2H1LM

The structure of the oncoprotein sv40 large t antigen and p53 tumor suppressor complex
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
199
structure length
199
Chain Sequence
SPLSSSVPSQKTYQGSYGFRLGFLHSGTAKSVTCTYSPALNKMFCQLAKTCPVQLWVDSTPPPGTRVRAMAIYKQSQHMTEVVRRCPHHERCSDSDGLAPPQHLIRVEGNLRVEYLDDRNTFRHSVVVPYEPPEVGSDCTTIHYNYMCNSSCMGGMNRRPILTIITLEDSSGNLLGRNSFEVRVCACPGRDRRTEEENL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Large T antigen
publication title Crystal structure of SV40 large T-antigen bound to p53: interplay between a viral oncoprotein and a cellular tumor suppressor.
pubmed doi rcsb
source organism Simian virus 40
molecule tags Viral protein
total genus 38
structure length 199
sequence length 199
chains with identical sequence N, O, P, Q, R, S, T, U, V, W, X
ec nomenclature
pdb deposition date 2006-05-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
M PF00870 P53 P53 DNA-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.720 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 2h1lM00
2BIOA 1HJCA 2FEJA 4AGMA 3D07A 5AOLA 3Q06A 2YBGA 4L18A 1IO4C 1TSRA 5G4OA 4IBTA 2BINA 3IGLA 1T4WA 2XWCA 2AC0A 3WU1A 2VUKA 2BIQA 3TS8A 1EANA 2XWRA 2IOMA 1EAQA 4HJEA 4A63A 4GUOA 2MEJB 4IBWA 3EXLA 3KZ8A 4LO9A 1YCSA 4AGOA 3VD1A 3WTVA 5AOKA 5BUAA 4IBQA 3D06A 3EXJA 3VD2A 4AGQA 2X0WA 5AOMA 5KBDA 4GUQA 2ATAA 1LJMA 2AHIA 1HJBC 2IOOA 2OCJA 4LOEA 4MZIA 3WTUA 2J1WA 4MZRA 4L0ZA 2PCXA 1EAOA 3Q05A 1KZYA 4AGPA 4IBVA 4LOFA 4IBYA 3KMDA 4IJTA 4IBSA 3D05A 1CMOA 5AOJA 3QYNA 1TUPA 5AB9A 2IOIA 2J1ZA 4XR8C 2X0VA 1GZHC 5ABAA 4G83A 2J6WA 3VD0A 2X0UA 5ECGA 3D09A 2J21A 3US0A 4AGNA 3WTYA 3WTWA 1UOLA 5G4NA 5LGYA 2H1LM 3QYMA 3Q01A 2P52A 5AOIA 2BIMA 2BIPA 2ADYA 3IGKA 3ZMEA 5A7BA 4IBZA 3WTTA 3US1A 4QO1B 2J1XA 2GEQA 1GZHA 5G4MA 2J20A 2RMNA 4L0YA 4KVPA 1CO1A 1E50A 5LAPA 3WTXA 4IBUA 1HU8A 4G82A 3D0AA 4AGLA 2WGXA 3WTSA 2J1YA 1H9DA 3D08A
chains in the Genus database with same CATH superfamily
4ZUWA 2BIOA 5CHNB 3K3QA 2WXFA 5F7FA 4AGMA 1G84A 3CZEA 3LSOB 3F7RA 4P2RB 5CEZE 1FN4B 2C5DC 3MGTA 2FGWL 5CZXC 1KPRB 1ZT1B 4UWQB 2FJHA 3Q1SL 1IO4C 1WQVT 4UDUB 1W91A 3SJVD 2J25A 4QRQB 3ULSA 4K15A 2GAZB 3LH2H 2Y06H 1LO4L 1IVTA 1DSYA 4FQJL 3F7KA 5B22A 3LN5B 4N2AA 7FABH 1JCKA 1HDMB 5CP3H 3WMSA 5BOZG 2COQA 2LVCA 2R1XA 1ECZA 3GSVB 3KAAA 4HCRL 3OZ9H 3P4MA 3EXLA 1Z9OA 2C1OA 5JUEH 3MLRL 2EEDA 2Y5TB 4X6CA 4CDHA 3C5XA 3HFFA 1XF3B 1TJHH 1E5UI 3CK0H 3LKOB 5AOMA 3BD4A 4HLEA 1SJMA 4RNRB 3T77B 4G8GB 2W8CA 3K6DA 1ITBB 4OCRH 4YC2C 2JLPA 3GNMH 4I4WB 4TL5A 1FP5A 3A6CL 3EBHA 5JOEA 2BOBB 4N1EA 3MGOB 4H5SA 5JTWA 2FB4H 3BP6B 1MCBA 4P5MB 3ZTCC 5CLXA 4UTBA 5J6GB 3BISA 3VI4B 4GIOA 4NFDA 1J87A 4RISH 4NQDA 2LU7A 4PJDA 5GGRB 2YAOA 3M17A 4FG6D 5KWYC 2ZKMX 1NCWL 2BP8A 3BDXA 3PP4L 4GW5A 5GS2H 5GSVB 2X9WA 3VGBA 3NFSL 1AE6H 1WWCA 5FHAL 4ODVH 3BO8A 2XC8A 1EDQA 4FQXB 4K7FA 4ZFQA 2GB2A 2X0UA 3SODB 2XTLA 4V11A 5IVOA 4A2FA 5ANMA 1YMMB 3OQ3B 3NUKA 1ZD6A 2RA1A 3OTTA 2ZNWA 4F2EA 1E2WA 3BSGA 3M46A 5DT1H 4UNUA 5LGYA 4PPTA 3VFRA 3U4BH 3VFTB 4R26L 4OBRA 3BKMH 2BIMA 5AUMB 2AXJA 4ZMLA 1A5FH 2R2HB 3GRWA 5FWRA 1WZAA 2DDQL 3U1PA 1N19A 2DQIL 3FU7A 4TVPH 3D3VD 3NIGF 2KDGA 1CE1H 2Q86A 5JIHA 3UIYA 3FRPB 1I8UA 1O6VA 4N22A 5C6TH 2F68X 2L04A 2WANA 2D4FA 3VMOA 1N0XH 2VDNH 1T0OA 4WHDA 2QZ5A 3N91A 2B16A 1JZ4A 2GUOB 4JDVA 4OUUB 2VDRL 4QLRA 4A1RA 3V6OC 4GQQA 3VG9B 5ETUA 1M3JA 2R83A 4N4YB 2NX5E 4AL8H 2MQCA 1I9EA 4AQEA 1INEL 3MV8A 3CVHH 4RBPK 2QR0B 1PFCA 2G2PA 3IEAA 1HHGB 5DRXB 3GIZH 4PRIE 5F1SA 1XF5A 3JWDH 5IWLA 2YGPA 3BUDA 3VFNA 4EDXB 1O6SB 2AV7B 1T22B 1JL8A 2XWRA 4Z18A 4AV0A 1AY1L 4JB9H 4GW1A 4N8UA 4RX4A 4YS4A 2Z8WC 1N7MH 3BLPX 2JJTA 5BZWB 4UMSA 1GY2A 2OZ4H 4IU2B 3TF4A 3QA3A 1X5XA 3U4AA 4Z8FH 5EIIA 3EJYD 3C08H 4LSSH 3LDBB 2XZQH 3BGMB 1X6LA 3STLB 5KOVC 3OF6A 3O6LH 2DLFL 4NKMB 3FRPG 1ND0A 2VUOA 5I2IB 1AQKH 3QEHA 2P5EB 4DW2H 1NCDL 4WLCA 5TJWK 1XO8A 3IMWA 4JJ5B 3E8UL 5E2TH 4DHLA 2CDGA 3G6JE 4LCYA 4JFDD 4UB0H 5CD5D 3AT9A 2VLJD 3KWTA 1WZ1H 1DJHA 4KXDA 2JXMA 2V3DA 3RZCA 2VLME 3MOBL 5EN2B 4MMZB 2OW7A 2B5IC 3VXQB 5I8OH 1QYGL 4KOBA 5GRJH 1IGYB 4JE4B 3VU1A 3D39B 3I6GA 1HWHB 1ZS2A 2PP8A 1O9ZA 3QQ4B 4R3SB 4WEBL 4WSKA 4CAGA 4HUVB 4PRNB 1AMYA 1OM9A 2AK1L 1S4IA 3O81A 3VXPB 4OZIE 3IBOA 5D7SH 4L9LB 1TJGL 4KXZH 5DMIH 4WFED 5J11C 1I9JL 5KANI 2BS8A 4XBGB 1FO0L 3H54A 5HJ3B 3U7YH 4V2CB 5AFAA 2WCSA 1BF8A 1I4FA 3O4OB 2B1HL 1XCTA 3CD4A 4N0CC 4JS7A 4JPWL 5I17B 3T4AB 5FF6B 3ZTJG 1A1MA 1KG0B 1Q1JH 3SCMA 2AEWA 3ORJA 3KXFB 1YEKH 5G4NA 3ARVA 4EBQH 4JPVL 4FOMA 1U2CA 1F58L 3BKYL 3WOVA 1GYAA 4X5RA 1F8TL 5I18L 2ZJSL 1P5VA 5CJXC 3QDME 2DYPB 4XVOA 1BSIA 3BCFA 2E9GA 1YEFL 1EIBA 3OHXB 1P4IH 3T0EA 1PTZA 2FIRT 3NCBB 4XI5D 3CC5B 5I6MA 4QHNA 2HKFH 4XCCH 4YHYB 2R56L 1UACH 1P5UA 3O2VH 2MQ3A 3P30L 4PJBF 1R5WA 1C7TA 2CRIA 4ZTOL 2J73A 4M6OL 1AC6A 1Q0YL 1DL7H 4NUPA 5AVWB 3CSYB 1EWHA 4HJ0D 3M1BA 4U1GC 3LMJH 1HINH 3KBFA 2XWZA 5DJYB 3T3ME 3QXUA 5C0CB 1IBGL 3IE4A 3SD5A 3RVTC 5I0XA 5L0QB 2WUBL 5KBKA 3QJXA 1WGVA 3QCUL 4YXHL 2J88H 2Q7AA 4X7TA 1SEQH 5HD8C 1NAML 1RURH 5F3HA 3MRNA 1KDJA 1F4WH 1SEBA 1CDUA 2WXOA 2OMVA 3OPZH 2XHNA 3M1OA 1SVZA 1L9PA 4LU5H 1T7ZA 4K7PY 4ZSOE 1OP4A 2YUZA 3KH4A 5E4IA 3WD5L 4A7VA 5BRZA 2F15A 3RUGB 3DXAB 1IX2A 5K39B 2K8QA 4GRLA 1BPVA 2RGSA 3TEZA 1U3HA 4HBQA 4HH9B 3K7UA 1MZYA 4LKCA 4O2FB 2X9YA 2V5RA 2E56A 4BUGA 3S5LA 3TA3B 4ZAKA 4N90D 3K6NA 5ESVA 2GJ6A 3N5AA 4G43A 2VDQL 4ERSL 4L1DA 4PJCB 3B9KB 5D7IF 1AFVH 3GPSA 3GJFK 3FH5A 5CN1A 5I1CH 1KCUH 2V5MA 4N2HA 1J0HA 4JM2D 1ASOA 4OGYL 3P4LA 3VXME 4WEMB 3DX6A 1MRFL 3KW8A 3TT3L 5I1HH 4XC1H 5ALCL 5FX3A 3OL2A 3QJZA 5DJZB 4L3EE 5HHOA 3ARFB 4QHKI 4PJFA 3KLQA 4QXGH 1QOKA 4BFIA 2QVMA 4JHZA 1U8JB 4CW1A 4DK3A 1QP1A 1K4CB 1AZRA 1MY5A 2O30A 4X8JB 1GA2A 1J5HA 4M7LH 2H6PA 4PJGB 3SE4C 1G7JB 4JZJC 3PDOB 4LESA 4H26B 3VQ1C 4P0DA 1W0WA 3L9YA 1SMDA 1UWGH 4O2CB 5E2VH 4FFZA 3HBPA 3MUUA 3MRKB 3NJLA 2YGOA 4FL4C 1TZIB 3FFOA 5CILL 3QIWD 5J12B 2F74A 2WKLA 4MJ5B 1RIHL 2CG9X 3FTWA 2QEJA 4N0FA 4YAQB 3U6RA 1T6WA 4JCWA 2VR9A 5D7LD 3SGJC 2X4TB 1IM9A 3GBML 2W0FB 2Y7SA 3I6SA 4R7NB 1XFPA 4WGVB 1NFDE 4HW6A 2YBGA 3DNKA 4NNYB 5DFTA 5GPRA 5DRNA 4N8VG 3KLHD 5ELIA 3TCLB 3V4PH 3FUFA 4C83A 1XB6A 4OV5A 2BP0A 3JWDC 5KBPA 2XX1A 3K0WA 4G8EB 1KFGA 2R0KH 4P57A 1DHKA 1KJ2A 1U8LB 1ZCRA 2J8OA 2JCCB 3G5VB 5BS0A 2NW2B 3AREA 1JZ2A 3PJSB 3QJUB 2ZXBA 3KDMA 3HMWH 4BGDA 1IM3D 3U9UA 1UCTA 5DD3L 3DI2B 4UUJA 5MHSD 3QSKB 3TVMA 4KNQA 3KH3A 5HHQB 3KPRA 3IJSA 3F7LA 4RMQA 3G6DH 4CU8A 3JXAA 5FECA 1JGEA 3FC8A 3NZ8B 1PKOA 3SPVA 2ATKA 5IOPB 1RZPA 2P80A 2MIZA 5D93B 4FQQB 2ZZUT 3ZQXA 3VFPA 3ZE1F 1MLCB 4WFFE 2C9RA 2J8UE 3B5GA 4UQ2A 1CE6A 3VB8A 4A7GA 5CN3A 3VI4E 2VZSA 4YX2L 2HTLC 5DJXB 3DO4A 3V4UL 4Q74A 4DP6X 5C0EA 1XGYL 3I6LD 3S2CA 5CZKA 3AC0A 4L0ZA 3DURA 3D85D 1BVNP 4UQ3B 5LNGA 4A2DA 4S2SB 8FABA 4P59L 3F5WB 2MNJB 3LN9A 3O11B 4NKOA 4YDZA 5I1LB 3GM8A 4IBSA 3HMXL 5BVPH 3L13A 4E68A 4Y0GA 4HS6A 4YDVB 4L4VA 1C12B 1PAMA 1ZVHA 2Y2TA 3F7YB 4HGKC 1NGYB 4NBXB 3V0GA 3OKKA 2KUTA 1ORQA 5HDQH 2W0LA 4X9IA 1S7RB 4Y2DA 1MI5E 2GJJA 1YNTB 5DJDB 4FG4A 3WIHL 1IEAB 2ITDB 2OL3A 5IQ9B 1WSST 4LF3A 4EUPA 1YDPA 4NSKA 3MRDA 3TGXA 4EO5A 2BSTA 3SDDC 4K94H 1DLFH 5L88H 1F2QA 4TOYL 3KJ6H 4HWBL 5C07A 5FCUH 5J6HA 2W59A 2R59A 1U2YA 1P6AB 3M8OH 3E2HC 5IY5B 4DJMA 3GHEL 2YN5A 1ROCA 4YQXL 4P2QA 3D30A 1OTSC 4L3FA 4OJEH 1JN6A 5FB8B 3LYRA 3QXVA 3UJIL 2IH3A 5INDA 5ESQA 2OYLA 1IBBA 1J8RA 3O2DL 4NENA 4N2NA 1J8HD 2FWUA 4WUKL 2PCYA 1KCSL 1RK0A 4L4TE 1SDDA 4MMYA 4PB9H 5DFVD 1KXVC 4PJXB 4JRLA 3HB3B 2XVKA 4WWKD 2WLKA 4FHJA 1NQBA 3UC2A 1R5IB 5EBLA 1UZ8B 4FLHA 4WI2A 4K3EL 5F1IB 3H9SD 1CFNA 3EW3B 4HXBL 2IDCA 3ZZSA 4B60A 5L8LB 4TULH 3FUNA 4OM1L 5BQ7B 3CMOH 1RUKH 1UD5A 3LXBA 3OJ2C 2E7BA 4TSCH 2V7HA 4NZFA 4DZ8A 2PWHA 5FA3A 3CDYA 4DVBB 1TVDA 1YEHH 2MWCA 4HEMA 4PY7A 1YN7B 2F53B 3RWJB 2XWJB 5E7FA 3RWDB 2K7PA 4F7KA 4FXGB 4PJAB 3LRMA 5HYJE 4TUJA 1A66A 3HZMB 4CU7A 1HZHL 4Y16D 5D96C 3HE6D 2ED8A 3DSFL 4I18A 4XPHH 1BREA 5C9JA 2SEBA 3AM8C 3AY2A 4XCEA 1CLYH 3EXJA 1MAKA 2TRYA 2A83A 3OC8A 4PJ5E 32C2B 4OKDA 3WE6B 3VXOB 1LE5A 2BS9A 3RTLA 3WNKA 2WQAA 2HKHH 4HDIA 3EJUA 2EH8L 5LO7A 1OGAD 2DQCH 3K2MC 5BV7B 3NAAH 3GMQB 1IGTA 3H2QA 4QHUA 1E4WH 1F4AA 1VACA 4N8CH 1FFRA 4JFFE 4MKTA 3CQQA 3UAEA 1KYUA 3FTUA 5JIKA 2C9PA 1XGUA 3E6HB 4PAZA 5IHUL 1XF2B 1CXLA 4L1HA 3WI9A 2VW7A 2XJKA 4AJWA 4Z6AT 2B0SL 3P2BA 1LP9E 4PLKD 1NOFA 2R2BA 3W5MA 5EUKA 4XZUB 2JIXA 2OR9L 2VAAA 1OTTD 5IGXL 3EFFB 4KHXL 2E59A 2PP9A 5IQLA 1G9MH 2YMOA 3OG4B 4K7PH 4XVUD 3VWKB 4ZMPA 4UT6L 4UV4L 3SGKC 2XY2A 4N9GB 5AZEH 2BNQD 2CDEA 5HHMB 3CWGA 3IXTA 4C47A 2OI9C 2BCMA 1A1NB 3KPOB 1HQ4A 3A24A 2I60H 3ARBB 5CIPB 5DHDA 5EC2A 3NJVA 1X9UA 1UEYA 2IG2H 3WUWB 4UQBA 1Q9WA 2YD7A 2CLRA 3BPCA 4NQCA 1PBYA 1UD8A 1EO8H 1UD3A 1H6EA 4HUCA 3AS0A 3S2AA 1J0IA 1Q0XH 2BY0A 2E9BA 4KGJA 4PRPD 4HH8A 1J5OH 1X5GA 3LZNA 5LAPA 3T0BA 4JY6A 1W15A 4NUGL 2KBGA 4UANA 2L8AA 2D73A 1F86A 2ATPA 2R9HC 1IFRA 1OSZB 3KPLA 3CHQA 4I9WD 2VQTA 4NPYB 1S9WA 4ZW5A 3LS4H 1VZHA 4NQXB 1Y0LB 5FYJE 2DWTA 3TZVA 2UWEF 5IP4A 4L8DB 3NK4A 3SHSA 1VADB 3QW9A 3PNWB 3SOTA 4EJ1C 5IEHB 2ZCLL 3G5WA 1OQXA 3GRWH 2V2WA 2Q8BL 1KXTB 1ORSB 2WWOA 1S7UB 4ODTL 4TXVB 5JW4Q 1F11A 1HWWA 4LDCA 5CINL 2FHBA 4J3OC 1R3LB 3RX8A 2PLTA 4HUKB 4BZ2L 5E2UH 4YFEA 2YRLA 4GG6A 4IMLB 3ZO0A 1ZXKA 2C4FU 1MCSA 4M03A 3S3PA 3DXAE 4DOHE 1KGWA 1OSYA 1ZOXA 4X4MA 1ZK5A 4I0PC 3N04A 1IC7L 3K6FA 5FW8A 3FQ4A 1NDGB 4BZ1L 1JWSB 5BW7A 5JW5A 2WVVA 5INCA 1ADQH 3QJSB 3AABA 2YK1H 2O5NA 4R4NC 1QBAA 4CNIB 1TMQA 4AW4A 1S7WA 3BKCH 4OCYL 4W9LC 5EFIB 5F7NC 3MJ7A 3QZLA 4NKDB 1P7KA 1EFXD 1BFOA 2OJZH 4ZX6A 1KBWA 3CE1A 4Z7OB 3ME0A 4UT9L 1MAML 5JHLH 1XR8A 5KYYB 2RH0A 3DUUB 4YDJA 2NW3B 1OLZA 2YPLA 1I85C 2I32A 5B3NA 5CR1A 2HX7A 4AXWB 4AZ8A 1KCVH 2Q6WA 1OZUA 1ZV2A 4XCNB 2LW3A 3DC0A 3B83A 3BGAA 3RKDD 3W1ZA 4OW6A 2GG1A 4XXCC 1E6OL 1A7BA 1NH6A 3O9WB 2IOIA 5HY9B 1ZK9A 3ILQC 1QAWA 1V7NH 4EIZC 2Q87A 2XFXB 3ERXA 1YC8A 5FDWB 4UILL 3I6KB 1VERA 1FF5A 3U0PA 5HDWA 2PCFA 1GGCH 2ESVB 5IG7A 4PJIF 1MG2C 1ZT7A 3PE9A 4KXBA 4AIZA 3VWJB 1PG7W 1VCAA 4N9OB 4EDWL 4XNYL 3MKGA 4UMGA 1IBFA 4OZGF 3VW3L 2GHWB 3FTSA 2GFBB 3WHXA 3E1F1 4DCQB 1XH3A 2OS7A 3EGXA 3GSQB 4PJHF 2UV3A 1PPIA 2AJXL 2H0EA 1FFOB 2UY6A 4FLQA 4P23D 1AD0A 2VABA 5A2JH 3WE1A 1BF2A 4NRYB 4DKFL 1H3TA 4MYWB 2I7SA 1MAJA 5KYUB 1VFAA 3TCTA 1F02I 5DEFB 4X6DA 2WXKA 5HDBE 2I9LB 2PNDA 3CH1B 4YHKL 2X38A 2XN9B 4WO4C 3SSGA 5J56B 4Q9RL 3GIVB 1P1VA 5AVQB 3SJVA 1NEZA 4J2QA 5HHNB 1EZUA 3BN9D 4JVUA 1MEXH 2VDPH 2WIIA 4DFHA 5EORL 5GGQH 3O4LD 1EAQA 3QUYB 1E9OA 4ATWA 3GSRA 3L1OH 4NAQA 4ZPTA 2D3JA 3KYKL 3HFML 5HHXL 2Y7QA 5E6ZA 4FP8H 3BMWA 2ZWLT 4ZUTB 1J1PH 5TE4L 4MCZA 2HPOA 1NBVH 1YCSA 3C6SB 1UM6L 4GS7C 1UD6A 1QKZH 5CEXB 3WJJA 5JXED 1KV7A 3L3JA 1D5XB 5AOKA 4UYQA 3AU1A 3BZFA 1MFEH 1YEGL 5JZ7C 1J1OH 2HTKC 4FYQA 4IU3B 4FNRA 1OKEA 1U3ZA 4D7PA 2YPKA 5EU6E 1WBZA 2WTOA 5EF0A 3IDIA 3RTQC 2JKXA 4YHLL 5AD0B 4UTAA 2FBOJ 3BEWB 1RJLB 3QUXB 1NCAL 4NN7C 3RNQB 5DVMA 3EO0A 4JVWA 2Y69B 1JK8A 1I7TB 4CVZA 2O6CA 3SY0B 4P05A 5B3JF 1CT8A 1H15A 4N86A 4H20L 4D8PA 1IEBB 1B6UA 4DUXA 2X7LA 3DRQB 5AW7B 3UTSE 1IQDA 3UTTD 4X7DC 1OW0A 2VXTL 4LEXL 2IPTL 4KK8C 1G5GA 3MX0B 1N5AB 1QPPA 3LZRA 3IPBA 5TF1H 4KVNH 3WEBA 4GAJL 2NY1B 5D1QD 4F8NA 1RZKL 1CFTB 4XP6H 3FXIC 4ZDHA 4V1DD 4L5FH 1EZLA 4QRRD 4AC4A 1XF4A 3FN3A 2WO2B 5CKGA 4G9FB 1SXZA 3FPYA 3RQ3A 4GAYA 5DFAA 5IR1B 3VJ6A 2WXIA 4TLUA 3S37X 4APQD 3T2LA 2WYIA 3UTOA 2OCCB 4YL4A 3D3VA 4LHJB 4LCCA 3V0WH 1KPRA 1GAFH 3L5IA 5A7BA 1C5BL 4ZUUB 3PABB 4GP4B 3WAJA 1PZ5A 3AZUA 1YYLL 1U4FA 5HHVL 4NRZA 4YSCA 4PJXE 3CPLB 1SMAA 2VR4A 1KIUB 1I31A 4X6CE 4NWUH 5JR1H 5KW9L 1E5ZA 3LN5A 3MLXH 4NQED 1PYWA 3LKQB 1QUNA 3F3HA 4S11A 4QF1B 1X5IA 1BMWA 1AR1D 4ZMQA 3ARUA 3HI6H 4I9XA 1DBML 3VD4A 1DJWA 2XG4B 3MBXH 1N0LB 4LARL 5AZUA 2C9QA 1RK1A 1PIGA 3LQAL 3QG6B 3QRLA 4XAKD 5AW6B 1GOFA 2GI0A 3TU6A 4CN4A 1DSFH 1MWAL 2XA8H 5IVXB 3HEIB 4OFDA 4LSTL 4NO2A 1DFBL 4NP9A 4NQDE 5AKVA 4GRMA 4PJDE 5CFHA 2JH2A 4FFZH 4X5XA 5DUML 5LDSA 1RP9A 4HISA 1UC6A 2EKJA 1EA9C 3DBXA 4I4WA 3HG1D 4C59B 3HVNA 2VLKA 3CXHK 4R84A 2WLYA 4BQCA 3UG4A 1FFTB 1FORL 4XH2B 3UJJH 2DPKA 1EEUA 3HC0A 5F1KC 4LLDB 4AVIA 4B53A 3WN5A 5HYSB 5KVFL 1LQSR 3REVA 1GC1C 4HJJH 5GGRA 2CU9A 4A55A 3WYRA 4AYBA 2Y1YA 3GQFA 4JFDA 1OXYA 3PWLB 3ARQA 3NIDF 2HFFA 1QMUA 1UB6B 2V2TA 3NABH 1IVLA 1SXBA 3S0PA 1WBXB 5ANME 3RDJA 1E27A 4HCIA 5GSVA 4IRSC 3VXUB 1TVHB 2XN2A 1F18A 1ZTXL 3MOAL 2XIIA 5KSBA 5CD3B 2BFGA 3N41F 1ZLWK 3KEDA 1BM7A 3D4ZA 1U3NA 4NYLB 4RGND 2BXYA 1Z7JA 3CN2A 1R24A 2VQUA 3GLAA 3VSQA 1YMMA 2A6IA 5E2WH 3ZN6A 3OKLA 3HRZB 1QSEB 3D4CA 5DF0A 1IT9L 4TQEL 4XHJC 2IQ9H 3RP1A 3QQXA 1IC5L 5F8RC 1JZGA 4JO4H 1KT2A 1UWFA 2CE6A 3ROOA 3ZRSA 2UZYB 3FRPA 3X14A 3MV8E 2CA3A 4PBVC 4KI5E 4M4RB 2IWKA 3V9FA 4CKQA 1TCRB 5KYXB 3RA7H 1MXDA 4UCFA 4FTVE 2GSMB 4G9DA 1KBPA 3L8QA 1GGIH 3BSZL 4IK6A 3QCVH 3FT9A 3IRZA 3MRQA 4XP4H 5KBNC 5BOPA 1K3IA 2H2PD 1AKPA 1HHGA 4PJ8D 2DQGH 2IBBA 2ZKXA 5KSAB 1RD6A 3EIFA 3O3EB 4MAUH 3P9WB 2C9SA 4P4KD 4LCUB 1FZOA 4HYTB 2AEQH 1X9RA 4Y19D 4WWOA 1MFAL 1EHLH 3DETD 4AKQA 1FVDA 4ZFZB 2OL3H 4QT5A 5I75C 2RACA 5CBAA 3BVNA 5EF3A 3VFOB 4EUPH 3EFOA 3DO7B 4IU2A 1BQSA 3E38A 5DEJA 4PV9B 3R4DA 1A3RL 2J4WL 4GI9A 3MRIA 5JOFA 2NYKA 4FULA 4I3GA 4OJCA 2W0KA 3MODL 4MB3A 4NKMA 5EEWA 4OBSA 2ORBL 5C7XH 2P5EA 4LCWE 3L5WB 3LZFH 3H6JA 1PG7X 2VDRB 2FAUA 3WSQH 2EDJA 4OF7A 1A4KA 2IOMA 1D6EA 1KTDB 1RZ8B 4ZD3H 2MHAB 4ZTEA 4JQVC 5IM7A 3S88H 4DP5X 4M5ZL 2PR4L 2WXLA 1J1XL 3O6FC 1FBIL 1U58B 2CGRH 4I1RA 3TWYA 4ZFGL 3NG5A 5C0AD 4GY4A 1HSBB 5EN2A 1QTYT 2RALA 5FOBB 5D2LA 1RUQL 4KDWA 4MMZA 5AVTB 1R3KA 4AENB 2Y72A 4RH4A 5IT2H 2H2SD 5CJ8A 1V8HA 1IGYA 1RPQA 1SN0A 4HWEL 3WXVH 4OVVA 3WLWD 4R3SA 2WYTA 4KQ3H 3IETB 15C8H 4PN6A 4Z7OE 2KPNA 2AXFA 3QNZA 1W72H 1XCQB 1KN4H 4G7VL 4LAQH 1W6WA 4PG2C 5IMKA 4HIJB 3CZFA 3T6VA 3WTUA 5HJ3A 1MREL 4IRZL 3QJTB 2CKBB 4Z7WF 4MZRA 4N6RB 3QPQD 3V95A 3VI3A 1X9QA 4B3VA 3MRCA 4Z7QB 1L7IH 1YEEH 2B9AA 3ZHFA 5I17A 4JM2A 5AVUB 3V7AE 4J6RH 4ORGB 1OALA 3SQOL 4MQTB 1BBJB 1MFUA 3C8DA 4XO8A 1WFTA 1M57B 3MLWH 1AHKA 1HAUA 1ZRUA 1ONQA 3IBEA 2ICWJ 2NZ9D 3GJEA 4LQFL 4XN9A 1DQTA 1AGDA 4BDVA 3FNKA 4S1SH 5D6DA 1E8XA 1MCRA 2O61B 1WBYB 2PYED 3GLDA 3OHXA 4X9GA 1T2QH 5E6IC 2APXA 1BZ9A 5AZ2L 3ECUA 2Y2WA 5CXPA 4MD4A 5HGGS 2HRPH 3OJDB 4P2AA 1KYFA 2EO7A 1EMTH 4M7KH 1JNNL 4XNQB 1BZ7B 1JGVL 4GIPD 1FJ1B 4OGQC 5DUPH 4J3OF 4JKMA 1NOLA 1Q9KB 3OV6A 1FO0B 7PCYA 3RHWF 2X1PA 2Q3AA 2NY2B 1U8QA 4R9HA 3T1FB 5CZVH 5DJYA 4PRDA 3SGDI 1WCBB 3LV3A 4PGJA 4OLYH 1H5BA 3QIWA 5H35A 1C7SA 4P2YA 4U1SA 1YNKL 3Q6GL 3V4LA 5KUMA 5ITFA 5LG6A 4RAUB 4Z7AA 4GO6B 4HAKA 5D7LA 1DDHA 3K6SB 2OMXB 1K5NA 3FU0A 4WEUD 2IGFL 3T3PF 5BRZE 4LE8A 5K9KA 1OTUC 4HV8A 2EAEA 1XZ0B 5H2BA 4FKKA 5IMMA 1JPGB 1W0YT 4XE5B 3UO8B 1PEZA 2AJVL 1LO5B 4HIHA 1KPUA 1U93A 3UBXB 4IEFA 4AZUA 4EI0A 3ULUC 1M2VA 1IM3A 1Y6MR 3DJRA 3NGBB 1PLGH 5K39A 5L9DH 3NSDA 1QA9B 1FNEB 3MZGB 2AI0H 2E9JA 2H26B 1OL0A 3MDJA 4QKXB 3POCA 1BEYH 1UH2A 1AYOA 4NM8H 2DWEA 3GBEA 5GGRY 5I9QC 4PJCA 3BVXA 1LVEA 2HT3C 2A1WH 4RQQB 4WCYH 4EN3D 1T1XB 4B9GA 1JFHA 2BSBA 4JANA 3TBYB 4D0BA 2FATL 1NAMB 1PLCA 1RZJH 4PU2A 5HHOE 5C1MB 1NFIB 2YARA 4OZFB 1U41A 2UZXB 5D1XC 4PJFE 4QCIA 3FT2A 4MJ6B 3OKMA 1T89C 3WMQA 3DHPA 4DP9X 4GT0A 3GK8H 4NLHA 4WI9A 5GIRA 1MCPL 2NY7H 4N8VA 2BK8A 4B6ZA 3V8OA 3D85A 1NUGA 2V8MA 1J0JA 1X5ZA 4JY5H 3UZVB 3LIUA 2YGVA 3EDKA 2JELL 5DQJB 3S37L 3ZBMA 4KROB 4PJEF 1HL8A 3KMDA 3C5JB 3G9VA 4JJHA 1EJ6A 4GG8A 1E4HA 4X8JA 3UG3A 4ELKB 1FH5L 3KYNB 4W70A 3F6LA 1AQDB 1SHWA 4F2FA 1ETA1 5F7YC 3CBKB 3TLRA 2OMYA 3NDZE 1FFNB 2YD3A 4P48A 4UIMB 2FEEL 4XAWL 1KCBA 2AF2A 3WFDL 1D3CA 4NHCH 2ADGB 1KV3A 4G9FE 2YZ8A 1F97A 2KYIA 3D25A 1A1OB 1KTLB 4DTGL 5AYUL 4FI7A 1P84J 5I15L 1TQSA 3NFPB 3GSOB 2V17L 2VXSH 2H6OA 2VLLB 4U1MB 5J5EA 1J10A 4EQ3A 1M9SA 3H3BC 1U30A 1E5CA 1O6TA 4MXQC 4R7NA 4YMPA 1CFQB 4NNYA 4HIIA 3APFA 2A73A 2WNXA 1SZNA 3KPRE 4RWYH 1QFWM 5GJSL 2FYYA 4DP8X 1XWVA 4M62L 5FO8B 5GQBA 3G5VA 1JP5A 1GZHA 2NW2A 3SKJL 2N4IA 3PJSA 4KDTA 4P3CH 5I1IL 4JO5A 4MX7A 4NHUA 5HDLA 1GJIA 1J8HA 4ZMVA 4FQLL 1H9DA 2Z93A 3FB6B 2HJLA 4PJ7E 3C09C 5IVZB 3MCKA 1CLCA 1HH6A 1MLBA 3AB0C 3LXUX 1N2RA 4M48H 4WWKA 4BCZA 2YWYA 5AW1B 4DGIL 3NZ8A 3A23A 4OJDH 2O6PA 3O2WH 4YEFA 3MUGB 2DI8A 5DJ0B 1HXMA 1NUNB 2WAQA 1U0QA 3NCJH 5D7JB 3NFNA 4HT1L 2X2UA 3NQIA 4PGDB 3CFEB 1QSFE 1WPCA 3TS8A 5DVNA 2HN7A 5IB1A 3DK0A 1HCFX 2DLIA 1K6QL 2Z31D 1T1ZB 3EFDL 1ZLDA 1K4DB 1WFOA 1GTFA 2QDVA 5KVDL 4L4VE 4KK5C 3HE6A 4Y16A 1IGML 5KJRH 3OKYA 3GMLB 4KFMA 1U8MA 3LKRB 5FYKE 3QIUB 1PGRB 1D5IL 1I3RA 5E03A 3VXUE 3APDA 2XACC 3ULVC 2W9EL 2EDTA 2EKSB 2XZCL 5D70H 3WY3A 1JNJA 3FCSA 4YDVA 2A4ZA 1OGAA 1N8OE 4GKLA 2EEFA 4XB7A 1IJ9A 1A6WH 3W11D 5I1KL 4R2GC 5D71H 1NCHA 4J3UA 1D7BA 5CBEA 1S7RA 5DJDA 1BG1A 5C07E 2APVA 3HUJA 1IEAA 1HHIB 1UKQA 2JKSA 1XAUA 3KJ4B 4XGZB 4RA0C 4AQ8A 3AFLA 3ZLQC 5CU9A 1CGSL 2X9XA 4I2XB 5T33H 1YQVL 3MYJA 4NIYE 4IKLA 4RDBA 5C8JB 3NJXA 4O9HH 4UF7C 4HFWA 3FT0A 2AMGA 2BMKB 4WU5B 4N8PA 2Q8AL 1R3JA 4XVTH 1BFVL 1RFDH 3EO9L 1XH0A 4ADIA 3R4RA 4FQPA 3K72B 3P9MB 4YGVB 3TPKA 2QVIA 3U46B 2W0PA 3V9CA 1AHWA 3NJMA 3UAFA 2R29L 1EAPB 2IGLA 3X1BA 1VEPA 2VM9A 2BNQA 2EIKB 3GYRA 3KE0A 4JFED 4KJPC 3DROB 2DJ4A 2DWXA 3JT0A 4UTAH 3N1FC 1DBKL 4QJ4B 3D2UB 1Z9MA 7CGTA 3CQFA 4WW2B 1D9KC 3LKNA 3G3LA 4X80L 3WHE1 2FBRA 3T0AA 4J28A 3OAZK 1UJTA 4DVRL 1N3NA 2LT9A 2ZIDA 3N85L 4HEME 3GWJA 2WINA 3F00A 4ZOCA 4YWGL 1IZJA 3WCYA 3MV11 2QPUA 3BLKA 3ZDYF 5DO2D 3DLQR 1M1XA 3CSGA 5C09B 3B7YA 1JDDA 2XOTA 4HKXB 3NIGB 3VXSD 2YN3A 2GHZA 3L7EB 1XX9C 2C9VA 2Y07H 3RWJA 2XWJA 3NSYA 5C3TA 4LPTA 1KN2L 3PIQB 4MJ2A 3PP3H 2X6UA 3QI9B 4OJFL 3QQ3B 4LSUL 4UQ9A 5DRZB 5EWIH 3DGGB 3HNSH 4C56B 4D9RE 3IK2A 3QORD 6FABH 1MJ8L 1AO7D 2CBQA 2DQTL 2L7EA 3HS0C 4JZNA 4PIBA 5C0FB 2VRKA 4Z95H 4YLBA 3FTGB 1LK2B 4JL1A 1MJJA 4O58H 5GGUA 4EZLA 1CBVL 3FUDA 3MV7D 3FFDB 2YLHA 3GZQA 4L3CB 3SDYL 3WE6A 1PKQB 2C3HA 3D52A 3L5JA 4DSYA 4LK4A 3B9EA 3U4EA 3WG7B 3SDAD 2WBXA 1DTUA 1PD6A 1HKLL 2A9ML 2GK0B 1S9VB 1UUNA 3IRPX 3RHWK 1X5AA 1G6RL 2F8OA 3NDYE 4NKIL 1DE4B 2OZNA 2YO3A 3ZE2F 5HTSA 4N3UA 2GSGB 4POYA 5DVOA 1WS8A 3VRJA 3F01A 1B0IA 2ADIB 4GQ9H 2ZP8A 4BH8B 5BO0D 3BHBA 4E41B 4LXFA 2M26A 4JBSA 4OZ4B 3D18B 5T3XD 3FTZA 4FFYA 1FYTB 4XNBA 3IFPB 5LBSL 4IKNA 5LGJB 2G9HA 1JD9A 1HE8A 5IVNA 2NY0B 2YGQA 3VWKA 2ICEA 4Y4HC 4XBMA 4NQCE 2A9DA 3AU0A 4N9GA 2XKNB 4YBLB 1I8IA 1OCRB 2IXQB 1IGJA 4AEIL 1KSRA 3KPOA 3TO4B 3ARBA 1QABA 2XPYA 1NMCB 1X5JA 3L4TA 1Y18B 3BDYL 3WUWA 3NCMA 3FL7A 1HSAB 4FQIH 1BQLL 5DMJB 5LLIC 2QLVB 3SYAA 3QJOA 2OMUB 4WUUD 3QFGA 5BO1L 2CWRA 2H6UA 3CSTA 4NQTA 1TEFA 3AG1B 4PLNC 1IKOP 3P4NA 2ERJC 5KYWA 5C0GB 4HZLB 2MNWA 4NPYA 3NSCA 4CJ0A 5J1SC 2VLRE 3E6FA 3DMMD 3RDTC 4NQXA 4MJ4A 3DHJA 4F7MB 5EU3B 4P23A 4JG1H 2FX9L 2FO8A 4G80B 4L8DA 4XP1L 4Z0XA 3NCCB 4GG6E 4RMRA 4DNLA 3PNWA 4Y2LA 4MSWB 3HZKA 4H40A 4G8IA 3ZW3A 4YZFE 1IIKA 3ZTNH 5TFSL 2Z64C 1S7UA 1T5WA 4JY4B 3NCWA 1HOEA 4TUOB 4BQBA 1RULL 4XRCB 3I74A 2MMXA 2XBTA 5EZLB 5ISZD 2Z92A 2VXQH 5FKPA 1R3LA 1QHPA 4QWWC 1LEIB 5E6SB 3S34L 1T83C 2Z9TA 2IDTA 1IKFL 2WIMA 2XX0A 4LHUG 4H1LG 2ARJQ 3A0OA 2DH2A 3BQUC 2BVPB 3CLWA 3O4LA 4TQ8A 3TESA 4JFOB 2EDDA 3ZO9A 4YLCA 3L3OB 4CNIA 1D6VL 1AGCB 3GBNL 3JV6A 3X17A 4WV1C 4BQ9A 1BM3L 1Z5LA 2YPLE 1CYWA 2Z8RA 3MACH 2N0KA 3C75A 5JDSA 1DN0B 3TYGH 3ELQA 2VWEE 4HKZA 4NZTL 1YPZB 1NGQL 1QZNA 1EPFA 4ELMB 1Z9PA 3FONB 3II2A 3VXRB 5TE7L 3QZNA 2IALA 4HAGA 4WWNA 4OLXL 3EG9A 5JXEA 4XMWA 3TJEH 2NW3A 2OX5B 5EOTB 4CMHC 5ID0B 2P8PB 2ZCHH 1ICTA 2EILB 1IGCL 3D69B 1LNUB 1VFUA 3UTQB 2VT0A 1OK0A 1KACB 3QZWB 3K81A 5EEVA 2M1KA 1LJMA 3OSKA 3MUY1 4LLVB 2PPDA 3DV4B 3EAKA 1JVOA 2ADJA 2K3HA 1IAOA 1PZUB 1T1WA 3W39B 3KWWB 3V9EA 2DBJA 3IMSA 2R23A 3SQRA 2V6HA 4LHUD 4PRHD 2ZICA 2Z4QB 4YL9A 1XTMA 3B5HA 1XMWA 2YXVA 3UTTA 2F5AL 5CJQH 4W9CC 1ZLSH 5D7IB 1MCJA 1TPXC 4B9IA 5D1QA 4X6DE 1FFOA 4UZGA 3GMOA 4MNGA 4X9BA 3ULUF 2IADA 4IRJB 4V1DA 3DOIA 5CSZB 4OF0A 3W81A 4QRRA 3GXUB 5B38G 5IJDC 4NQQA 4ZOAA 4AMWA 3PWNB 3SJVE 2BOCA 3X13B 1CTOA 4JEGB 4AV4A 2EIZB 2R69A 3FO2B 4WI0B 4F2MA 2C3VA 1HH9B 3WO4C 2P7TB 1JERA 3QYMA 2I9LA 3UXFA 3CGTA 2GT9B 5E5UB 4APQA 2YJLA 4NN5C 4L8SC 5J3HD 1BZQK 5ID1B 2MCMA 3WN6A 4Q89A 1M56B 5JPMB 1EZVX 1WYJA 1AANA 2J1XA 3C5ZB 1PW3A 4H0IA 1FFPB 3A47A 5JXAL 4R97C 1HVXA 4NQEA 3QUZC 1QNZH 1SFDA 2GQHA 4DGUA 3QUYA 1ZANH 2AEIT 1MNNA 3JVGC 3T2NL 4CKVX 2OTUA 4KKBD 4Q56A 3L9RA 3I50L 3FU5A 3RZWA 4DK5A 2GK2A 2XXFA 4KQ0A 1RY7B 1UA3A 1WG3A 2XT1B 5FCSH 1HC1A 4JPIA 2OYKA 1Q94B 2VDML 4KVCL 5T1KD 1QTPA 1I1RA 1D5XA 3KPQB 3ILPB 4FXKA 4JQXA 3VTMA 3CLFL 1DBAL 3QIBC 2CBPA 1A4JB 5IJVB 1ERNA 3ECVA 4UV7L 3TA4D 3V6FA 1NA8A 2AQRA 3JWNH 1AACA 4JFTA 2I5YL 1GKOA 4MWFA 5IBTL 1OVZA 1OV8A 1C5CH 3FO0H 4OFVA 4M1GH 2IH1A 1NCCL 4QTHA 5EC1A 4Z3IA 4D9LL 1GGBH 3QBTB 3KL3A 3TYFA 4LASH 4IIQA 2O5ZL 4MD5A 4PFEA 4S1QH 1KTBA 1NKOA 1O9WA 2HVJB 3FU3A 4KK6C 3CFMA 4TPRH 3O0RH 1GIGH 1DN2A 1CQKA 1IFHH 5F9OH 4OF3A 1DO5A 1IBYA 4OV6F 3ZE1B 4YE4H 3P0YH 4AE1A 1WFNA 3DX7B 5DHYA 4ZUSB 1PX4A 4PJ6A 3LPPA 5IJKA 5HGBB 3G6AB 1ZGLM 1AIFA 3D3VE 3RNKB 1IAKA 4E9VA 4XOBA 3C8KB 3LPGA 1WA1X 3JWOC 4U1KB 3DI3B 2VIRA 4PUBH 2XN1A 1QHQA 3ZL4L 3ALWA 3SO5A 3VACA 1Q0EA 3LY6A 4OT1H 1F4XH 4XTRC 5IK3A 5E8DL 1UT9A 2OXGA 3Q1EA 3V0AC 5IB5B 5KS9F 5HGDA 2GJPA 4MVBC 1B90A 4WJG3 5TGBA 1GCFA 2AW2A 4YPGA 5C6PB 3HNTL 4MNQD 3VSTA 4DN4H 4WWID 1OCCB 5B1KA 3DX0A 4FQXC 3U1SL 3VYOA 1JE6A 2E7CA 1KIUA 3QISA 1U33A 5DS2A 4HHGA 3VUAA 3IFLH 4JRXB 4YHPA 4HXAH 3TEXA 2Y23A 4PS7A 4OGXL 4O2EB 4PJ8A 3EJZC 1JJUA 1FVCA 5EZPA 1GC1L 3NJKA 3FQXA 1T4KA 4P4KA 2G75A 3QG6A 2ZX7A 4YFDB 2OKMA 2XVLA 2UXTA 2FH8A 5FGCE 3H42H 5F7HA 3ULVF 1NFKA 1WRFA 1YUHA 4E42A 5E56A 2WBKA 1MQKH 2QTVA 1F3DH 4JFDE 1ZDQA 1H6FA 1RCYA 2GPZA 4RIRA 4ZZKA 3H7BB 3HR6A 1UWYA 2VLJE 2CUHA 2DJUA 3CN1A 3MRRA 5CGYC 2O4EA 4AMKH 4L18A 3UTZA 1JGDA 3VG9C 4MRCA 1NMBH 1QFUH 4P9HH 5FO7B 1TR7A 4ODHL 5KSBE 5JYLA 2QQLH 1A7RH 3NCYP 4YC2B 5A3ID 2K78A 5CUSL 5JHDB 2AC0A 3TN0B 4YPJA 2BNRB 1U2HA 3KVQA 4MCNA 5ILTL 3RGVB 5F88B 4CJ1A 3TURA 4KJYB 2AJSL 4XMKH 4EOWH 2B8OT 4UM8B 5C0AA 4P5TA 1SF5A 2IPKB 5K9QG 4WFEE 4PWEA 4X6FA 2CPUA 2UYLB 4PGZA 1A7PH 3TIEB 1MWAB 5I66B 3PAYA 3LEVH 5FO9B 4KRPB 5HP5A 3KGRA 4NZRH 1P9MA 4EE2A 3NESA 3IDYB 1L7TH 3LDBC 6TAAA 2DBLL 2QKSA 1U8NB 3HRZA 1AZCA 1LO0L 3GB7B 1KCKA 3IDGA 4OCMC 4BK8A 3S36L 3P77A 4GBXB 2A0LD 3NIFF 3AAZB 3IDJB 3MNVA 2VJ8A 2EDLA 4M6NL 2HJKB 5EA0H 3TBSA 5C0JA 3FHEA 4P2OD 4U6VH 2FZ3A 4M29A 5AWNL 2D0HA 1FUNA 2HT2C 1B4TA 2NNFA 4AMXA 4BSVB 3EYFB 4HJIA 1X5FA 1BDYA 1FRGH 1DYZA 2XQBH 2IANB 2WY3B 5CZXD 1FCCA 1UENA 2JJWA 1FE8H 4NAJA 1F6LL 4KX9A 4R5VA 2CO6A 2MCPL 1L5GB 3FHAA 3STZB 3T71A 3ZDXF 2PYEA 4YSTA 1VFBB 4L37A 2YMXL 3GXTA 3ZT7A 4QOKB 3FQUB 1MVFA 3QWRD 4OCXH 1B2WL 1G94A 1AI1H 3OGCA 2ILLA 5AQ0A 3L4YA 3X2QB 1K3ZA 3O4OC 2BVYA 3BZEA 1UM4L 3DVFA 1MNUL 3QJHA 5SWQA 3T09A 5HHPA 1UGKA 5SWSB 1S3KH 3T4AC 4U6HA 5FK9A 1BD2D 1E6JL 3VFOA 4ABUA 2VSDA 3UACA 1QR1A 2UZPA 3V6ZA 2BS71 3R8BB 4WHTB 2C7UA 1LE9B 4KITB 3LVTA 4IOIA 1E9QB 3NJHA 3S96B 3UYPB 3V7MA 1JZHA 3ZE0E 2J55A 1MCOH 1KCRH 3CCHA 2CHDA 1CO1A 4WKZB 1T1YA 5D2LE 4L1TA 3WXWH 3EOTL 2LAAA 4E5XG 4LP4A 1JZFA 4YHYC 3IDNB 2IIJA 4N90E 2J6EA 4F7TB 1WTGT 1G87A 1U58A 3BIKB 3NJIA 2D3LA 2QGDA 3QEUA 4YHIB 2E8ZA 3S5YA 1HSBA 4Y9BA 2GTWB 4O02L 2DKMA 3G6JF 5FA4A 1LDPL 2JNZA 3I9GL 4ENEC 3VI3E 1EFXB 4K9EH 3TEYA 1JF6A 3BZ4A 4JKKA 4L8CA 3L54A 3QJFB 4XZ4A 4F57H 1BX2A 1Z9NA 3WDHA 1ED3B 5GHWH 1F00I 2LAGB 3FN0L 1OAYH 2B5IB 5E1HB 1EDHA 3SPGA 2UUDH 3RX7A 4TM9A 4EN3A 2XTJB 4JHWL 4YXKH 2CKBA 3GKWH 5JHAA 2O5YL 4XODA 4YDKH 1RLWA 4FCHA 1QWNA 4GI6A 1RPUA 3L7FA 5HI4D 2NLJB 4R5TA 1KIQA 3R18A 5T1DH 2QHRL 4QRPD 1JXFA 1L9TA 1MRCL 1DQLL 1NCIA 4TUKL 1X44A 4ORGA 3VMNA 5I1JH 3V2AR 5D7EA 2X53A 4M1CD 4GUQA 1YJDH 5I1DA 4DKDC 4LSVL 4PS8A 2KT6A 5T3ZD 1E5YA 4F8TA 3VB9A 4DKEH 4OCSH 5FGBA 1U8PB 1FV1B 3TA3C 5KSVA 1LXMA 4YFLF 4DGYL 5IMOB 2FSEB 1WBYA 4DO4A 5JIIA 4MAYD 4M3HA 4DO6A 2NXYD 3R06B 3B9KC 5BV7H 4A68A 4EVNA 3Q5YA 2H47C 4MZ3A 2ADFH 1MHHB 4M7ZB 4ZW8A 1ZHKB 1R1CA 3QE5A 5D7LE 1KEML 4NBZB 2B39A 2BM3A 3AY4C 3WEXB 3GI9H 2OSLB 2CGYA 5J9PB 3JBG7 3WLBB 1PY4A 1WCBA 4FMKA 5DJ6A 1XBRA 4BA8A 3CN3A 3F7QA 2OMTA 4Y1AD 4G83A 2JI3A 2W65B 3ARFC 4RAUA 2YAEA 2BVOA 3NRQA 3BQVA 2WKOF 5DC2A 2IF7A 3QDGB 4FZEH 4U1GB 4N0YH 4ZRGA 4J8RB 4HJ1A 5I8EB 1KGCD 5MHSE 2CCLA 2EDYA 5I6XB 3TF7C 3AQZA 4H88L 4JR9L 4QRTB 3EZ8A 4K5OA 5L2KB 1CDYA 4OZGB 2IDUA 1UD4A 5ICYB 1GYVA 3RL1A 1XGQB 3NH7H 4JO2L 1UA6H 2A6KB 2LLGA 3OX8A 1VZIA 4AYFB 2E6JA 4WW1A 1EX0A 3WFBL 1C1EL 2Z35B 4BFEA 1MIML 2FT6A 2WV3A 5J12C 2A74A 4N2KA 2CMRH 3LIZL 1QFWL 1PZSA 3TH4T 4PP2A 2ED7A 4ETQB 2IBGA 1DVFD 1SHSA 2PW2A 3I6LE 2DD8H 2X28A 3UP1A 3CDZA 4DERA 5D4HA 2B14A 4DKTA 4S0SD 5CSGA 4WY7H 1JNHA 2WXPA 2XWCA 4JFZL 3GI8H 1P7QD 2FX8H 2Z31A 5F6HJ 3UL4A 4IJ3B 2CLVA 3QFJD 1SGKA 4W6YB 4QTIH 3VFWA 4MCMA 1R5VA 1I9IL 4HUXB 1DBBH 2VTFA 4LLUB 4LMQE 3SKOB 2VL5B 1CG9A 1WHPA 4NGHL 2E7DA 4AM0Q 3O3AA 5SX5H 3GXFA 3SBRA 2P24B 4NN6C 5E7BA 1NCOA 4O51A 1FPTL 4KKQA 4HEPG 3CH8A 4Z23A 3ARGD 5DQJA 1QHOA 4FHBD 4HIQA 5F1NA 4PGEA 5AG8A 1DLHA 4ODXA 3KLDA 3AS3A 1J9TA 2OJEA 4UBDC 1PNCA 2X4UB 5IROC 1P4UA 4FQCL 3MLZL 1MJ7H 5DZ9A 4GUPA 4B0MB 1R3HB 5AAWC 4OLZL 4B97A 1WAPA 1OT4A 4G7QB 2A38A 1BQHB 2G4EA 2E74C 3RL2B 3MLTA 3WNIA 4PCTA 4DK6A 3FO9B 2BY3A 3GSOA 2WOYA 3P3UA 1UD2A 4FNLH 1U36A 3ARZA 4PW3A 1OF2B 3FCGA 2VDOB 2R1WA 1ZT4B 4B9PA 1J8HE 3LB6C 1CFQA 2LU3A 5I6NA 1RUMH 3B2VL 1AJ7L 5GRWA 2FNBA 5KVEH 4BWUA 1MUJB 4ZO9A 4JFEA 4PV8B 4W9GC 4CVXA 3QXTA 1UJ3A 1JPSH 1FL3A 3N40F 4I3SH 4LLWB 3H9SE 4HHAA 2WNWA 1YG9A 1TZHB 3D0VA 1I7RA 5B7MA 2O1AA 3WTYA 3BWAA 3FB6A 5EO9B 1B4JL 5IVZA 5M7QA 2EUZA 1HX0A 1SLXA 5E99H 2Y7NA 2YD6A 1SLWA 3KVPA 4U1JB 2BRRH 2B77A 2EYTB 4K73A 4OD2B 1YNLL 5G55A 2X88A 4KMTL 3GXNA 1I3UA 1GKEA 2PCPA 3MCLL 3QAZB 3QK0A 4K8RH 3IF1B 1FHNA 3DX8B 3OPUA 5I5IA 2OXHA 3T6ZA 4AQ1A 3WFEL 2Z65C 2X4QB 2L7UA 1EEYA 1KPVB 3QDAA 3PXLA 1T0MB 3GJFA 1VJSA 3HG1B 1PQZB 3UMTA 5D7JA 4UZUA 5CCGE 4U6YB 5IHZA 3VXSA 3PGFL 2IEPA 4L9DA 4F9LC 3KVDD 4M43L 3HG0A 3I9PA 2P8LA 1NC2B 1CQYA 1FGNH 2R69H 2X42A 4J1UB 2Y6SD 2FIKB 4ODSL 2YEZB 3X1NA 5LQBH 4HP5A 1HHKA 4XCYB 1OGAE 5FDYA 2H3NA 3LEXB 2F6AA 1AO7A 2AXHA 2HX9A 3QNYB 3LKRA 4XCFH 3VI4F 4UDTB 5HPMA 5EO1A 3MLSH 3MV7A 3SZ6A 1N67A 2PWGA 1Z9SB 4LIQL 3B3IA 2IQAB 3QEQB 2I85A 4U1LA 2FJFA 4TVUA 1VHPA 1PEWA 1R17A 3UDWC 3W2DL 5I8KL 1N6UA 1DQDL 2BVEA 4LEOB 4LSQL 4MS6A 1NAKH 3EKCA 2YAMA 5IOKA 1RUAH 2PKDA 1NBZA 3MJ9A 4F33A 5JYMA 4U3SB 2NNAB 3NJJA 3JZ7A 2NXZD 4XC3H 1J8KA 5DU7A 4OZHE 4FXGC 3REWA 4I2XA 2H1PL 3C6LB 4JFYB 4MGXA 4G6ML 1YJDC 5KAQF 5KVFE 2BFVL 2BNQE 3P0VH 1NCBH 1UVQB 4G6KH 4TVPD 3ATBA 2Y1ZA 1KJVA 3EDDA 4KKAC 4XOEA 2Z91A 5G2NA 3I9IA 4UM9B 3HZVB 3KGSA 3QDJB 1T7VA 3HCVB 4MJID 3RPIA 5IV2B 3V52L 4JN2A 3NIDB 1S46A 2XY1A 1I8MA 3BJLA 2XZAH 3BVTA 5ACMA 1LWHA 2Q7YA 3WKPA 5L6YH 4PRPE 3EBGA 4FHKA 3V5DA 1SXNA 3GSNL 1RHHA 3ARXA 1BYNA 3AW5A 4OQTH 1GY1A 3U6XS 5DMGC 4I9WE 3QHZH 4GSRA 5DJ8B 3MN8A 1ZVNA 2YC1A 1UXWA 1HIMH 3TM6A 5IB4B 2BNUA 4Y19B 2VDKL 4A6YL 4GNKB 1JWUA 2YIHA 3BZDA 4WUUA 5E8PA 1L0PA 1JZIA 3OR7B 4OR1A 4FXLA 3GSXA 3RB5A 2HXAA 4Z76B 1J0KA 1REIA 2YKLL 4P4RB 2HLAB 2JE8A 3VRLF 2WYZA 3V4VA 3GF8A 3X12B 4KO6A 1LO3L 1PNDA 4KFZC 3HI1B 1W9XA 1ZGLP 2W5PA 5IESH 3WJMA 1EHNA 5FUOH 4KI5C 4KZDL 4PGCB 4TRPH 1J86A 3QQ3A 2FEEI 1YEIH 2DQFA 4R4FH 5CEXA 3FTVA 4J5VA 3MRPA 4MB4A 1MN4A 1NL0H 1U8KA 2HTLD 3BH4A 3MRLB 3THML 1LK2A 5ISZA 2VXVL 4QPEA 3U9PL 1S9XB 5CFAA 5D5MB 2ALWA 2CJ3A 5KVGH 4BD4A 5IW3A 3PHSA 4M8VA 1U8IA 3Q6FB 2PMZA 5CWSB 3JSSA 1OARL 4MA7H 3U9WA 4PCYA 1BLNA 1T20B 3QH3A 1X6NA 5DZAA 1TSRA 4ZT1A 1D7DA 2NY3C 3NEEA 4NWTL 5J4MA 2YA0A 4QGTA 5EO0B 3CDFA 3HRPA 2R4SL 1TKWA 2VR7A 2ZOTA 1EUTA 2QT6A 4NP4L 1OE1A 3MBEB 4NCC1 3JUYA 5GS0C 4OZ4A 3VA6A 4KTGA 1HZLA 1WFIA 2HWZH 2FD6H 1FYTA 3ESVF 5GSRA 1TTRA 3LOWA 4Z0BL 1RK7A 5LGJA 3V0VB 4HKBA 4JGUA 4PJ9A 3SDDD 4DAGL 1AGEA 3S7GA 2G5BB 4OD3L 3CG8A 3J2PA 5IW1A 2P8MB 3IAPA 4IBQA 3KCPB 2XKNA 4R96B 5L8KB 2WAHA 4YSDA 5E9NA 1HHHB 3O45B 4IMKA 1CICD 4M6MH 3PGDB 4OI8A 4GW4B 3CDGA 4F7EB 2Q20A 4FQJH 3BE1L 3MRBA 4Q58C 4UIKL 1G6RB 3QUMA 5F9AC 4IGBD 4HCRH 4WDIB 1WTLA 2OI9B 3U25A 4LHUA 4H1LA 3LEYL 5D1ZB 2HH0H 1WCQA 3MLRH 5GRVL 4AYMC 3N44B 5F7DA 4OTXL 5CR8A 3BT2H 2CR0A 2XXCB 2J2ZA 3T6QC 4B5ZA 2ZX6A 3QJVB 3WL9A 1I7UA 4B27A 1ZA6B 3MKKA 4YHML 2QELA 1HWGB 3B4NA 3D0LA 2G3MA 2PWFA 4G6AC 5DMKA 1G9EA 5E1GA 1UQSA 3RFZB 4G80A 2BSSA 4GAGH 3O3DA 1CGYA 3O9WC 4G1MB 4HPYL 5C2UB 2P43B 2GTZB 4F3FA 4QHPA 3RVUC 1CR9L 3UYRL 5B8CB 5IUSA 3VGAB 5JDJA 1G9NC 2PO6B 3S48A 1P5UC 3KNBB 5EZLA 3KPSD 3VWJC 4NDMB 1AXSB 4LP5A 5FYLH 3O4LE 4FADA 4DPCX 5E4EB 3PP4H 1M7IB 1A25A 4RAHA 3ZUNC 2X4SA 3PLYA 3SBWA 2ODIA 5C0IA 3MNZA 3NFSH 4WNQB 1INDL 3QCTL 3SGDH 3ECBA 3KLSA 1EVTC 5I6LA 4PJBA 5FHAH 4U6XB 4IDJH 3L1GA 4TS6A 3CVIL 5B1CA 4ES9A 3L3OA 4ONFH 1AGFA 4ZTPL 3RUGF 2C1PA 3TOPA 3KLLA 3O3BB 2P48B 3D51A 3B43A 5I1EL 5TD4A 1ES0B 1UXLA 4R26H 1A0QL 1NFAA 1NWOA 3FONA 1BIIB 1Q9LB 3PU7A 4KWUA 1OIOA 3RWCB 2DDQH 5DK2B 3F12A 4Q6YA 2JK5B 2VKWA 3PP3K 3DOSA 3T3PB 2K8MA 2OSXA 1F6FB 4E9RA 3WKMH 3D69A 2Q0ZX 3NQKA 4BZ2A 4DETA 3KLAB 5EBMA 1HHJA 4N0RA 4TTGA 5B39G 3PXJA 2VSMB 1FC1A 3UAJD 3UTTE 1FC2D 2VDRH 1U21A 4G3YH 4I5BB 4JG5A 4PR5B 3FQYA 4F20A 1ZIAA 3IPFA 1TZAA 7FABL 5DFWH 3U79A 3APNA 3NSJA 4ZPVB 2WLIA 1DBJL 1NIEA 1ZS8B 3H3PL 5D1QE 1IE5A 3GUTA 3S97C 2FH6A 1O0VA 3DIFA 3OZ9L 4J3OG 2J6EH 5CN2A 3TTSA 5JUEL 4BK4A 4MNGE 1SN2A 3LX9A 1JPTL 4V1DE 5DI8A 5C7ZA 5GGVL 4QRRE 3VD2A 2OCFD 2VZOA 4LLYA 5D7IA 5DUBB 4MAZA 2XKSA 4F2ME 4ABVA 2GABA 1RMFH 3CFJB 4DP7X 1L3NA 3RWGA 4H13C 1C08A 4NCC2 1WT5A 3EHBC 3LTVA 2ED9A 2AVFA 4OCRL 3HAEB 4PTTB 3PWPB 1HQRB 1LLAA 1YEDA 3GS0A 2FB4L 1B0GA 5I71B 1AXTH 2YLKA 5A2KH 2CKBH 4JNXA 4HOXA 1NCDH 4RISL 4HKJA 5D1ZI 2AJ3A 2F5BL 2XWBB 4NNXB 1DJZA 3E8UH 4IHBA 4KQ4H 3GBLA 5ESAB 4ZFOA 4NQEE 3RPKA 1SJHB 1GR7A 4PJEB 2D7NA 5ID1A 2JJSC 2QL1A 4Y88A 1HOCA 3ARDD 2DQJH 3B2UD 1WZLA 4MNQA 5BNXD 1JOIA 3QQDB 1AE6L 1EUUA 2NY1C 2DTML 2J6WA 2BVTA 1TO5A 4J3OD 4XAKE 3JV4A 3NN8A 2JCCF 2AS5M 1T0PB 3CQPA 4GQPH 1QYGH 3BD3A 5DURB 4RBPH 3BAYA 3C60A 4I0PD 3CPUA 5KN5B 2AK1H 4EN2A 4MJHA 1YZZA 1HYRC 4TN9A 3UJTH 5DT1L 5ABZA 1TJGH 3HG1E 3U4BL 1CFBA 2X4OB 4P46D 1NANI 3BKML 4ONGL 4DUWA 4ZXBA 1AS8A 1OOWA 2XNAA 1RZFL 1FO0H 3R1GL 1FVEA 2SODB 1Q94A 1MDAA 3FB8A 4OLUH 4JFPA 1JZ7A 2RD0A 2VN5A 3DYMA 2UY7B 4JPWH 3AROA 1FGVL 3DV6A 3MLYH 4EKXA 4KO7A 3GEWB 4K9JA 1EEQA 3PUCA 4KJWC 1N0XL 5IFJB 1DVUA 2VDNL 1YEWA 4JPVH 4LEEA 2A9CA 2H8PA 4MA3B 1OCWH 2H41A 1O7SA 3FQTA 3PAZA 4LOVA 5DS8A 2DKSA 1M3IA 1F8TH 1LILA 1PD1A 2ZJSH 3IN0A 4N87A 5E00A 4AL8L 4UNVA 5F70A 5BOJA 2Y36L 2R39A 3ZZQA 2YQGA 1YEFH 3GRGA 3IGLA 4RGNE 1HEHC 1FDLL 5KJ7E 2F54D 1BCIA 1AD9A 5HVGB 3U36A 4NN7B 2C9AA 2ZUSA 3MCG1 5LUMA 4LP8A 5E6RB 4ZTOH 2K45A 3P30H 2GKIA 1V3MA 5GGTL 2APSA 4M6OH 1Q0YH 5C08D 3MUJA 2VDMB 4XB8A 4J3SA 4J3TA 1N7ML 2WXJA 1Q9OB 1CLVA 2O93L 3OLEA 3AXLB 3KPMB 1SOSA 3DX9A 1MVUA 3MNWB 2XBDA 3MROA 4FQ1H 5IKCA 4Z8FL 1CFSA 2XPZA 3BW9A 1PJ9A 1IBGH 1WZMA 4N2OA 3MV9B 2XZQL 1B4LA 5KVGE 5BVJA 1RIVH 4OLWL 4Y5VA 3OB8A 4TLKA 2BXZA 4RGMC 3QHFL 1OCZB 2QKIB 3WNNA 1NAMH 3JUZA 4OZFH 3PHQA 4Y2DC 5DQDH 1VCBC 3E3QC 3QRBA 1F3RB 4OUOA 2X4RB 3KPPB 3OAWA 4YSOA 1A2YB 5F9JB 4X98B 5HGHA 4D0CB 3B8YA 2MKLC 5IF0B 3WD5H 1E67A 3CFDA 4Y19E 4WO4D 3S98A 1KY7A 5I8OL 4M02A 5GRJL 5IFHL 4JFUA 5T1MA 4FXTA 1BXXA 5FV1L 2EVIA 4ANUA 1DUZB 3GEFA 1KCWA 2XVGA 3EYVB 3LRLA 1MF2L 4PJXF 2VSCA 1CZ8H 5EU5A 4W81A 1Y1DA 5E1QA 2A6DB 3U7YL 3DSNA 1A9EA 4EAEA 1QEXA 3QXWA 2KZKA 3EOBB 3TFKC 3LXCA 1AQMA 1BD2A 1MCCA 1X5YA 5FM4A 4C4UA 1DQQB 3IJ7A 2EDEA 2ZXGA 1Q1JL 2AJYH 3DTUB 3T2PA 3C6EA 3QORB 4YN3A 1BOYA 1SXSA 3EADA 1EZSA 5EIQA 3MREA 4EBQL 5DYOB 3S3DB 4P5KB 3FCTB 4FN0A 1UXSA 1O7DE 2VE6B 3W37A 3T6XA 1MFBL 3P0GB 5C0AE 1FNLA 1Z5HA 4PJDF 5JZ7D 2HTKD 1VLXA 4U7KA 2XICA 3HLAB 2EDMA 2FRGP 3GGWA 4PJAF 4P9ML 2EVHA 1AGBB 1LD9A 3SDAB 1RZGB 5F88A 5AENA 5KSAC 1QVOA 2Y1VA 4KJYA 1FYHB 3OAYH 2HKFL 5JO5B 1KLUA 2C4FT 2IPKA 5FKAA 5CMAB 4R7VA 1J11A 5I66A 1JXGA 2DMBA 1EGJA 4IRSB 4UTCA 3FUIA 2QJDA 4YOKA 1FQ9C 3SKMB 3VH8B 1FNAA 1KBBA 5F72S 4U1IA 3LAFA 1RIHH 2DQ6A 1GTNA 4AC2A 4KZ0A 1JWMB 2J88L 2VR8A 5BMFH 4X4ZA 8PAZA 1AKJD 2Q9OA 3NZUA 3VMPA 5AOZA 2UZIH 3QFDB 5ADPH 1U95A 3BAXA 1F4WL 5E8NB 2PYEE 1TXKA 1BOGB 4QRPA 1ZV5A 2V7NB 3OPZL 4Q9BA 1A6PA 2ZWNA 3TJHC 3PL6B 3FBKA 4BA0A 4EKJA 2VC2H 4BCYA 3MRJB 1I8KA 1U92A 4KO9A 4X6EB 4E5XA 3UH8A 1ZE3C 5DD3H 4KTDL 5IQ7L 3BP7A 1M9WA 4MB1A 2AQPA 3Q8EA 3ZE2B 2CO7A 4KI5F 3RU8H 2GBTA 3JTSA 1PZ2A 3AJ7A 3L3DA 1I8LA 4BH7B 1XIWB 1R6VA 3K2IA 1AC0A 2HFTA 2E76C 3IJEA 4NQUA 3FFCB 5DHVA 4HF5L 2BVQA 2ZSVA 3IB4A 3V6OA 4KJQC 4GFTB 4AGPA 3MJ9H 5DVLA 2CIIB 3DMMB 2O26U 5MEOA 2QHLA 5K93A 4IS6A 4F1ZA 4AW7A 1CL7H 4JO3L 1MCLA 3FQ2A 3VAEA 3KWUA 3DRTA 4K2UL 1JF1B 2FE0A 3IJHA 5JW4R 1XGYH 3QS2A 2AKRB 4PVLA 1LE9A 4JRYD 2F8XC 1KB5A 3EUDA 2BWIA 2F7RA 5I1HL 3FO1A 3K74B 5IHWA 4XC1L 5A40E 1MCWW 1UT1A 5FYJL 4HJTA 3FCUB 3GZOA 3U48A 4RGOL 3EJQA 5L8JB 1PSKH 4QXGL 3V5KB 1WVZA 2D7MA 5E5MB 1MW3A 2QV4A 3BIKA 4JQIA 3TZVC 4P3DB 2GTWA 3FQNA 1FZKA 1X3DA 2NY2C 3WIHH 5HYQB 4WK2B 5E23A 4F1SA 1EEZA 5I5JA 2HG5B 3O6FB 1S7TB 3VFMB 3H3KA 2UWEA 1OGSA 3O8XC 4RX4D 1OSPH 5TDNB 2W60A 2LFEA 4LQ1A 1ECYA 4PP1C 3L3IB 3FF8A 3QO0A 1M6OB 4XN5A 4NUJA 1DVFA 2EVJA 4TOYH 4CC4C 3V4VH 4HPHA 3PQYB 1P4LA 4ISVB 4MQ7A 3OF6D 3HS9A 5C0BB 2WN2A 5T5FA 3L3KB 4QY8A 3S3JA 2ZUQB 4Z7OF 3ETBJ 4F91B 3S4SB 4N0UB 2D31A 4DZBA 2P5PA 3GHEH 4DESA 4YQXH 5MEND 2R0KL 4JX0A 4X8GA 3ML9A 3NGBC 4TQIA 3K80A 4MA8H 4FNSA 1UATA 3HMWL 3U0TB 1GZPB 3BZ5A 1T2JA 3O2DH 1LEKB 5F7KC 5T1LD 1HL4A 4YHNB 1EHXA 1A3LH 1PX8A 4UQAA 1EXUA 4O02B 2WKGA 4XVSH 5BJTA 1BP3B 3MRMB 5DD6A 2F19H 4BCXA 1TOXA 3RZCD 1S7XA 1A6TA 5DJCA 3ZZ1A 5LXGL 4I87A 2J72A 2X3BA 1HS6A 1OE2A 3H9HA 5LAXA 1N59B 4A2LA 3BP5B 4HXBH 3PDGA 2OMZB 3QAQA 2EH7H 4W68A 1JMZA 4OM1H 1ZHKA 3IWUA 1F56A 1ZEAH 2GC4C 1J5IA 2DQHH 3QNXA 3WFCH 3GDCA 2JV6A 1MXGA 3O6KL 4MQSB 2B4CC 2ICWI 3KBEA 4N1CA 3R0MA 5CLYA 5CEYA 4PS4H 5E6UB 2X6BA 3RVVD 1ZA3B 4JZOA 1Z3GL 1PY9A 4Z7VB 5AOJA 2QQNL 3F85A 4PJIA 1DSWA 3T8XB 3HNVH 3WY1A 4NQVB 4FFWD 1ZHBB 5BVPL 1TJXA 2FECL 3QS3A 4OZGA 2EH8H 4EUPB 1OK8A 1INQB 5CP3A 5ICYA 4HU8A 1JV2B 2APTA 2HFGL 1LEGA 4HEPA 3T0ED 3G5XB 2NY4B 2P5WB 3QUMH 4OKVA 4PJHA 1VA9A 2BP5M 4HSQA 4AGNA 3ZXAC 4RFEA 1KNOB 5HJBA 5IHUH 1EQWA 5EPMA 3SPHA 5SWZB 3HHSA 2UXGA 1KELL 1QQDA 3D5OF 2WP3T 4PREA 2P28B 4HUMB 4NQSB 3ET9F 1YYML 1JZ3A 5FCUL 4FZ8L 4Z3TA 4NPJA 3IFNH 3M8OL 4IW4C 1D5MB 2ZSWA 4AV5A 5I9QB 4UT6H 4UV4H 2EYRA 3BESR 2GTQA 3W0WA 2V37A 2WGXA 3MNDA 4ZO8A 1YY8A 5KUKA 3G04B 4PYGA 5DTFA 3ZIYA 3TIDA 1AZBA 4GRWB 2EXTA 5D1XB 4LLQA 2QMJA 4PYHA 2YZ1A 1SFHA 4HMCA 3MXWH 4PW4A 2AK4B 3VVVA 3AXIA 1E0OB 1ETB1 2OTWA 4G71B 5DRWB 4C8XA 3IVKA 3HZYB 1TQVA 2C7FA 2Y4SA 4U0RB 2AJZB 4TULL 2GJ6D 3CMOL 1RUKL 3NZSA 4PRAB 3DX4A 5E6ID 4NRXA 4MNHB 2UUDK 1CPUA 3MOQA 1A14H 1ET8A 4BFJA 2HT4D 4UOZA 4FG6C 4UI2A 5FYJU 3S35L 3SE4A 3LZPA 4JZJA 4M5SA 4GXUM 3I2CH 4JFEE 3SIKA 3VQMA 1NCTA 5C3IA 2Q8BH 1EJFA 4ODTH 4Q6KA 4Y4FD 5GS1B 2WZ5A 3LNEA 4HWZB 4B7IA 1XXDC 3CDCA 1NLDL 3FQRA 4BZ2H 4ZS7H 1JUFA 2F61A 1E5AA 5A7EA 1NKGA 1MUJA 3FH8A 3ZDZB 1U8OB 3H6AA 2YOCA 1DP0A 2DQCL 3NAAL 1IC7H 1QRNB 5EH1A 4D94A 4GKSB 3CVHA 1E4WL 1BQRA 1OTUD 1VKXB 3KJ4C 3NYKA 1TZHA 2ZONA 4G1EB 1OB1B 3P9LA 4N8CL 5E8EA 1W8OA 1NGWB 1T3FA 2PTVA 3G9AB 1DFXA 4CSPA 4CVUA 3MHZA 4OD2A 2EYTA 3VXSE 4F7PB 3ULUD 4J6IA 1Z6JT 3TBVA 4HG4J 1IBZA 1RZIA 2ZWSA 5A2FA 1BXVA 3NSFA 1TCMA 5H4YA 5E8OB 1CC3A 5D2NB 2OZ4A 1MAMH 3AB0B 4PJ7F 3RVXC 1PQZA 1AO7E 4K7PL 1WAAF 2JQZA 2I9TB 2ZG2A 4JHVA 4XP5H 5J89A 1QTSA 3SE9L 5JLZB 5IVXF 2IDQA 4MHHI 2HT3D 3MV7E 1IM9D 1R47A 4UTBL 4KKPA 4WW2C 1CN4A 3ZVVA 3AS2A 3MV01 4B95C 1QRKA 2FIKA 4Y9GA 5D9SB 5JORB 3AS1A 2I60L 4LFHG 4JPQA 2WXMA 3PGCB 4UILH 4AE0A 2Y24A 5JA8B 4D7BA 1UG9A 3ARED 2IG2L 3QNYA 4HBCL 4ZYKB 5BS0D 5BZDA 1E42A 4Q52A 1SHXA 3UERA 1IAIH 1KTRL 2FX7H 4RMTA 1Q0XL 3TVMD 4XNYH 2K70A 1ZLEA 3CLEH 2WQSA 2A6JA 3ASWA 1RAMA 4Q2ZA 4JN1L 1H8OA 1CFVL 5T3XE 4KBPA 43C9B 4Y4KD 2H0FA 5DDHA 5KVMC 4L2YA 1JRHL 2V0AA 3ZY7A 2AJXH 5HGAB 4MMXB 4EUPG 3WN5C 3TO2B 3M07A 3QI9C 4R2GB 1BVLA 2GY7B 1E30A 4Z7IA 5CD5C 3G5YB 3GRWL 3TNMA 3MLUL 2HLFC 4P2OB 3UBFA 4OGAC 2XA3A 3T4YB 4BHUI 3QYCA 1C8PA 1CCZA 3QDJA 1QFWI 5I1GH 1YC7A 2Z3FA 4PMEA 4YHKH 5DD1L 3SDDA 4IBWA 4HOWA 4ICWA 5E2UL 4QRUA 3U2SB 1AS6A 3ESPA 1XHHA 4LFHD 3PREA 5ICUA 3AGVA 4BFFA 1KC5L 3BUYA 4WUUE 3BT0A 3FTXA 3J07A 4K5PA 2DB8A 4MDJB 4WF7A 2EXWC 5EORH 3VDBA 2KPWA 3UX9B 2DLEA 1RKRA 1ZMYA 3GSWA 5DJ8A 43CAA 4IGBA 4X8CA 5IB4A 3BKCL 4HX1B 3HFMH 3OKDB 1D9KB 1WA2X 4YDLB 2H0JA 3EYUL 2EP6A 2PCXA 3OR7A 3BKJL 2GSIB 2OM5A 1UM6H 3IU3B 1KXVA 2NY0C 2AQNA 5CJOL 4M8QA 4HQQL 1X5LA 5BZZA 2YD9A 3QPKA 3T04D 5ISZE 1HNFA 5EV7A 3QXAB 3HC2A 5J8OA 3WEOA 4HUUA 3TO4C 3WIIL 3TBTB 4U3CA 1NMCC 1RUPL 4YHLH 4KY2A 4XI5C 3RIKA 3J7HA 4DQOL 4P2QD 1NCAH 3LRSB 4QYAA 2LTQB 3GSNB 2CA4A 3AITA 1SJEB 3K4DA 2Z7WA 1T5KA 1S9XA 3DARA 4YJZL 5C0DA 2J56A 4KK5D 2XWXA 4KDVA 2VDKB 5KTEH 3AM8A 4HJ0C 2MCG1 1RJZA 4A6YB 5DJ2A 2BSRB 2EE0A 2IPTH 2ITCA 1KIRA 2NX5B 1E28B 4YIQB 4BEIA 3ULVD 4OLVH 4OCWH 2OLDA 3IS1X 4F15B 3PV6A 1A6ZB 4PRIB 3QQNA 1HL5A 5LNDA 1FWXA 1KJMA 3OXSA 1JGUL 1QLRA 1YRKA 4AJVA 4PD4J 4WI8A 4CL7A 3RWEB 5ABDE 2O5XH 3P3YA 4NO0B 2NY5C 2Y5EA 4NAMA 5AOLA 1J0ZA 2YPVA 2X4PB 1D7CA 2R2EA 3VGGA 3H9YA 1ILSA 3RX9A 2P8MA 1DVSA 2AABL 5CP7A 2OV0A 1YYLH 2CH8A 3STBA 2FR4B 4PRHE 4Z7QF 2VYRE 5FFOA 1N8ZA 4I48A 1NDMA 1MHCB 2NY6B 4MAYB 4GW4A 5TK4A 4IQHA 3HBQA 3L1EA 4U1NB 4Y4HB 3G6JB 5KW9H 1S9KC 3SGKA 4G8FA 1FAIL 1OWRM 1Z9LA 1R4XA 4QXUL 3V5HA 3ZPDA 2MKWA 3L1OL 4KHTL 1A6AB 1V3KA 1DBMH 4AGOA 4D0DA 3FS9A 4FP8L 4FLRA 4LARH 3SOBL 5D72L 1ZSDB 1NDTA 4JDEB 1J1PL 4JM2C 1IARB 2GBUA 5BUAA 3H0TA 1QKZL 4M93C 1MWAH 2R4RL 3IS0X 1TU2A 3IGUA 4LSTH 3ZYZA 4Z7WA 5DLML 1MFEL 2ZOOA 4QRSB 4AX3A 2C9XA 2JIXD 3CFNA 5EOQL 3PWJA 2TSAA 3OKOA 4UZSA 5EU4B 4OZIB 4X5WA 1N10A 2JFCA 3IKCB 3UZQB 2ZUYA 4GQZA 4G1MA 1SYVB 2QZQA 2Y9RT 1FORH 1V55B 1G7HB 5F7UA 3EH2A 4Z7VE 5I16A 4Y2NA 2IAMB 3V4PA 1KTKE 2D9CA 4P06A 5F9DC 3KNBA 1ETJA 5B39A 2DM2A 2L7JA 2WQWA 4R7DA 3SN6N 3DECA 5IHLB 1A9VA 4G11A 3FPXA 2P5WE 4DP4X 4YZFF 3ARDA 4MXVF 1ZTXH 3SQBB 2ZOKA 3UZEC 3QDMB 1MFDL 4U6XA 1JYXA 1I1FA 2WTRB 3INOA 3U7WH 3WGVB 4FRWA 3ZGIA 4HHWA 5E1AB 5GZOC 1G7IA 3K1KC 3ILEA 1FL5B 4I0PA 4POUB 1BGXH 1TJIH 4L5FL 1I1YB 4M1DH 2FCBA 4TNWF 1IT9H 3GD1C 4TQEH 4K5LA 4P46A 2BC4A 3ELAT 5KYNA 1BIIA 1OANA 1IC5H 3LRGA 4WV1B 3HG4A 3T0XA 1VIWA 3QFJB 3AMLA 3L45A 4H8UA 3T3MB 4ALAC 4BKTC 5DO8A 1GAFL 2WBJD 3CZJA 1ASQA 1G4RA 1WZKA 3KLAA 4GSDH 3C5ZC 1KB5H 2FLBT 3A4EA 4ZI8A 3JVFC 3WTSA 5TQ2H 1OAQH 3CFBA 3NTCH 1TETL 1XGZA 4ZJ9A 4CMHB 1I85A 4Z7UA 4I5BA 3BSZH 3L6FB 4JAMA 4NWUL 4ZPVA 4TKWA 2WVTA 3K6IA 1BVKB 1GYUA 1JXKA 4JHUA 3V0FA 2YD1A 4X83A 3QC5X 2F54A 2BINA 3HC4H 1YN6B 4JQIH 4TMPA 4RMUA 3MBXL 3V0DA 4ZUVA 1CBJA 4HK3N 2Y3NA 4ZSOB 3EDEA 1CURA 2F1AA 3D8MA 4NOBA 1MFAH 1DSFL 1FAKT 5C08A 1JVLA 4FFZL 2N0MA 5DGQA 2FL5B 1S7QB 2G60H 2HUHA 4RMVA 3ZTEA 2GYSA 1OEZW 4WGWB 4KTEH 5TE6H 3KL5A 3UJJL 3DWTA 4MNQE 2ORBH 2WXRA 3RDTD 5C3LD 3DX3A 2DM7A 4NNXA 3GMNB 4HJJL 3DPBB 1UFGA 1RL1A 2EXYD 4QHLB 3VXMB 2WXGA 3NABL 1KJ2L 1KIPB 4PJEA 4BE6A 4YSAA 1NEZG 4M5ZH 2CUAA 1IBDA 1J1XH 1T0NB 1MH5B 4PLOB 3I02B 4OCLC 2AXGA 4AH2B 4BUHA 4AEFA 3DUSB 4NC0B 4WO4A 3KD4A 5AVVB 4LL1A 2AANA 1YA5A 2YUVA 3VNYA 4LAJH 4MTMA 5E2WL 2EYSB 3ZQ9A 2B1OA 3CIQA 1U8HB 3QR0A 1JFQH 2HFEB 3LD8B 4Y5YB 4MDIB 4YFLI 4G7VH 2VQ4A 4J2XA 1AHMA 1JBJA 4R97B 3BQUD 3QUZB 2IQ9L 3T0WA 2DQDH 2R27A 3V79C 1MREH 3EYOA 3ZGHA 3N42B 1GZHC 1LWJA 3DVGA 1JZ8A 3WAKA 1UB5A 4XBEH 2OQJA 3SYOA 3VD5A 5ICZA 3OMIB 1NGZB 1NJ9A 3SQOH 4GXFA 1UOLA 4R8WH 1A9BB 3P73B 1ZGLB 5IFJA 3C5SB 3NT0A 4ZMZA 5MEQB 1GGIL 1NFDB 1RZKC 2QBWA 1J5DA 3QCVL 3GUFA 3QIBB 4TTDC 4GKZB 5K9OA 4M6AA 4QO1B 3RTQA 4WJ5B 1FA4A 4XO9A 1XAKA 3OVUB 2PN5A 1ZHLB 4MAUL 3QHTC 1JNNH 1JGVH 1NBQA 2AEQL 2CXGA 4XWOC 1EHLL 3IMRA 5FYKL 2OL3L 4Y2OB 3Q3GA 1Z1WA 4Y16C 3HE6C 4HLJA 5I74C 3LN4A 4MBRA 3RPBA 5E9DD 4HJGB 1IBHA 3RKPA 1WLHA 2OK0L 1S8DB 2IO5A 4Y7OC 4U6TA 5DK0B 3MV9A 2OTPA 3Q6GH 2FO4A 2VDNB 1HKFA 1S9YB 1PLAA 3B6SA 4MJIB 2J8UB 3B1TA 5CLTA 5I24A 3TN0C 5LBVA 3RGVC 2WQRA 1SBSH 4AUYA 1AKJA 2IGFH 3WSQL 4FF9A 4AUJA 4LIQE 1RIUH 1MCQA 3P4OB 1MCDA 2R0WH 5MEPA 1A65A 2AJVH 1ZHNA 5BUGA 5AYTA 3LQAC 1U8CB 2CGRL 3GMMB 5BXFA 3VX0A 4XOAA 5HI5D 4WHYH 4L3ED 1CTMA 1PL3A 4KRPC 4YSQA 4NZUH 3VD3A 2H32B 4LPVA 3IDYC 5IT2L 3WXVL 4K3DH 4WW2F 1JDAA 3WO3B 1MHEA 1BD2E 1I1AB 1IGIL 3VCLB 3MJ8B 4KQ3L 1ZVYA 4LRNL 3DDFA 1JCVA 2F8VA 3T65A 4GBXC 3P1VA 1JZ6A 5F6IC 3ML8A 2EVFA 1S7SB 3QXDA 3QRFM 1MI5B 2AITA 1KULA 2YD4A 1OHZA 1C5DA 1WUZA 2FATH 2NDFA 5EZIL 2CHXA 1YEEL 3BDBA 5E0QA 3DTXB 3NK3A 5DD0L 5I5MA 4HAFA 4ZMWA 4FG2A 4P2RD 3U83A 2H0PA 4H8HA 4BFNA 4XP9H 2XG5B 4JRYA 2J1ZA 2HVKB 4KKLD 5IHHA 5A16A 1TSHA 1TT6A 3MLWL 1MCPH 2NTFB 4PQXA 2VDOH 5AVXB 4S1SL 1JK9B 1G7QB 5KANG 3S37H 2IVFC 2JELH 3OKNA 4URKA 1L0XA 4X4XA 3VYNA 3US0A 3HR5B 1Z0MA 4W9DC 3L4VA 1JMXA 3LXAA 3TT1L 1ADQA 2CAKA 2P52A 1EMTL 1FH5H 1Q72H 2QQQA 1GPOH 1OAKH 3NA9L 4Y9CA 4OD1L 1D5RA 5JNYB 2PF6A 4L1SA 1KB9J 4L4TB 4UINL 4QYOB 1C16A 4LNRB 5ENWB 3LKSB 5KAQG 1MOEA 1JTOA 2DY2A 1GMEA 3O6MH 3FUJA 1N4XL 1M05B 3DJZA 5F7LB 4A7QA 3SKMA 5CZVL 4QRPE 3PHAA 4UNTA 4OLYL 4DTGH 5AYUH 3FOMB 5JHLA 3PWUA 3ZKXB 4G8GD 1XH1A 1GHFH 2V17H 4CSSA 2DQUH 3CZUB 5T3ZE 1F3JA 2E7MA 2VLKD 4IOFC 1QASA 2RIKA 2ZYIA 3E9TA 3F7VA 4XPGL 4EI6A 4PSRA 4BZYA 1TYEB 5E8NA 3FYEB 4CRPA 3D12B 4YO0A 1CICB 1DEEA 1ZKAA 4HGMA