2H1LM

The structure of the oncoprotein sv40 large t antigen and p53 tumor suppressor complex
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
199
structure length
199
Chain Sequence
SPLSSSVPSQKTYQGSYGFRLGFLHSGTAKSVTCTYSPALNKMFCQLAKTCPVQLWVDSTPPPGTRVRAMAIYKQSQHMTEVVRRCPHHERCSDSDGLAPPQHLIRVEGNLRVEYLDDRNTFRHSVVVPYEPPEVGSDCTTIHYNYMCNSSCMGGMNRRPILTIITLEDSSGNLLGRNSFEVRVCACPGRDRRTEEENL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of SV40 large T-antigen bound to p53: interplay between a viral oncoprotein and a cellular tumor suppressor.
pubmed doi rcsb
source organism Simian virus 40
molecule tags Viral protein
molecule keywords Large T antigen
total genus 38
structure length 199
sequence length 199
chains with identical sequence N, O, P, Q, R, S, T, U, V, W, X
ec nomenclature
pdb deposition date 2006-05-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
M PF00870 P53 P53 DNA-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.720 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 2h1lM00
4IBQA 3D08A 4IBZA 5AOMA 3D0AA 1GZHA 3TS8A 4L0ZA 4AGLA 2BIQA 3WU1A 4XR8C 1GZHC 4MZIA 2OCJA 5G4OA 3QYNA 2WGXA 1T4WA 3WTYA 4AGNA 2XWRA 5KBDA 5AOKA 5G4NA 3IGKA 2J6WA 4L18A 3US0A 4IBUA 1IO4C 2ADYA 5ABAA 3WTVA 4IBVA 4IBSA 2GEQA 4IBTA 2BIPA 5AB9A 5ECGA 3Q01A 5G4MA 2X0WA 4AGMA 3KZ8A 3D09A 2IOOA 2IOMA 2J1WA 4IBWA 1YCSA 1CO1A 3EXJA 3VD2A 3D07A 4KVPA 2P52A 5AOJA 2MEJB 3WTSA 3WTXA 4G83A 5LAPA 4LOEA 4LOFA 3D05A 1HJBC 5AOIA 1HJCA 2J20A 3WTTA 3EXLA 4IJTA 2AC0A 2H1LM 1LJMA 4L0YA 3US1A 1EANA 4A63A 1E50A 3D06A 4QO1B 1KZYA 4GUQA 4GUOA 2AHIA 2XWCA 1H9DA 5BUAA 5LGYA 2BIOA 2RMNA 2X0VA 3IGLA 3VD0A 1HU8A 3QYMA 1TUPA 1UOLA 3ZMEA 2FEJA 2PCXA 4AGPA 4IBYA 4MZRA 3KMDA 2VUKA 5A7BA 4G82A 4AGQA 2X0UA 2BINA 2J1ZA 3WTWA 5AOLA 1TSRA 2YBGA 2J21A 4LO9A 2BIMA 1EAQA 2IOIA 4HJEA 2J1YA 3Q06A 2J1XA 1EAOA 3Q05A 2ATAA 3VD1A 3WTUA 1CMOA 4AGOA
chains in the Genus database with same CATH superfamily
3HG5A 3CC1A 1SQ2N 4CMMB 4S0HA 1CDCA 2EDOA 4OW6A 5EU6D 2H1PL 1AY1H 3TO2B 1KTJA 5EN3A 3LNEA 4GRLA 4G42A 3VI4B 2CGRH 1RIHH 4I48B 5ESQA 1HL5A 5AL8A 3W9EA 2K78A 4MJIA 1YEFH 1B4RA 4E0RB 1MHPL 1HHHB 1MCOH 5D1ZB 4AUYA 1I4FB 3MV9D 5IB2B 4DKFL 1HNFA 5DJ8B 3DJRA 3EJZD 4ODWB 2KPWA 5FO7A 4JFFE 4N8PA 2FE0A 3UC2A 3GIVA 2R23A 4JVWA 4F9PA 4JFTA 3CXFA 4FYRA 1XF3A 3MXWH 3PL6D 4HALA 5AW3B 3TBCA 2JK5A 2OMXB 3NQKA 2EP6A 1R3HB 2IG2H 3DNKA 2VXVL 1OXYA 1JXFA 2XQBL 3IDMB 1U2CA 2PN5A 4QTFA 3ABKB 2GW5A 2I32A 3IFOB 2C9XA 1DLHA 3LXAA 1N0LA 3LEXB 4Y2OB 1NUNB 1MXGA 3NFPB 1YEJH 5C09E 4BK4A 3ESPA 2L04A 3D39B 2AJXH 4U6YB 4WUKL 4BFOA 2CJUH 5FC9A 4UIMA 4MYPA 3SYCA 5DK0B 4M8QB 4ETQB 3SDXF 2X05A 3CUPB 4XMWA 5CMAA 1FNSL 1NIFA 2P26A 3F64A 4DAGL 1M1XA 2Y07H 1A7OH 1NOFA 4PLJD 3SJVB 3VWKA 5C3IA 4AT6A 1L9SA 1NAKH 1K8IB 2E9WA 1PLAA 2WCSA 2RIKA 4NX0A 3UTSD 4F5CA 2OA9A 4RMVA 1WA0X 1U6AL 1BQUA 2APFA 1F11B 2F53A 3I9PA 3DURA 3HFFA 4M7JL 4ICXA 3L3IB 4MSWB 1T5WB 5GGVL 4P5MA 5L2KB 5KS9B 2Y1VA 4JDEB 1V3KA 4HEMA 3HPLA 3M7OA 5J89A 4BHUI 1QLEH 2C3GA 2VZVA 3UJJL 4P23C 4MMZA 3U2JA 1PTZA 4UILH 2DQTH 3CFDA 3NIFB 4ZUSA 4JHWH 4JDZB 4PJHA 5JTWA 1J12A 4NP4L 3LMJH 3P73B 4DKEL 3QUMA 1RZPA 3AS3A 1WIPA 4NZ8A 1JZHA 1KJ3L 2OMUA 2PP8A 1RJYA 5FK9B 4LGPB 4JG0L 1RP8A 4HIPA 2ZJSH 4PTTA 4F27A 2ED9A 3U0WL 2OQJA 2XKSA 3G7TA 3HHRB 1BZ8A 1IQDA 1R1CA 2F5AH 3WUWB 1JZ8A 3MODH 1BFTA 1E2WA 4HEPA 3W0WA 4KHXH 1NCNA 5E4EC 4RGOH 1OOWA 4K3DH 3O3DB 5J12C 3KPQB 4JN2B 4G5ZH 2KZBA 3VXMA 4PRNB 3NEXA 2NY4C 5CWSB 1DZBA 2J55A 4G5AA 2Z8WC 2ZP0T 3GI9H 1KGCD 1VFBA 4GKZA 3WS6C 1JK9B 5K9QG 2BNRB 3QUML 1NCDH 4HZLB 2HVKA 5KN5B 2TRYA 1UJ3B 4TS6A 4V1DB 1RZKH 3MBXL 4HHAA 2XG4A 4JRYB 3GXIA 2WOBA 3ILQC 2WV3A 2NTFA 4LB8A 4MRBA 5KYYB 3B3IB 3BQVA 1ZT4B 3AQZA 2DWDB 4HHGA 4X9GA 5I2IB 4KZEH 1U2YA 3H2PA 4ZW8A 3B4NA 4HC1A 2YKKA 1E27B 2PF6A 3QZWB 4PJDB 1CFNB 3REWB 3IJ9A 4JAMA 5F97E 2A74C 3N85H 1RUML 1CG9B 1XF5A 3MRCA 2WYTA 2B2XH 3I02B 2JB5H 3PWPE 4OAWB 1FORL 4P3CL 2XNAB 3LRLA 2IWGA 3EH5B 1HJCA 1X5MA 4S1RL 5PCYA 3MHZA 4XWOC 2F15A 1MAMH 2HVBA 4PV9A 4BCZA 3DOHA 3KPSD 5KYWB 1YYCA 3FTXA 1CBVL 2NNFA 4R9HA 3EYVB 1J88A 1QACA 2FJGB 1FO0L 2XLLA 1Y18B 3MRGA 4TVPD 3IDUA 4ZMXA 4FA7B 4OFDA 1BWWA 3FQTA 4X6DA 3F7QA 1BM7A 3TESA 4RH4A 4JY5H 1IUZA 3JZYA 4HS6A 2APBA 4R26L 4AK1A 3Q1SH 4K7FB 1SN5A 5ICZA 2GSGB 3MRHA 4ZO8A 5INCB 3VFRA 5KYXA 3VWKB 5DZPA 1X5IA 1RZFH 3FCTA 5JHBA 3V9EA 4AVIA 1BAFH 1XL6A 3O2VL 4EF3A 3IMWA 4PBVC 1J5HA 4NUGL 4ELKA 2CA3A 3RWEA 4Y5YA 5AENA 5I0YA 3S97C 1YMHB 2YPVH 4M8VA 3U36A 5BMFL 1X6NA 3K80A 3IJYB 2OS7A 4MB1A 1KYFA 4E41A 3VI4F 4D3CL 1CDGA 5T33L 3QI9D 5KVEE 1DFBL 5C3LD 3JV4B 4PRIA 4WEBH 5AWNH 5I1DB 4F57L 3TH2T 5LXGL 3GIZH 3NBNA 1X6LA 2VR6A 1E0OB 1NCAL 3LN4A 3ESNA 5LNGA 5D7JC 1H3XA 4JPKL 3FO2A 2W5PA 2A9DA 2VLME 3NTCL 4O2EA 2YXVA 1K8DB 4M7ZB 2WB1A 3T4YA 5IHUH 1F4AA 4RISL 1MJ7H 1CI5A 3ME0B 1Y07A 1U95B 2GJJA 3F04A 3G5XB 3L5WB 1H19A 2EUXA 3VXRE 5HJ3B 1D3CA 1JOIA 3ZL4L 1B3IA 2DYPD 1NPNA 5IV2B 5GRJH 4FI7A 2BSBA 2HPTA 4BD4A 3PQYD 1IQWH 4P9HL 3CVHA 3SYAA 1I7UA 5HBBA 1DCLA 2AF2A 5GGRB 1G1CA 1TVDA 5I8EA 1Q0EA 4XCFH 2X3CA 5DUPH 5BVPL 1C5BL 2E9JA 2EE9A 4PJHE 1O5DT 3HNTL 2NX5B 3C6LB 1D2PA 1IC5H 2YMOA 4FYQA 4FQCL 4Z7OF 2I85A 3O6FC 1U3NA 3EYFA 1OE1A 2PPEA 5DHXB 3IAGC 4P46A 3TEYA 4MNGE 4Q9RH 2ATPA 2D31B 3OXRB 1YEKL 5AVQB 1CD0A 2HVKB 5KN5A 1RXLA 1JYXA 2NXZC 4M93B 3BSZA 3WFDH 2YAHA 3EGSB 1E50A 5IOKA 1AO7B 4JHBA 3VQMA 5LG6A 3LIUA 4NRYB 1BZQK 1FYHB 1NL0H 3EO9L 3CZFA 2V7HB 7CGTA 4LIQE 5DD1L 2Z9TA 3ETBF 3T2NH 5D72H 5IREA 4IKNA 3BO8A 5CNHA 4LPXA 3VVWA 1CFTB 2UV3A 3W81A 5LXVA 2IC2A 4NJAH 3U2IA 3SGKC 2ICWA 4LHQB 3VVVA 1QNZH 3PQYE 3QS3A 5IHBA 4C47A 4MMXC 1E4HA 3H53A 5IB1A 1JXKA 3KL3A 1N5YH 3MQIA 3PWVB 1ZK5A 5EMYA 4ZPVB 1J5OL 4L23A 4XP5H 2FT7A 3X1NA 1YPZF 5GS0D 3CZLA 5JIMA 3F12B 3O0LA 1UCTA 2BP3A 4YSOA 5AVYB 3RE0A 4B3VA 1PZ5B 1K72A 3N44F 3KWUA 4JG1H 1AGEA 5H4YA 3BH9B 1MLBA 4AYSA 4ODXB 5H37H 3LKSB 5H2BA 1N12A 4G9FD 4R97C 5I9QC 1NUFA 1T6WA 2EUWA 4D8OA 1CGWA 4NXKA 3VGAC 3VXPB 4IRZA 3NRFA 3D0LB 4HAGA 2AXHA 3EOBB 2AGJH 2CDFB 2VJ8A 3LNDA 4JGNA 4LSRH 4DGYH 4QHLA 1FDLL 3ERXA 1N2RA 3EYSH 2IGTA 5E2TH 5KUKA 3EZJB 2ESVA 1S7VA 2VJXA 4IBUA 2JXMA 2FB4H 5JO5A 5H4ZA 1RIVH 1CD9B 2Z92B 4LHJB 6FABL 5J1TC 2EYRA 3RUGE 1DEEA 3EJQA 4G3YH 4KDTA 4K23L 5IMMA 4NQCD 4FQ1H 2PMZA 5DQ9B 4QRFA 3H42H 2BWQA 1M4KA 3RWIB 2KC0A 2OJZH 4HC1L 1U8JB 3DIDA 1E5UI 1JGLH 1TZGL 3BQUD 3BWAA 3CFEB 3M17A 1S7WB 4QCIA 4AQEA 2AJ3B 1KYOK 3QJZA 4MD5B 1XIWC 3MODL 5C7XH 3EH3B 2YN3A 4HOMA 1XDTT 1KY7A 5IB4B 5IEHB 1FIGH 4YIQB 4K5NA 4ZFOL 15C8L 3JWOC 2DLHA 2HKFL 1LMKA 2CO4A 3HZYB 1GKEA 2OSYA 4HG4J 4I7ZC 3KG5A 4L2YA 4BK8A 1KEML 1XCWA 3EW3B 3MPCA 4PJCB 4QOKD 4GRMB 2K6ZA 3PWUB 4ALAL 3AREC 1I3UA 1MHHB 2AJZA 3D39A 4LASL 4LCWA 2DS4A 4ZS7L 4F7MB 1CS6A 2SEBB 3Q9PA 3RVTC 1HAWA 1EZLA 1ZLDA 1GZPB 1YY8B 4W9ZA 1SJEB 4KWUA 4X7EC 3R4DA 5IKCB 1VFUA 2OMBA 4ZMAT 3RDTA 3NCJH 3TYFA 2YRLA 1XIWB 1Y18A 1TZIB 2FUTA 4EAEA 1K6QH 3N0PB 5F96L 3UYPA 5CCJA 5DS8A 2NNRA 5B3SB 3UO8B 5C0DA 3UBGA 3PHOA 1C08A 4NKIL 4UT9A 4UDUB 3SGJC 4N86A 3QJOA 1HHJA 1NDGA 1IBBA 1YN6A 4FMFA 4UT6L 3HI6L 4F8TA 3MC0A 4KBPA 1OARL 4KROB 1NAKL 1XR8A 2QGBA 1MHEB 1FYTB 3KPRE 1HDMA 1J5CA 1L0YA 3CHQA 1JWUA 1T1WB 1JGDA 4JPVH 1QOKA 4L8DB 5CZRA 2WBWB 1DQDH 3WSQH 1TCRB 1KC5H 2Q0ZX 5CJQL 3TO2A 2WXKA 5F9OH 4NM8L 1J11A 2BVOB 3NDZE 2AJYH 5DO2D 3V0VA 4KMTH 3BH9A 3MFGB 1JYWA 1JZ5A 5JXAH 5GGSY 2ZXEB 2XWXA 1HN1A 1C16B 2R56H 4JPIA 2V17H 3F12A 1CFMA 1U8MA 3DV6A 3F6IA 3BQUB 5I0DA 2UWEA 3BYYA 3NK4A 3GLEA 4EEEA 4NQSA 2XBDA 2FBRA 4PJFA 2F58H 2IPUK 4Z95H 2WSDA 5F1KC 4P0DA 2YEZA 4RDBA 4LCUB 4JM2A 1DQTA 3TZVB 2AP2A 4I3RH 3FTGB 4LPVA 4XC3H 4ZX4A 3F7RA 1U8LA 2EDFA 1M6UA 2VERN 2CA4A 2G5RA 3HUJA 4FHKA 4ZOCA 3TBTB 1MH5A 2OMYB 2E6PA 4IOFD 1CK0H 2UXGA 3WDHA 1G7PA 1T1ZB 1O7SA 5ESVB 4Z7VE 3QCVL 1CD1A 5D7IF 4WNQB 1RZ8A 1UT9A 1UWFA 1CI3M 2IDSA 1VB9A 2FTAA 3JV6A 1U8CA 1VA9A 2O5ZL 3ES6A 3DIFA 3V5KB 4APQC 4QHUB 2AEQL 2RCSL 3BKJL 3PP3H 3LAFA 3BMWA 1G9EA 1FPTH 3ZKSD 3N2JA 5ITBL 4G8IA 5C0EB 4P4KC 1DBMH 1KZYA 1KBPA 1BQLH 3QRFM 3OQRA 5ALBH 3VA2C 1RHHB 3WXVH 1HCZA 5K9KA 7PAZA 4D9RD 3SZ6A 1PZCA 3OV6A 3TT3H 5MENB 4P5TB 1EHKB 5E2UL 4OM0H 4JO2H 4GH7B 1G9NH 1QPKA 2QVMA 3TZVD 3T77B 5KWYC 3ZY7A 1H9VA 1YVLA 5EBMA 3ARGC 1ZTXE 5AUMB 3I6LE 5EF2A 4GMTH 5T3XD 1H3UA 2EDTA 2MIZA 3TBWA 2CQVA 1AOHA 1WAEA 3AC0A 3AM8A 4MZRA 4L9LA 4ZMOA 4APQB 3BGMB 4UTAL 3O4OC 5E99H 4C4KO 2Q9OA 5IM7B 4OZHF 5FA3B 4YPJA 3US1A 3OAZH 1A9EB 4PJFF 3G04B 4JDVB 5HHMB 3Q2WA 2YMTA 3FT2A 4QF1A 3RIFK 1RL1A 3VFPA 3D4CA 2HLAA 2J5WA 2J1YA 2LU7A 4W9HC 1IT9L 3EGXA 2BJML 2W59A 4Q6YA 3EBHA 2LTQC 1GJWA 3MGTA 1U92A 5TFSL 5KVFH 1DO6A 2ORBL 2Y7OA 2XXCB 2DEXX 3VXSD 5TGBA 2OLDA 4AGOA 2VDNL 2XVBA 4AIEA 1BBJA 1KJ2B 3HMXL 3IKKA 3S2AA 2GTWB 3T2NL 1KTRL 5FLVA 5KVMC 5JHMA 5D71L 3UAAA 1VGKA 5IOPA 1JK8A 3OLEA 1YAZA 2R0ZH 3O2VH 3QUKB 4YBQC 5FS5A 4E9QA 5I1GL 1XCTA 1IAKB 2NY5C 2MKLC 1A7RL 4PLKC 1YEFL 2E9IA 2OCFD 3GZQA 5L7XH 3HKFA 4NYLA 4B9ZA 1PKQE 3OGCB 4JPWL 4W9IC 1AD0B 5HXMA 1TU2B 2OSXA 1JTPA 4D3CH 3LQAH 2ZXAA 3KLHD 4ADGA 4LAJH 3HAEG 5IGXH 3U4EB 1XB6A 3B56A 4P9ML 4WDIA 2BXZA 3VD5A 4I87A 4PREA 1EJOH 2MCAA 2BPBA 1UB6B 4PYGA 3DX6A 2B59A 4U6VH 2ZXDA 1A8ZA 2ADFH 3F8UB 4JM2B 3VYOA 4TNVF 4UAHA 3LV3B 4ELMB 5LHDA 4ZYKA 1CURA 4IJ3C 5I16B 1CYWA 5AOJA 2MH4A 4IGBD 4EZJA 1MJ7L 4X7TB 3QHFL 2BIIA 2OP4H 2BZDA 3BWAB 3CFEA 2Y1ZA 3M17B 3UJIL 4AQEB 3O2DA 4H25A 1ITCA 1OTUD 2BZ7A 1KTLB 2CDEA 3J7HA 4LOEA 4N22A 2UZXA 3MBWA 2HB0A 4OLEA 2UY7B 5GRJL 2FHBA 1ZGLP 4AE1A 1U8KA 3T0WA 1NANI 3MUUA 3K6SB 5BV7C 4E41D 1WK0A 2GG1A 4E5XB 4Y19A 2MTPA 4GRWH 1TVBA 4EJ1C 3CX5K 3QNXA 3KJ4B 4IHBA 4Z7UE 4XPAH 5DI8B 1CG9A 4HS8L 4FCHA 1MCNA 1EUTA 1S7UB 5F89B 1N2RB 3F58L 4WVRA 1CQYA 1YQVL 1P1ZA 1ZA3B 4PJGB 1FWXA 3IDJA 5DC9B 2CDFA 4RBPH 2DWDA 1DBJH 3FHEA 4L1DA 2HG5A 1TUPA 1ED3B 4OH2A 3H2QA 5B1BB 1SMOA 5LWYH 3Q6FB 2ED6A 1RV6X 4GAJL 2XCMC 1PCSA 4JS7A 1RURH 2VQ1A 2Y25A 5A7BA 2O26U 4K7PH 3C5ZC 1XSKA 1JWSA 4H8WL 2BVPA 1TSRA 4HKXB 5C0ND 2JI1A 1PG7H 1ETZA 5JNYB 4WW1B 3P9LB 4I77L 4XWGL 1MEXL 3ARDC 2YD7A 2I5YH 3WY1A 1HQ4A 4OCSL 3ZTDC 4JFXA 5J3HD 3CZNA 3QO0B 4JY6A 1NC4B 4IKJA 4LL9A 4X5PA 4UTBH 4CGTA 3MLXH 1CL7I 2BH0A 3V0FA 4GAFB 4JM2F 1Q72H 4JDTH 4NZFA 3HE6D 3VJ6B 1NAMB 5IHZA 1KBGL 1NM9A 3Q9QA 4Y9BA 5BOZG 3A67L 3HR5A 1XMEB 3QJHA 1NIAA 3L45A 4I13B 2XFXB 1H15A 1U3HD 4P46C 4B9PA 4DP4X 3HG1D 3H7LA 2C9UA 4LCCC 1GH7A 3BPOB 4TULH 1RZKL 3K81A 3MBXH 2UWEB 2KERA 1M57B 4Z76B 2XI9A 1FNGB 3T08A 4J12A 3VRLE 1CUOA 5HHVL 2D3NA 4JHAH 4YXKH 1GS7A 4N8VA 3UTOA 4E5XA 5I1KH 1NGXB 4H26B 3TIDB 5D1XD 5AVSB 4TTGA 3NFSH 3RWCB 3NESA 3LVTA 5FYKE 4E42A 1R34A 4MZ3A 5JPNC 4D0CB 2X4OA 1OQXA 3D85A 5DD3L 2J2ZB 3W0WD 3T0EB 4DW2L 1AKJD 4DTGL 2J1KA 2OM5A 4UZGA 4CSSA 5HPMA 2JCCF 2CNZA 4OCYL 4PRIE 3RZWA 4BIKA 3GSOB 3NIGE 1XEDA 2CWRA 1J9QA 3GSNA 3L5XH 3NOIA 2AK1H 2B9AA 2C9QA 4MLIA 2X6UA 5FM8A 4PRHE 1HHJB 1NDGB 3CHXA 1BX2B 3KYNB 5B8CA 2VDQB 4CL7A 3RWDB 4OV6F 1UT2A 1MAML 3QPQD 4QO1B 4DKAA 3F6LA 4IS6A 2ZJSL 1GPOL 1MREH 1QD0A 3PP4L 3FN9A 4GG6B 1ZV5A 1Q9OB 4MHHI 5F71A 5EF3A 2BWDA 1Q94A 2F5AL 3COOA 5A7EA 4FXGB 2YAQA 2XWEA 5AD0A 1YG9A 4HIIB 2XX0A 4UQ9A 5DRNA 3OJVC 3V4PL 2R29A 2VE6B 4YAQB 4GQ9H 4DP8X 3UGXA 2EINB 4L48A 2F7OA 1P69B 1OQOA 4PGBA 2YMXH 4PJ5B 5JOPE 2O1AA 3ELQA 4ZAKA 2ESVD 3DJZA 5EOTB 5EU7C 1BJ1H 2YPVA 4NNXA 2W94A 3ZPDA 2VUKA 1W6LA 3C9NA 3IBEA 1XZ0A 3VXSA 1N59A 1ECZA 1KIPB 3PG2A 5I1AA 5JXEC 1KLGA 3PIQA 5FGBC 25C8L 4ABQA 1NJ9A 3FT2B 2Z31B 2LFGA 3EFOA 3ARYA 3QFGA 4I0CC 2YEVB 4IJ3B 5D1XC 4ANXA 5F89A 3IU4L 3GSXA 1JWMA 4AY0A 5FXCH 1WRFA 1PSKL 1NEZB 4BZ1H 4U6XA 1OAXH 1BEXA 1ZD6A 2W0PA 1QYGL 3OPZL 3MRFB 1U58B 4D94A 3HS9A 5DQDL 5EWIH 4MQXC 4M02A 3PWPB 3OAWA 3KWWA 5EEYA 4TNGA 4G7SB 3AMKA 1W6WA 2LT9A 4AGNA 2A6JA 4ERSL 4XXWC 3QIBC 3FN0H 2W9LA 5EUKB 1UWEL 5FB8B 5KBDA 1SDYA 3D8MA 3JWNC 1KB5A 4AKPA 4EPSA 2DM2A 5FOBB 1TEFA 3SDXA 4ABVA 1L9PA 5C08D 5IFJA 1ZHLA 5C0BB 3EJYC 5K9KB 3I2CL 1KCRH 4IBLT 3QJHB 3MXWL 1OAUH 4ABWA 2F7RA 5GXBB 1KC5L 4LSQH 4JDEA 3T3PE 1UACL 2FL5B 3CIAA 3PQYA 3RDJA 2BCKB 5K9JH 4KX9A 3CNKA 1BF5A 4CU7A 2GYSA 3HNSH 3FJTA 4OF0A 2K3TA 4KI5C 3H9SD 1KXTA 3V6ZB 1DJSA 2WN2A 3T8XB 4Q6IA 3UBXI 3BGFC 3PAYA 3RX8A 3RFZB 1NA8A 4NFDA 4XAKD 5DVLA 1A4JB 2BMKB 4EOWH 1XH1A 5EBGA 1YEGH 1A7NH 1QKZL 1TJHH 2E5EA 5D7LE 2A9NH 1D5BA 2XWJA 3C9NB 3SD5A 3IK2A 3AITA 2HFGL 3WFDL 2CLVB 1E2VA 5SWQA 5IB3A 4GYBA 3HVDA 2Y22A 5LBVA 1S78C 1J1XH 1Z9LA 1XBDA 1SLUA 2AKRA 4PGDA 1BMGA 4N0FB 1WIOA 4NAQA 4L1HA 4MX7A 4PJAB 2A99A 1PZ3A 2Y07L 2BOLA 2FECL 3QQ3B 4FXKC 3VFSB 2E4TA 1OAKH 3B43A 3R1GL 1I8UA 4M93C 3SBPA 3W5MA 1R5VA 2HTKD 3PXHA 3RUGA 1FFOB 3BIKA 1NSNL 4ODUB 1J18A 4L37A 4IS6B 4NNPH 1OTUC 3BT2L 4BV1A 1QFWM 5DC2A 3SOTA 4LLMB 4CUCA 5JIHA 5EU5A 2B7DT 3VQ2C 5FFLA 3VGHA 5BS0A 3MA7A 1JV5A 5ECJE 2ATKA 3QVAA 1BVKA 3N43F 2Y5QA 5DQJA 1KJ2H 4DCQB 1N5YL 3KPSE 5HYFA 1R5WA 1XTMA 3QPXH 3IAPA 5EZIH 2DTMH 5D5MF 3P02A 2DQFA 4XX5A 1Q1JL 4P5TA 2PPCA 1ZXQA 4GG6E 3LDBC 2XTJE 5K59E 4OV5B 3LV3A 5CU5A 1U8OA 4MAZA 1F4WL 3RIFF 5FGCB 4NZTL 3QI9A 5GHWL 3QXTA 4P2QB 2OR7A 4LMQE 1GR7A 4DVBB 1HIMH 3FYIB 4FXKB 5IFAH 1P2CA 2X70B 4JFOB 1MQ8A 4AGLA 2UYLA 3ALXA 3B37A 5DMKB 3JTTB 3S0PA 1HESA 1ZT1B 2DM7A 3OX8B 5GS3A 2OJ1A 1JI2A 2CM5A 2PTVA 2WO3B 3OKKA 4QY8A 1FDLH 3EYSL 5E2TL 4AJYV 5EV7A 4U31A 1CDUA 2ZUVA 1LO3L 3EG9B 3X14A 1I8MA 4TLTA 1WAAF 1RULL 3WE1A 4HJ0C 3VGEA 1Z3RA 3ZR5A 2YN5A 2GJRA 4IBTA 3NP4A 4UYPA 5EBLB 1S7QB 4R4FH 3C2SA 2D73A 5FUOH 2GJ6A 3H4FA 1FV1A 3FFDA 2CU9A 3UTSE 5J8OA 4OCSH 3HFML 2HJKB 5DYOA 1ACXA 1BBJB 3DC0A 4FNLL 1M7DB 2PXYB 4G7VH 4HWNA 1AI1H 1KFGA 3NA9H 3WIIH 3ZJAA 5K39B 4YHOH 2ZCKL 4BUQA 2WXQA 1RLWA 4HJJL 5I30H 3LEXA 4PB0H 1JBJA 4KZDH 5B7EA 3FDWA 2VXSL 2X1XR 4A7SA 3HKZA 1Q72L 5EZLA 4RIRA 3MLYL 3LXBA 1TYRA 3S37X 3KS0H 3T0EE 1E4KC 3JWNE 3D05A 1C16A 2RGSA 5DDHB 3HE7A 3LQAL 2BC4A 1A1MB 2NUTB 4LLUB 4Z7UB 2K9FB 3LN5B 3MRDB 2VABA 4P9MH 2NXYC 1DYZA 1NFDF 1VCBC 2ZKYA 3LVEA 1IL1A 2A5UA 4OD2A 4PS8A 1XL4A 4PJBF 5FA4B 4RMQA 4EI5C 3NSDA 3AGWA 5L2JB 2XZCH 3G6AB 3Q3GA 5A16B 3AT0A 3VH8A 3BISA 3T8XA 5H94A 3B2VL 1TZ8A 1T0PB 4I0PB 4CVUA 3H3PH 4ZMVA 4MYWB 3ARFA 2F8VA 4XXWA 2AV1A 4RZCB 5CZVL 2FQEA 4DK5A 2L0DA 4FHBD 2W07A 5CGTA 1HU8A 1E9QA 5LB1A 3W2DH 4Y9FA 5BXFB 2LLGA 3HHSA 4QRPD 5E03A 1FH5H 3B2UC 4H7VA 2KT6A 5K1VA 3B2DC 5DURD 2DBLL 3PWJA 2V9RA 3KYMA 4ODVH 4CMMA 1Q38A 1SN0A 4QRUA 4RMSA 3NFNA 3WY3A 2UXVA 5T5FA 3EFFA 4HAKA 4X4ME 4YHPA 4ZW6A 3K6SA 1NC2A 3TVMA 4ATTA 1EVUA 5DJYA 4U1IB 2YUZA 5BMFH 3QPQC 3VXNB 3G6JA 4IOFC 4JFPA 3V2AR 2C1PA 4DPRA 1WQVT 4I0PA 4X6CF 2CR0A 3DXAA 4I8DA 3MX0A 5F1IB 3U48A 1N3NB 3WN5C 5JW3H 3WGUB 3DARA 3X3GL 4F7CA 2XG4B 4ES9A 1BXXA 2AJZB 3ABMB 1DDTA 3RTQC 4QTIL 2XPGA 3CVCA 3STZA 4WRLA 3QUYB 1OM3L 3BKCL 5EORH 4WU7A 1BQSA 1FGNL 3CFQA 4DEPB 1YZZA 4NPYB 1KLUB 3PYCA 3ULUD 1MFNA 3ARSA 4M6AA 5DHMC 2WTRA 4XXDB 3UO1H 1KCLA 3CDZB 3A4DA 3MV8A 4I77H 4PJGE 4XWGH 5I8CB 3US0A 1OT4A 4J8RB 3S35H 3BVDB 2Q1EA 3Q8FA 4P57A 1EMTL 1OAZH 4IGBB 1BD2A 3FQNA 4HJTA 2CKBL 3HB3C 1CU4H 2P7TA 1KFAL 4M5ZL 1JXDA 4ZAKB 3KWXA 4MLSA 4NC1C 1MIMH 2IXQA 1TKWA 4YXLH 3F6JA 1BZOA 1UWXK 4OKDA 1BG1A 1OTSC 2NZIA 5L4MA 1PKQB 5F96H 3RY5A 4E2OA 3HVNA 4A68A 5CP7A 4S2SB 4DSYA 4Y4FD 3FOMB 3T04D 4E41E 3D0VB 4X7CC 1I4FA 2HLFD 5EOQL 4MNQE 2DMGA 4FULA 4TRPL 2F1BA 5E2WH 5ISZA 3SBWC 2R1XB 3BP4A 1CFVL 2BNQA 4PV9B 3RBGA 2XZQL 3L4CA 1GC1C 1RIUL 2OR9L 4P23A 1BVZA 1BQHA 4OF5A 3SGEH 2WLLA 4BE5A 1ZTXH 4JRXB 1VZHA 3RVTD 4HMDA 5EC1A 5AUMA 2GIXA 2IFGA 1BQRA 1XIWA 2NY7H 3QFJD 3S3DB 1R47A 2I9LA 4LLWA 12E8L 3CTTA 2AQ2A 3DVIA 5E1IA 3T0VA 4X4YB 2CRYA 1EVTC 4UTAH 2Z4TA 3FU5A 2A74A 3CLEL 1JUFB 2YARA 1YSOA 5AB2A 2UUDH 4FTVA 2DMHA 3TIDA 2BNRA 4KROD 4KHTH 2P7TB 1VEOA 2OTPA 3L7EA 4L37B 5CLTA 1KDJA 5LCVH 3G08A 1H3GA 2BINA 2NZ9C 4UNUA 1G7HA 4C56A 4ANKA 1CGXA 3V4LA 3OC5A 3SKNA 4X5WB 4LRNH 4Z6AT 1DJIA 1LILA 3EAKA 2DQCH 3QDGD 3U6XS 4NKDA 2EVGA 5CHNB 2WZAA 2YOCA 4FFYL 1DVSA 1OEZW 4Z3HA 3DROA 1RCYA 3QQ4A 1FG2A 3Q8BA 4JRFA 4Y4HB 3EJPA 1YEGL 4FQHB 4LT7A 3AGVA 3H9HA 4IGBC 4LSTH 1BCIA 2KQMA 5F7FA 4Q58C 4ABUA 4HGWA 5T3ZL 2CCLA 2DLFL 4HFUL 2ZG3A 1F2QA 3HR6A 5C0IA 4I85A 3EOYG 3OZKA 3VSUA 4EDWH 5EBWA 2QTEA 3ROLB 3ZE0F 4NBZB 4X6DB 1U8PA 2QZQA 3H55A 4XMUA 5BO1H 3G6JB 4JFPB 3LTVA 1B4JL 1K4DA 3C6LA 4GPVA 1FNSH 4BSVA 3ARQA 3SDCC 5JW4N 3PV7A 1PZAA 4HG4K 1UCBH 4O58L 2DQGL 2BWIA 5HHPB 1NLDL 2J4WL 3STLA 3TV8A 2FAUA 4XPFH 2H8PA 3V79C 1Z5LA 3C6SA 4ZUWA 4PLKD 2B0SL 3V7AG 1IKFH 3ZQXA 3I3BA 2Q7AA 2EJ1A 1OANA 1U3HA 5C0NC 1I9IL 2XWTA 3ECWA 3C5ZD 1JGLL 1NKOA 1P53A 2DKUA 3VFOA 1F6FB 1TO5A 2ZX9A 5IW3A 3MRNA 1MFAH 3IJHB 3MR9A 3KVDD 3QCTL 1P7HL 1UXSA 1MHEA 4G8AC 2QQLH 3QUXD 3H42L 1M2VB 1QLEL 4PRDB 4NKMA 4NBYB 2G60H 5EUKA 2JTYA 3NG5A 1UH3A 1NFIA 5ICUA 1QSZA 2EICA 3WTTA 5MP6L 3QJFA 3CZUB 4P59H 4UDUA 4PCYA 3EHBB 3MRDA 1VFBB 4GKZB 4JUSA 4MB5A 4U6YA 1KGWA 3L1FA 3TWCL 1EEUA 3A6BL 2IALA 3B5GA 1N67A 1INDL 2A77L 2PTTA 3AXHA 3GSNL 4NO3A 1WZLA 4R7DA 2O5YH 1E43A 2AQPA 5D7IA 5IHLB 1PVHA 2R2BA 1XXFC 3P4MA 1AR1C 1KIUA 3SO3C 3W37A 4WFHD 5GZNA 3M07A 1EEZA 1BD2E 1N59B 5K69A 4D8PB 4HT1L 2EDQA 1JHKH 3RGHA 4B27A 4NRZA 5JW4M 3BIAX 5C9JA 1XSOA 4DQAA 2VLRE 3GMRB 2KMWA 2AXGB 2MOGA 5CILH 1I8LC 3DPDA 3FN3A 4PJ5A 1XH0A 3QXUA 3FCTB 4HH9B 1TZHA 4JRXD 4NRXA 3AY2A 2H32A 2C8NA 4BFRA 4LSPH 1E9OB 1R3IL 1QZNA 4PB0L 1IBGH 4KKRA 3LKRB 2DH2A 1AANA 2OI9C 4C56B 1XF2B 2ADFL 4O00A 1VGKB 5C9KA 3PUUA 2H26B 1DJWA 2OX5A 4XPGH 4ODHL 5G5DB 2X4RB 3QIWA 5E6YA 3KCPB 4ATWA 4XCEA 3CBJB 5I0XA 3ULVF 4NGHL 2DPKA 2GSMB 3C09C 4H2CA 3RL2B 3X11B 2HTLD 2BIQA 3D2UD 1NGQH 1TZAA 1V27A 4HGKC 4XCNA 2CBQA 5C0CA 4N8UA 4U3SB 2BNUB 3NUKA 2M83A 2YPLE 3BWSA 4PGCB 3UTQA 5MEOA 3O6FA 5KYUA 5G4NA 4F5CE 5GRVK 4B5ZA 1NBZA 2QKIA 1IRAY 2IEPA 2VM9A 2JJTC 3FCSA 4MBOA 3GRWH 1MJUH 5AYUH 3B8SA 5FO8B 2WUCH 2VLMD 3C5XA 5HHVH 1S7SA 1L7TH 2DLGA 1I1AB 2ZSVB 4WKZB 3HC3H 3K72B 1A7PH 5AB9A 1KZQA 2W81C 3K1DA 5CZKA 5K33A 1HHIA 1G7JA 2X1PA 5E6RB 4G9DA 3TP4A 3FQNB 5HHPA 1PYWB 3IBOA 3MRQA 4EXKA 1B2WH 1RZFL 3NJVA 1XXDC 2J8OA 3MUGB 2JJSA 4E41B 3KLKA 2QFRA 2KLSA 2IAMD 1E9OA 3SPGA 2AQSA 5D4IA 4EVNB 2YGQA 3G6DL 3JTBA 1T89A 2K0RA 2XRAL 4J4PD 3CJJA 3KPQA 3VNZA 5JYLA 3D18A 2VR9A 3CH1B 4NUGH 4ZS7H 4GQRA 5KVDL 3ZE1F 4AG4H 3BPCA 1AR1B 2NY0B 2VDMH 4X6BB 4PVBA 3QIUA 1MFMA 1J8HB 3OMAB 2AXGA 3US9A 1KGXA 2VQ1B 3DHPA 1BOGA 2IF7A 2I5YL 3BI9X 4NCC1 1X4XA 1UGKA 3ULUH 2DJUA 1U8CB 2R1WB 2RALA 3AADB 3HFMH 5DEZA 1M71B 4X99B 1JZ7A 3B7TA 2G30A 2BCMA 4PBWD 5EPMA 4OUUA 1RZ8B 4UTBL 2I60L 3U46B 1L3NA 2D9CA 4WO4B 1G9NL 1T7WA 1FBIH 1OPGH 3CDZA 4LARL 2RMNA 4MDIB 4XAWL 5AVZB 1HZLA 3CN0A 1NQBA 3BW9B 4DN3L 2NY1C 2Q8AH 1ETZB 1NLBH 1AQDA 3NCFB 2ENYA 3LJ3A 1PEWA 5IHUL 4NQDD 5B4MC 4L4VA 3DIVA 4RAUA 2QSCH 5CO1A 1T5XB 3MRBA 5IW1A 1BVNT 4LSSH 1GOHA 3GRGA 4AW7A 2XZCL 3BP6B 1UD2A 1H5BA 3MBEC 3O81A 4LKXB 1JZGA 2OL3A 5IVZB 3K6FA 2CUIA 2EEBA 2BJMH 5B7MA 1PY0A 2BS9A 3S36X 4J3UA 3REWA 4P2OA 5TFSH 5DJYB 4MDRA 5H94B 3J07A 2ZPKL 5IK3B 3PWPA 2W9EL 3I6KA 1YEKH 2C3VA 5EB9A 3MAWA 4S1QL 3RURA 1GKOA 1UKTA 5JIKA 2NT1A 4L4VB 3WFBH 1IL1B 4Y19B 1NCWL 3HI1A 1A14L 4WTXA 8PAZA 4ZZFA 4Z95L 4EN3C 5CAYB 4X4KA 4DFIA 3T3PF 2WXRA 3UXFA 4J7RA 1BSIA 2X1QA 5CUSL 4HW6A 3U46A 4F7KA 4KRPC 1GCFA 4LCIL 2ITFA 3QXWA 2ZUSA 4JQVC 1JD9A 3MOAH 2ITCB 3LZPA 1DLHB 4J1UB 3KXFD 1LO4H 2VITB 1J9RA 3MJWA 4GXFA 3AWEA 5EBWB 3RLSA 3O3DA 2Y06H 4YHYC 3C5SA 1EJOL 4U7KA 1SJMA 4UF7C 5DS8B 5GSVB 3S5LB 3ATAA 3V4PB 3C75A 4JPWH 3V9CA 1NAML 1WT5A 4KJYB 3FSAA 4M1CC 2HMID 2D3JA 2V4LA 1F3JB 1LWJA 1K5WA 1YCSA 3FSVA 2J5LC 3RHWF 2RTTA 3V6OC 5SX5H 5KVEH 1C1EL 2COVD 4LBEB 3VD2A 3UTTA 5E6IB 2AEQH 4K0OA 4P23D 1GZPA 1YY8A 4FG4A 5I24A 4WU5B 3QC5X 3IJYA 5AVRB 1Q9OA 3ZT6A 4ZI8A 4E0RA 2MQCA 2HJKA 4BQCA 3QEGL 1CGSH 1HL9A 3VXTB 2LVCA 5I76B 2XDHA 3WJJA 1UTDA 1HK6A 1J05A 4EDXB 1ZPUA 3A6CH 3SE8L 3DVNB 3FRUA 1WG3A 3LB6C 5FV1L 1QSFA 1OHZA 5L2KA 1VCAA 2V7NA 3BAXA 2JKTM 3L54A 1Q90A 1S8DA 3UPRB 1OK0A 3CXDL 1FC1A 2UX6A 1MAKA 1Z0NA 3WNNA 4FQCH 3KEHA 4XNUL 2ICES 3VFPB 5IBTH 3O9WD 1FZKB 5KEZA 1FFNA 1NC2D 1JPST 1JV5B 4FJZA 1NPJA 2K4AA 1CVRA 5HYJE 5EZIL 4Q9BA 5IMMB 3CN3A 5L8KB 4QRTA 2ZG2A 4L9LB 5HGBB 2B0SH 5I28A 4DFHA 1IAOA 4YXHL 2Y7SA 4JFDE 1UKQA 4XVSL 1E9QB 1NCBL 4NQVA 5E5LA 4KTYA 4V2BA 3SOBL 1EFQA 2E7MA 2IADA 4OJDH 3UP1A 1MF2H 3DDGA 3QULA 4WO4A 5EO1B 4BUHA 3K8LA 1G7PB 1KXVA 5KOVC 5GGTH 4ZMNA 1X5LA 2HUEA 1CLYH 3WTUA 4JNXA 5GGUB 3NCYS 2E7HA 1YEIH 2RR3A 4PCSA 2CK2A 3FH7A 5GRUL 3TN0D 2GUYA 2GABA 4QRAA 5C0EA 5MI0B 1XCXA 3U9WA 2WQSA 5CFAA 3BT0A 3OBAA 4TLKA 4Z5RB 1GYAA 4DGUA 2E27L 2PCYA 3A6BH 2DQDL 2EDJA 5DCCA 1A9VA 3GZPA 2ZNWA 4YL9A 4QHKJ 3UTZA 1JRHL 4N25A 2HT4D 5JHDD 1WWAX 1M6OB 1CD1B 1AMXA 1MCSA 4Y1TA 4LNVA 2PCFB 4PH8A 2WNKA 5IROD 5E56A 2X87A 4DPCX 3BRGC 3VDCA 3NAAH 1NM4A 1F6AA 3H9SB 3WEOA 5IMOA 5GS2D 1QR4A 3VAEA 3ENEA 2WO4A 4JJ5B 4YDLB 3NPZB 3OM3B 1DANT 4XMPH 4BWTA 3WUWA 3AY4C 2F8IA 1F4XH 1A4JA 2PNDA 3FTYA 4AX3A 1G6RB 2PXYD 2WQVA 2ZF8A 5IQOA 3OAYK 4EDWL 1BPVA 3IXAB 3QRGH 1P4BL 2YGOA 1I7RB 1FYTA 1RMFH 1JZ6A 1CE1L 4RAVB 4AQAA 3L5XL 4HIHB 4NDMA 1S9YB 5CJQH 1UCBL 3LRGA 1BPLB 2WIIA 4A04A 5C0AB 1A5FL 4NOFA 3MUZ1 5JR1L 3STLB 2QHLA 4KMTL 1K5NB 2BS8A 1USZA 3SY0A 5G5DA 4X7SH 3SGKA 2H26A 2OX5B 1C8QA 2WBJB 4S1SL 1JVKA 3KR3L 3P3RA 1WAPA 4KUZH 1N4XH 3RL1A 3G9VA 3H3BC 1NOLA 4F92B 4U4BA 4J3SA 1GAFL 3PAVA 1ADQL 1ZCRA 3S8GB 4WFHE 3VI3A 4OUUB 3D69B 3SJVA 3L8QA 2Y1YA 1JZJA 1NMBL 3MLSH 1MZYA 3MA7B 3MRFA 3RGVD 4F33B 2GTQA 4KAQH 1CXFA 2IAMC 4ZNEA 3SCMA 4DQOL 1R5IB 2ZUXA 4DP1X 3DX1A 3NABH 5DEFA 3U4EA 2P8PB 4JM4H 4R3SA 3VFVB 4AV4A 2G2RB 2UX7A 4D8PA 3K6DA 2C9RA 5M7QA 5ICYA 2F9BT 4ZO6A 3L4TA 1JNNH 3V5DB 1ZLSH 4WWKC 1MCWW 1JN6A 2I7SA 2PO6C 3BAJA 4RIRB 1FN4A 4PVNA 4ZW5A 1YECH 2WLZA 5GPRA 4ZO9A 3VXSB 2O6FA 2VR5A 1XFPA 2B5IC 4PS4H 2VLKA 5AW2B 2BSCA 3NSJA 3KPRD 3PAUA 4AYID 3AU1A 3NACL 3S6CA 1KT2A 4YOKA 4G6JH 5A1AA 4JKNA 1T22B 3QJSB 3D39E 5KS9E 1YYML 4GRMA 1R3JA 1WFUA 1N5AA 2HWZL 4JX0A 3FN0L 3RWHB 4JRLA 3WEAA 4PJ6A 2VDKH 5HPMB 3K2MC 2HTLC 1YNLH 4A55A 4P5KB 2QMKA 3T4AC 4GB9A 2CHDA 5BQ7A 2VLJD 5C97A 4YXLL 3TYGL 2GK0A 4XN5A 5HYQB 4YQXL 2NQ3A 2DIEA 1WYJA 1A6UL 2P42B 5HYSA 3EDDA 3OTTA 5DD3H 5HYJA 3WY4A 1WH0A 1QVOA 1XVSA 1BGXL 5TQ0H 1BM3L 1JSYA 3DA0A 2DQIH 4XRCA 1GA2A 2K4WA 2OMWB 3SDAC 4HWBA 1AVAA 2VDMB 5EA0H 1GTNA 4XMKL 3FMGH 5C09B 1CDBA 3ROOB 5GZNC 1MRFL 1S2EA 4AVHA 1E5BA 4KXZH 4XI5C 2XZZA 4X98A 4LCCA 3Q43A 4ZXBC 3TOPA 2O61B 4I9WE 2MPVA 2DTSA 4U6TA 4N8VG 2XJLA 4Z7QB 4H0LC 4XBEH 3GINA 3LS5L 4S1QH 5IQ7L 1RZ7L 2G4EA 3EGDA 3PE9A 4QJ3B 1L0QA 1QBMH 3F01A 3MOAL 5GISH 5G55A 2VXUH 5IHWA 1NCWH 1GIGL 4HJ1A 1RUKL 4M62H 3GXDA 2J8UB 2J88H 3MV8B 5E94B 1HQ4B 4PJIF 1YNKL 1IKNA 2UWEE 5ELIA 3S8WA 5DRXB 3RIAK 2YO3A 1BBDL 2R8SL 2IWEA 5L88L 3MRPB 2R7EB 2YD5A 1GYWA 3VXQA 4HUKB 3A4EA 3Q7JA 3V8OA 4K3EH 1KT2B 4G6KH 2V2TB 2EIBA 3VFWB 2DZEA 4ONGL 2F7PA 2CLVA 3GXTA 4NNXB 1W15A 2YBRB 1TFHA 1JCKA 3O3BB 2DICA 3LHPL 5J57B 1ET8A 4XP4H 4YO0A 4F24A 4LBAA 2N4IA 4FA8A 2LR4A 4PLOB 1NWPA 1G5AA 1WGOA 4YHLL 2X53A 3NN8B 1BECA 1CCZA 5F21B 3JWNG 4PVLA 4GAAA 4IRZL 1F45A 1SEQH 5ANMA 4KNSA 4TKWA 1ORSB 4N90E 3SDCD 2CIIA 4WKXA 1VGEL 2ZCHH 3N91A 3QPXL 2A4EA 2OP4L 4X7FC 2CBOA 3RWDA 2HA1A 3TS8A 43C9A 2QSCL 3PDOB 4XPAL 4XZUB 4L8DA 4QRPA 1RZGA 3I2CH 4EI6B 4OZ4B 1KGUA 3REVB 3FOLA 4UYQA 1AD9B 3KJ6L 4YX2L 4AUUA 2PW1A 3WN5A 3LKNB 3NJNA 1KB5B 1MXDA 2NLJB 4KXDA 3C8HA 1BDYA 4KTDL 3ZR6A 1AP2A 1TXKA 3P0VH 4U1SB 5HYSG 1N0XH 1QEWA 5D7SH 3WEXA 1NMCC 4Y5XA 2I24N 4I88A 1KULA 1DBAH 2AANA 1T1XA 3VXUD 2FD6L 3WD5L 1RZQA 3FUEA 3U30B 5CEZD 4KRMB 4FNLH 2AJSH 1FP5A 5DHVA 3GS0A 1X5YA 3HZVA 3WLWC 2FNBA 3F7VA 4K8RH 4KVCL 3F7PC 1RUQH 2VTFA 3KDMA 1TJGL 3Q2VA 4K07A 1EGJA 3OKDA 4HIJB 4P99A 5CHNA 5BQ7B 4G83A 1UH2A 3SDCB 5FUOL 1V8HA 1TZOA 1J1PL 4BXVA 3LS4H 4X6EB 5MENE 1KLGB 4XVUD 1IAKA 5C1MB 1YMMD 1NMAL 1FO0A 2ID5A 3N41B 3FFDB 4TQPA 4E68A 1AZBA 2RAMA 2WQ8A 3GF8A 2VZTA 2P8LA 4NZUH 4PJXB 4WI2A 2XYCA 3CVIH 1UWGL 4CA4A 1I8KB 2OMVA 4Q74A 3V10A 5D2LF 4FFZA 3MRLB 3DOSB 2P43B 5C0CE 1B0IA 5K93A 4KVNH 5HHXL 5CP3A 1KCWA 5F1OB 3GJFK 1F4YH 5DLLA 2PPDA 3SBWA 4EN3B 3UPCA 1W72L 4G1EA 4OGYL 1GOFA 5E9DB 1A7QH 3NJKA 3S34L 1HT6A 2APWA 4HJUA 3A24A 5I75B 4Z5RA 5L6YL 2Y1AA 1UUSA 2JELH 5FYLL 1Q94B 4R4BA 3X12A 2FEJA 3RWEB 1M05A 1KCVH 2X70A 2MQ0A 4FI8A 1C5CH 5E00B 3N55A 4HT1H 2Y7QB 4P2QA 2H6UA 3SCMB 4FLRA 2CXKA 2HG0A 5I74C 1P1VA 1C5DB 4XMPL 1AXTH 4JO8A 4Y4FC 2CRIA 2H32H 3HHSB 2Z93A 3L7FA 4PQXA 1O6SB 5EC2A 3AMLA 3SDAB 1EAQA 1ETA1 3QRGL 4P2RD 4RFOL 1G6VK 3O45B 4MA1B 4J4PC 1ND0B 4G8GD 3S98A 4Y2LA 3QEUA 1O7VA 4MQ7B 5D2NA 5DK2A 1CDJA 3FF8A 3QORB 3BUPA 4KUZL 1W72A 1YJDL 1SPDA 3LZRA 3NZ8B 3IPEA 4K5PA 4TOYH 2Z7ZA 4HJSA 2GFBB 1J5IA 1AIZA 1MJUL 3UJJH 1JYNA 1H8OA 5IQNA 4F15C 1J0YA 4UOQA 4X7SL 3MLWL 3D9AH 5MP6H 4OU3A 1XF5B 4Y5VB 4YO0B 5IY5B 2VDPH 4JAMB 4KXCA 3DO7B 4KK9D 4GKNB 1T1ZA 1G9ML 1TTBA 3SKJH 1SBSH 3WBDA 4NLHA 4NPYA 3L3HB 1INDH 4FEIA 2VWEC 4N24A 1OALA 5E6ID 5EZOH 3QEQA 4RMRA 4LNRB 4DUWA 1BZDA 1IX2A 1FV1B 5TDOA 1LP9E 1K2DA 4E9YA 1BVNP 3GMLB 4F7CB 2ZX7A 2J6EL 1WPCA 2WWKT 5IROA 2CKBA 2BVTA 4WDIB 3T09A 2ZUUA 4RGOL 1CDYA 4HF5L 5DR5L 1EO5A 2BSSA 3HN3A 4MCNA 1D5ZA 3SDYH 1F42A 5DJ2A 3TO4A 4ANUA 1ZLSL 1IMHC 2ZX5A 3O11A 1DJYA 3DJTA 2Q6WA 3FB6B 4MXVE 2NY1D 4WW1A 4BZ1A 4UM8A 5CEYB 4X4XB 3D5OF 4QYAA 1G0YR 1OAXL 3U82B 3ZXAC 1YPZE 1QYGH 2X6AA 5HVGB 5HI3D 3RYMA 5EEZA 1JF5A 2P5ED 3D87B 1P2CB 3OKNA 1R0AH 4LCUA 2V33A 1NEZG 3KYMB 3NP3A 5C92A 3CCHB 5B38B 4G7YH 4N0RA 3D2UB 1MVUA 4PJCE 3CSBA 3OLIA 1I9JH 3MLTA 5DLMH 4M4PA 3BLKA 2K45A 1E42A 1UD8A 5FB8A 3MI6A 1RJYB 4OZGB 4CN4A 1ODUA 2W9DH 4OCWH 4PJ7B 5LAXA 1FFPB 1HXMB 2W60A 3QZBA 1WISA 3C60C 4H40A 3V0EA 3E8VA 4MCZA 3P9MB 3DTXA 3MO1B 3HBQA 2A6IB 3WLBA 3HHMA 5J12B 1VFOA 5CCKL 1JGVL 3CPUA 1R5VB 3RUGB 4WO0A 1KCRL 2H9GA 1TZIA 1P4LA 4LE8A 2Q8BH 4PI2A 2LLNA 3ZGHA 4CC0A 2N7SA 1JF1A 3TYFB 3MXVL 3TBSA 1DE4B 4JO1H 2IOIA 4O5LH 4J6RH 2CCVA 1CDIA 5E9DD 2ATAA 4BQBA 5MENA 3BUIA 4LKCA 4MFHA 2HRPH 1C08B 2R0KL 3DLQR 3PWNB 4BA0A 4OLVH 3CFCL 1IM9D 2R69H 2EYTA 4RNRB 4DVRL 4AE0A 1MCFA 4P06A 4ETQA 4WK0B 3WU1A 4GSXA 1V7NL 4ZO7A 2N0KA 5IESL 1UM5H 1QRKA 3DUSA 5G4OA 3S36L 2YAMA 3L5IA 2GIYA 1IV8A 1RSFA 4FXGA 5DMGC 5DJAA 5IB2A 4D7BA 1EBAA 4GXUN 5DD1H 2MTAA 3S2CA 1MIML 2CGYA 4PY8J 2G2RA 3QISA 4FCAA 3SGJA 3E7JA 2C5DC 3ZOAA 1RFDL 5I75C 1YRKA 4MJ6B 4YK4B 1P5VB 2Z64C 2R1YA 3CFUA 3CH1A 3OB0H 4RGNE 5DK3A 2IAMB 2WWNA 3KWVA 3VWJB 4G6FB 1CGSL 1VACB 5FYKH 5FHBL 1X44A 2B1OA 4BGDA 1QWNA 2A9ML 4Y88A 1VIWA 4RWHA 4Z3TA 3E80A 3BH4A 4ZFOB 2OYLA 5SWZB 3DV6B 1EO8H 2QADD 2A6JB 3IFLH 4X50A 2O6EA 5KG9B 4OM1L 5FYLD 1FZOA 2XPYA 4MB3A 1ZE3C 3QUYC 2AXFA 2EECA 5D2NC 5EF1A 2B5IB 3QAZB 3C60B 4N68A 4GO9A 1KB9J 2FYYA 5HYSB 3MV7E 1RK0B 4ZSOA 5IBTL 5MERA 5E5UB 5ANMB 2WANA 4HSAC 4RAVA 4YZFF 3KD4A 4GQQA 1S78D 4M6NL 3RI5K 2ZZUT 4WHTB 5E7BA 5CR1A 3O6FB 3ARXA 4KHTL 1F56A 1AXIB 5CZXD 4BH7B 2BXYA 4WV1B 4DP6X 4QRPB 2VCOA 1QBLH 2V37A 1WWBX 4YDIH 1DEDA 1QFWI 1I1AC 3VRJA 1P6FA 5CJOL 1HINL 1GGUA 1QPPA 1R9FA 4I9XA 32C2A 1RHHA 2WY3B 5A43C 3QWOB 3LS5H 5IQ7H 4LDLB 1DQLH 3NMEA 3UC0L 2JIXA 3LH2L 4Q6KA 2JB6A 1WP6A 2OYPA 3CIQA 3UBFA 4WI8A 3QJRB 3KCWA 4JGJA 2VM4A 3DX8B 2CNYA 3CVIL 2CK0H 2VDRH 5AAWA 2DD8H 3BSHA 2XA8H 2Y9RT 5DA4A 3U1SL 5CXPA 5E94A 3RTLA 1RU9L 2DM3A 1E3XA 2E27H 4NM4L 2ED7A 4XO9A 5D7LA 5A2AA 5C9JB 1WLHA 2G9KA 1G7QA 2R0WL 3CD4A 3OJ2C 1OTSD 1OAJA 2P24B 4A7GA 1EV2E 5CIPB 4M61B 1AXSA 1PEZA 1F3DH 1F2XK 3DOIA 2EO7A 1XF4A 1NKGA 3EJCA 4MD0B 3WN6A 4R5XA 2Y4SA 3IGKA 4PWJA 4UINL 2H3NB 5IB4A 2LQRA 3HS8A 5A2FA 4ZTOL 4BKSC 4MJJA 1E8YA 3VXOB 3ILDA 2X4OB 1MJJB 4UT7H 3T1WA 3O9WB 3NVQA 4WWOA 1N64H 5AZEH 3EFDH 4M8UA 3ZRSA 5DUMH 3IDXH 3KAAA 4K9EL 3MRKB 2VOTA 4Q97A 4U33A 1HEJC 2OZ4H 4W9JC 4B9GA 1JFQL 1JPGA 3ZDZB 3H0TA 4HWZA 1N10A 1F1AA 1FNHA 3P0YH 5GS1C 3ARDB 3QFDA 5JO5B 3RJQB 2FEDD 4G6AC 3WTSA 2VB5A 4J3TA 4L8CB 3GTNA 5HP5A 4YHMH 1JVOA 4I1RA 4TLUA 3OMZA 1ZEAH 3VWJA 1GSMA 2DQTL 5C0CD 5KJRH 4FG0A 4Z7NF 2B2XL 3FRUB 2FLRT 3ULVL 2VLKE 4GW5A 4NQED 2E8YA 1LNUA 1AGFB 2CLZB 2HKHL 1T83A 3NIFF 5CJXA 5ENWA 1NCCH 3LN4B 1MWOA 4OGXL 4NQDE 4Y2DD 4XXCA 4ZNCD 3MSPA 4XT1C 3UCQA 3AG4B 3GGWA 4UB0H 4KI5D 4YNYB 4WNJA 1E7VA 2I27N 3ZTNH 5I1HH 3SBRA 1JHLH 3EYOB 3HC2A 1F3RB 3EJTA 3VXRB 5DRWB 4KHXL 3FU7B 3QDHA 3ULAB 2CDGB 5E24E 4ZPTA 4X5QA 1FZJA 1A0QH 1SBBA 2B08A 2PW2A 2Q2LA 3WHE0 3AREB 4N85A 4HGWB 4JO3L 4NHUA 4AMWA 5D1QE 3B7UX 3LX9A 3K6NA 4LSPL 1KENH 5B39G 4X8GA 4LARH 3X1BA 4ALAH 4CADA 3DGGA 3KMDA 1M7XA 4N90D 1UATA 2OMNA 4PJGF 2FEDC 2VSDA 4RA3A 4XN4A 1YO4A 3QDJE 1LEKA 5L4FA 2B4CC 4F9LA 4UOZA 3GSNB 3CFIC 3ATDA 4TXVB 2EAEA 2VDNB 1GY1A 4ORGA 1D6EB 3RU8L 5IHHA 1CTMA 4HWEH 3C5JA 3SDCA 2Y6TE 3PAZA 2J44A 1QMUA 1PF3A 4IKLA 1QTYT 5HHMD 1HI6A 1NZRA 5LGHH 4MAYB 4GQPH 1FIEA 4WF7A 4A7UA 3M86A 4U1JA 3NSFA 3PWNA 3WNKA 2NR6C 1I82A 1LO2L 1GHFH 4GP8B 4QHKI 2VZ3A 1NPUA 4XNZC 2E47A 4YQXH 1YYLL 2W9EH 4P46D 1C12B 1V55B 4JCLA 3JVFC 4IK7A 1RJLA 5E4IA 5E0QA 3RWJA 1I9JL 5F88A 4RISH 4TV3A 1M2VA 2I9LB 4LLWB 1KTLA 2CDEB 1QLFB 4KNUA 4EMZA 4HD9A 4ZFFB 1A6TA 1HCFX 1F13A 2WINB 4QKXB 4H2AA 1RUMH 3VG9C 3G6JF 5T1KA 3HR5B 5E6SB 3OKNB 1RZGB 1NAMA 5IHZB 3LRSB 1N4XL 2FQDA 2OFQA 3MV9A 4B9JA 3CGTA 2XIIA 3N40F 1MFCH 4DHLA 3LQZB 5E8NB 5LAXB 1QRNB 5FFOA 4L4TB 1M1SA 2IGFL 2QQNL 4F58H 5IB5A 1NC4A 2ZCLL 4QRRB 4JKMA 3C12A 1AS8A 3H9ZA 1CFNA 1G7MA 1IM9A 2OSLB 3V55A 3DRTA 1UC6A 3LEYL 3E6FB 4XC1H 1U8PB 5IESH 3SD2A 2QELA 1LWRA 4KJYA 1WO2A 3QNYB 3MV01 4IHOB 2VO5A 1XGUA 4TQEL 3EYQD 5CSZB 1L6ZA 2XQBH 4K8RD 3BPLB 3O3AA 5DWUH 3L81A 2I07A 3HRPA 5DD0L 3AY4A 4GUOA 3TASA 1HX0A 3SKMA 2A0LC 2J72A 3WUWG 1NCHA 1QI5A 2J6EH 4KX7A 1T7YA 5AKTA 2VLJE 5JHLL 5I6LA 3UTZB 3VXUE 2WTRB 2HTKC 4HUUA 4XXDA 2DMCA 1NFDE 2VW4A 3ZYZA 4DO6A 4YBLB 2EKSA 1EDHA 3ARWA 3IGLA 1MFBL 4FFWC 2VT0A 35C8H 3CZFB 1AACA 3GM0A 5J4MA 4DN4L 4ZZKA 1IAIL 1MVFA 4MAYD 3RX5A 5I73B 3MTXA 4QNPF 4OCXH 1E4KA 3BDYH 4O2FA 4ZBJA 3FULA 3OHXC 4NHCH 3SJVD 4D9QD 4OGAD 2MRYA 1ND0A 4P5MB 1RZJH 2KL6A 1CR9H 2VH5H 4G1MA 1R6VA 3QCTH 5FYKL 4QXWA 4PGCA 3FBKA 3N1GC 5FO2A 4DP0X 5ADOH 5D6CA 3OQ3B 1T6BX 2E7DA 1ZMYA 3CFDB 1PGRB 3ESUF 2J6EA 4WI6A 1KUMA 4WFGD 1C5DA 5DEJA 4QWWC 4DGYL 3DX2A 4IOSD 3T71A 5BRPA 3NZ8A 2IAMA 3GHBL 2HRHA 4G71B 4TUKL 1IQWL 1MUJA 4P9HH 3EJRA 4ZMPA 1DVYA 2WKOF 3IYLW 4R2GC 4UCFA 4JVUA 5L2KE 3UTPD 4R2GD 4DGVH 1LEIB 1ZHKB 4YDKL 3TBBA 5HYQA 4F2MB 4WLCA 1DDHB 3T1FB 4AKQA 3QEQD 4KGJA 4PG2C 1EHAA 1L9TA 3FFCA 3P77A 3NAAL 5E95B 3FTSA 1UM4H 1KF9B 4NQXA 5AW7B 3ULVD 1WS7A 4HMEA 4AEEA 1FIGL 3VXTA 1MDAA 2DL2A 3ZE1E 1KPVB 3KZ8A 4Y16B 4TNEA 5EN2A 4A66A 4GIOA 1RURL 1OAQH 3K0WA 4FQ2L 3MRMA 2B16A 3ORJA 4QXGH 4NFCA 4HULB 1BFOB 1T04A 4JZOA 3MJ6A 3KWTA 2V5MA 5D72L 3CFKA 2AK4B 2UZYB 5HHXH 4PRPA 1AE6L 4JKPH 5EDSA 1LEGB 2HJFB 4PUBH 4EZLA 4Z7IA 3TF4A 1LNUB 3DK2A 5DEFB 4APQA 3ZVVA 1OB0A 3BVNA 3FSOA 3QZMA 4PR5B 4LLVB 5E2JA 3QNYA 4P4KA 3K4ZA 4GIPD 3WKML 1E5AA 2AJXL 5JW4Q 3IS0X 1DHKA 1SY6A 4RESB 3DUHA 1E3FA 3AT8A 4BFKA 5E1AA 1IGJA 5JORA 4A6YA 3EYQC 3X13A 2VO8A 2XQYA 1N68A 3MCYA 4PWFA 4OZFH 3MRGB 1D5IH 2XN0A 4JG1L 1JFQH 3AB0C 1TTRA 2JELL 3KJ6H 1HZHL 3KPMB 3L4XA 1NCBH 2R29H 2QHRH 3QARA 1K5NA 1KCVL 1HH9A 1JL8A 2H8PB 2YKLL 4HIEB 4Y0GA 3ARPA 1CE6A 2DQEL 2QDVA 1W8OA 3HMWL 5FF6B 2DMKA 2PCPB 1F4HA 4PJBB 3DBXA 3QR2A 1AXTL 1N0XL 3QW9A 4J2XA 4R2GB 3BP5A 3OKOB 4C54A 3BLPX 2H3NA 1ZLWK 5FOBA 3EIFA 2VAJA 4R5VA 4GG8B 5BZDB 1EA9C 1L5GA 1AHKA 1NCCL 3A21A 1IGJB 3FH8A 5FGRA 1NMCB 4FXTA 1DFXA 3WOVA 1L0XA 5CIPH 3VH8B 1SJXA 5T5NF 43C9B 1RK1B 2ZKHH 2G75A 4JFWA 1X5AA 4G8EA 4G8GA 4M56A 1AR2A 5IF0A 2NNAA 1I7TB 4D2NA 5AAPA 4BRJA 4HPOL 3I75A 3ZDYE 4F2FA 4G3YL 3NH7H 5A2LH 1BOGB 1GZHA 3D33A 1J1PH 1CZ8L 3P4LA 5KSAA 4ONFL 4PJCA 5I18L 1Q9KB 2AMUA 4HQQL 2X7LA 4PJFB 1N7ML 2J57A 4MDIA 5MEQA 4NO3B 4WK4B 4KV5F 4MCYA 3Q6GH 2FDBP 2XKUA 2CK0L 2VDRL 4NO0B 3EHBD 4B6ZA 1FQ9C 3QNFA 4CKQA 1S7WA 2ADYA 2JB6B 3JBG7 3ULUE 2DYRB 5HHQB 2AITA 3KLSA 5C0GB 2B1AH 3EGDB 5KTEL 3C6LD 5L0QC 3LXUX 3DDFA 1OPGL 2UXTA 4ZNEE 3GM8A 2IIJA 2QADB 2QVFB 2AXJA 5EIIB 3VA6A 3GSUA 5FHAH 5CGYC 5MHSD 3F7YA 4V1DD 4ZPTB 2J1WA 5FFGA 2G5UA 2BMKA 2JKSA 5DSCB 2FNWA 3X2QB 1EQWA 3FMGL 1UG9A 4OLZL 4CMHC 1WDAA 3D39D 3RFZA 1G43A 1HH6A 2XOTA 1O0VA 3GQFA 4XP9L 1G7MB 1I8MB 2BVUA 3HG1B 3KGUA 3T2OA 3RU8H 1A1NB 4MCMA 5BZDA 1YEDA 5E8DH 2ZUYA 1BVLB 4GEJA 4XRCB 1PX4A 2BNUA 3CU1A 1T4KA 1BYOA 3MLRH 2GI0A 1L7TL 5EA0L 5IVXA 3AB0B 1VSCA 5FF6A 1QBML 4L3CA 2EACA 3UTTD 5ITBH 5M95B 3DETD 2XV6B 1DBML 5AAWC 2X4RA 3QIWB 4HYTB 5FIEA 4YSCA 3DVFA 1H8NA 3EZ8A 2WW8A 4LVNC 3BP7B 4X98B 3MJ9A 4MD4A 4TL4A 3FC8A 2YUWA 3U4BL 1HH6B 3UTQB 4NQCA 4PWEA 1D7DA 2VRQA 3K2UH 4KQ3H 1A6WH 1OP9A 1TQVA 1ASQA 2IXQB 1EXUA 5FYJU 4K3EL 5DHDA 2VLRB 5C08E 2AW2A 3LKPA 1UFGA 3ATBA 1S9WA 2ADIA 4LLMA 1YNKH 3Q1SL 1FG2B 3IS1X 5TDNB 2ZD0A 3IJEB 3OF6A 4XP4L 5FWQA 5SWZE 2I60H 5I6XB 5JQ6H 4B9IA 1ETJA 1JYVA 1E9PB 3DHJA 1I1CA 5IEHA 4RA0C 2GJPA 4XN2A 5A40E 5I8OL 2F2HA 1U3JA 2V7HA 3TBVB 2YD0A 2FIKB 2XXGA 1OV8A 3TJEH 4FFZH 2CO2A 2D7OA 2GC4C 4BFJA 4HV8A 4LAQL 1A6VH 1J0IA 2I07B 3AREA 3MV7A 4I18A 4NHUB 4R96B 5JQHC 2KZ1B 2Z1PA 2XPZA 3ZL4H 5E9NA 1FSKB 3ZL1A 4FTVD 4WEBL 4PJ9D 5HYIA 1S3KH 1YC8A 2RCSH 1MQKH 3POCA 5EZJA 1J1XL 1TENA 2MWCA 3L13A 3W82A 2W0LA 3T2LA 1PS3A 3GJEA 1JD7A 1RZJC 3VRLF 4Q6IB 5ALBL 3T1FA 3WXVL 5I5IA 3V95A 2OPCA 4NO2B 1BM3H 1K9TA 3O2WL 1NC2B 3HG2A 4WFED 4XHJD 4CVXB 4EI6A 5IGXL 3ARDD 3VCLB 4K3JH 4G8FB 1BFSA 4H0IA 1RHFA 5EF0A 2VSMB 5GGRA 4HEME 3NYKA 1OE2A 2HVJA 3P2BA 1DUZA 5ID1A 4J39A 1X9UA 1JGUH 3V5HB 1B90A 4OCXL 1RH8A 2XYBA 1E4XH 4HCGA 3MV11 2K8MA 4QRQA 5IVNA 4LPTA 4HMCA 3W5NA 3GNMH 2IQ9H 1W0VB 2AQQA 2XG5B 3DSFH 4M4RA 5J6SA 4X5LA 3CSTA 3GXPA 2BP0B 4H8PA 4LSVH 1R19A 1DVQA 1H5BB 1DSWA 4OLWL 2WKOA 3ROLA 4LOFA 3TV3L 5C0BD 5FA4A 4M62L 5AOIA 4TSBH 1KEGL 5E2VL 1S6NA 4XVUC 4GMTL 2CIKB 2H1LM 2W92A 2YBRA 2P45B 3KBPA 3NIGF 1FVEA 1BD2B 4HV8B 1QEXA 4NDMB 3RA7H 4JG0H 5K9JL 5FLUA 4IRSA 4M43L 3WIFB 3JUYA 2ROXA 4L3ED 4KV5E 1CFTA 3N43B 4YEFA 5F1NB 1KEMH 1OT2A 2GT9B 2W0FA 1OGSA 5FV2A 3R7RA 2WD0A 5HYEA 1MCDA 5GS0L 4WWKA 5DJ0A 2LGNA 1DVUA 4ZX5A 4B96A 2OAAA 3Q5TA 3BKYL 5JLZA 3JYCA 4MXQC 5DF0A 4JGUA 4KZCA 4WWID 4R0LB 2DW5A 4HISA 2WZ6A 5BZWA 3GZKA 1SOKA 1Q1PA 4MJ4A 4PP2B 2BX5A 5E8OB 3LY6A 2FQGA 5F7NC 3HG0A 3VMPA 3NCJL 5GZND 2VUOA 4HCFA 4FTVB 3TCTA 1XGUB 4P4KD 1FSKC 5E9DE 4XNXH 2GSGA 3UTTE 1I3VA 4QXGL 4XAKE 4CVWA 2DLEA 2HH0H 4YLCA 4KXAA 4RWYL 1SGKA 4WHCA 1XCTB 3M6DA 4PHXA 3HC4L 4JRXE 5B1JA 3BKML 5FX3A 2OSWA 5HI5C 1IAOB 3WO3B 1QR1A 4J27A 3TVMD 3FS9A 4PRID 3UCRA 3O3EA 3RVUC 4HUVB 2VLRD 1MOEA 1I3RB 4WTZA 3V5HA 4U05A 5AFAA 3BOVA 1N6UA 4YXHH 4I2XE 1JDCA 2XQYK 4MA7H 4UM9B 3ZTEA 3FTVA 1AGCB 3V6FA 2LFEA 3QULB 1FNEA 6PCYA 3MFFB 5E9AA 1A3ZA 1N8ZB 4UQ3A 5I8KH 5TDPA 2X89A 1YDPB 2VGLM 3L7FB 3RNQB 2CM6A 5D7JD 3FHAA 1F1GA 3UL4A 3M8OL 2B1HH 3V4UL 1H5BC 3BVNB 4PR5A 4WI0A 2F5BL 3HE6A 1HEHC 4DOHE 4F3FB 5TF1L 4QJ4B 4DQOH 4EUPG 1KOAA 4DP2X 2VDQH 4NJ9H 2DWYA 1BVOA 2IDFA 1QSEB 4PJXE 4WY7L 1MVYA 3CZKA 1G87A 4N2CA 5SWZA 1GY2A 4AXWB 1HKFA 5A2BA 2DKSA 3U6XA 1OSYA 2K3HA 1X5KA 1QTPA 4UWQB 5ID0A 3C60D 4HK0B 3QQ9C 4HWUA 3NABL 2NXZD 4FQXB 5E4OA 2FR4B 3GDBA 1JI1A 2XIDA 3GHPA 3AJ7A 3BVWA 1UD3A 1RI8A 5IQ9A 4AQ1A 5DHYA 3FUMA 1LJMA 1VADA 5J1AB 5E8OA 1GJUA 1L3WA 4DERA 4L2LA 1N6QL 3HCVB 4A2MA 3BEVB 3ZX1A 3TEZA 4B97A 3MJ9L 2NW3B 6PAZA 4KC3B 3GMPB 43CAB 3DXAB 1DDHA 4C59B 2PYEB 4ODSL 2JCWA 4NQCB 2BSSB 3G3LA 4LASH 1I1FA 4PCKA 1KBKA 4ENEC 3BP7A 3NSYA 4D9QE 3DV4A 5CD3B 2EABA 2KZKA 2XPGB 3RIKA 4GJTB 4DJMA 1MN4A 4RNRA 4FXKA 4MMZB 2DIBA 4N2GA 3RZCC 4DKTA 3IKCB 1A02N 3FRPG 2ZAIA 3MNZB 4HLZG 1CYGA 2CIKA 3IRPX 3MLUH 3QJFB 4KJPC 4DZBA 1NTDA 5BV7H 4E9WA 4M1DH 4P2OB 1NFIB 3BZ4B 1A25A 4L8SC 2YGVA 1F11A 4CJ1A 2A38A 5IMKA 3KPPB 3RGVB 4B50A 1FL3A 1OT1A 2ENJA 4K94H 3QDMA 5INDB 4S1DC 1UZGA 2Y72A 4OIAA 4OQTA 2EE3A 4LDCA 4ZUTB 3TT1L 4FNPA 2NY0C 4R90L 5GGRY 3HI1B 1EERB 1EZUA 1CMOA 2APVA 5DI8A 3W2DL 1ORQA 4TRPH 2R4RL 2WO2B 3P2DA 3F7YB 4WEEA 3U4BH 1OB1B 2XBZA 1U8NA 3QI9C 2BFVH 2GJZA 1A6WL 4KUCF 1ZEAL 3EOAB 2DAVA 2DJMA 3SKJL 2OCJA 2CHZA 5DO2C 2C3HA 1NOAA 2EDWA 3D52A 3VXOA 1KYOJ 3JXAA 4ZW3A 3BZEB 1K4DB 1Z9OA 9PCYA 1A8JH 3PL6A 5AALA 1WGVA 5HTSA 4NSKB 1TPXB 3RX9A 4AJWA 1YN6B 3E2HB 3RGVC 2NXZB 4FQXD 1N9PA 5AAMA 3KYOA 1JGIA 4C57C 2VISA 3C8KB 5FYJL 4EUPA 1HYSC 3VFWA 5I71C 4JREB 1ZGLM 5DS2A 5T1MA 1LK3L 1LMIA 4PB9H 5TE6L 3SHSA 1P9MC 4HAFA 3VD7A 5D6DA 2JJVA 5E9DA 2AK4E 4CC1A 3UBXG 1PL3A 4HPHA 1J5DA 1XGQB 2DJSA 5HDBE 2WNXA 1HWGB 2KDYA 1IBZA 2F7IA 1SQMA 4OCNC 5EOCL 4EKJA 4OM1H 1S9VB 4XNDA 1G9HA 3B2MA 4Z3JA 2DI7A 4G70B 3G08B 1BX2A 2HN7B 3QDGB 3WMSA 4PD4J 4HWEL 4KDVA 4A63A 1SVCP 4FNSA 2DQIL 3VDBA 1FF5A 3INUH 1WJ3A 4PJEE 2F8OA 1S5HB 2O61A 1MRDL 2VLLA 4IMKA 4OF3A 4M7LH 2QVIA 1JAEA 1XD1A 3A4FA 1BF8A 4KPHL 4WFFE 1UXWB 1M3IA 1U4FA 3BSGA 4Y4KC 3UGEA 1MCPH 1DE4A 4QF1B 1HHIB 1TQSA 2HLEB 1QI4A 4OQTL 3WJMB 1A9EA 3E3QC 2DI8A 4YHZH 5F3HB 2WOYA 4N1CA 2CO6A 1NEZA 2NY4D 3MNDA 2ETWA 3HC0A 5I76A 4QAWA 4AC2A 2DBJA 1WFTA 4U7SA 4IU2B 3HTLX 5CBEA 1TJGH 5DHVH 3UADA 1WTGT 4OKVB 1R75A 4JM2C 1F90H 5F7BA 1UGNA 2X4NA 3QIUD 4YVNA 2DTML 3IFOA 3LZLA 2X6BA 2XTJD 2C7UA 1J10A 2JLLA 2YJLA 3QNZA 5JA9A 3UTSB 4HOZA 1XTLA 2FX9L 1ZHBA 3CH8A 1B6DA 3GBLA 4OCRH 4OLUH 1Z5HA 4LSQL 5B8CC 2BVQB 4G11A 4BM7A 3ARTA 1UZ8B 4JM2D 3QP3A 1UM6L 2GUOB 3WYRA 1BFVH 4EN3D 5D5MA 4I1PA 3BEWB 3FB6A 4G1EB 1AFVH 2VN6A 4MXVF 3E6FA 1TNNA 1MCQA 5DJAB 5DS1A 4LCVA 2O5YL 4Z7WE 1KWKA 5IG7A 5D93B 4GW4B 3MCG1 3APMA 1MLCA 2ZCHL 3NPSB 3FB8B 4JHVA 3T3PB 1XR9A 2GJZB 3QPKA 2OJEA 3KH4A 3EOTL 4X80L 1JZFA 2JJWA 4J8QA 1ZHNB 3KYOB 3RWFA 1IAIM 1TTUA 4K2UH 1GGYA 4PRBB 2LOEA 4QYOA 1WS8A 4D0DB 5D6CB 4CJ0A 1BREA 3JTSB 1XD0A 3PL6B 1M9SA 1ZE3H 1UURA 3F7VB 3N6YA 1RZJL 3WS3A 4MMYA 1SXZA 2DB8A 1FL5B 3UJTH 1W0WA 1AO7A 4H8UA 1ZANL 3JWNH 1A3LH 1INQA 1C7SA 2J20A 5D4JA 1PBYA 1UYWL 1NLDH 2J4WH 3RNKA 4L4JA 4ODHH 2VZOA 4N2HA 4J6IA 3N1FC 3FQWB 5IW6A 4OZFA 1SUHA 4U1SA 1JERA 2LLLA 1HOEA 4AIOA 3I6LD 4F37K 4WJ5B 1ZHLB 4WHYH 5C0BA 3PNRB 4ESKA 2VMCA 4P5RA 1SEBA 3ZKXB 2XACC 1MFDH 4WIQA 2DDQL 4NBXB 2W07B 4LFHD 1IGIH 3OR7A 5LGYA 1KJ2L 4AJ0A 2YKLH 4M7ZC 2PW1B 3MRNB 2P44B 1Z6JT 3QZWG 3S4SG 2HKFH 2XG5A 3R0NA 3N40P 1MFVA 1INEL 1EEYA 2X38A 3EO0B 5IEKB 1X5JA 3PL6C 5GRXG 3ZZQA 5A16A 4AEIL 3HJ0A 3IGFA 4HKJA 3JWOL 1EBPA 1XMWA 5C6PB 5D7JA 2V17L 2OL3L 3MKGA 1A3QA 4GW4A 5D7LB 4QGTA 1LWHA 2J12B 1EPFA 4JBSA 4Z8FH 5F72S 4RQQB 1ACYH 1WEJH 4GRLC 2O5NA 4QXUL 1BYNA 1WZMA 1A9BA 1QABA 3TWCH 3VG0L 1B2WL 2BVEA 4XWOD 3RDTB 5EU3A 3NT0A 5DRWA 3ME0A 4JFQA 1TSHA 3FQ2A 1KB5H 5HI4C 1X7TA 1E5CA 1HYRC 2O5ZH 4FFVC 4KH9A 5CEXB 4UIKH 3N42F 1XGYH 2ZONA 5M94B 3V7AE 3PJNA 4IMLB 2VDOH 1UD5A 4HPOH 1KTBA 1EFXB 2WXFA 3K72A 1YAIA 3OVUB 4UT6H 5D1QD 4J28A 2P8LB 3MBED 4NQXB 4W6XB 4C4KT 4WFEE 2YJQA 3TNNB 2IADB 1OCCB 2BK8A 3CHSA 2WLMA 4KJPD 4JO5A 2X09A 1AQHA 4G6ML 3WL9B 3UGUA 3DMMD 1GGTA 4YLBA 3GB7B 1YYLH 1A4KB 3U7YH 5F2FA 3AS2A 2FYYB 4M9PA 2VMDA 4UI2A 2FJSA 2MNUA 3G5ZA 1TJMA 4X6FB 1M7IB 5AYQA 3OSKA 1CL7H 5DZLA 4YMPA 3Q01A 2XJKA 4H20L 5DQ9A 1A6ZA 4XCEB 4OT1H 2RB8A 4TUOA 4WI0B 1NCIA 1VPOH 4KTGA 1TDQA 4MS8C 1OAUL 4HLJA 4O5LL 5FECA 1I53A 2OR9H 3PHSA 4P4RB 2AERT 3NFSL 4NM8H 4U49A 1G9MH 3E6HA 2YA0A 4UQ3B 1NH6A 2F19H 5D7IB 1FNEB 3VU2A 5JIDA 1TOXA 2D0GA 3II2A 2HN7A 3GK8L 1X5ZA 2BNQB 3QDGA 2P9RA 3GMRA 4JO1L 5F8RC 3VSTA 2MCMA 1G7QB 2EDMA 2XNAA 1S9VA 4YHIA 1MI5A 2FCBA 3ZBMA 1T80A 4P5SA 4PGJA 4Z76A 4XO3A 5H2BB 4NUMA 5JUEL 1MWAH 3AUWB 5KVFE 3EDFA 5I19L 2Y69B 4YSEA 1G6RA 1OM3H 4H5SB 4NAMA 2N56A 3GLDA 4CU6A 4NUJB 2G3XA 1XO8A 5F1NA 2KLRA 3FAXA 3RAJL 1WD9A 1W16A 3NJFA 2GTWA 3PDDA 5JW3L 4LRNL 3SKMB 1J0ZA 3SQBB 4HSQA 2NYKA 2XETA 1QPXA 3HZKB 4HEPG 1XBRA 1B9ZA 1RY7B 3B83A 2YD3A 4P57B 3O3AB 3CDGA 4KO7A 3WIAA 2ARJQ 3I84A 3O6LL 4F8NA 1YQ2A 4WO4C 5KTEH 1RK7A 3HG4A 5FM5M 4FZ8L 3MRJA 1NFKA 1KBWA 1MDTA 1IC4H 4HU2A 2H9GB 4Y5YB 1V3LA 3GT6A 4Y5VC 1CXIA 2HT3D 3GTVA 5KSAB 3C5ZA 4O9HH 1P7QB 3TNMA 4M6OH 4CILA 4KKBD 4BQ9A 4IIQB 3DVGA 4BZYA 5CJ5A 3EGSA 4QGYA 3CN1A 1K3ZA 4NERA 1FFPA 5EOQH 3QEUB 4HS8H 1T0NB 1ONQA 2FECI 3EDJA 3TN0C 4ONOA 1PY4A 5HHOB 2VLJA 3PJSB 5DVOA 2XZQH 2ITEA 1QHPA 5IFJB 3BP6A 4CGUB 2EVFA 2X9ZA 2JFCA 4LDOB 1BMZA 1DBJL 4Z9KB 2CUHA 1NGWA 5L2JA 2ERJB 2YAOA 1DQIA 3DO3A 5HHNA 3F2LA 4EIBA 4YHPB 2G5BA 1MCLA 3FQRB 4FTDA 3O2WH 3MTRA 1S46A 4PRAA 5CJXC 5ADPL 2QGEA 5BOJA 1AR1D 4LLDA 2V2WB 1DQLL 3IJSA 1XCQB 3F58H 3QEHB 2XN9E 2Q7NA 3QUHA 4NS0A 1T5WA 1X5GA 4E9VA 1XR9B 2XKNA 4LXFA 3OZ9L 2R2EB 1JGUL 5F7EL 1WF5A 1B88A 4U1LA 2WLYA 1MPAH 3ZDXE 1HINH 5JORB 3G5WA 4XH2A 3J8F7 1Y6NR 4OLUL 3V0GA 2XVLA 3L3GB 3D6GA 3MRJB 4Q8BA 3QQXA 1M7DA 4KI1A 4JEGB 4LEOB 2O4EA 4H1LG 4B9KC 4Y4KD 4GP4B 4B5EA 5I0WA 4L0PB 2H4EA 1ILSA 2AC0A 2FH8A 3VO0A 3B7YA 1G0DA 1OF2B 3UFIA 4R96A 3BD5A 4KZDL 1E6OL 3ULUF 3ZK0A 3E8UL 1JPFB 1FH2A 1TQUA 4KJWC 4JZNB 5D7IE 4JZOB 1KJVA 2VDLB 3M1CA 3EJUA 1TQTA 2LHAA 2IV8A 1TTGA 3OSVA 4X4YA 2R0WH 2EIJB 4P8QA 5TE4H 4O2CA 5J0BA 2F53D 1WWWX 5FA3A 3ARFD 2IFFH 3CX2A 3FQYA 1R17A 4CN6A 1F02I 5FO8A 2OQJB 3P0GB 5DK2B 1WD8A 4ZXBA 3C09B 2YD9A 4GLRI 3O45A 1F4WH 4URKA 1FH5L 4ZUUB 2WLIA 5C07E 4IDJH 4FAAB 2A2QT 5GSRB 5T5FL 1HIML 4F2MA 5C7ZA 1PZDA 1XGPA 4YSDA 2DQEH 3BPLC 4JFZL 1UQSB 2O6DA 5DMKA 3PWLB 2XSKA 2X2IA 1OSEA 3THML 3SQRA 4WV1C 3I74A 1JIBA 3NZSA 4L9LC 2EXYD 4WSGA 4YDKH 3T8MA 4KK5D 2FBJH 1ZVNA 4BCYA 3LH2H 3FQWA 3WJMA 5IW6B 4N2OA 1AO7D 4JFED 1UXLA 2B1HL 4AEHH 5SWZD 3V5KA 1P5UB 4KK8C 3U0PA 1ECYA 1E65A 5DD6A 4CAGA 2H3XC 2FT6A 3II1A 1NWOA 4UAOC 4AQAB 3TA3D 3O6MH 2E56A 4XVJH 1XGRB 4PBXA 3CVDA 3GKWH 2NYYD 5CJBA 3CZSA 3MACH 4ONFH