2FGX A;  4ZIL A;  3I6A A;  3F63 A;  3L9U A;  2AJQ B;  2C1Y A;  3C71 A;  5IPG A;  3UEM A;  1GSS A;  1KNG A;  4L8E A;  2CQ9 A;  1GSF A;  4XS6 A;  4ILF A;  1EOH A;  2DBC A;  3GSS A;  3QAW A;  3O6T A;  1O85 A;  4MAB A;  1GSU A;  3W8J A;  2QGV A;  3L4N A;  2R3X A;  1XVW A;  3EYT A;  3FY7 A;  2C3T A;  1T3B A;  4KF9 A;  4J57 E;  2VLV A;  4WEY A;  2YJH A;  3HJO A;  4HI7 A;  5DAL A;  2V41 A;  4HZ2 A;  3MSZ A;  5D9V A;  4MP4 A;  2B6M A;  5COH A;  1GP1 A;  5H5S A;  2R0C A;  3DVX A;  1R5P A;  2L4C A;  2VL3 A;  2J9H A;  4Q5Q A;  1DSB A;  2H72 A;  3TKS C;  3ERW A;  2H73 A;  2OA7 A;  4ZL9 A;  5ECI B;  3W6G A;  4JBB A;  3SWL A;  4V2M A;  2JZT A;  3ZFB A;  3ZFL A;  2ALB A;  1WP0 A;  2C0F A;  4AJ6 A;  1K0A A;  2UZ8 A;  1SJ6 A;  2LJA A;  3EMX A;  5ABR A;  2DC5 A;  1HNB A;  1XW9 A;  4MPG A;  4NMU A;  2CZ2 A;  4GLT A;  2JZS A;  5IMC A;  4BPY A;  1GWC A;  4EC0 A;  5HQP A;  5ENU A;  1O8X A;  4DSS B;  2R5G A;  4IP6 A;  4N10 A;  3TOT A;  2LTK A;  5DCH A;  1OAZ A;  2FNO A;  4G10 A;  2TRC P;  5A4U A;  3G7Y A;  1XVQ A;  1YF1 A;  3ZYW A;  1AIU A;  4Z2R A;  3GN3 A;  1LJR A;  4KA0 A;  5JCG A;  4F2I A;  1XOB A;  1SK2 A;  1F3B A;  2R6K A;  2B1K A;  2PWJ A;  4N11 A;  1IYI A;  1RQM A;  5JCU A;  4I6X A;  2HSH A;  3C7M A;  3D5J A;  5H5R A;  3FMW A;  1FOV A;  2HZF A;  2KUC A;  4USS A;  2CA8 A;  4L0W A;  5JCW A;  4YQU A;  4TXV A;  1PQN A;  2VUP A;  1ZGN A;  3IA1 A;  3P90 A;  3Q18 A;  2O89 A;  1VF2 A;  2LEG A;  1GUM A;  3CRU A;  4DSR A;  1SJZ A;  3DYR A;  3NOF A;  2IMD A;  4V1A g;  3EU3 A;  4JR4 A;  4BIK A;  2WGR A;  2JSZ A;  3HYP A;  4KDY A;  2NPB A;  3GA4 A;  1GSD A;  2X8C A;  2KP1 A;  2H8L A;  3HVS A;  2HFD A;  3ME7 A;  3TKP A;  1FB0 A;  1K0B A;  5GZZ B;  1AQW A;  5KEJ A;  1SK1 A;  4K0G A;  3UVH A;  4X4J A;  1EP7 A;  1GTA A;  2H19 A;  2L6C A;  3GUS A;  1KBN A;  2M72 A;  5IIZ A;  3PR8 A;  1HYU A;  3F6D A;  2EC4 A;  3ZVJ A;  4F9Z A;  1GL8 A;  1V9W A;  4DSS A;  1ON4 A;  2A4V A;  1K0M A;  4YH2 A;  5DQS A;  2J23 A;  1BYE A;  4LMV A;  2V6K A;  5C04 A;  2AV4 A;  4ZL8 A;  4AJ8 A;  3LSZ A;  3Q74 A;  2VAF A;  2KLX A;  1X5D A;  3ZMK A;  3RPP A;  2WS2 A;  1X9M B;  1N8J A;  1A8L A;  2V6O A;  3W8S A;  4GWR A;  1N2A A;  1FHE A;  3LJR A;  1A2J A;  1T4Y A;  5H5Q A;  5DBQ A;  3ZIV A;  4NPB A;  2WUL A;  2H70 A;  2DJ0 A;  4WKW A;  4G9H A;  1M2B A;  3FR9 A;  3I69 A;  4POB A;  1R7H A;  4YKF A;  4POL A;  2OE3 A;  1SD9 A;  2EIO A;  1B4P A;  2H71 A;  1U6T A;  2AB6 A;  1YZX A;  4PNF A;  5J41 A;  5G1K A;  1WE0 A;  4JR6 A;  1EOG A;  1YKC A;  5BMU A;  1WPI A;  2WFC A;  1ZMA A;  2DJ3 A;  1XIY A;  1YF0 A;  3R3E A;  2L57 A;  2VCT A;  3ZVJ D;  3DD3 A;  1TTZ A;  2VCQ A;  1F6M C;  2L4Q A;  3WYW A;  1PFO A;  1J08 A;  1EGR A;  2B3S A;  4FH8 A;  1V57 A;  3D4M A;  3MWH A;  3DKS A;  2TIR A;  2YPM A;  3HKR A;  2H1A A;  2VCZ A;  3TUE A;  4BWQ A;  4EDY A;  3GYK A;  3H79 A;  2XPD A;  5ELG A;  2JAD A;  4ML1 A;  1VF3 A;  1KEB A;  2FWE A;  2IFQ B;  3IV4 A;  2H0H A;  5IO0 A;  1JZW A;  4ZBD A;  1JLW A;  1HQO A;  2F8A A;  4FYC A;  1FOH A;  1DUG A;  5B7C A;  3GKN A;  3M0F A;  4YAV A;  3ZIJ A;  2B5Y A;  2QC7 A;  2GDR A;  4E8E A;  3D22 A;  3R2Q A;  2GVP A;  3GST A;  4GSN A;  3QFA C;  2PPT A;  4NV2 A;  2XPE A;  3EWL A;  4LLR A;  3H8Q A;  1TK5 B;  2NDO A;  4PQH A;  3TKS A;  5IMZ A;  3HDC A;  4TN8 A;  4AGS A;  1T00 A;  2B5E A;  4OMV A;  4MJC A;  4L5O A;  2C4J A;  1USB A;  2OAC A;  5HR2 A;  2RM5 A;  4KW6 A;  3S9F A;  3APQ A;  1ZZY A;  2VLT A;  1XWC A;  1VGL A;  1TP9 A;  4MCU A;  5IQY A;  1LU4 A;  5KN1 A;  4KCA A;  2H30 A;  2H6Z A;  4KSM A;  3N5O A;  2FD3 A;  4MPF A;  4ZBB A;  4GXZ A;  3P8W A;  5D93 A;  2JU5 A;  1XCC A;  4GF0 A;  2WRT A;  2WDU A;  1QXH A;  3MIX A;  3QAV A;  1M3I A;  3CQF A;  1UVZ A;  5IM9 A;  5D9T A;  5JWO B;  1XFL A;  3RHC A;  3ZIT A;  2X64 A;  2GSQ A;  3LWA A;  1K3Y A;  5AIV A;  2C80 A;  1SU9 A;  2A2S A;  5D9X A;  3UAP A;  2VL9 A;  3IRA A;  1TK8 B;  2DJ2 A;  4KND A;  2F9S A;  3EIN A;  2P5Q A;  5G30 A;  1ABA A;  2GT5 A;  2FY6 A;  3VWX A;  3EUR A;  2IFQ A;  5D73 A;  3MAK A;  4MF5 A;  2VCX A;  1FVJ A;  3UBL A;  2DMM A;  2QA1 A;  4LL4 B;  1G0T A;  4OFN A;  2VLU A;  22GS A;  5AIS A;  1Z6M A;  2KHP A;  4WXT A;  1TJD A;  3ZLP A;  2O7K A;  3GMF A;  2IME A;  1Q98 A;  6GSU A;  1SKW B;  3TRP A;  1OC9 B;  4I2U A;  3EC3 A;  4PQI A;  1GTB A;  5G1L A;  3LEF A;  3C1S A;  4IGJ A;  3NIV A;  5LNK e;  2C3N A;  2DKH A;  1FAA A;  1PKW A;  3ZML A;  4G2E A;  3BBY A;  2IMI A;  4IBP A;  2LKU A;  3GKX A;  2GGT A;  5FHI A;  2QKE A;  2P5R A;  4YAP A;  3FR3 A;  4G19 A;  5F0G A;  4PNG A;  3IOS A;  4HDE A;  2GS3 A;  1SJI A;  4GTU A;  3QDN A;  4JU5 A;  1TK0 B;  4ECC A;  3E3E A;  5G5F A;  3ZRE A;  4FYB A;  4I5Q A;  4CDO A;  2N5F A;  1Z7P A;  2H6Y A;  4EE0 A;  4ECB A;  4IQA A;  2L5O A;  1XBS A;  4F03 A;  3LFL A;  5CP1 A;  3CXG A;  5DAK B;  4TRX A;  5EL8 A;  1TXX A;  2XBI A;  3LGC A;  4I8B A;  2PBJ A;  2PUK C;  3CBU A;  4IS0 A;  2HRF A;  4K7I A;  2H1G A;  1PX6 A;  1F9M A;  2YWI A;  2F51 A;  1ZYN A;  1H75 A;  1SKS B;  2YP6 A;  1FW1 A;  2CZ3 A;  6GSV A;  4HQZ A;  3ED3 A;  1OKD A;  1A8Y A;  4ZB8 A;  1TDI A;  1SKR B;  4K6X A;  3VWU A;  4OWY A;  1YDK A;  1XWG A;  3QMX A;  1B9Y C;  2EIR A;  1JZR A;  3WD6 A;  2H6X A;  1X9W B;  2C3Q A;  4N0V A;  3GH6 A;  1OC9 A;  3VI7 A;  1YJ6 A;  4MA9 A;  1B9X C;  3CYN A;  4BA7 A;  1G7O A;  4POM A;  4XCS A;  18GS A;  2H1D A;  1X9S B;  2F8F A;  2K8S A;  2MMA A;  3H93 A;  3SBC A;  4ZXG A;  3LQ7 A;  2O87 A;  5G5E A;  4Z2T A;  2FWG A;  1M99 A;  2DJJ A;  4DVC A;  1UC7 A;  3UJ1 A;  2XHF A;  1T1V A;  3NZN A;  4IJ3 A;  2NVL A;  3D21 A;  3MDK A;  4MH3 A;  3CMI A;  4XS4 B;  2A2P A;  3WGE A;  2FA8 A;  3TCO A;  5HFK A;  4TR0 A;  2VIM A;  1CQH A;  2PN8 A;  1O7U A;  2A4H A;  5DCG A;  1X5C A;  3A5W A;  5DAK A;  3VLN A;  2LRN A;  2H75 A;  9GSS A;  1MDK A;  4DSQ A;  1TU7 A;  1OE7 A;  2YZU A;  5B8A A;  2LRC A;  1V2A A;  4WBJ A;  4KE3 A;  4EO3 A;  2FHE A;  4I97 A;  2H0I A;  2H0G A;  2WB9 A;  2YWO A;  1XOA A;  4K9Z A;  4NHW A;  1U87 A;  1GUH A;  3F8U A;  4ULX A;  1SD8 A;  3LW9 A;  4NXI A;  5E4W A;  1TU8 A;  2K18 A;  2EIQ A;  1ERU A;  1NSW A;  1GLQ A;  3F4T A;  3RAZ A;  4OCF A;  2OE1 A;  1R5A A;  4PXO A;  5IO2 A;  3C8E A;  4DEJ A;  5G2Z A;  16GS A;  3A3T A;  5CYY A;  5HFG A;  4OO4 A;  4LL1 B;  11GS A;  4KDU A;  1SL1 B;  1BX9 A;  1WWJ A;  1EEM A;  4EXJ A;  2GZZ A;  5F07 A;  3TKQ A;  1O73 A;  2WZ9 A;  4ISD A;  4X0X A;  1GH2 A;  3GTU B;  3DGQ A;  4HSC X;  2HSY A;  3WT2 A;  4XS1 A;  2O8V B;  3BJ5 A;  3IAS 2;  3APO A;  5IMA A;  4MH2 A;  4NWY A;  2I4A A;  4KH7 A;  1K0D A;  4HOJ A;  1RK4 A;  1Y6E A;  3ISO A;  2DJK A;  4XS4 A;  5D96 A;  4OFM A;  4WBR D;  4FIW A;  4NHZ A;  3F9U A;  1U3I A;  2RM6 A;  3QFB C;  3WT1 A;  5G31 A;  4OCE A;  4MDC A;  4RI7 A;  4EIQ A;  5J9C A;  2I1U A;  3QPM A;  3TGZ A;  5INY A;  5CRW A;  2V1M A;  1M2D A;  3G7J A;  4IEL A;  4ZB9 A;  2CX4 A;  2KP2 A;  3CRT A;  2GST A;  2YWM A;  5ECO B;  4ML6 A; 
#chains in the Genus database with same CATH homology
 5AIX A;  3RDW A;  2E2M A;  3L0H A;  4D73 B;  1GSE A;  2HLS A;  4GCI A;  4IVF A;  5ECM B;  4ZL7 A;  1ZOF A;  4HEA 2;  1X0R A;  2AUV A;  1XXU A;  1TRV A;  1V58 A;  2CV4 A;  3DRN A;  5DJM A;  3VI5 A;  2O85 A;  2V2G A;  3TJK A;  5J5N A;  5KN0 A;  1F37 A;  2LNT A;  3KEB A;  3G7I A;  3DML A;  4G0L A;  2E0Q A;  4AJ7 A;  2OAD A;  4FYU A;  4RI6 A;  4KB3 A;  1A0R P;  2LST A;  2HE3 A;  4O5R A;  3US3 A;  3IC4 A;  1ILO A;  3U5R E;  3CSJ A;  2OE0 A;  4MJA A;  4EL1 A;  4TR3 A;  12GS A;  4PUF C;  1MDJ A;  3KM6 A;  4O5Q A;  3FZA A;  4IQ1 A;  2IPA A;  3GIX A;  6GSX A;  3GTU A;  5F05 A;  4KAE A;  2DLX A;  3F4R A;  5IMF A;  4XIH A;  3IAM 2;  1SYX A;  1WMJ A;  3LXT A;  5A5K A;  3FR6 A;  1Z5Y E;  3J7Y k;  3PPU A;  4OD7 A;  5CNW A;  4MZB A;  2CAI A;  4WR5 A;  2K9F A;  4KSO A;  3ERF A;  3F4S A;  2OBI A;  5CRD A;  2YV9 A;  3HHV A;  2BTO T;  1ACV A;  4MLY A;  4PUR A;  2JL4 A;  3TJJ A;  1JZO A;  4F82 A;  1HD2 A;  2PGT A;  3PGT A;  1MTC A;  1M2A A;  3KTL A;  4OFT A;  3CSH A;  4XRD A;  3FW2 A;  1VF4 A;  3IBH A;  1PL1 A;  1EV4 A;  4CY8 A;  1FVK A;  4D73 A;  2YV7 A;  2JSY A;  1THX A;  3VWV A;  1CQG A;  2MMZ A;  5EPF A;  2LNS A;  3GRX A;  1EP8 A;  3PIN A;  6GSS A;  2E2G A;  4KDX A;  3FRC A;  1QMV A;  1F2E A;  2VO4 A;  1HNA A;  3GHA A;  2MMO A;  5DJL A;  1OC8 A;  2B1L A;  3KTB A;  3QCP A;  2GTU A;  4WET A;  2CAQ A;  2X99 A;  2DJ1 A;  3DVW A;  3LYP A;  1URM A;  1QGV A;  1A2L A;  5GAN D;  1SL0 B;  2LV3 A;  1EGO A;  5LCZ A;  2GSS A;  1XWB A;  1SEN A;  4YQM A;  3GH9 A;  1XW6 A;  2B7K A;  4IP1 A;  3TJF A;  3DIE A;  3N9J A;  1PL2 A;  1AQX A;  4HU9 A;  5IOW A;  3TOU A;  3WGX A;  1AW9 A;  1F3A A;  1YEP A;  1TRW A;  4AF2 A;  1JLV A;  1GNW A;  2X8G A;  5IMD A;  4K5S A;  1ERW A;  1G6W A;  1T7P B;  4MZC A;  2N5A A;  5B8B A;  3KCM A;  5B6N A;  4L0U A;  3KH7 A;  1AQV A;  3IR4 A;  3HVV A;  3HY2 A;  3GL5 A;  3FHK A;  3IPZ A;  1BED A;  3IXR A;  1GTI A;  4Q5R A;  3H1N A;  3I9V 2;  3QAG A;  3GKK A;  1EZK A;  5IPH A;  4G0I A;  2DML A;  2MBS A;  4TXO B;  1B48 A;  3F3R A;  3IHG A;  1J9B A;  2MBT A;  2AHE A;  2FWH A;  4BVX B;  1GRX A;  1EV9 A;  2L5L A;  2YJ7 A;  1M9A A;  3FEU A;  1U3A A;  1TRS A;  3KJY A;  5ECL B;  1A2M A;  2HXK A;  3KZQ A;  1YY7 A;  1O6J A;  1T4Z A;  4IN0 A;  1WOU A;  5C00 A;  4XRA A;  2HT9 A;  5KOW A;  1A0F A;  2P0G A;  1ZL9 A;  3QOU A;  1E2Y A;  1OYJ A;  2QA2 A;  5ID2 B;  2HRK A;  1NM3 A;  2R2J A;  2BMX A;  5EY6 A;  3ZL5 A;  3VPQ A;  4YQV A;  4HS1 A;  2L6D A;  1QQ2 A;  3IC8 A;  2PER A;  4L5L A;  1K3O A;  1DE1 A;  2CVK A;  1W89 A;  1DBY A;  4HQS A;  2K6V A;  4K0N A;  4RUV A;  2L59 A;  3GX0 A;  5A4V A;  4EF0 A;  5ECK B;  2Z9S A;  2R0G A;  1FG4 A;  2HZE B;  5A4W A;  2YNX A;  3M1G A;  4I2T A;  2FWF A;  2H74 A;  1DE2 A;  1ERV A;  3KP9 A;  4Z2U A;  1WRY A;  3DXB A;  3A5I A;  1VF1 A;  1TRU A;  2HSM A;  1K0O A;  3FZ9 A;  4ECJ A;  4TKY A;  3TKS E;  2AYT A;  4X43 A;  4GQC A;  4MMM A;  2GQM A;  1K3L A;  5E59 A;  5HR3 A;  3E0U A;  3AY8 A;  3KMN A;  3M9K A;  4YKG A;  1HNC A;  1XW5 A;  2HI7 A;  3J7Y b;  3GNJ A;  4TXO A;  2MZC A;  5BRT A;  3HD5 A;  4BVX A;  1OC3 A;  1I5G A;  2C0D A;  1S3A A;  4JZQ A;  2G0F A;  4PUA A;  2WCI A;  17GS A;  4CW9 A;  3H4K A;  3F6F A;  4K1F A;  1AAZ A;  1K0N A;  4IHU A;  1U88 A;  2X49 A;  2YWN A;  3UMA A;  1A23 A;  3A2W A;  1BAY A;  2CX3 A;  2VM1 A;  3TRX A;  1PA3 A;  4MJB A;  2ON5 A;  3C73 A;  5ID2 A;  4GQF A;  3UL3 A;  2B7J A;  2REM A;  5J3R A;  3FKF A;  4MNN A;  2GZY A;  3HVX A;  5JWQ B;  2FLS A;  5D9W A;  5D8I A;  1GSQ A;  3F3Q A;  5JWR B;  1B4Q A;  4N30 A;  1JFU A;  2PVO C;  5HR0 A;  2IWT A;  3GKM A;  1KTE A;  3I43 A;  3CSI A;  4HU7 A;  3EVI A;  6GSW A;  3U6V A;  4O7H A;  3UBK A;  3FYG A;  4JE1 A;  4NAX A;  4TR4 A;  1GUK A;  3D6I A;  3DEX A;  3BOA A;  4TOP A;  1FO5 A;  2OJL A;  2HZE A;  3HJM A;  1T8E B;  3KXO A;  4V1A p;  1W4V A;  4KX4 A;  1MEK A;  4PGT A;  2P31 A;  5FT3 A;  3EU4 A;  3VFI A;  3VUR A;  2IIY A;  4FO5 A;  5DVB A;  5ECS A;  2R0P A;  3V1W A;  4TW5 A;  5LD0 A;  2C8U A;  5HFI A;  4GRF A;  4BL7 B;  1WJK A;  4FQU A;  2HNL A;  3F0I A;  3TKR A;  4J2F A;  4Q5N A;  4K2X A;  4H86 A;  8GSS A;  3D4T A;  1WIK A;  2MMN A;  3HZ4 A;  2I9H A;  3TJG A;  2RUF A;  1IYH A;  4KGI A;  2LJK A;  2IMF A;  2YZH A;  2LS5 A;  2GQL A;  1R4W A;  4IW9 A;  1YKA A;  1BQ7 A;  2KOK A;  1S3C A;  3FZ5 A;  3HJP A;  5ECR B;  4ZB6 A;  3UIW A;  3ZZX A;  3RPN A;  4HUA A;  1ZCP A;  1FB6 A;  2MYG A;  3ZTL A;  3FZ4 A;  3IDV A;  4ZIJ A;  1Q4J A;  4Q5F A;  3QR6 A;  5FWG A;  5KOX A;  1G7E A;  4X1U A;  3L9S A;  2AAW A;  1M0U A;  2VD0 A;  2ZNM A;  3M9J A;  3O3T A;  5ELA A;  1PGT A;  2IN3 A;  4MF7 A;  5J4U A;  14GS A;  2ZUP A;  1YEX A;  1B8X A;  1AC1 A;  2NBS A;  4WF5 A;  2GSR A;  3IE3 A;  1Y25 A;  3LYK A;  2VL2 C;  1V40 A;  5F06 A;  4PQ1 A;  1XPV A;  3KP8 A;  3APS A;  1K0C A;  1NW2 A;  2DSA A;  2RUE A;  5L71 A;  1E6B A;  1PRX A;  1G6Y A;  1NHY A;  4BL7 A;  4P3Y B;  1Z3E A;  4V2N A;  2FA4 A;  2JAC A;  3BCI A;  4K5R A;  3EMP A;  3P7X A;  1ZYE A;  5DDL A;  2M80 A;  3BCK A;  3KD0 A;  3A2X A;  2C0G A;  3PH9 A;  1OE8 A;  2LRT A;  2RII A;  5ECN B;  20GS A;  3KH9 A;  3TDG A;  1TW9 A;  4QL9 A;  2CVB A;  3WGD A;  3GV1 A;  1GTU A;  5GAP D;  3ERG A;  4ICY A;  4JED A;  2CT6 A;  4JRR A;  1V98 A;  1AUC A;  3L78 A;  4EIP A;  3K8N A;  1XWA A;  3A2V A;  3BD2 A;  4EDZ A;  2GZP A;  4ACS A;  2TRX A;  1X5E A;  4O92 A;  3GFK A;  5DQY A;  4XTS A;  3UOM A;  4MK3 A;  2HRA A;  4LMW A;  1BJX A;  1PSQ A;  3VWW A;  1SK0 A;  5CRE A;  4EUY A;  5HR1 A;  3MNG A;  6GST A;  2CVD A;  1PKZ A;  2GQK A;  4HJM A;  5AGY A;  2FUG 2;  2IL3 A;  4CHS A;  4O5U A;  2RLI A;  2ZCT A;  1O8W A;  2FCH A;  2IJY A;  2K8V A;  4TVE A;  3EPT A;  4EKZ A;  3TB2 A;  1A24 A;  2HYX A;  1I9D A;  3DWV A;  2B5X A;  5CRG A;  5B6M A;  2WJU A;  2DIY A;  2YCD A;  3CTG A;  1XWK A;  1S3D A;  3GUR A;  2G2Q A;  2VCV A;  4MZW A;  1ERT A;  3HZ8 A;  1PN9 A;  1ST9 A;  1ZYP A;  1Z6N A;  4RQR A;  3UVT A;  3HA9 A;  2LJR A;  4EVM A;  2VOC A;  3GX8 A;  3C1R A;  5ECP B;  2OBK A;  2N5B A;  3D0Z A;  5GSS A;  3IK9 A;  4A5P A;  2E7P A;  2LQQ A;  4GSS A;  1GSY A;  2H66 A;  3LG6 A;  5ECQ B;  3GL3 A;  4BWS A;  4O32 A;  4F0C A;  2D2Z A;  2PVQ A;  5CRH A;  1J0F A;  4K7N A;  3P2A A;  4TR1 B;  2NTO A;  1M9B A;  1QFN A;  2XBQ A;  6GSY A;  1GNE A;  2M46 A;  4POK A;  3IHQ A;  5EVO A;  3EE2 A;  2DKI A;  4OO5 A;  3O76 A;  2ON7 A;  1NHO A;  4RQX A;  4ECI A;  2C0E A;  3QD9 A;  4BVY B;  1PX7 A;  10GS A;  2ES7 A;  3LOR A;  4GST A;  5CO3 A;  3L9V A;  4KUN A;  1TKD B;  4HJ2 A;  5AN1 A;  4K2D A;  2PU9 C;  1PD2 1;  1PMT A;  2V32 A;  2IMK A;  3OR5 A;  4WR4 A;  5F8B A;  1TOF A;  1AXD A;  5ECH B;  4CY6 A;  4KCE A;  2F3M A;  1SL2 B;  13GS A;  3RBT A;  2I3Y A;  4WF4 A;  2BJX A;  2YOI A;  5KN2 A;  19GS A;  4E8H A;  4F0B A;  1M7T A;  3RHB A;  1MD3 A;  2GLR A;  7GSS A;  3JCM L;  3G9B A;  2VM2 A;  1BG5 A;  1UA5 A;  3HCZ A;  4QL7 A;  4K7O A;  2OKA A;  2R37 A;  4MF6 A;  1TI1 A;  3CTF A;  4XHM A;  3TRQ A;  4G0K A;  1Z9H A;  4ZBA A;  2YAN A;  3M8N A;  1H4O A;  4MJE A;  1MDI A;  1THO A;  3KMO A;  5DAL B;  3Q19 A;  1ML6 A;  4IJI A;  1JZD A;  1OKT A;  1SYR A;  3IK7 A;  5IMV A;  4V2L A;  1Z7R A;  1EEJ A;  1LBK A;  3UAR A;  3M3M A;  4TR1 A;  4J56 E;  1ZYQ B;  3VPT A;  1OVN A;  3HXS A;  5KN3 A;  3Q6O A;  4NV5 A;  4PX1 A;  2JZR A;  2HRN A;  2H76 A;  2VL2 A;  1JHB A;  2LUS A;  4LA1 A;  1EWX A;  2H1B A;  1XZO A;  3ME8 A;  2A2R A;  2VD1 A;  1GLP A;  3VK9 A;  1QUW A;  4IKH A;  5CAX A;  1C72 A;  1O81 A;  1MD4 A;  2PMT A;  1QK8 A;  2XC2 A;  2X4A A;  2GT6 A;  1RW1 A;  3ZRD A;  1UN2 A;  4N0Z A;  1VRS D;  4BVY A;  2H01 A;  4PTS A;  2VCW A;  2YN1 A;  4ID0 A;  2QSI A;  3KGK A;  5J9B A;  3MYD A;  3LXZ A;  3E9J B;  5IOX A;  1YQ1 A;  4HZ4 A;  3TJB A;  4Z7X A;  3KIJ A;  2I81 A;  4QQ7 A;  1PN0 A;  2R4V A;  3FK8 A;  5GST A;  2DIZ A;  2X8H A;  4K8M A;  2LQO A;  1TI3 A;  1GUL A;  1R26 A;  2FGX A;  4ZIL A;  3I6A A;  3F63 A;  3L9U A;  2AJQ B;  2C1Y A;  3C71 A;  5IPG A;  3UEM A;  1GSS A;  1KNG A;  4L8E A;  2CQ9 A;  1GSF A;  4XS6 A;  4ILF A;  1EOH A;  2DBC A;  3GSS A;  3QAW A;  3O6T A;  1O85 A;  4MAB A;  1GSU A;  3W8J A;  2QGV A;  3L4N A;  2R3X A;  1XVW A;  3EYT A;  3FY7 A;  2C3T A;  1T3B A;  4KF9 A;  4J57 E;  2VLV A;  4WEY A;  2YJH A;  3HJO A;  4HI7 A;  5DAL A;  2V41 A;  4HZ2 A;  3MSZ A;  5D9V A;  4MP4 A;  2B6M A;  5COH A;  1GP1 A;  5H5S A;  2R0C A;  3DVX A;  1R5P A;  2L4C A;  2VL3 A;  2J9H A;  4Q5Q A;  1DSB A;  2H72 A;  3TKS C;  3ERW A;  2H73 A;  2OA7 A;  4ZL9 A;  5ECI B;  3W6G A;  4JBB A;  3SWL A;  4V2M A;  2JZT A;  3ZFB A;  3ZFL A;  2ALB A;  1WP0 A;  2C0F A;  4AJ6 A;  1K0A A;  2UZ8 A;  1SJ6 A;  2LJA A;  3EMX A;  5ABR A;  2DC5 A;  1HNB A;  1XW9 A;  4MPG A;  4NMU A;  2CZ2 A;  4GLT A;  2JZS A;  5IMC A;  4BPY A;  1GWC A;  4EC0 A;  5HQP A;  5ENU A;  1O8X A;  4DSS B;  2R5G A;  4IP6 A;  4N10 A;  3TOT A;  2LTK A;  5DCH A;  1OAZ A;  2FNO A;  4G10 A;  2TRC P;  5A4U A;  3G7Y A;  1XVQ A;  1YF1 A;  3ZYW A;  1AIU A;  4Z2R A;  3GN3 A;  1LJR A;  4KA0 A;  5JCG A;  4F2I A;  1XOB A;  1SK2 A;  1F3B A;  2R6K A;  2B1K A;  2PWJ A;  4N11 A;  1IYI A;  1RQM A;  5JCU A;  4I6X A;  2HSH A;  3C7M A;  3D5J A;  5H5R A;  3FMW A;  1FOV A;  2HZF A;  2KUC A;  4USS A;  2CA8 A;  4L0W A;  5JCW A;  4YQU A;  4TXV A;  1PQN A;  2VUP A;  1ZGN A;  3IA1 A;  3P90 A;  3Q18 A;  2O89 A;  1VF2 A;  2LEG A;  1GUM A;  3CRU A;  4DSR A;  1SJZ A;  3DYR A;  3NOF A;  2IMD A;  4V1A g;  3EU3 A;  4JR4 A;  2WGR A;  2JSZ A;  3HYP A;  4KDY A;  2NPB A;  3GA4 A;  1GSD A;  2X8C A;  2KP1 A;  2H8L A;  3HVS A;  2HFD A;  3ME7 A;  3TKP A;  1FB0 A;  1K0B A;  5GZZ B;  1AQW A;  5KEJ A;  1SK1 A;  4K0G A;  3UVH A;  4X4J A;  1EP7 A;  1GTA A;  2H19 A;  2L6C A;  3GUS A;  1KBN A;  2M72 A;  5IIZ A;  3PR8 A;  1HYU A;  3F6D A;  2EC4 A;  3ZVJ A;  4F9Z A;  1GL8 A;  1V9W A;  4DSS A;  1ON4 A;  2A4V A;  1K0M A;  4YH2 A;  5DQS A;  2J23 A;  1BYE A;  4LMV A;  2V6K A;  5C04 A;  2AV4 A;  4ZL8 A;  4AJ8 A;  3LSZ A;  3Q74 A;  2VAF A;  2KLX A;  1X5D A;  3ZMK A;  3RPP A;  2WS2 A;  1X9M B;  1N8J A;  1A8L A;  2V6O A;  3W8S A;  4GWR A;  1N2A A;  1FHE A;  3LJR A;  1A2J A;  1T4Y A;  5H5Q A;  5DBQ A;  3ZIV A;  4NPB A;  2WUL A;  2H70 A;  2DJ0 A;  4WKW A;  4G9H A;  1M2B A;  3FR9 A;  3I69 A;  4POB A;  1R7H A;  4YKF A;  4POL A;  2OE3 A;  1SD9 A;  2EIO A;  1B4P A;  2H71 A;  1U6T A;  2AB6 A;  1YZX A;  4PNF A;  5J41 A;  5G1K A;  1WE0 A;  4JR6 A;  1EOG A;  1YKC A;  5BMU A;  1WPI A;  2WFC A;  1ZMA A;  2DJ3 A;  1XIY A;  1YF0 A;  3R3E A;  2L57 A;  2VCT A;  3ZVJ D;  3DD3 A;  1TTZ A;  2VCQ A;  1F6M C;  2L4Q A;  3WYW A;  1J08 A;  1EGR A;  2B3S A;  4FH8 A;  1V57 A;  3D4M A;  3MWH A;  3DKS A;  2TIR A;  2YPM A;  3HKR A;  2H1A A;  2VCZ A;  3TUE A;  4BWQ A;  4EDY A;  3GYK A;  3H79 A;  2XPD A;  5ELG A;  2JAD A;  4ML1 A;  1VF3 A;  1KEB A;  2FWE A;  2IFQ B;  3IV4 A;  2H0H A;  5IO0 A;  1JZW A;  4ZBD A;  1JLW A;  1HQO A;  2F8A A;  4FYC A;  1FOH A;  1DUG A;  5B7C A;  3GKN A;  3M0F A;  4YAV A;  3ZIJ A;  2B5Y A;  2QC7 A;  2GDR A;  4E8E A;  3D22 A;  3R2Q A;  2GVP A;  3GST A;  4GSN A;  3QFA C;  2PPT A;  4NV2 A;  2XPE A;  3EWL A;  4LLR A;  3H8Q A;  1TK5 B;  2NDO A;  4PQH A;  3TKS A;  5IMZ A;  3HDC A;  4TN8 A;  4AGS A;  1T00 A;  2B5E A;  4OMV A;  4MJC A;  4L5O A;  2C4J A;  1USB A;  2OAC A;  5HR2 A;  2RM5 A;  4KW6 A;  3S9F A;  3APQ A;  1ZZY A;  2VLT A;  1XWC A;  1VGL A;  1TP9 A;  4MCU A;  5IQY A;  1LU4 A;  5KN1 A;  4KCA A;  2H30 A;  2H6Z A;  4KSM A;  3N5O A;  2FD3 A;  4MPF A;  4ZBB A;  4GXZ A;  3P8W A;  5D93 A;  2JU5 A;  1XCC A;  4GF0 A;  2WRT A;  2WDU A;  1QXH A;  3MIX A;  3QAV A;  1UVZ A;  5IM9 A;  5D9T A;  5JWO B;  1XFL A;  3RHC A;  3ZIT A;  2X64 A;  2GSQ A;  3LWA A;  1K3Y A;  5AIV A;  2C80 A;  1SU9 A;  2A2S A;  5D9X A;  3UAP A;  2VL9 A;  3IRA A;  1TK8 B;  2DJ2 A;  4KND A;  2F9S A;  3EIN A;  2P5Q A;  5G30 A;  1ABA A;  2GT5 A;  2FY6 A;  3VWX A;  3EUR A;  2IFQ A;  5D73 A;  3MAK A;  4MF5 A;  2VCX A;  1FVJ A;  3UBL A;  2DMM A;  2QA1 A;  4LL4 B;  1G0T A;  4OFN A;  2VLU A;  22GS A;  5AIS A;  1Z6M A;  2KHP A;  4WXT A;  1TJD A;  3ZLP A;  2O7K A;  3GMF A;  2IME A;  1Q98 A;  6GSU A;  1SKW B;  3TRP A;  1OC9 B;  4I2U A;  3EC3 A;  4PQI A;  1GTB A;  5G1L A;  3LEF A;  3C1S A;  4IGJ A;  3NIV A;  5LNK e;  2C3N A;  2DKH A;  1FAA A;  1PKW A;  3ZML A;  4G2E A;  3BBY A;  2IMI A;  4IBP A;  2LKU A;  3GKX A;  2GGT A;  5FHI A;  2QKE A;  2P5R A;  4YAP A;  3FR3 A;  4G19 A;  5F0G A;  4PNG A;  3IOS A;  4HDE A;  2GS3 A;  1SJI A;  4GTU A;  3QDN A;  4JU5 A;  1TK0 B;  4ECC A;  3E3E A;  5G5F A;  3ZRE A;  4FYB A;  4I5Q A;  4CDO A;  2N5F A;  1Z7P A;  2H6Y A;  4EE0 A;  4ECB A;  4IQA A;  2L5O A;  1XBS A;  4F03 A;  3LFL A;  5CP1 A;  3CXG A;  5DAK B;  4TRX A;  5EL8 A;  1TXX A;  2XBI A;  3LGC A;  4I8B A;  2PBJ A;  2PUK C;  3CBU A;  4IS0 A;  2HRF A;  4K7I A;  2H1G A;  1PX6 A;  1F9M A;  2YWI A;  2F51 A;  1ZYN A;  1H75 A;  1SKS B;  2YP6 A;  1FW1 A;  2CZ3 A;  6GSV A;  4HQZ A;  3ED3 A;  1OKD A;  1A8Y A;  4ZB8 A;  1TDI A;  1SKR B;  4K6X A;  3VWU A;  4OWY A;  1YDK A;  1XWG A;  3QMX A;  1B9Y C;  2EIR A;  1JZR A;  3WD6 A;  2H6X A;  1X9W B;  2C3Q A;  4N0V A;  3GH6 A;  1OC9 A;  3VI7 A;  1YJ6 A;  4MA9 A;  1B9X C;  3CYN A;  4BA7 A;  1G7O A;  4POM A;  4XCS A;  18GS A;  2H1D A;  1X9S B;  2F8F A;  2K8S A;  2MMA A;  3H93 A;  3SBC A;  4ZXG A;  3LQ7 A;  2O87 A;  5G5E A;  4Z2T A;  2FWG A;  1M99 A;  2DJJ A;  4DVC A;  1UC7 A;  3UJ1 A;  2XHF A;  1T1V A;  3NZN A;  4IJ3 A;  2NVL A;  3D21 A;  3MDK A;  4MH3 A;  3CMI A;  4XS4 B;  2A2P A;  3WGE A;  2FA8 A;  3TCO A;  5HFK A;  4TR0 A;  2VIM A;  1CQH A;  2PN8 A;  1O7U A;  2A4H A;  5DCG A;  1X5C A;  3A5W A;  5DAK A;  3VLN A;  2LRN A;  2H75 A;  9GSS A;  1MDK A;  4DSQ A;  1TU7 A;  1OE7 A;  2YZU A;  5B8A A;  2LRC A;  1V2A A;  4WBJ A;  4KE3 A;  4EO3 A;  2FHE A;  4I97 A;  2H0I A;  2H0G A;  2WB9 A;  2YWO A;  1XOA A;  4K9Z A;  4NHW A;  1U87 A;  1GUH A;  3F8U A;  4ULX A;  1SD8 A;  3LW9 A;  4NXI A;  5E4W A;  1TU8 A;  2K18 A;  2EIQ A;  1ERU A;  1NSW A;  1GLQ A;  3F4T A;  3RAZ A;  4OCF A;  2OE1 A;  1R5A A;  4PXO A;  5IO2 A;  3C8E A;  4DEJ A;  5G2Z A;  16GS A;  3A3T A;  5CYY A;  5HFG A;  4OO4 A;  4LL1 B;  11GS A;  4KDU A;  1SL1 B;  1BX9 A;  1WWJ A;  1EEM A;  4EXJ A;  2GZZ A;  5F07 A;  3TKQ A;  1O73 A;  2WZ9 A;  4ISD A;  4X0X A;  1GH2 A;  3GTU B;  3DGQ A;  2HSY A;  3WT2 A;  4XS1 A;  2O8V B;  3BJ5 A;  3IAS 2;  3APO A;  5IMA A;  4MH2 A;  4NWY A;  2I4A A;  4KH7 A;  1K0D A;  4HOJ A;  1RK4 A;  1Y6E A;  3ISO A;  2DJK A;  4XS4 A;  5D96 A;  4OFM A;  4WBR D;  4FIW A;  4NHZ A;  3F9U A;  1U3I A;  2RM6 A;  3QFB C;  3WT1 A;  5G31 A;  4OCE A;  4MDC A;  4RI7 A;  4EIQ A;  5J9C A;  2I1U A;  3QPM A;  3TGZ A;  5INY A;  5CRW A;  2V1M A;  1M2D A;  3G7J A;  4IEL A;  4ZB9 A;  2CX4 A;  2KP2 A;  3CRT A;  2GST A;  2YWM A;  5ECO B;  4ML6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...