2H1LM

The structure of the oncoprotein sv40 large t antigen and p53 tumor suppressor complex
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
199
structure length
199
Chain Sequence
SPLSSSVPSQKTYQGSYGFRLGFLHSGTAKSVTCTYSPALNKMFCQLAKTCPVQLWVDSTPPPGTRVRAMAIYKQSQHMTEVVRRCPHHERCSDSDGLAPPQHLIRVEGNLRVEYLDDRNTFRHSVVVPYEPPEVGSDCTTIHYNYMCNSSCMGGMNRRPILTIITLEDSSGNLLGRNSFEVRVCACPGRDRRTEEENL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Large T antigen
publication title Crystal structure of SV40 large T-antigen bound to p53: interplay between a viral oncoprotein and a cellular tumor suppressor.
pubmed doi rcsb
source organism Simian virus 40
molecule tags Viral protein
total genus 38
structure length 199
sequence length 199
chains with identical sequence N, O, P, Q, R, S, T, U, V, W, X
ec nomenclature
pdb deposition date 2006-05-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
M PF00870 P53 P53 DNA-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.720 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 2h1lM00
5G4NA 1HJCA 3VD0A 5AOIA 4AGLA 4IBZA 2GEQA 4GUQA 1EAOA 1KZYA 5LAPA 4HJEA 2YBGA 4IBUA 2IOOA 3QYMA 4IBTA 1HJBC 1UOLA 5G4OA 5A7BA 4IBVA 2XWCA 4XR8C 1EANA 3D0AA 5ECGA 3TS8A 4LO9A 2IOMA 3VD2A 4AGOA 1CMOA 2J1XA 4AGMA 2X0VA 3EXLA 5AOJA 4IBQA 2VUKA 5AOMA 2XWRA 4G83A 4GUOA 1YCSA 4MZIA 2BINA 2J6WA 3US1A 1LJMA 1TSRA 5AB9A 4IBSA 2P52A 2BIQA 2J1ZA 1TUPA 2OCJA 4L18A 2J20A 3WTUA 3Q05A 1E50A 5AOKA 2J1YA 3D08A 3EXJA 4L0YA 5G4MA 2FEJA 1GZHC 3WTTA 2AC0A 3D07A 4IBYA 5ABAA 4A63A 3IGKA 2PCXA 3WU1A 1H9DA 3WTWA 4MZRA 2BIPA 2J1WA 2AHIA 4AGNA 4AGQA 1IO4C 2ADYA 5BUAA 1GZHA 3KZ8A 4IJTA 1HU8A 3ZMEA 3D09A 3Q01A 2MEJB 1EAQA 4G82A 2BIOA 2H1LM 3D05A 1CO1A 1T4WA 4L0ZA 2RMNA 4IBWA 2BIMA 2ATAA 5AOLA 4AGPA 4LOFA 3QYNA 5KBDA 5LGYA 3KMDA 3VD1A 3WTSA 3D06A 2IOIA 4KVPA 3WTVA 3IGLA 3WTYA 2X0WA 3US0A 4QO1B 4LOEA 2J21A 2X0UA 3Q06A 2WGXA 3WTXA
chains in the Genus database with same CATH superfamily
2V17L 3NP3A 4W4OC 2ADGB 2ZAIA 3NFPB 5AAWA 1QUNB 5HHOD 5AD0A 1FNHA 4HBQA 3MRIA 1T5XB 1W72H 5F96H 2X4PA 4M62L 5D7IB 2Y1YA 4PRHA 4WTZG 5F0PB 4DPAX 4S0HA 1D5BB 4WNQB 5EZPA 5C07E 2FHBA 4WLCA 4RMTA 1Y6KR 1V10A 5CJOL 3VH8G 3B7RL 3FZUD 4AXWA 5FR3A 3QIUD 5F8RC 3Q2NA 4ES8A 3V6BR 2EVGA 2J2ZB 4O2FB 3B6SB 5TH2B 1N4XL 4C4KO 5FEBA 2BY3A 5LCVH 2VZSA 4M61B 3VO0A 4WGWB 4A37A 4AGMA 4AMWA 4XNMB 4PB0H 2V5RA 2CKBL 4ZDHB 4BSWA 4ANWA 4YSEA 1SRDA 1KGIA 1XCXA 1I75A 2FATL 4Y16C 3VWKC 4JN2B 2JJUA 5H8DA 3E0GA 2MWCA 5EOCL 4Z3HA 1U3ZA 2R4RL 3QDGD 1UKTA 4J3OG 4YVUA 1WDAA 2VDMH 3K5SA 1EV2E 2NDGA 1RK0A 5E24E 1JNHA 2UVEA 1DQQB 3JVGC 5B7EA 1ONQB 3F7YB 1RHHA 2N1TE 1T89A 2YARA 2H7WA 1ZXKA 2VISB 1I9EA 2JB5H 2JJTC 3DGGA 1FE8H 4HWZB 4HV8B 2H0FA 5FK9B 3R06A 1EUTA 2R0KL 4PG2A 4OJFL 2XDHA 3W38A 4ATWA 5DHVH 3OM3B 1KV3A 2P5ED 2W80C 3H9SA 1UVQB 4JQIH 4YHKL 1W0VA 4NBYB 5DK3A 4EAEA 5J12B 5ADOL 4Z77A 2FDBP 3U7AA 3O4LB 1E4KC 3K2MC 4HOXA 1TVBB 2Z92B 4Y7OC 1K5NB 5LG6A 4AQOA 1YA5A 1LDPH 4RQQA 3UBHA 3X3FH 4OSUH 2B3RA 1F2XK 2I7OA 3K46A 2WNXA 3ULUL 5DFAA 3MXVH 3E3QE 4ZFZB 5JPNC 2Y2WA 3LXAA 4FZ8H 4PY8I 4JDTL 3KMDA 1Y6MR 5CILL 1U58A 1KJVA 3GGWB 3QPQD 4Z7WF 2XQBH 3BE1L 1RULL 4Z7OB 4G11A 4IBLT 2ALAA 4DGIL 4GSXA 2LFEA 5H37G 3S37L 5F72S 4MMZA 3QI9B 1M7DB 5KYNA 2VN5A 2DQHH 3GNMH 1WAEA 3Q9PA 3TGXA 3IDJA 4AEFA 4DUXA 4I3RH 2IPKA 3CU1A 4U3XA 2UZIH 4FA7B 2I9LA 5IHZA 1EZSA 2ZOLA 4X4KA 2FUTA 1RMFL 3MOAL 4L8SA 3GRBA 4KGJA 5E2UH 2V7HB 4XP6H 3POHA 3QB7C 1VADB 3Q3GB 1CFBA 3IXAA 1R0AH 1RZPA 5JXEA 3V6FB 3MBXH 4OZIF 5T1LA 2H1PH 3CWGA 4ZTOL 2BNRA 1N18A 4PI2A 3MVSA 4X80L 1YECH 4NFCA 3VM5A 1ASOA 1A7OL 3MROA 4MA8L 4JGJA 4BH8A 2YOAA 5B1KA 5FKAA 4F8OA 2JF1A 4WW2B 3M17A 1XMEB 3FXIC 1FL5A 2IPUK 1QSFD 1CZ8H 1HHKB 3GZQA 2X1XR 4LLMA 4TTDD 3U4EA 4Z3JA 4XP1L 4IEFA 1NGXB 2JELH 3S88H 1WO2A 3VQ1C 1WK0A 1I9RH 4Y0GA 25C8H 1UT9A 3X11B 3MTRA 2NY0C 5C2BH 4X9HA 5FX3A 5D1QB 1WEJL 5F1NB 2Q6WB 2F58H 1SXCA 1MHEA 3FN0H 3TLRA 1ZIBA 4JG5A 4NRYA 4AT6B 4MCNA 3T8VA 4FHJA 2X2IA 1AS6A 2HKAA 4FCHA 4BV1A 4FG4A 5F7FA 2A6DB 5D1XC 2HLAA 1VFAA 4NPYA 1U41A 4DZBA 4FE9A 4KI1A 4OLVL 4X4XB 1DN0A 4MJ4A 5IEHB 3RFZA 5E8DL 1I1YA 4JFTA 4HBCL 5D8JH 2W0FA 2UX7A 3HE7C 3U1QA 2O5YH 3O41B 4PH8A 2HWZL 3NGBB 4PY7A 1DQML 2IFFH 4U6TA 1OB1B 2V9RA 3EOBB 1GHFL 3FCSA 1G7LB 2ALWA 2YC1A 3IKCB 3ISYA 4Y1AD 3CGTA 3VXRA 4BZ1L 2ZP9A 2BVQA 3I3BA 1KPRA 5IREA 3WL9B 5C7XH 2CHZA 3BYTA 4P23C 1NOAA 1S7XA 4XNXH 4ISVB 1BQHB 1XO8A 3Q1SL 4FYTA 3PQYB 1PKQA 4PJIA 1MI5A 2W94A 3GSNB 3U9UA 3WNLA 4CMMA 2JI2A 4WDIA 4EI6B 2IWKA 3MUUA 2IQAB 5FUZH 4XCEA 5F89B 4WW1A 3NABL 3BESR 2ARJB 1IVLA 4HALA 1VCAA 5F7DA 4ZAKC 2GC4C 2XN9E 1FL3A 5E6IB 2G2RA 2WGXA 3HG5A 3LSOA 1PSKL 1ULVA 4LARL 4WI9A 4Z7VF 4YDJB 1VACA 4NAMA 1DBKL 4P46D 1LK3L 5AZEL 1FFQA 5BCAA 3D85A 5FYLE 5T1MA 2BZDA 2K4AA 3BT0A 5MEOA 2XTJC 3CDCA 2KDGA 4JO5A 2XZCH 4L4TA 4G8GE 3OJDB 3LS5H 2VJXA 3BH9A 3STLA 4LCYB 1S7UA 3IGFA 4K8RH 4NGHL 3O8XB 1BVZA 1FWXA 3HS0B 3BP4A 3BH4A 2FECL 3GMNA 1HHHB 4IYKA 4CC4A 2HX8A 1JYNA 3UG5A 4U1JB 4AYMC 2FD6L 1FYTE 2XQYA 2Q2LA 3VVVA 2DWSA 4JZNA 1CUOA 5IK3A 1KJ3H 4YXKL 4I3GA 1U8NA 2E9BA 4D2NA 3ZW3A 5HD8D 2E59A 3ARPA 4CU6A 1NM9A 2NQ3A 5HPOA 2A6IB 4PWEA 5BZZA 1TZ8A 4LLAA 3OAYK 3J8F7 5DHMC 1IC5H 4GG6F 1S7WB 3T3MF 3JWNE 1SDYA 4L18A 4FG6C 4DN4H 4BGLA 1DUYB 2XY1A 3TEWA 1KBGL 2O6DA 4WWKC 5TGBB 1DQDL 4ZOCA 1D5ZB 4ORGB 3QQ4A 1IAII 4LLUB 1C5BL 1A1NB 1QFWH 4PJ9B 4U6YB 2J3SA 1PLGL 4NZRL 1FZKB 1FAIH 1N3NB 1XF1A 4P5SA 3UTTD 4P2OD 4KC3B 3RWEB 3HI1A 1LGVA 1X7SA 3UAFA 2B15A 4BSJA 4CAGA 5KYXA 4OCYH 2CHDA 3PJLA 4S1RH 1VCBC 1KG0B 1YPZF 4APQD 1XF4B 1G9EA 2GI0A 3L7EA 4PJFE 1IE5A 4NN5B 4U7MA 3OKMB 4ZFFB 1JVKA 1P7BA 4G1EA 3QNYA 5FWQA 2W88A 4NT6B 3ZTNH 4QGTA 3VWJA 4XNYH 2EEDA 1S78D 1YY8A 1P5VB 2ATPA 5DDHA 2CXKA 3V79C 1NFIB 5L6YH 4L9LA 1IM9B 4F15C 2MPVA 5JQ6H 5D7IF 5DVMA 5AW8B 1NEZA 4WO4D 1I9JH 4ONFL 3F12A 3DV6B 4IS6A 4ELME 1WZKA 1D5XB 3HHSB 3MFFA 4N8CL 3QJFB 4TUUA 1GIGL 1SNRA 2C1PA 3QQ3B 5EIIA 4OZ4B 5C0BD 2O61B 4JCMA 2H3XC 3GHEL 5GGSA 3AAZA 1CCZA 4AVIA 4LRNH 4GO6B 3S96A 3RY6C 2YS4A 5DFVC 5JHLL 3M7FB 3OZ9H 2CBMA 2HX7A 3QHFH 2V7NA 3PREA 4WHYG 1KGWA 3LRSA 1XGYL 2FTAA 3M86A 4IU3B 3AXIA 5C0ND 5BQ7A 2OW7A 5CEZE 4HX1A 3L3IA 1MCCA 3FJTA 1DFXA 4GXFA 1QNZH 4HEMA 3IPEA 5FV1L 4J8QA 2FYYB 1ZT7B 4Y7MA 3SD5A 4F80A 1RH8A 3TO2B 2ZJSH 3FOLA 3HJEA 4YOKA 4RAVA 32C2B 2K70A 3U4BH 1GMEA 1P7QD 1NGPH 3D5OF 3LMJH 4R2GD 3G5ZB 4OKVB 2DKMA 1MPAL 2VSCA 2H26B 5TK2A 1XL4A 2HT2C 5AVXB 5K1JA 3RTQC 5FKPB 2EZ0C 4ZX4A 1FO0B 3NA9H 5I1CL 4ODUB 5I8OH 3MV7B 1KFGA 5KUKA 5TJWK 4LQFL 3UGXA 1L9QA 1WIUA 1MJUL 4OQTL 1HL5A 5SX5K 4R0LC 1JN6A 3LV3B 5DURD 3F62A 1G9NH 3T09A 4BZYA 3FFDB 4K71C 2R83A 4XN5A 5E5RB 5DJAB 1JNLH 3L1FA 3MRBA 3RL2B 4D8PB 3PHQB 3TYFA 1OPGL 5DMGD 4IRZL 4NUGL 3HUJB 2H47C 3MNVB 1ZPUA 2CKBB 3UC0L 3REWA 3D1MC 2WZPA 1SJHB 1Q38A 2Y07H 2H0JA 4AYDC 2PPAA 1F1DA 4MBOA 1FF5A 4Z7OF 1T7VA 3DYOA 3E7JA 5EORH 4BFGA 2RHEA 2NW2A 5I66B 1MCWM 3MBEB 4KVCH 3VTTA 4WFHE 4HXBL 2VIRA 5DZLA 3TWCL 1FVCA 4H8VA 1JXFA 3NSXA 3T1WA 1U8CA 3HS8A 5DJXA 2BHZA 5T3ZD 2B77A 2QGDA 1H3WM 3TO4D 3P9MA 3BAEL 2BP8B 1R47A 5ITBL 4IK7A 1JFHA 4NCC2 5EEUA 4RMUA 3DBSA 4MX7A 2C9AA 3OXRB 4N6QA 4NRXA 3FB8B 1LEKB 1N64L 2PPEA 2VLJB 3HBZA 4KMQA 3HZVA 2AZUA 4JZJC 4G1MB 2WTRB 3T1FB 4QWWC 3AUWB 3BRGC 4BA8A 3V5KA 2BCMA 4WW2F 3TA3B 2GQHA 3H9HB 4RWYH 4NZTL 4XH2A 4ZS7L 5E70A 1MLBB 1YQVL 4KTDL 3B83A 1SOKA 4QXVA 5KW9H 1KZQA 2XFXA 3NAAH 4DESA 4I1RA 1ADQL 1H5BC 3BAKA 3VFVB 4BD4A 3O6KL 5IR1B 2FGWL 5LAPA 4RFNB 2HG0A 1RY7B 3VTMA 1L3NA 3QVAA 1IEBA 2YGPA 5HYJE 3QDJD 5AW4B 2MPAL 3LZQA 1KN2H 3PCYA 2L7QA 1PZ3A 2X2HA 4P2QB 1BIHA 3T65A 4H8WC 3QPXL 4MA3B 3LEVL 4ODXA 1C08A 5EBLA 1C1EL 4X99A 1U8KB 5EU7E 3VXSA 2R0LH 2NY7H 1QWUA 4QRUB 5EOTB 5DYOA 3MYJB 3TA4D 5CBAA 1X3DA 3JZYA 3K74B 3MRPA 1QFUH 3AABA 1UM4L 2R29A 3C5JA 3UIZA 4OCXL 4PGBA 4RMSA 3TV3L 3AS1A 1D3CA 4LSQL 3ZT7A 2AQQA 4LESA 5JORB 1G7QB 4IIQA 1BQRA 2B1OA 3AXLA 3LX9A 3ATAA 3GUTB 3L4WA 1TKWA 3EYUH 1S5HA 4L3EA 4YQXH 3CVBA 4P2YA 1WAAE 2YRLA 3CSPA 5JUEL 3QZBA 1RZKH 1MN4A 1FNEB 3C6LD 1ZTXE 3ARGA 2YMXL 2YRBA 3PWPD 2Z1KA 5D6DC 1F11B 2VR6A 2Z0BA 5KYYB 1P1ZA 5E08H 3EO0A 3OB0H 2EC9T 3FT1A 4ICXA 4WU5B 3OX8A 1QRNA 4MS8D 2X9YA 4EE2A 4N0UB 1FL6B 4NO0A 1CTMA 4GKSB 1V55B 4G71B 2CUAA 2ENJA 3VMOA 3U0TB 5FM4A 3I75B 4FKEA 1ZLUK 4KOBA 2D3VA 2VXQL 3BDXA 4OTXH 2AEWA 4YHOL 3R4RA 2UY7B 1DHKA 4JHWH 4I4WB 3LNFA 3WENA 1I82A 1CE6B 4ZPVA 5AAPA 1FSKB 2TSAA 1NPJA 3C08H 4NO2B 4KI5F 2NYZA 3NSYA 5H35B 4U1KA 3EGDA 4J3OC 1JL8A 1BF2A 2W9EL 3TCXA 2F6AA 4NWUH 5BVJA 1BVOA 3VW3H 4UT6H 4NKOB 3BP7A 3KJ4B 4PJ5D 1FIGH 1FFTB 1N2RB 2X10A 3GSNH 2E3VA 5E51A 4V1DA 3H2QA 4BK4A 4AIOA 5KTEL 1BW8A 3EHBC 2EEXA 3LNEA 3UG3A 3QS3A 1AI1H 5IW3A 1N5YH 1E8XA 2DEYX 1KDJA 1A6AA 2H2PD 3BRFA 3GJFH 4KV5E 4UWQB 4RIRA 4U0RC 1FFOA 3PL6D 1ZT1A 1D6EA 4B9CA 3BVWA 2B4CC 5DR5L 4F37F 5B8CA 4JKNA 4OV6F 3QQ9C 4X5XA 5LXGL 1JYVA 5E5MB 2VLMD 4YLCA 1T4KB 5LNEA 1T0PB 4ERSH 3J27A 2V33A 2E6JA 3WFHB 1K72A 3L3OC 1CGSH 4JX0A 5F3BB 3CUPA 5M95B 1YNKH 2OQJA 3HI5H 2NY6D 1Q0XH 4NNXB 2FJHB 1WC7A 2EO7A 1UH4A 1R5VA 1WJ3A 3UTSA 3VXOB 1AJ7L 3CPLA 4P2RB 2DQGH 4NWTL 1PMYA 2A4EA 2X4TA 2XA8H 4KH9A 4LIQL 4C4BA 1JYWA 1MWAL 3DXAD 2GFBA 3VYPA 1R5WB 2Y4SA 4QD2E 2L7EA 1NMAH 4POUB 3VJ6B 3D08A 2XX1A 4NSKA 4BK5A 2DWYA 1GY2A 1NCCL 4P3CH 4K94H 2DQTL 1LO5B 3O9WD 2FEJA 1A9EB 1ZHKA 3S8WA 1U0QA 2BRQA 4GKZA 2NXYC 2GJZB 2X40A 4J4PC 3W0WB 3BVDB 4JREB 5D7KE 3TPUA 3DETD 4X98A 2PETA 5E4OA 5E9NA 2Y7MA 2OTWA 2WWOA 4Z8FL 2YD1A 1OIOA 1J8HA 5EPMA 1A64A 3AMKA 5I16B 4LCVA 5HDLA 2F2HA 4LNRB 4AE1A 4UQ9A 1ZVSA 1J18A 3TH2T 1BGXH 1F6AB 2QQNL 3S5LB 4Q9QL 4ZFGL 4MA7H 4XMZA 2ICEA 3DJSA 3DX1A 3EF4A 4FFWC 1ESOA 4M1CD 3RIFF 3U46B 3HC0B 3EJZC 3OG4B 2VLRB 4AMXA 1FZOB 3FU7A 4U7SA 1GC1C 2KYIA 1TJXA 3VXMD 2JIXA 1QSEB 1RQ5A 2XWEA 3M8OL 4PRBB 3TJEL 5KVMC 2EDWA 4X4YB 3V4VL 5DRZA 1NBZB 2GSGB 1SXZA 2EIJB 4HSCX 1G9ML 1YAIA 2B1AL 3FQXB 3GXPA 4GQRA 4FQXC 3ZPDA 3MRMB 4QOKD 3H7LA 4D9QD 1F3DJ 4W6WB 5IROD 2VABA 5HHNA 3C87A 4ZXBA 5IHBA 4P5TB 3LEXA 5KBPA 1HXYB 5GHWH 4EUPB 3WTVA 3OR6A 5D96B 2YD8A 5DTFA 1YNTB 4G9DB 2VDOL 1OOAA 5HHVH 3QJQB 1DBAH 3FYIB 4TLTA 5GRYA 1B0GA 5FCUL 5GRXG 2YPKB 4PBWD 4UQEA 4S1DD 1AXSB 4P48A 5C0AD 1RUAH 2DKSA 3NH7H 4NQCB 4ADGA 4BZ2A 3IF1A 3QCVL 5ACZB 1I7UA 1OQXA 2VQ1B 3SGDI 4JHVA 5J6GB 1UUSA 3R19A 1SEQH 4P05A 1C12A 4KKBC 5C97A 4TQEL 5LBGA 4BSVB 3FQYA 4L8DB 3UO1L 1T7WA 4C56D 2BS8A 4OGAC 4EQ3A 5CINH 2UYLA 1VEOA 3DNKA 2AAVA 3C60C 3LQZB 1A6UL 2EILB 3WEAA 5JHDB 2X4NA 1NC2D 4JFYB 3VD2A 1KFAH 3H8NA 3HUJF 2B2XH 1L9NA 1EIBA 1XH0A 3MNDA 3G08B 4UINH 3TASA 5DUBB 5C0CE 3ARDD 3QDMA 4TXVB 3VGFA 4CU8A 1RZGB 2DMHA 4E9VA 3L5HA 5HVHB 4OQ1A 4M6OH 2XG4B 3QWRD 3JXAA 3MRIB 1IGML 1KIQA 2QADB 1N8ZA 2B0SL 4Y4HB 3S2AA 1JMXA 3QARA 3DROA 3DVIA 5F7LB 4JFEE 3TU6A 2EDXA 4LDLB 2F74B 4PRHB 1TZIA 1UA6H 4UDUA 4X6CE 4XVUC 2Z31D 5I74B 2ICWA 3INUL 3FC8A 1F18A 1CD1A 1RUML 2DJ4A 3IDIB 4M62H 4RGMB 4A7GA 1WGVA 2QHRL 4CDHA 3C6SA 4HJ1A 3WY2A 1ZY9A 4IBYA 4B50A 1A66A 2VMFA 2QHLA 3PV6A 4WVRA 4PRIE 3O2DL 1CL7L 4BDVB 4HYTB 5CJOH 1RJLB 2IANA 3O4OC 1I1RA 4FRWA 4OZFA 4X5PA 1N4XH 2ESVA 3Q8AA 4BSWB 2APSA 2QQLL 2O6EA 3X1NA 12E8L 2XTJE 2CKBH 3UROR 3BPNB 2X2JA 2IBZY 3VGHA 4RSVA 1G6VK 3F84A 3T0BA 4C55A 3N55A 2FATH 1YYML 3BLKA 5GS1B 3ULUF 4L1HA 5D7LE 5EOCH 3S34L 1MVUB 1GJUA 6PCYA 1RK0B 2R4RH 8FABB 4GH7B 4L05A 5I75C 1XB6A 4LGRB 2HJKA 5JZ7C 2JCWA 3HPJA 4FMKA 3JT0A 3VDAA 3N1GC 1UHVA 4KQ4L 4XNZC 3R06B 1ILSA 1MCQA 3CC1A 1ACCA 4GRWB 4H0GA 5DRWB 2Q8AL 3WTXA 3NRFA 1DANT 2R0KH 4OJFH 4J1UB 1MEXL 3TZVB 3OC8A 4JFFE 3S8GB 1ZVHA 3F7KA 2MH4A 3OLEA 1YN7A 4N1HB 3E6HB 4YHKH 2EXYD 5I5RA 4PR5A 5ADOH 2NY2B 4UTBL 3K6NA 3FCTA 1KGCE 3NPSC 5FHAL 1J8RA 5F1IA 1GZPB 5AVYB 2FLRT 3AWGA 4HJTA 4KHTL 1NIAA 3QUHA 1F6LL 4GIOA 1F4WL 3ULUH 5IB5B 3R0MA 1U58B 2VLKA 3SBPA 3D8MA 5FA3A 1HIML 4LL1A 3D0AA 3MPCA 1CDUA 4D0BA 4JDTH 5CILH 1ACZA 2BMKA 5SWZA 5GXBB 1RULH 2FT7A 3Q2VA 35C8L 2YD2A 4DGIH 1EAPA 2JKWA 4NHUB 3S37H 1X5IA 2Y3AA 2I9LB 2ZWYA 4I13B 2ZOLB 4V2BA 3O3BA 2IF7A 4L8SB 4LDOB 4E9YA 3EDDA 1AY1L 2GB2A 3D4ZA 5A2IH 4YLBA 2DIJA 2C7FA 3IXAB 2QT6A 1SPDA 3CPUA 4OD3L 1YEFL 4J3XA 2R29L 3MOAH 4PJDE 4Y8DC 1TIUA 4QXWA 2VRAA 3K81A 3UJIH 4GS7C 3QRBA 1KIUA 3DO4A 3FB7B 3MROB 4RGOL 4D0CA 3ZTJH 5IFAH 1XR8B 4RSYA 5FKAB 4EQ2A 3M17B 4X80H 3AXHA 1A7OH 4MA8H 4ZX3A 2DJMA 4LLMB 4EI5C 1NCIA 2WXGA 3ABLB 3B9EA 4Z18A 2PTTA 3MAWA 1FBIH 2X53A 4YH6A 2FWOB 3PWJA 2GJ6A 3SE4A 1MFNA 5KS9E 2BSBA 2FLBT 1OZUA 2BH0A 4RA0C 4IMKA 5GSVA 4AJWA 3OKEB 5ALCH 3FQNA 5MENB 3UADA 1IEAA 4F24A 2ZCKL 3JWOL 4ZPTB 1EH9A 2CJ3A 4D0DB 1GGCL 2R51A 1UD3A 1T6VN 3GPEA 2PW1A 1IQDA 2DWDA 3FQ2A 3ZHFA 3F7LA 4JFOB 1CGUA 3HHMA 3US9A 1ZANH 2HLAB 2X3CA 3T77A 1D7CA 3I85A 1VFAB 1LL1A 5BMFH 4NPYB 4DZBB 2BZ7A 4G7SB 4AOFA 1DN0B 4G7VL 3VI4A 4YHNA 1JTTA 4ANUA 1I1YB 4QF1A 2ATKA 4TLUA 1A4JB 1F5WA 4UNVA 2W0FB 3AG1B 1ZJAA 4AYFA 5E8DH 2J55A 2N3JA 5AOIA 2P49B 2YSTA 3ILDA 2ZWSA 4HBCH 1BLNA 3OKNA 3VXRB 3CK0H 5EBMA 3QEQE 2HWZH 4EN3D 2BVQB 3PRZA 3FKUS 1DQMH 1BOGA 2VB5A 5ADPL 3P11L 4BZ1H 1P9MC 4F2MB 4MCYB 4MVBC 1WGOA 4B3VA 4G6FD 4U33A 4YSPA 1A4CA 3ZE1E 3FAXA 1BZ9A 3SPJA 2YAOA 4UUJA 3BQUB 3QAZB 5DJCA 1CXLA 4CMMB 1KYFA 4G6JL 4LP8A 1E40A 3E1ZA 3Q1SH 1JVOA 4GBXD 1IVTA 1NBQA 4QYOA 5C71A 2F5BL 3T0EB 1JGEA 3GTTA 3WKQA 2OMNA 3BAXA 2FZ3A 1K2DA 3H55A 1JWUA 2R1XA 2YAEA 3ARBC 1UM5L 1L4IA 5GRJH 4F2FA 3GMLA 3NABH 2JFCA 2IBZX 5DEGA 3WJLC 5F9DC 3NJVA 3T4AC 3MFGB 1MQ8A 2DEWX 4WK0B 1QLEL 2HTKC 5F0MB 1E8ZA 1O6SA 1EGJL 4X5RA 4YEFA 3RGVC 1DBKH 1Q1JL 2EEBA 2OBGA 1QI3A 4HCRL 1CG9B 1LK3H 5F71A 5AZEH 4BFJA 2XV3A 2M2DA 5AL8A 1MFAL 1S7UB 3K4DA 3QIBA 4WKZA 1BXUA 3F7RA 2LVCA 4X5LA 3BP4B 1LTXA 3GXFA 3GMNB 4ZZKA 5IQNA 5I1IH 1RJZA 3G9AB 3ZDZB 4Y2OA 1TJMA 3GXDA 4NGHH 4WIQA 4QJ4B 1TMQA 2FB4L 1E9OA 4FTVA 3LXCA 4JZNB 4MQ7A 5IK3B 3RPBA 2YSSB 5HHQB 2FD6H 3BN3B 4YL9A 1U30A 4OZGB 4PMEA 3VYNA 1IEHA 2XACC 1YNTF 4O2EB 4YXLL 3HMXA 4YXKH 1BD2A 4H13C 1NJ9B 1KCBA 3FOMB 5D70L 4W9JC 5KYWA 1VEPA 2YQBA 3LCYA 3NSDA 1X5LA 4G8GD 4CSTA 5IBTL 1LNUB 4EKXA 3C6EA 1NCGA 3GB7A 2E4FA 4ZX6A 4ZQTA 3KW8A 2WIMA 3I02B 3NCFB 5PCYA 4DUWA 5EEVA 2QPEB 4KUCD 4WENB 2VKXA 1VFOA 4M48H 3QQ4B 2EEAA 2P5WE 4WK2B 5EFIB 1DQDH 2OL3L 3KLAA 5GS2H 2WLYA 1J1PL 4WI4A 4XN8A 1I8LC 1YJDC 4NQDA 1M9SA 5C07A 1PLGH 3KCPA 5FYJU 4H26A 1CU4L 4JJHA 3H9SD 4PVMA 4LF3B 4Q9RL 1PU0A 4QT5B 2CJSA 5T3ZL 1CLZL 4IDJL 4F8LA 5T33L 3PP3K 4UNUA 4PJ8D 1OM9A 2OZNA 2P24B 4MNHB 3PFUA 4G1EB 2VW7A 3IU3A 3D3VB 1OCWL 1E5BA 2WQVA 1NWPA 1YY8B 1EK3A 2ATPB 5FGSA 1NCNA 5DDHB 4TM9A 3FTZA 2AQRA 2VDOB 4L9LB 3BO8B 2ED8A 4XI5D 4UTAH 1EEYA 1GA2A 1JTOA 1NCHA 2BNQE 2LABA 5DI8A 7PAZA 1PZAA 2F1EA 3F12B 3ZGIA 5MHSE 4WTWA 2WSKA 2ZUUA 3CQPA 5JDJA 4ONFH 1PG7L 2ZWKA 4U2ZA 5BOPA 4J6RL 4M00A 4MMYB 1EQWA 5GGSB 4H0IA 1GIGH 2A83B 2E0PA 3S96B 3HHRB 3D51A 4FERA 4NQEA 1J0HA 1U8QA 1JRHL 3LRLA 2V7NB 4C4KT 4KXZI 5JXED 3LRSB 3LKPB 3WUWG 5JHLH 4X8GA 4X6FA 4AVJA 5T1LD 1KF9B 3NK3A 3MV9E 4NC1C 3P4MA 2BNRD 3SJVD 1XGYH 3FCGA 1NFDA 2ICWJ 5EU4B 1LVEA 5CIPH 5DK2A 3MOQA 1IV8A 1M1XA 1NQBA 1UXWA 1KGXA 4JDVA 3KPRE 5D72L 3SE3C 4AQ1B 1MXGA 2DOCA 5D7JB 1MPAH 4Q7DA 5KANG 3VSQA 8PAZA 4GRWF 2O93L 4R3SA 3WIHL 3GLAA 2WQWA 1ADWA 5EOQL 4BHUA 1XGUA 2FSDA 4DEWA 1I8MB 4PCYA 3K2UL 5I1CH 3DIFA 5KVDH 4PY8J 2IDCA 3V0WL 2QVIA 3UBXG 4KY2A 3EKCA 3B1TA 4LQFH 4OQTH 1MJUH 4QTHB 4BRVA 3GIZH 4CRPA 2R9HD 1J8SA 4IK6A 1A6TA 3MRBB 1XV8A 3TYFB 2CBTA 5EUOB 1R24B 5I0XA 1UOVA 1A7BA 1OANA 5L2KB 5E6UB 3EW3B 3I6GA 3LKQA 1OPGH 5ID0B 2BC4A 4IRZH 4NUGH 2VQTA 4I8DA 4OIBA 3NEOA 5IJDC 3EJUA 1VERA 1MCEA 3UC0H 4ZI8A 5K93A 4MWFB 3TNMB 2GCYB 3P73B 1EX0A 4NX0A 1DQJB 2KC0A 2VIRB 2IH9A 3B2UC 3ZBMA 1Y1UA 3CZGA 4J7RA 2EJ1A 3VXRD 1XWVA 2FEEL 3DLQR 1PPIA 1HQ4B 2VW6A 2CHXA 4BQCA 1A6ZB 2I24N 4H88L 1L0QA 4GRWH 4GO8A 4WJKB 4LLWA 4UV4L 3NCYP 2WY3B 4PIRF 4E9XA 5HDWA 3P9MB 3FNKA 2ZUWA 5F6IC 2YBRA 4FC3E 5C0RL 2R69L 3P0VH 1MI5D 3LN4B 4MX7B 4OLYL 1KTLB 3WGVB 3BAEH 2R8SL 1CIUA 5ITBH 3RA7L 1ZGLA 3MA9L 3HZVB 4V11A 3CFKB 3H3PL 1D2OA 4RDQG 1KCVL 5F88A 4PJXE 2V9TA 4AMKL 5T3XD 1N64H 1G6RA 4TN9A 3RDTB 2H3NA 3OJ2C 4H8HA 3V5KB 4EDXA 5DMYA 5FGBC 1USZA 5TK4A 3ZKND 5E8NA 4XC3L 3CFNA 4G9FD 1U3YA 3FQTA 1NGWA 4NN6B 4YC2C 4ZMLA 2XBTA 2XFXB 4LLVB 3FB6A 4NZTH 1ZS8B 3FTGB 3D85D 4LDCA 1SUJA 4ZS7H 1YQVH 4KTDH 3QUYD 3CVCA 3ZDYB 1QW9A 2J6EA 1GGIL 4M3KB 2Y1ZA 1IEBB 2DAVA 3O6KH 4L4TD 3VDBA 2FGWH 1I4FA 2EH8H 4GKNA 3STZB 3WUZA 5KSBE 4I18C 2EDEA 1XBRA 3LDBC 3LB6C 1JP5A 1S9YA 2CO3A 1WSST 1TO5A 4F33A 2MPAH 3ARYA 1Z9SB 1EEUA 3WG7B 4LXFA 4ODXB 1C08B 1J8KA 1OAJA 2NCEA 4X99B 5CJQL 3VXSB 2FJFB 1HKLL 4HUXA 3CFJB 5JMOC 3IMSA 3AQYA 3GSWA 4M7LT 1C1EH 4LKXB 2MOQA 2QSQA 3C5JB 4PGBB 2X6CA 2N59A 2VM3A 3B8SA 1EXUB 4LHUG 4CJ0A 1UWYA 3WMPA 2RR3A 4QKXB 2RGSA 1UM4H 3BIAX 4K73A 2D8KA 4OCXH 4HIXH 5K1VA 3TV3H 3IT8D 1U4EA 4GRLB 4J3SA 1E27A 4LSQH 4X9IA 4FLRA 1I8UA 1TKWB 4L3EB 2IWFA 3DMMC 3HE6D 4XGZB 4LPVA 4YHPB 5GRUL 2FO8A 4G6MH 5BZXA 2AJ3B 1WA0X 3ARGB 5JUEH 1P1ZB 2PCYA 5KVGL 2X4QA 4ELKA 3OX8B 4WU7B 2YMXH 1BM7A 5F7MC 3B3IA 3CZLA 1CIDA 2N1KA 4NO0B 2HH0L 3FTYA 3IK2A 1E4WL 4PJBA 3ULSB 5LQBL 3WIIL 2WKOF 5IMOA 5BOZG 4OF5A 3ILQC 1FCCA 1BAGA 4KKCC 1P84J 2WAHA 5KANI 1O6TA 4L37A 4WGVB 3VWJD 2UWEF 2VXQH 4X6DF 1AR2A 3RVTD 3ULVL 2VDPH 4PJHB 3WNPA 3AM8A 1YC8A 4R8WH 3JQOB 3UBXI 4U1KB 4EKJA 4PS7A 4APXA 5B1BB 1AKJA 3AGWA 3EOTL 3OMIB 1GYAA 4MYPA 3NOIA 1KXQA 1M71A 5C0IB 5BVJB 2QTVA 4Y4FC 2O6PA 1D9KB 1S7SA 4N28A 5ALBL 4G70B 2W9EH 5KUMA 4UM9B 3RPIB 3L2MA 4K7FB 4GUOA 1YCSA 4E36A 1E28B 1TENA 4JN1L 1AXTL 4WNSA 3GBEA 4TVPE 4QRRA 3ATDA 3R1GH 3QK0A 4L9DA 3KXFD 4OZGF 1A1MA 3LZPA 5C08B 5CN1A 3VX1A 3WKPA 4R7DB 2DBLL 2NY5L 3MNZA 3FO0L 2W60A 1XTLA 3UTQB 5SWSB 2XWDA 2A74C 2JK5A 2XTLA 1BHGA 2ZUQB 3A4AA 1FFOB 4UT9L 3VCLA 1D6EB 5FUCC 4JR9L 3ARSA 5B8CB 5DO8A 1DCLA 2HG5A 4B9JA 2PXYB 3LNHA 4HCIA 3ZT5A 4Y16D 1S2EA 5DR5H 1SVZA 2MNUA 1A1OB 5J1SC 4KO6A 3CUPB 5LXGH 4FA6A 2NY4C 1QLEB 3FTWA 1ITCA 3OF6A 1QA9A 2GIMA 4JM4H 4ABUA 4PV9A 5TE6L 5I0ZA 4P04A 2BZCA 5DGRA 5A7EA 1CFSA 2IFGA 1R5VB 4ODSL 3GKZA 3QR0A 1QWNA 3MLSL 1RSFA 4JFPB 4GRMB 5B22A 4FNUA 1TG8A 4BYHA 4LZKA 3U0PA 1E6JL 2X4TB 4QJ3B 1U3HB 5C0GB 1F1GA 3QUKB 4ODWA 1NIEA 4UQIM 5I1GL 1AJ7H 2GFBB 1FVEB 4YZFE 3OXSB 1I8LA 4NWTH 1DVUA 1BREA 4LIQH 4NI6A 3QEUB 1QVOB 5L0QB 3RTLA 1MWAH 1H0DB 1I1FA 1MCHA 3VD1A 4MAYA 1L0PA 2NX5E 1ZHKB 3U7WL 1KJ2A 4XNDA 4X6BA 1WBYA 4RAHA 1KNOB 1XSIA 4M7LH 4LVEA 3TBSB 3S7GA 5M7QA 1VRSA 1G0YR 1NCCH 4RRPA 4W6XB 5AKVA 2WZPD 4X98B 3TPUB 2OTWB 5FFGA 3SSGA 1NPNA 2LLGA 4LDEB 2NTSP 2Y7QA 4W9CC 1N6QH 5I8EA 1E9PA 3LD8C 1HNYA 4G8EA 4Z8FH 4YX2L 1UACL 1REIA 2A6KB 4JDEA 4DCQB 4MD5B 3GSQA 4L4JA 3G04A 3QNXA 1WCBA 3PWLA 2JKRM 1N59A 1WISA 3BSZL 5DRXA 3FU7B 5F6HI 3ZKSD 2OAAA 3ZO9A 2QQNH 4Q9QH 3RWDA 2JIXB 4OT1L 1NLDL 4ZFGH 5C8JA 1ODAA 2OL3B 4K9EL 5DRZB 1XT5A 4UOW0 5CJ8A 5D7KD 3M8OH 3TJEH 1AVAA 2K0RA 5FYKE 3BPLC 1T22B 3V4VH 1VSCA 5AW0B 1G9MH 2B1AH 2P7TA 2QKSA 3KWTA 2EH7H 4FQPA 5C0EA 5BS0A 1BJ1J 1UB5B 3N43B 5DJ8B 2YFOA 2E9IA 2VERA 4I48A 5DUML 1H8OA 1KIPA 3WO3B 5SX4H 4OFYA 1KLGB 3VQ2C 1GGTA 2VDOH 1WPCA 2BSTA 5I17A 2CIIB 2N7BA 3SHSA 1PX8A 5FCUH 1P4LB 4YSUA 3IF1B 1UZ6E 4V33A 1TUPA 1I7UB 2R1YA 3T2PA 3Q05A 3HLAA 1AC0A 1C12B 1YUHA 3QCVH 3QFJE 2D31A 1NUGA 3Q0HA 5FWRA 4HG4J 3MGTA 3GINA 3ZMRA 1KUMA 2J56A 4FQLL 4GG8A 4JM2A 4QHUA 3RLSA 3BUDA 5IKCA 4R5VA 1HE8A 2AK1L 4C4UA 2UYLB 3ECUA 4A63A 1ETB1 2F0CA 5D71L 3K6SB 1PAZA 4IRSB 4A2GA 1UEYA 1HNFA 1BA9A 5EUOF 1A7QL 3H9ZA 5CU9A 2ZG1A 3VB8A 1A6UH 1NANI 4DGUA 4KZDL 4IJ3C 5CZXC 2CUHA 5FOBA 2AANA 3UDWA 5A2FA 3QDMB 1DLFL 5D9SA 3VA6A 1NKRA 4FQ2L 2AF2A 4PS4L 3JZ7A 3S3DB 1T5WB 2H32H 5HYIA 1PX4A 3B3BA 5D1XD 2YAPA 4ZSOA 1PG7W 3MDJA 4MJID 5A6MA 3AB0C 5GS0D 3TCLB 4LPWA 2BIMA 3DROB 4E9QA 2B5IB 1TNMA 5J89A 4FD0A 2AXFB 1AYOA 4UDUB 1IGMH 1UXSB 5LHDA 5GGUA 3HG1E 1EJ8A 4MD4B 3NJHA 5FDWB 3C6SB 1Y1DA 2F61A 3INUH 3ARGD 4QCIA 4AY0A 4OJCA 1RUMH 1KDIA 2QHRH 3GBML 2AEPH 3C5ZC 5I73C 4QRPB 5HPMA 1QRND 3IN2A 1GKOA 4OZFB 3DO7B 1P84K 1QG3A 1CL7H 1XF5B 3O2DH 5FLVA 3MV8E 5DHDA 3KYNB 4P23D 2HFEA 1M3IA 3V9FA 1BQLL 3MNMA 1IC7L 1PVHA 1SHSA 3PAVA 3SCMB 3GSXB 2F68X 2FX9L 4BCZA 3LH2L 2QQLH 1U93B 2PUQT 4BA0A 12E8H 4JQXC 4A2FA 2VYRE 4E5XB 1S7VA 2ZOTA 4XT1C 3VFPA 1NCOA 4UYQA 3LNIA 3SKJL 3ZDYF 1MNUL 1YYMH 3QUZA 3DVNA 3RZCB 3T0WA 1P7KA 2WQAA 3S34H 1V8HA 3EJTA 4IKLA 3MRRA 1QI5A 4BFBD 2RCSL 3FUJA 4Z3TA 3VQMA 5B38B 4MNQB 1MH5A 4XVOA 1EA9C 1JXKA 4KQ4H 1HZHL 3TCTA 4PD4J 1T1YA 1IU1A 5KOVC 2IH1B 3QORC 3WEOA 2JB6A 2Q8AH 4NNPH 3PGCB 4IGBA 2X4UA 1YN7B 3MNWA 4V1DD 4NIYE 5F9WB 1MCDA 1O6VA 2KQMA 1RL1A 1MEXH 3QO1A 1HHIA 1SXBA 3FCTB 4MJHA 3LVEA 1H3TA 2L7UA 3FTXA 4LEOB 3AU0A 1B9KA 1M9WA 4IKNA 1BQUA 4TS6A 3SGKC 4XAWH 2DWXA 2F54A 5FHAH 5J9PB 5B39G 2GSMB 1I85A 4WK4B 3ZXAC 5C3LD 1BWWA 3RPKA 3DDGA 4TLSA 1SVCP 3ARFC 4KHTH 2DYSB 4YE4L 1UA7A 2V2WA 1F4WH 43C9B 5D4HA 2C9VA 1SLXA 3D48R 1D5RA 3BPOB 2AHIA 1P5UC 3TBWB 4W93A 5CF3A 4LASL 3NFSL 5E9DE 3SDCA 2OYLA 3UTSD 5CN2A 4E2OA 2D3LA 1Q94A 1LE9A 3RWCB 3BHBA 35C8H 3FU8A 3O3BB 3A6CH 3WLWC 3NJXA 2NT0A 2Q86A 1X44A 4HW6A 1GGUA 3BWAA 1CFTA 1QBML 4XB3A 4X83A 4RZKA 3CFQA 5CEYA 1AY1H 2IDTA 4PJAB 1ZHNA 3D39E 1EO7A 2QDWA 4K7PL 3L1OL 4YGVA 1QPXA 1TPXB 3FFOA 1YEDA 4JHAL 2ZXBA 4OD3H 5ERWA 4Z5RB 1YEFH 5CSZB 4DP7X 1KPUA 2UX6A 5JYLA 3L2NA 2OA9A 4GAYB 4PJHF 1BF5A 1TCRA 1ORSA 4NCC1 4KJYA 4U1GB 1EZLA 4JRXA 3ETBJ 4RGOH 1BAFL 5FYLL 2HRHA 4MNGB 3Q5YA 4QRTB 2DY2A 2X6BA 3TIEB 3FBKA 3IDGB 5EBWB 1PYWA 1J8HD 4MQXD 3PWJB 4XXDB 2AK4A 5DO2D 4P49A 5C6PB 3TIDB 2YD5A 4N0CC 1UGNA 3EO1A 1BMZA 3DYMA 3FH5A 3P2BA 5GSVB 4R90L 1NIBA 2J88L 4Y1TA 3ZE0E 4B53A 4Z7QE 1IEAB 4XPTL 3HB3B 4FCAA 3FUKA 3DBXB 4CBZA 1BM3L 4O2CA 1M53A 1TDQA 4N2IA 4TPRL 1TQCB 1IQDB 2DWDB 2ZCKH 3JWOH 4Y4FA 4ESKA 1GGCH 5IB1B 4DKFL 1I7RB 5JA9A 4IBVA 4XCYB 5EZLB 4ZXBD 1KTRL 2YPLA 4C57C 2NXZD 1UC6A 3KG5A 3BMWA 4MAZA 5ICUA 1HVXA 3EO9L 4AL8H 3PP4L 4YHNB 4QF1B 5F44A 2ATKB 4DAGL 3LKNA 4G7VH 1ZEAL 4I88A 5A43C 4AYFB 1Q1PA 5HHMD 2XT1B 3GDCA 1T0NB 3OVUB 5DD0L 2F8IA 4HG4K 2BP3A 2OMVA 4N2MA 4P4KC 1F56A 3SKOA 3TM6A 3D6GA 3OKNB 1A3RL 2NR6C 4OZHA 4WHTB 4X50A 5EBMB 5D2LF 3GRWA 2VMDA 2DJSA 1KLFA 4X2UA 1E4XI 2X38A 3Q48A 1X4XA 4GUPA 2G60L 4NQVA 5IWLA 3P11H 1KYOJ 3SDAA 2UZPA 3SOTA 3U25A 2QSTA 3P2TA 2EZ0D 4AM0A 2RB8A 3VFNA 3U30B 5TDNA 3VXQB 3SKUD 4QYOB 3EYVA 1PG7X 4G6JH 4OCWL 2FZ3B 5EDSA 5JOPD 1K2DB 3IE4A 4YL4A 4ZTEA 3VACA 2F5BH 4P5MA 1A22B 4WJ5B 4CC1A 4M9PA 4KKAD 4N2DA 1O6SB 1LWJA 1OTUC 1A7NL 1SXAA 4HISA 2WBJA 1RU9L 3ULAB 3WS3A 1QLEH 4H40A 4JO2L 3RYMA 5HGGS 1M57B 1EGJH 2ROYA 3O6FC 2DLGA 3QUXB 4IRJC 3MX0A 1Q1JH 1VA9A 2H9GA 2X87A 3FRPA 3IFNL 3NZ8B 1CWVA 3QIBB 4HCRH 7CGTA 1PY0A 3CZEA 2YGOA 5IT2L 1BQHG 1JXGA 1MFAH 1YMMA 2HLFC 2BERA 3F5WB 2E7LA 3VYOA 1X5ZA 3CD4A 1E9OB 4GW4A 3JSSA 3RKDC 2Y2TA 2IAND 3GXMA 3MCKA 4Y2DC 2IIJA 1K4DB 1BCIA 3NZUA 3MLTA 4GI9A 3KJ6L 5CEZL 4HQQL 1HHJA 2ESVD 4XCNB 2XPGA 1S7RA 3N43F 1BD2B 3X13B 1V27A 2VW4A 3HZYA 4NZDA 4WUUA 4AITA 5ICYB 3IMBA 2DH2A 5KYWB 5BW7A 4YXLH 1OT1A 3FFCE 4A2HA 5IVXA 1ICTA 3NVQA 5D70H 3GB7B 5FLUA 1IBZA 3QXDB 5IBTH 4DETA 4Z6AT 1W91A 4QWWD 2HRLA 1WITA 4PD4K 4QHKI 4R4FH 2JKLA 1JZEA 3RHWF 4WHDA 4LVNC 4J2QA 5DXWA 5C07B 1NC4A 2YUWA 3AUVA 1N12A 3BUPA 2JCCA 4AUYA 5E2TL 2OL3H 1JD7A 2QKIC 1J1PH 4H26B 4LPUA 1RZIA 3VXPB 4N3UA 1TOXA 3QBTB 2APFA 5AB9A 3HI6H 4PRIA 1LP9E 4JFDA 2DQDL 1CU4H 3HR5A 3TVMA 3ESPA 3H6JA 4Q9RH 3TYGH 3VFRA 2XY2A 2W9DL 4KKPA 3B9KA 3OAUL 5T3ZH 4EDWL 1CLZH 4IDJH 4F8QA 1T2JA 1DVFC 4HCFA 1D7DA 4Z7NF 2WLLA 1MZZA 2HFGL 3LRGA 4FQCL 2HFFA 2CLZA 5G5DA 2CR0A 3BP5B 3MR9A 4FN0A 1OCWH 3B8YA 3PJSA 2M1KA 2WN2A 1ZT4B 4W81A 4X42A 5FUOL 4KK5D 3RIAK 1EEYB 4UMGA 2VLKD 5D7LA 3AREC 4XMXA 5BO0D 4DEPB 1CBVH 3M6DA 3WN5C 2BIPA 2EICA 3ULUE 3FHQA 5SWZD 3A47A 4OR1A 3EYQC 3HN8A 5IZ7A 3HC3L 2VSDA 5DZPA 4UNTA 3INOA 3FZUC 4YDIL 4JG1L 2HT3D 2F7PA 3QIUC 4NKDA 5KSAA 4E9SA 1PG7H 2CJUL 1JF5A 3K0WA 1T21B 3QDHA 4J6RH 4PW9A 4GLRI 1U8QB 2IPUG 3DOIA 1F4YL 4ZD3L 4ZNCD 4TUKH 3I9PA 3KL0A 5JTWA 5FW6A 1NEUA 4JFFA 4N24A 4PJ7A 4EVNA 1JRHH 1KC5L 4JUSA 4HZ1A 2BSEA 1NMCC 3CHOA 1K4CB 2XXFA 4HFWA 5T1KB 3BGMA 4LAJH 4AK1A 4FQHA 2R2HA 4ZUSB 5I1JL 2GBAA 4M1DL 2WAQA 1KB3A 3GI9L 2FNBA 5BO1L 4X0KB 3V4PA 5D5ME 1SFHA 3AY2A 4R96A 3UTZB 5HGAB 3WFCH 2NQCA 4YS4A 1QFHA 3SYOA 1A7PL 3MU3A 2OMUA 1EPFA 2GJ6D 1PZSA 4PRAA 1RIVL 4FFYL 5D72H 1NDGA 4DUVA 2J5WA 3W82A 4G7RB 4G80B 3Q8BA 3HAEB 3TBYB 2GIXA 3SDXE 4K0OA 5FUCE 5EC1A 3K2UH 3VXUE 1J12A 3V0WH 5JPMA 2X6MA 5LGJB 1JHTA 4QUOA 1DO5A 3WAJA 2X6VA 5K9QG 3MN8A 2PO6B 3H54A 2FWLB 5SWQA 4F57L 3TS8A 2ITCB 2ZP8A 1AHMA 3I6GB 3ABKB 4YFDB 3PWNA 5JQIB 5I5JA 3DHJA 1E7UA 4GJTB 2ZAHA 3V5DB 3US1A 4Z3IA 2B20A 2AJUL 1FFPA 1OAUH 5CN3A 3ZYIA 5F3FA 4YAQB 4GAJL 1J0JA 2CGRL 3O81A 4XOCA 4ZQKA 1KYOK 1ZTXL 4LPYA 1MJ8H 3QQ9D 3CQQA 3ARFA 5DHXB 3GTVA 3NIGE 1OK0A 1QZ1A 2L3BA 2KI6A 2WQXA 2VLLA 3FB5B 3J7HA 3S9DB 3AQZA 5ACMA 3ZUNC 2QJDA 4JK0D 4MJ6B 4AW7A 4OF3A 2VDQL 3VNZA 1UT2A 1DSWA 1CGTA 3T8XA 4PJAF 3C09C 5HGDB 2Z93B 5C0RH 2Z35A 2R69H 5C3IA 3CDFA 3O2VH 4OLYH 4Y5YC 4N85A 2ZNWA 4LMQI 3RA7H 3LNGA 3MA9H 1OSZA 5LGKA 4JRLA 3H3PH 1KCVH 4HUNB 5E8NB 4AMKH 1ROCA 1NGWB 1TJIL 4O02A 1JDDA 2OZ4A 2W91A 3UACA 3FB6B 3BVTA 4XC3H 4HKBA 4TTGA 3IDYC 3K4ZA 4JS7A 4XBMA 1MHPH 2H6PA 1AZCA 3MRFA 1MDTA 4A2EA 3M88A 4U0QB 3P1VA 1S3KL 3WGUB 4NP4L 3CC5B 5FA4A 1GGIH 2GKIA 1FAKT 3BW9B 4U3HA 3RU8L 2ZYHA 3NJMA 1OXYA 4DP8X 2ZSVB 4P99A 1I8KA 5INCA 1DSFL 2AEQL 2NY3B 4FFWD 4FTVD 3EJZD 4XXCC 1BP3B 2ZWLT 3B7YA 1TQVA 2J12B 4H1LA 4HUXB 4P9HC 2PYEE 2H1XA 4OJDH 3L3JB 5CJQH 2DB8A 2ADFL 1BPVA 3Q6FB 5J13B 1HKLH 2YKLL 1RXLA 5I28A 1RUPH 2PP9A 2I9TA 4MSWB 1CXEA 2BSSA 2XN9B 3WFEH 1HJBC 2MKWA 3ULVF 4FAAB 3NJIA 4NRZA 3I9IA 1LEGA 4U3SA 1DQKA 4WUKL 1AD9A 4KK6D 5T5FL 3MRNA 1CICC 5AUMA 2JE8A 4PCKA 4M8RA 2RIKA 5GRUH 5J11B 4MQSB 2PWDA 4AGOA 4L8CB 3BP6B 4LNVA 5BV7L 4NQDD 4NZFA 4FXGA 1Z66A 3JBG7 3Q8FA 3QFGA 5KSVB 1A7RL 4KKBD 5D93C 3EG9A 5KVGH 1M6OA 5IM7A 2LGNA 4QLWA 1FYTB 3B5TA 3LHAA 3CFIC 4XNAA 5CBEA 3UL4A 3HCVB 5GGTL 1EFXA 3OHMB 3I6SA 3K0YA 4OGAD 5DS8B 2E7CA 2HH0H 5K9OB 1TZGH 1E4WH 4L0PB 3C60D 4PRDA 3WIIH 4L23A 4PP2A 5LCVA 2D03L 4HZAA 3MUY1 1HSBB 1Z1WA 2IAMA 4P46C 3GKWL 3AQDA 4K7PY 4YHMH 4Q4EA 5ENWA 4EZJA 2AC0A 3ULVH 3RAJH 4APXB 3IGKA 4XNUH 1AKJB 4AZUA 1PQZA 5AYQA 1JZ6A 1H6UA 1M71B 1NGQL 3ESNA 5KG9A 5I1EL 1M2OA 2WCSA 2KUTA 1WYJA 5K9QI 2AGJL 1C7TA 1QLRA 3QR2A 1BXAA 2BX5A 1G9HA 2HX9A 2A77L 3ZZSA 4XVSL 4HS6B 3SD2A 3LQAC 4XVUD 5C0JA 2AQ2A 5ALBH 4H8PA 4P57A 5HY9A 3DI2B 4QRRB 4KQ0A 1E9QA 3V0DA 4GSUA 3UC2A 4NQED 4B9ZA 3ELQA 2WMPA 3NJNA 1H3XA 3L95B 4JN1H 4KROD 3ROOA 5AOLA 5HD8C 4M5SA 2XBDA 1AMYA 1LK2B 1MFDH 3ILPA 5DHVA 4PJFB 1SHXA 2NY5H 2EE9A 3TONA 1P1VA 4JQIA 2G9HA 3BFOA 3FO0H 4GNKB 4FYSA 1MCBA 4OW6A 4KX9A 4X8JA 4HJIA 4UT9H 3QIWA 2FWSA 3UAEA 2X0WA 1WS7A 5FPIA 4JR9H 3GSUA 2EO1A 5A6LA 3OZLA 2XNAA 2XXMB 3HNTL 2XVLA 1J0KA 1QA9B 3WMQA 2AV1B 1CXFA 4PV9B 1G7PA 3HFML 3QFDA 1OW0C 1F3JA 4PP1C 3TBVB 4HXAL 4XVTL 4ELMB 4NJAL 3PJNA 4G2AA 5TE6H 1N6UA 4AJVA 4J23A 1E65A 1S9VA 4ODSH 3N85L 2GHZA 2E4TA 4R97C 3SGJA 4YXHL 2DF3A 5BNXD 4GSQA 1RVFH 4M8VA 1E6JH 5ESAA 2VJ8A 4FXKA 4UIKL 2H3KA 1J86A 3V7AG 5I1GH 2QKIA 4APQC 5KVDE 1V3JA 4MAYB 4DQOL 3NDYE 4IU2B 4X6BB 4XR8C 3ARRA 4M6NH 1NOFA 3KPTA 3U7WH 5DC9B 5CLZA 1ETZB 4YDVB 4FLHA 2WGNB 3BRDA 3E80A 3P3YA 5I8EB 2E27L 2YD3A 5I23A 1DJWA 1QYGL 1PTZA 2VITA 3K6IA 4JDEB 4AIZB 1HZKA 3GSQB 4YPGA 2IADA 3PWLB 4I0PA 1N59B 4YX2H 1UACH 2P9RA 3N42B 1MFBL 2IDQA 3PHAA 4HEPA 2NX5D 3MRKB 5TQ2L 3V8CA 1JZ7A 2G3NA 2FQEA 3BSZH 1O5PA 5SX5H 2EDYA 3UFIA 4OT1H 1HNGA 4PGCB 2BWDA 4RMWA 2OYMA 3S5ZA 1XH2A 4OJYA 4FMFA 4UANA 4B9FA 2NSXA 5JO5B 1UB6A 1T83A 3D0VB 4NKMA 3VU2A 4BH7A 5E2WL 3U6RB 4BKTC 1A9VA 5C0EB 4PU2A 3S4SA 3F8UB 7FABL 1B9ZA 1YC7A 3T6XA 1L5GA 1B0RB 3A22A 1HHGA 4QMEA 5ID1B 2PTVA 3KZ8A 1L9TA 2J43A 4LLQA 1G7HB 1WLHA 2A2QT 2W1NA 2BSTB 5DUMH 5I17B 4PRPA 3FT4B 4FQQA 3FONB 4OZIA 4Y5XA 4KOCA 1U8HB 5K5YA 1TTBA 2X89A 1J9TA 1YUHB 4OGYL 2VTFA 3RI5F 2E8YA 2WCPA 1GOGA 5FO8A 5IKCB 3WTSA 2CO6B 4B95C 3G6JE 4XX5A 4HAKA 4G7YL 4FQLH 5E2JA 1JGDA 1OTTC 3DVFA 1BV8A 5B1JC 5HYSB 1I3VA 2AK1H 2NUTB 3O45B 4PGEA 5BUGA 4X7CC 1YG9A 4EUPG 2ENSA 2GPZA 1Q9LA 5D71H 1KIRA 2C8NA 5DMGC 3SYQA 4DQAA 4O4YL 2ADJA 2CO1A 1KYUA 5D9SB 1MIML 2ZTBA 4YBLB 1VZHA 2X4RA 1CI5A 3R0NA 5KAQG 2BWIA 1DLFH 1M2VA 1MXDA 3N50A 4FQ2H 5AKTA 3SIKA 4K7PX 1NBYA 4W9HC 1OSPL 4JFXA 3VU1A 3RNKA 3KPSE 3NQIA 5EA0H 5DJDB 5C09E 3RDJA 3OWRA 3VRIA 3KLKA 1K9TA 1AO7D 5F97E 2A9BA 2IVFC 4N2LA 3IMTA 4QCIB 2YR3A 4D9RD 3TO4C 5HYJB 4JLRA 2GTWA 2MQGA 2O5NA 3HAEH 5DZ9A 1EDHA 3KHQA 5C70A 1AGCB 4L4VD 4MQTB 3EXLA 2QDVA 4OJAA 5AOMA 2BPBA 1KT2A 2D7MA 1IJNA 5J56B 3VFMB 3WKML 1WD8A 2XN0A 3B9DA 4MVBD 2ZXQA 3BLPX 2GEEA 2A6JA 3ALWA 3ZRCC 1Q8MA 1FH5L 1WAPA 1R33A 2ZQKA 2VOTA 2XKSA 1BQLH 4IOSA 1GYWA 1Z32X 1GW6A 2ZWZA 1C8QA 2AV7B 2BOCB 3FU5A 5E6IC 1S7VB 3NYKA 3VFPB 1Z9MA 2FX9H 4PGZA 4OUOA 5I1DB 2YHGA 1BLIA 3W5NA 3QUZB 3MKKA 3ARBD 2B1HL 4RBPK 1P7KB 3F2LA 4YR6A 4ZNEA 2APBA 2MMXA 3MRRB 3SKJH 2ILLA 1MNUH 5F9AC 5FOJA 1BFOB 3IFLL 4U49A 6CGTA 1PZCA 3L3KA 2CDGA 2PCFA 4Z7VA 1OP3K 1MH5B 2K45A 4X8CA 5CLWA 3TP4A 3S3BB 1T1YB 2RCSH 4MDJB 3U48A 4HU8A 2A73A 2MEJB 4ICWA 1I3RA 1HWGB 2JB6B 4IGBB 1HZHH 5EUKA 4U2YA 3GFUA 5A2KH 1R3KB 3BWSA 3QULB 3GF8A 3CVHL 1BBDL 3OV6A 5A2JH 4FL4C 5JLZA 1OCRB 4QXTB 1DEEB 2P8MB 4S0TD 5LGHL 4TNVK 4Y19D 4TUJB 4XXCA 2YIHA 4JKMA 1ZV2A 2GK0B 5ISZA 5IESL 3MRLA 4W9LC 2Q7YA 4OAWA 5F3HA 1UGKA 2YD7A 4WTQA 2FECI 4FDWA 1CLVA 5DMJB 3PF2A 2YRZA 1DVQA 2YEZB 4GKOA 3IDNB 3OF6D 4YE4H 4R7NA 1DLHB 4PEEA 4PJ9C 3HEIB 1TFPA 5ICZB 4GG6A 1DQVA 2AXGB 1LE9B 3FUEA 4OM1L 3DV4B 4LASH 2WLIA 3NFSH 2J7LA 1A3ZA 2IOOA 3VWKB 3S3CB 4JQVC 1IZKA 3A4EA 3BWAB 5E99L 5CEYB 5HHOE 1ZHNB 4EN2A 1OV8A 1RKRA 4YGVB 5ERWB 4F7PA 5JNYB 2EEFA 3FT2A 2UUDK 1QBMH 4B41A 5MEQA 4NN5C 5IEKA 4K7PH 1KPUB 3NRPA 3L1OH 2O30A 4JHAH 4LO9A 1XR9A 1M7XA 3SDDA 4NO3B 1ORSB 3DUSA 3C8KB 4KJYB 3EAKA 2VDKL 1JWSA 4KHXL 5ES4B 3AC0A 3D2TA 5HYQA 3L9YA 3NP4A 1YNLL 1YPZA 5EH1A 1PYWB 3UEQA 3R7QA 4DH2A 1BAFH 5FYLH 2FEDD 1DJXA 3BZEB 1CDJA 2V8LA 2BIQA 3G6DH 3W9EA 4NQQA 4J39A 1HYRC 1W72L 2ADGA 3EO1B 3NFPA 4IIZA 4QRFA 4JGNA 5B1CA 1URIA 4JO1L 2G4EA 4MCZB 4PB9L 1V3KA 1IAMA 1J9QA 3K8KA 1T5XA 3G5VB 5KJRH 3TN0A 4EIBA 3GMQB 2J88H 1U4FA 1W80A 5D7IA 3CBRA 4XPTH 4MJJA 5I9QC 2FQGA 1I7ZB 3V9EA 1BM3H 5H4ZA 1D5BA 5BV7B 4FFTA 1XCQB 3QDGE 5DYFA 4TNEA 4TPRH 5LBSL 4PVNA 5FYJD 5JPNB 4CGUB 3GBNH 5DJ6A 2WXLA 4PJFF 4TSAL 1T7YA 2ZXCA 4XBPA 4DKFH 1BQKA 1EFQA 3CHSA 4ZFQA 5BS0D 1B90A 2J2ZA 4O2FA 2FHFA 5TH2A 4PB0L 2W95A 2H2PC 1A8JH 1EDYA 2NNFA 4W9DC 1F4HA 4M61A 2WUCL 1XGPB 2ZG2A 3V8OA 5IOPB 3EO9H 4YEEA 1DDTA 3PP4H 4XNMA 1T3FA 3JWNH 3T3PE 4RMQA 3GXNA 5G55A 2H1LM 4UDTB 4DAGH 1BBJB 2MNJB 3ZTEA 4H8WL 1ZEAH 2P5EE 5DJ2B 4JN2A 3UAAA 2VDML 2NY6C 4ELMF 5F7HA 2Q3XA 4L3AA 1PDKA 2VR8A 1KLFB 2BIHA 3BVNA 5JXAL 4NQVB 4JM2D 3RIKA 5I71B 1DQQA 3QZOA 1TJGH 3SDAB 3TNNA 1ONQA 2ZXGA 3BCDA 5CGTA 1OW0A 3L81A 3HVNA 2Z7UA 2ZKYA 2G60H 5TDNB 2VISA 4X5QA 2IMNA 3QS2A 5BRZD 3PXLA 3EYVB 2PPDA 4HV8A 5FK9A 4QAMB 4EO5A 4PCSA 1U8OB 5D6CA 4X7DC 3D4GA 2VMCA 3O9WC 1EZUA 4GUCA 1UVQA 4FLQA 5HDQL 5TQ0L 5AVRB 4OCWH 3DUHA 2K9FB 2NSQA 1DZBA 1RZ8A 1QWHA 2NY0B 1TVBA 2VR7A 3BVXA 1GGYA 4MB4A 1K5NA 3BZ5A 3UZQB 2WBJB 3ABMB 4K3EL 4K3GA 5IUSA 3NIDE 1UKSA 5CZKA 4X5WB 3QCUL 1GW0A 1A7NH 2E86A 3Q6GL 2WKLA 3N42F 4NOFA 4ZFZA 1XSJA 4M1CC 3HIZA 4PJCE 1ZLWH 1SGKA 2MCAA 3GNML 3IFNH 4JO3L 1TVHB 3FUHA 3OLGA 4JO8A 5IT2H 2WINA 1T20B 3QI9A 2QMKA 2I60L 3LHPL 1KYAA 3SGEH 2N0MA 2WVTA 4ETYA 2KBGA 4LVOB 4RDBA 4KNQA 1HHJB 1QSFE 2XPGB 2YGQA 4X7TA 3RWGB 1K85A 1G7IB 3HE7B 2RFXB 4UM8A 2X3BA 4QLRA 4U1MB 5A16A 3KJ6H 4W9IC 5F7BA 2ZUYA 4MHHG 1VADA 1W2KT 3V6FA 4WF7A 4QPEA 5C0CB 4S1DC 3RY5A 4YDKL 1SEBB 2H2SD 1RZFH 2N4IA 2UXTA 5DCCA 1L6XA 2PCXA 1WS8A 3QYCA 4JFEB 4F27A 4LEXL 3EDEA 1T80A 4JBSA 4R4ND 4WW2A 4X6CB 2Y7NA 2J44A 3V0VA 1ED3B 4LSTH 3PUCA 1HHKA 5E94B 1IBFA 1CXHA 3VG0H 4LSRL 3D30A 2P46B 1RZIB 2XQYG 4CN4A 4OCMC 2OFQA 3KL3A 4U4BA 5IHWA 5E2TH 4ZAKB 4FS0A 4PRIB 3X11A 4JFDB 1VFBB 5D1QA 2Q6WA 3S48A 3LYRA 1KBBA 3LB6D 3MREB 4AT6A 4Y4KA 4HUMB 5B1JA 2PR9A 4Y1AE 1T7ZA 4PV8B 1LO2L 3ZK0A 4EDWH 2XTJB 3ARDC 2CLZB 2GTZB 2Y72A 1AH1A 2F54D 3PJSB 1OWRM 2A6DA 2QV2A 2G0LA 3VGGA 4FQCH 3PNRB 5D7LB 1X7QA 3L5WA 5HI5C 5AB2A 5E4IA 4JJOA 3TEZA 1L7IL 4HJGB 3CVDA 5T3XH 5IEHA 2Z31C 1FFNA 2WXNA 5DS1A 4Q97A 2JVUA 1IAIL 3NQKA 3SDCD 4KH2A 2E74C 4NKDB 3ZRSA 4G42A 4GPVA 1T2QL 5AVSB 1EHKB 1OB1A 3EOBA 4JPKL 3L4UA 1G7LA 3IKCA 3KH3A 3V5HB 5CJXA 4YDIH 4JG1H 1BFVL 1T6BX 4DP2X 4CILA 3WL9A 2DQCL 4JFFB 4UT6A 3N40F 4PJ7B 1U8IB 4MZ3A 1BFSA 3FO1A 4YSCA 4ZD3H 5L2JB 3M1BB 1Z9LA 2CIKB 1BQHA 2IPTL 2WOBA 4HFWB 4ISVA 5DGQA 2B7DT 2VXVL 1JK8B 3PQYA 4WWKB 3JWDC 1KC5H 1CF8H 3GSNA 1ZKAA 2A0LD 1Z9PA 1FNSL 3WAKA 4HSQA 4EI6A 3KHOA 1GC1L 3CN1A 5F89A 3B9VA 4JRXD 3V4PB 1NEZG 1DJSA 5IB3B 5I1JH 3ILQD 1FSKC 4FNRA 3T2OA 5DF0A 3GI9H 2OMUB 4N2HA 2NDFA 4LCWD 3MACL 5BO1H 2AK4D 4ZOEA 1BFTA 2KKQA 3GJFA 1WAAF 2VZ3A 5E1GA 3UAJC 3P3SA 1A7PH 5EIIG 3VGEA 5HDBB 5C0DA 2XZCL 5I0WA 1RIVH 1NTDA 4FFYH 3CHQA 5E9AA 4YK4B 1NUDA 4WI3A 4KX7A 1MNNA 2A99A 3BISA 4F7EB 1RLWA 3T2LA 2F7QA 3OJDA 4Y4FD 2G3XA 4GI8A 2WN3A 4IOIB 3VI3F 4LCYA 1JHTB 5DHYB 2WTOA 4UOJA 4ES9A 2EXYC 4BGDA 3O8XA 3HS0A 4JFZH 3WS6C 3SYAA 1HHHA 2YPLD 5SWQB 2D2CC 2VXSL 1HS6A 4FNTA 2BVOA 2Y6TE 4RMRA 4F57H 4HT1L 3FT9A 1NINA 1FFPB 2CCWA 3SKNB 3UTTE 4W9GC 2YOCA 2XWBA 5E5LA 5DD6B 1S4IA 2W9LA 2DN7A 1EXHA 4JUTA 2ZUSA 1P4BL 4ZQKB 2AJUH 3PWVB 3W56A 1L9RA 2R23B 1S7WA 4WTXA 5CLYA 5KS9B 3LN9A 4GAJH 4XX1G 3W1ZA 4AYBA 2CGRH 2CUMA 3ZKXC 1DUYA 1NMBL 4AENB 1ZTXH 2VLLB 4MHHI 3WXVH 5TGBA 5H4YA 1G94A 1NCBL 1DEDA 4ORGA 1A1NA 3VFUB 3A6BL 3T8XB 4DP6X 5IB4B 5GRVL 1V7MH 3PXJA 2Z35B 4PAZA 1F00I 1N3NA 5L88L 2VDQH 4YHLL 2F8XC 5LWYL 2QR0B 1NIDA 2ISDA 3P30L 2BDNH 5F2FA 3RWEA 5BZDB 4GT0A 2FIKA 3KH4A 3R7RA 2D7QA 4DSYA 1T6WA 2YPVA 4NS0A 2HSIA 1KG0A 4O02B 3RTQB 1EHLL 4JREC 1XF4A 3DC0A 3ZTNL 3T6QC 3GS7A 4XNYL 5C0BE 3OKMA 1PLBA 4ZFFA 3FMGL 4A67A 5DUPL 1TJIH 4AQAA 3N9GL 2C3VB 1I7TB 4R0LB 4A68A 2E46A 2MQ0A 1P5VA 3MRFB 3ZHKA 3QEQB 3CFBB 4MDRA 1M7IA 4KK8D 2VR4A 2XG5B 1BYNA 3OMNB 1S3KH 4TVPL 2IOMA 1YMMD 2P8PA 4YDLC 4NP4H 1TYRA 3ZE1B 3S3PA 1JNJA 1I8KB 2X0VA 3RU8H 4WV1B 1D5XA 3HHSA 2A3TA 3HKFA 1KTJA 2N56A 2VL4A 5CJBA 4Q6IA 3D9AH 3QQ3A 1V3LA 1RK7A 1DSFH 1XGTB 2AEQH 4OZ4A 2O61A 4P5TC 2Z4QB 4JAMB 4WUUD 1HEZA 1QZNA 5LNDA 3E2HC 1GSMA 2ADFH 3G5XB 4E9WA 2WD0A 1OAXL 2I26N 2H45A 1YN6B 2FYVA 2YKLH 5LXVA 1L9OA 4NRZB 1LEGB 2MCMA 4Z0BH 4JRFA 1AD9B 3VVWA 1IC0A 2JI1A 4ZK8A 3U4BL 4ENED 4HVBA 2FYYA 1ZT7A 4WUKH 4DVBA 2WUBL 4M1GL 2XPYA 1S9XB 2WNGA 3TO2A 2FX8L 4G8FB 4A2MA 32C2A 5T5FH 3P77B 1W72B 1NC4D 2D9CA 4OKVA 4NAQA 4JZJB 1BPLB 3TL5A 1GZHA 2H26A 1OAQL 4JM0A 1M6OB 4N2NA 5BV7H 4QNPE 5BJTB 4ODUA 1XSKA 3OSVA 3CX5J 1EFXB 5I26A 1A7RH 2DYPA 4XBGB 3TVMD 3C2SA 1HXMB 1TITA 3QHZL 3CN4A 3B9KD 3OZKA 4I3SL 4OV5B 1ES0B 3LV3A 4PRDB 2AQNA 2EECA 1EBAA 2OR8A 4PJGE 4PP2B 3FFDA 4LB8A 5K9JH 1AQDA 2HVBA 3FSZA 1IM3D 5EU6A 5AAWC 4B9KC 5DJAA 4KDTA 5MEPB 3PHQA 2D03H 2QADC 1HXKA 2WO4A 3HUJA 3MNVA 2Y07L 3GKWH 5DMKA 1I31A 3BD3A 2CKBA 1DBBL 2CQVA 4XN2A 2K8QA 2D3JA 4CVXA 1R3JA 3LEYH 4DFHA 2LTQC 4KKQA 2P5WB 4E41D 1SJHA 4XXWA 4NPKA 5AKRA 3D52A 2VDMB 1NGQH 4AGLA 2R0ZH 5TTRA 3LPFA 3ROLA 3SY0B 5I1EH 2W0PA 3SKMB 2Y22A 4GUQA 1XGZA 4OCLC 4HGKC 5C0JB 5IMKB 5KSAD 3MZGB 4P57B 5HY9B 3MBEA 5I66A 5FYKL 2A77H 1XGRB 4XVSH 2IH8A 3WO4B 3ARQA 4QHKJ 2GVYA 3MO1B 4QY8B 2XA3A 1GYUA 2QPSA 4HOMA 2BP8A 1W9XA 2C4XA 2FL5B 5AOZA 3NCBB 1W15A 1V3MA 4JRYD 3BPNC 4LMQE 3FB8A 2ED9A 1LEKA 2C3HA 3QDJE 2ED6A 2LLLA 3P02A 4WAFA 4IOFD 1KCSL 4RWYL 2E7HA 3GSUB 3UYPA 3ARUA 2WTRA 4G1MA 3T1FA 2JLPA 5AVVB 1YEGL 2XWTA 1FC2D 1CL7I 2BNQB 1GKEA 4X6CF 2WJ7A 1OARL 3TA3A 2J8UE 3H9HA 4BXSV 1F3JB 2GW5A 1Y6NR 1T89C 4YIQA 4AI7A 5I6OA 3HNTH 5JHMA 5CNHA 2WQSA 4PN6A 1BZQK 3BPCA 3HFMH 4LSSL 1JZ5A 2PPCA 4PG2C 5I5IA 5IR1A 4HXAH 3SE8L 3PGFL 2Z7WA 4JO4L 4NJAH 2ODHA 5CKGA 4FXKB 3ARVA 3RY4A 2NNAA 3N85H 3TZVC 1Z3GL 4YXHH 3BGAA 3KPPA 4UIKH 1JHLL 5GSRA 3SPIA 1F58L 3TX4A 2CLVA 2K6ZA 1KBWA 2NY2C 3QORD 2QQKL 3VD4A 2ERJB 4P2QA 3LNDA 3MV9B 2MKLC 3RRQA 2R0LL 4IMLB 4DQOH 1NPUA 4XP9L 2JNZA 4MA3A 2XV6B 4N9GA 2NPLX 2NY1B 3G9VA 4W68A 3MCYA 3PWPE 1SBSL 4XAKE 4QRUA 5EOTA 1WZAA 1IAKA 3MYJA 4XI5C 3SYCA 2BIOA 5FO7B 1QEXA 2VITB 3U9PL 4FNLL 3KPRB 4MRCA 3QEGH 4HKZB 5D5MA 2E27H 4YPGB 4NUJB 2D4FA 2QVFB 2BLFA 1QYGH 4MMZC 2G2NA 4BKLA 4YQXL 4NC2B 3ARFD 1M4KA 4ZW3A 3OKDB 4J5VA 3LKSB 5IHHA 1CR9L 2EACA 2N01B 4Z3EA 1MFUA 1MFBH 1AGDB 1A6WL 4L8SC 5TQ2H 4TL4A 5E08L 2CO4A 4JPQA 3GJEA 4U0RB 1CDHA 1FNEA 1UB6B 4BH7B 4LT7A 5JXEC 3VXUA 4YHYB 3S4SB 5KYYA 1PY4A 3WLWD 2XETA 4WU5A 3L3OB 4J3UA 5E2WH 5TPWH 3X12B 7FABH 1DCEA 2Y06L 1FL6A 1F4AA 1UCBL 1ITBB 4WI5A 4OLEA 4P5RA 3F83A 1BDYA 3U0TA 3ZZ1A 1UJ3A 5A2BA 4PJ5E 3I75A 1C8PA 3S36L 1TTUA 2CRIA 2DWEB 2HPOA 4G5AA 4OLZL 2ZSWB 4BQBA 4FI7A 3A5VA 2UY7A 4BUGA 2XXGA 2AEOA 2C4FU 4LSPL 3KE0A 5JNYA 1CE6A 4NQXB 5DZJA 5H35A 4PHXA 3DHPA 2IGLA 3VW3L 4ORZC 2F9BT 1JXDA 3I50H 3I3EA 2FT6A 2PN5A 2ZCZA 4U1LB 3LAFA 4I7ZC 4AEEA 2NXYB 4G7YH 2R9HC 5FGCE 4NKOA 4PJDF 4WFED 4OJEH 4BZ1A 1XB3A 2VLME 1Q9LB 5C92A 3ZL2A 3HRPA 2XKNB 1PJWA 2C9SA 1OGSA 3HPLB 4FULA 1NWOA 5GZNA 2ADJB 4FG2A 4PJXB 3MLPA 3F3HA 3WTUA 4L1DA 1YJDL 4MA1C 3RFZC 4O4YH 1MIMH 1QLFA 3MV7E 4JFXB 3RNKB 3MSPA 4HH9B 2XJKA 2ZX7A 5CSBA 4F5CE 2H5UA 1RZJC 1FGNL 2I5YL 1JWMB 3VRIB 5KS9F 1OSPH 4ERSL 1LILA 1DJGA 4FQXB 3DX6A 4OFVA 1YNKL 1T4KA 1WFNA 1DTUA 1M42A 2XYCA 1PLCA 1L7TL 1H8NA 1VPOL 3CX5K 4JLRB 2XC8A 2NR6D 1ASQA 4OKDA 5KSUB 5KSBB 1I9IL 4N87A 3GMPA 4Q58C 3BFQG 1WCQA 3DX2A 2E47A 4N5UA 4NNXA 2CMRH 4PJEE 4CSPA 2F5AH 2FJHA 3V4LA 2CSPA 1OGAD 4WWOA 2A6JB 3HMWL 3VXOA 1L6PA 3KPSD 2CA4A 4R4BA 3CDZB 3P0YL 2F7RA 3WKMH 5KVGE 1NMAL 4N0RA 4OCRL 5DSCB 2ZOKB 1VZGA 2WVUA 1FH5H 4K94L 2RQ8A 4AUUA 4ZMVA 2G9KA 3BD4A 3ZKNC 3W39B 1MRCL 3VJ6A 3II1A 4K2UL 1FVDB 2IAMD 4HIQA 2WXFA 3VXME 1S6NA 3ZDXE 1NBCA 1A9EA 1EHXA 2KZBA 4P2CG 6TAAA 2NUPB 3TJHD 3W0WA 2B1HH 4QOKE 4D9QE 4PGJA 1IIIA 2OMXA 3L9RA 3QC5X 4P3DA 4XB8A 2PCFB 2K6YA 2VLJE 3ZE1F 2BY2A 3HC4L 4XMVA 2Q5BA 5KZCD 1BVNP 1II4E 2A73B 4CC4C 1I3RB 3O6FD 1VLXA 4LNRA 2EVFA 3CXDL 3II2A 4OZFG 4BZ2H 1F6AA 5EUKB 3S5LA 1R4XA 3N1MC 2ZONA 3U46A 1WZMA 3BD5A 2VAJA 3HC0A 2BVPA 3GD1C 2VLRA 1FZOA 3T0VA 1QSEA 2C9RA 2B39A 5JLZB 4X4YA 1CYXA 2YO3A 2GSGA 3CVHH 1BBDH 4KTEL 3FQXA 3MRMA 3NIFE 2A9NL 2Q7YB 3ES6A 2QL1A 3WEXB 1MCJA 3RUGE 1DBAL 2HTLD 1HXYA 2FWUA 3QZLA 3QIWD 5IESH 4C56E 3DPDA 2YK1L 1YNTA 5HI3D 2HKFL 5TFSL 3UTOA 2Y9RT 2JLLA 1FORH 4R7NB 2MSPA 3ZUCA 1CF1A 2YPKA 5HYEA 2MFNA 4LHUD 1AXSA 5HXMA 3T3MB 3CFDB 3SPVB 1AP2B 2YGNA 2JH2A 3B2MA 1WBXB 1ZSHA 5ACZA 2PPFA 3DURB 2VQ1A 5J6GA 4OM1H 3EXJA 3NPZB 5D1ZA 4WI6A 2D7NA 5CINL 4XPHL 1ZWIB 4F7PB 3FBQA 3L4CA 4JKKA 3ABZA 3FT2B 3MRGB 4LKCB 5DJYB 5E99H 4ZUWA 5IEKB 3EOAA 1KFAL 2O26U 1CGWA 4FQJH 5I75B 1MCKA 3SDDB 3DUSB 5JHDA 3VWJC 1JWSB 1AMXA 4JFYA 3RVTC 5HYQB 1TYEB 2ARWA 5JHLA 4B3EA 2ZPKL 3GEFA 5I6NA 1UJTA 4L9LC 1O7SA 2VDKH 3G08A 5AALA 3MLXL 4KHXH 1A3QA 4AH2B 1XH3A 1YNLH 3OB0K 3NEXA 3UH8A 1OB0A 1RZGA 4PLJC 1RD6A 5CIPA 2FJUB 4N0UE 2XG4A 4I0PD 1UA6L 2OULB 4NB7A 4Y4HA 3ARED 3TN0B 4ZFOL 3QHTC 3MRJB 4JO1H 5E2VL 4PB9H 1QPKA 5DRNB 1DVSA 3CH1B 4I85A 2F74A 4E9TA 2DH3A 4JG0L 4TNFA 3BAYA 5J1AB 2QGBA 4R83A 3NSJA 3EYQD 3NCEB 2IALB 3IDIA 1JCVA 3QRGL 5DJ6B 1E3ZA 3QUGA 4XBPB 1SN0A 3DTDA 4HCGA 3W37A 5LBSH 1UCTA 4BDVA 1I8IB 1RJLA 4TSAH 1F6FB 3D2UD 4OQTA 4Q0XH 1INDL 4JVWA 3QXUA 1FFRA 2CHNA 1GTFA 1T3FB 3KPQB 3IM1A 3HG4A 4PRPD 2WUCH 2VERN 4NENB 4YE0A 1J5HA 1ZGLP 2IH3A 5EV7A 2X89D 1MG2C 4H8WH 1T0OA 1TU2B 3A3YB 4FQ1L 4IRZA 1PDKB 5GS1A 4KY1H 2P80A 3HZ3A 3BVNB 43CAB 1MVUA 2VH5L 2Y2YA 1XQ4A 4AE0A 5CKAA 3B2XA 8FABA 3TNNB 1MCRA 1EEZA 2NYYD 1H15B 5JXAH 3NCWA 3M7OA 4MTMA 4UQDA 5TE7L 4EZMA 5DRWA 5DC0A 2ICWI 4J3OF 5D6CB 4EI5B 1LO0L 3NESA 3CG8A 5K59E 2PNDA 4J1UA 3TZVA 3BEVA 3ARXA 4IKIA 2OX5B 3MUZ1 4PPTA 1RZ8B 2KDYA 3E6HA 2GT9A 2P47B 5HDQH 2YAQA 5TQ0H 5IB2B 4OB5L 4ABQA 2X1WL 3IAGC 6FABL 5CUSL 4L0YA 1O9VA 2GTQA 1GZPA 4B9YA 2WXJA 1PD6A 4L2LA 4K3EH 2C26A 4BBWA 4TOYH 4HUUB 1UH2A 4XRCB 3QCUH 1L9SA 5IB5A 3Q6GH 4NQUA 4OFPA 4XNQB 5E03A 4WO0A 5FXCH 1DZ0A 1I1AA 1KBVA 2WINB 1KXVA 1ADQA 4JO3H 2R1WB 3CIQA 2E9GA 1GAFH 3AZUA 4NHUA 4X7TB 2I60H 1B6UA 1HILA 1QABA 2YXVA 3LHPH 4K8RD 4UM8B 1MZYA 2ARJQ 2COQA 4MLSA 2QVMA 3QAQA 1A2YA 1U95B 2OMZA 3P4OB 3GIVB 5A16B 4J3OH 4L0ZA 3D25A 5ICXB 4XPBL 3UJIL 4UCFA 5CGYC 5BZWA 1CK0L 1XH1A 2X44D 1SJVA 2PWFA 2GBVA 3KLQA 3L9BA 4NN6C 5IFAL 1F02I 3GMOB 2A1WL 4F7TA 3FB7A 4ZMZA 5HHPA 2GSIA 4MBRA 1URLA 4YDKH 1QX1A 2UXVA 4ECNA 2NTFA 1KOAA 1UADC 1XR8A 3UOAB 1WZLA 1DVXA 1Z5HA 1FBIL 3V0VB 1BVNT 3HG1B 2ZNXA 2YD9A 4JB9L 4LEXH 1XEDA 2AJSL 2BVYA 3PS6A 4UMSA 3S98A 3F6LA 2FWOA 5ALCL 2JXMA 3CSYA 4DK5A 4LSRH 4LQ1A 4AC2A 2ZYSA 1ILUA 1AZBA 2AABL 4NQSA 1CVSC 3D18A 5CLTA 2B4CH 3IAPA 3OKEA 4ZW8A 1Z5LB 5IJBC 1MAJA 5MENA 3I6LD 3WFZA 4ZPTA 4FFZL 5BRQA 3MV8B 1ET7A 4D0DA 4Y4KB 4WWID 4PJXF 5AWNH 4NQCE 4X4ME 2XFGB 2Z91A 4Y9CA 1GMIA 1ZIAA 1ZANL 1OEZW 4KXAA 3RGVB 3WY1A 5DUJA 1DJHA 2HCZX 1IGJB 3VSVA 5BMFL 1AOZA 4JFOA 5ISZD 2DIEA 5H37H 1LO2H 5ILTL 4FJ6A 1J9CT 1X7QB 3L5WB 4BFIA 5GS0C 4IIQC 3RIFK 4RESB 3OHXA 4PTUB 5C9JB 1FFNB 3ASOB 5FW8A 2Y7OA 3FU9A 4JPWL 1A4JA 2VXQA 3LRMA 1L7IH 4FXLA 1DYZA 5KSBF 3CK0L 1JS4A 4HLZG 2X5PA 4YSOA 3ILEA 3ARGC 4G42B 1IAIH 3P69A 3V0JA 3B1UA 1VKXB 2VMEA 3IB4A 1CICD 3BKJH 2WM0A 5MERA 1KV7A 2DTML 2X1PA 3NCCB 1CYWA 3K7UA 5AW2B 1T2QH 5I6XC 3P9LA 4JPKH 1OCOB 2Q2EB 4P5KB 4B5ZA