2H1LM

The structure of the oncoprotein sv40 large t antigen and p53 tumor suppressor complex
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
199
structure length
199
Chain Sequence
b'SPLSSSVPSQKTYQGSYGFRLGFLHSGTAKSVTCTYSPALNKMFCQLAKTCPVQLWVDSTPPPGTRVRAMAIYKQSQHMTEVVRRCPHHERCSDSDGLAPPQHLIRVEGNLRVEYLDDRNTFRHSVVVPYEPPEVGSDCTTIHYNYMCNSSCMGGMNRRPILTIITLEDSSGNLLGRNSFEVRVCACPGRDRRTEEENL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Large T antigen
molecule tags Viral protein
source organism Simian virus 40
publication title Crystal structure of SV40 large T-antigen bound to p53: interplay between a viral oncoprotein and a cellular tumor suppressor.
pubmed doi rcsb
total genus 38
structure length 199
sequence length 199
chains with identical sequence N, O, P, Q, R, S, T, U, V, W, X
ec nomenclature
pdb deposition date 2006-05-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
M PF00870 P53 P53 DNA-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.720 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 2h1lM00
2H1LM 4MZIA 3WTWA 3US1A 1TUPA 4AGLA 2J1YA 1EANA 4GUQA 2MEJB 4XR8C 4IBSA 4A63A 1EAOA 2XWCA 4IBQA 5LGYA 1LJMA 1T4WA 5G4MA 2AC0A 2J1ZA 5A7BA 3WTUA 3D09A 4LOFA 5BUAA 3QYMA 4IBTA 4AGQA 3QYNA 1H9DA 2ADYA 5LAPA 1KZYA 5ECGA 3TS8A 4L0YA 1HJCA 5AOLA 3WTVA 4G83A 4LOEA 3EXJA 2X0VA 3KZ8A 1EAQA 2YBGA 4IBYA 3US0A 2J6WA 4L0ZA 3D0AA 2BIPA 2IOMA 5ABAA 3WTSA 2J1XA 5AOJA 1E50A 5AB9A 4IJTA 2J21A 2J20A 3Q05A 3ZMEA 3WTTA 3WTYA 1GZHA 5G4OA 4QO1B 2PCXA 3D07A 4GUOA 3D08A 4IBZA 3KMDA 4IBWA 2WGXA 3VD0A 1UOLA 1TSRA 2BIMA 3VD2A 2X0UA 1GZHC 1IO4C 3D06A 5G4NA 3D05A 4KVPA 4AGPA 2BINA 2J1WA 4AGMA 1CO1A 1HJBC 5AOKA 3Q06A 3WU1A 2XWRA 4G82A 4LO9A 3EXLA 2BIQA 5AOMA 2BIOA 2GEQA 3Q01A 3WTXA 1HU8A 2IOIA 1YCSA 2RMNA 2X0WA 4IBVA 3IGLA 2AHIA 4AGNA 4MZRA 5KBDA 2P52A 2FEJA 1CMOA 3IGKA 4L18A 2ATAA 4HJEA 4IBUA 2OCJA 2IOOA 5AOIA 3VD1A 2VUKA 4AGOA
chains in the Genus database with same CATH superfamily
1IM3B 4IHOB 2G5BB 4HWZA 2XKUA 3UABA 1YEGL 3PQYB 2MCPH 1RIVH 1YYLL 2C9SA 1OGAD 1CE6B 3B5HA 3CFNA 5IESH 2RCSL 1SOQA 4WFHD 3QUMB 3CVBA 4TYUA 1A6AA 1K4DB 4EIGB 3RNKA 3FONB 4AVKA 2E7BA 4JM0A 1NH6A 3I9IA 3AQYA 3DETD 4TF4A 4P57B 1SN0A 1TQVA 4Q9BA 4WI6A 5D4HA 1EFQA 1WGOA 1NFIA 3W11C 3OXSB 4IM8A 4YGVB 1E27A 4DN4L 4BH8A 4NHCH 4XX1E 1JHLH 4HWZB 2WINA 2W88A 1FNFA 3QAZB 3ML9A 4XBGA 5F7NC 3FQXB 2BVOA 4CADB 1VFAA 3IGUA 4AC2A 2WLIA 4BFIA 1N6QL 2R27A 1EFXB 4XMXA 1T1ZB 2GQHA 2LV4A 4NOFA 5AB9A 1MRFL 1S7RB 1YYML 1G7HB 1RJZA 4PGCB 4OAWB 5DS8B 4A6YL 4MD5A 1BVLB 3GZOA 4RDBA 4UM9A 3FT0A 3ZVVA 3G7TA 3VD0A 5C3LD 1AD9B 2DI8A 3LIZH 4L5FH 5DR5H 3B3BA 5CIPH 2ZUQC 3PFQA 1YYMH 1XXFC 4EZLA 1C5DB 3LPWA 3SPVA 5B8CB 1IAIH 3FTSA 3WKMH 1FF5A 2RQ8A 5L0QB 3VXUE 4DNLA 5E8EB 3L6FB 1KBVA 1QYGH 4QEGA 1G7HA 2E9IA 5K9KA 4PN6A 1LE9B 4Y1AE 2BY0A 3QEUA 1PFCA 4WSGA 5IIEB 1JGVL 4PS4L 2XWXA 5C07D 3WIIH 2JCCA 3E1F1 3UTSE 1U93A 4L3ED 3PDGA 1UWEL 3LHAA 3QUYA 4BHUI 4MA8H 5D7LD 1BXXA 1MHEB 3PWPD 4QXWA 5DRNB 1FL5B 4OIIH 2N0KA 1OV8A 2D03L 2J6EA 5GRZA 1UXSA 5EIVA 1MCPH 2CPUA 4GBXC 4NO5B 1RVFH 2NSQA 4OM1L 1IBHA 1ADQL 3IFOA 5HHPA 1T1XB 2GAZB 3IRPX 4NQDD 3VI4F 2QQQA 3QORA 4O5LH 5KOMC 5EWIH 5FKAA 4BH7A 3SYAA 2Y0SA 3QFDB 3SPIA 2GITB 2ZUVA 3KPMA 4NFDA 1X5IA 2YZ1A 3AG3B 4J3OG 4N1EA 4F7MA 3D48R 1BOGA 2P9RA 3ULUE 1O7VA 4NM8H 1MCSA 4HV8A 3EYOA 3EYUH 4LP8A 4JMXA 2LTQB 2BSCA 2BFVH 4HCRA 2VABA 2OTUA 4K23H 3RG1C 3ENEA 1UXSB 2Y23A 4KH9A 3IDGB 1NDMB 1XR9B 4YSEA 3TEZA 4YHPB 1RK1A 4QCIA 1F2QA 4GW1B 1CXLA 3LKRB 4GW5B 2XTLA 5E56A 1HCFX 1G6RA 1Q38A 3ILQD 5JHDD 2MJWA 5D4IA 4PJEF 2D7PA 4FXGA 1QZNA 1V3MA 2DLFL 2L3BA 4MDIA 1NMAL 5BUGA 4HCRH 4PCSA 4HKJB 3VAEA 4M5TA 4UV4L 3EH4B 1UCBL 4ZTPL 1J8RA 3U4AA 4WWOA 5DHVH 3VFSA 1N7ML 4MXQD 1UURA 3QO1A 3O6ML 1WSST 4NC2B 4UIKL 3VB9A 3BUYA 3CXHJ 5GS1B 2MOVA 5DJ6B 1H6TA 4YC2C 3H42L 4LKXA 3RTQA 4AOFA 3AU1B 3O6KL 1DQJB 5SWZB 1QBAA 4KUCD 1DQKA 3HRZB 1AGDB 3KPSB 1AI1H 4JGJA 5HHMB 3IKCB 5JW4M 5KW9H 3BLPX 4R7LA 3BJLA 3V9CA 4AX3A 3VD2A 1F3DH 1ZGLB 2Y9RT 4QXTA 2CBPA 3TA3D 2AJYL 1MLBA 4OUUB 1NLDL 3VFSB 1F4HA 2GTZB 3DHJA 3X1NA 2EJ1A 3WN5C 4J27A 3R19A 1W2KT 2IJ0C 5E99H 4K5NA 4JQVC 1KWGA 2IXQB 2ZCKL 4ZFGL 1SF3A 2HG5A 2WTRB 3QB7C 1NCJA 1HH6B 1UWFA 4BKSC 4K8RD 1RIHH 2HVJA 4LIQE 5HTSA 2UUDH 2L0DA 5IB5A 4LIQL 1NKOA 2V4LA 1KTJA 1A6TA 1QA9A 1XFPA 2ZSWB 4NZRL 3HKFA 2X3BA 4JY6B 1XEUA 3D30A 4IOSA 4PRHB 1JFHA 2ZOKA 1YY9C 4HPOL 1NAKL 2OL3A 2CRYA 1O7DC 2E4FA 2VDOL 1FCCA 1NCWL 2Z31D 4KK5D 4X6CB 4I18A 1CPUA 1YRKA 5C0GA 1FGVH 3NCMA 5I16B 3QHFL 1WAAE 2VDQB 3ABGA 4O2CB 1HH6A 1Z9MA 2Y06H 4XOCA 4ISVA 5BZXA 5IB5B 5FHAL 5L7XH 4ELMF 3S4SA 1CF8L 4PG2A 3K6NA 1AXIB 4Y9CA 3P9MB 3SQBA 1HILB 3LS4L 4LGPB 4ZW8A 2KDYA 2MMXA 1SBSH 4F37K 1H6EA 1X9UA 1JPGB 1JRHH 4JFHD 1J9SA 4Z7WB 1AC0A 2LFGA 3L1OL 4KOCA 5H8DA 3MGOA 4ABWA 3S3PA 3VFNB 4R5XA 4K3JH 2FQFA 4HF5H 3ZE0E 1RZIA 4Z7OB 2HWZL 3VXRB 1GZPA 4DP9X 5HI5D 3S5YA 4PGEA 3CXFA 4ODXA 1KMGA 1DVXA 4R2GB 2XKNB 2A0LC 2HKFH 5F9WB 5D7IA 4XE0A 1CIUA 3U25A 1S3RA 5T1JA 1SY6A 3OAYK 3VFWB 1GS7A 5CP3A 3GFUA 4D9QE 3CIAA 3W82A 2BOBB 4Z7WA 3CUPA 4R8WH 4PBDA 2E7CA 4BHUA 4GMSH 3MGOB 3C5ZA 3EO9L 4PLOB 2LOEA 2ADIA 5JW5B 4ES9A 4LSRH 1JWSA 4PGBA 4P9HL 2BHZA 3BD3A 2DQJL 3IJSA 3PGCA 3HMXL 1J8KA 4G6JH 1GZPB 5E6ZA 3AAZB 1MVUB 1F8TH 5T1LD 1BFTA 5E8NB 2WQXA 4PVNA 1EEYB 2XV3A 3D25A 3SDDB 3CHSA 2OI9B 3H2QA 5D7LE 2WSDA 3GSVA 2DJSA 2GUYA 4GW4A 2VITA 4MSWB 3UZEC 3X13A 3ZR5A 2OI9C 1A6UH 4PRAA 2KT6A 1RZKL 4G7YH 3GMMA 2F74B 4GSRA 4O51A 2QVIA 3QUMH 1UQSA 1ZCRA 3QI9C 2I07A 4DGUA 1DFBL 2KI6A 2X1QA 4MBOA 4OFVA 5HHVL 1JCVA 4KX9A 1WFNA 4JGUA 1SXCA 3IU4L 1Y07A 3TBVB 2YSSA 4U2YA 3U9PH 5GGUB 1IGFH 1KLFB 2R0WH 4KMTL 3KXFA 1QHOA 1SY6L 4HPYL 1YCSA 2I7SA 5B3NA 2WQ8A 4UNUA 4JN1H 4L8BB 5IMMA 3GSVB 3BGFC 3BHBB 3X13B 2HX9A 3OSKA 3NJLA 1PCSA 2F8VA 4XO8A 3SKOA 4AY0A 1A6AB 4AIOA 1IGJA 3UC0H 4AUYA 2DWDA 5MEPA 1LO2L 3EYFB 5IT2L 4N0YH 2XXGA 5AD0B 4IBUA 4UV7H 1E7VA 3S3DB 3FTUA 2I07B 5IM7B 2FE0A 1TVHB 3KE0A 3OXSA 5JHDE 3AQZA 2G75B 3AY4A 1OT4A 3S8WA 3PJLA 5F2FA 1T6BX 3IS0X 4APXB 2WHVA 1CBJA 4L9LA 5IBTL 3BSZA 4LCYB 4WO4B 3KH3A 2X87A 4FNSA 3V7MA 2VQUA 4ZFFA 2A1WH 1U8JA 3A67H 3ULVL 1NCNA 5TDNB 5DRZB 3T04D 4XPGH 5GSVB 3VDAA 3QHZH 5MEPB 2A9MH 1FO0H 1QMUA 3IDMB 3OXRB 5AD0A 1M1SA 3KYMA 1KF9B 4GSDH 5A2LH 1X7TA 4PJ9A 4KJQD 4N8UA 1NAKH 1N12A 1WA0X 2R0ZL 4B9IA 5IHBA 4RFNB 3MRQA 1YEEH 1OM3L 2X53A 3VXMD 1M71B 3OLEA 2DICA 4LCYA 4WI2A 1ZKAA 1R3LA 1ROWA 4IRJC 3QJHA 2ZE0A 1YEDB 5HYQA 1K2DA 1RSYA 1U3YA 4WTQA 5E2WH 3WEMA 1EX0A 2V3FA 2X70B 5FYJD 1DL7L 4ZFGH 4DVRL 2JH2A 5DR5L 1XIWA 2B1AL 3ZDZB 3SN6N 3WFDL 2ZOTA 1OF2B 1F58L 2IPTH 2J21A 1P1ZA 1QRNA 3W0WA 4KKQA 5T1MA 1LE9A 4NO3A 1JIBA 4NWTL 4AZ8A 3F8UB 3AY2A 5GRJH 4MMZB 1OK8A 1FRGH 5KWYC 3PAVA 4BK5A 2Y3AA 1MLCA 2ROYA 3GMQB 4HWNA 3LY6A 4MXWL 3RFZA 1LD9A 4RVBA 1Q0XL 2C3GA 2WXHA 3UG4A 5B4MC 3NFSL 1YMHB 5A6IA 2JKRM 1H3PH 2W92A 2K4AA 5FLVA 3GXNA 2VDLB 4X7SH 2APVA 1LMIA 3FO1B 4WFEE 1RHHA 3MUY1 4FKKA 3ZKMC 3E8UL 3GINA 4NAMA 4S1RL 3VXOA 2CBQA 2ZP0T 3VI3A 2VLRD 1HFUA 3ARZA 5AOKA 2NQCA 2CHXA 2N0MA 1H5BC 3ZE2B 5DZJA 3MXVH 3CIQA 4H7VA 3S4SG 2KBGA 2PTUA 3Q9PA 4G70B 1C7SA 3NBNA 3QWQB 3D9AL 2D7NA 5CIPA 2DQCL 3FQNB 1AQDA 1JRHI 4TOYH 2FB4L 2HWZH 2VC2B 3VYPA 1ZS8A 3O8XC 4B97A 1DQVA 1WC7A 3CHXA 3CFCH 2Y25A 4B27A 2DI9A 2Q76A 4NAJA 4PJ5A 3EO1A 3LKRA 4GW5A 5ALCL 3VI3B 1F1AA 3NK4A 5FYKU 1A4KB 3EAKA 1G6RB 4Y4FC 1U8MA 3M6DA 2R7EA 4K94H 5IOKA 1HQRA 3BI9X 4J4PA 2HT4D 4UTBH 5EZOL 4AGLA 2R39A 4JO2H 3H6JA 1EUUA 4S11A 1JHTA 2E5EA 3BZDA 3RI5F 5JPMC 4HKJA 1ES0B 4K9EC 4ZS6C 5LWYH 3DMMB 3SY0B 1BLNB 1F86A 1HKLH 4EEEA 3A21A 3KPQB 4MCNA 1OLLA 4GQPH 4QRSA 1DJYA 5DJ6A 4N0CD 4BXSV 4K3DH 4FHBD 1PG7X 2CDFB 1CDCA 3RU8L 1REIA 2IGFH 5F7BA 3LS4H 4HIJA 5IJVB 3DTXB 1DQJA 1UT9A 1VFBB 3WFBH 5DHVB 3UH8A 1KPRB 3BEVB 2R7EB 3UGUA 2SODB 3HG3A 4AL8L 4NNYB 2BSED 1IKNC 4DKEH 12E8H 4Y2DD 5E7FA 2V0AA 3DARA 1IEBA 3K74B 3DVIA 2FGWL 4XMUA 5GSRA 2XIIA 3LYRA 1QWUA 3D3VA 3MJ9H 3UXFA 4LRIA 2OMZB 4ZXBD 1YEKL 4PJBE 1HEJC 4LAQH 4G11A 4BINA 2Z8WC 4QRSB 1ZLVK 2V3EA 2FWLB 4AQ1A 3EIFA 4X8XA 1JZ4A 2CO7B 2N4IA 4Q74A 4ATWA 3P1VA 1T2JA 3FSWA 1T0MA 1BD2A 3IRZA 5T5NG 3N43B 3ZRSA 3LAFA 1P5UC 1VFOA 2WQRA 3F7RA 2E47A 2P8MA 2BSRA 3R06A 3E6FA 1N67A 3APMA 2AABL 4I4WA 4CA4A 5FKPB 5IK3A 1EGJA 3QVAA 2VW6A 1I8KB 2Y07L 3CFDB 1XH2A 3ZXAC 2ICEB 2YGOA 5C7XL 4FXTA 3U6XS 4DUVA 4YNYB 3FQRA 5DK2B 2BS71 2JK5B 4YE4H 3IU3A 4AGPA 4AEFA 3HUJE 1F3DJ 3P4LA 4J3VA 1YNLL 4QRBA 4E42B 2D4FA 1U3ZA 3FRPG 5AW4B 4L4VD 4I18B 1T7WA 5L88L 3GSUA 4LHUG 4L29B 1BJ8A 4NDMB 4TUOB 4KNUA 3IFLH 3NPSC 1CFMA 4WI4A 1I7TA 2XICA 3DXAB 1QSEE 3PPEA 4ZUUB 4MNQD 5IB2A 4A2LA 5GGRA 3WUWB 3F6JA 4JKLA 4MDJA 3S4SB 4HT1H 1W9XA 1SLVA 5IK3B 5KS9F 2F7OA 3DTUB 2ERJB 2ICEA 2ZUXA 1RFDL 3RWIA 3T08A 1MI5A 5D6CB 5DFTA 2MPAH 4KY1L 1TJXA 4NT6B 1NGXA 2PYFA 2UXTA 1SUJA 3FYEB 1AGBB 5AVUB 1OT2A 5DUPH 1KY7A 1YQ2A 2ENJA 4TUOA 4O02A 4X6DE 1XGYL 4PGEB 5EOQL 5BVPL 5JQ6H 1U8HB 4Y2LA 4OZGE 5LCVH 3B83A 4I0PA 5K1VA 3QUXA 3RWIB 1MI5B 5D6CA 3BAIA 3AGWA 2MQCA 1HINH 1RULL 3I9AA 2HTLC 5BVPH 2ESVE 5E8PA 4FMVA 5AVYB 2NR6A 2QSCH 5DJYA 4DPRA 5JW5A 2WVSA 4ODSH 4D9RD 2DDQL 4MQTB 5D2NB 5B4MD 3B2VH 1A25A 3QIBC 3UCRA 2G9KA 4KMQA 3G5ZB 3KLKA 5ICXA 4XVJL 2PXYC 4KGLA 4D0BB 4F93B 4O2FA 2RH0A 4PWFA 2NX5E 3CZFA 4KAQL 5AB2A 4L3AA 1DCEA 3EJYC 1PZ5A 4GG8A 3ARDC 3GDCA 3HNVL 4XXWA 3GNMH 5E6YA 3VH8A 1NC2D 1PX8A 4BBWA 4ZMAT 3TNMB 4B5ZA 4FNLH 3VFPA 2XBDA 3QC6X 1Z0MA 2F7QA 3VRLF 1RXLA 4HIIB 1W6LA 4W9GC 4M1GH 2K7PA 2Q7NA 4HU8A 1E5ZA 4MA8L 2WWKT 1ZHBB 4GRLC 2BC4B 4Z7AA 2WGXA 5LGJB 4IK6A 4TVPE 5EEVA 1UOLA 2CXGA 4GAGH 1F1DA 4G8IA 3PNWA 4HGWB 3VI4B 4JPKL 5EO0B 1NBZB 3P11L 4L8DB 2BS8A 3U30B 1W8NA 1QSZA 4MA7L 5CZXD 5B1JC 3V0FA 1J0YA 4HUVB 2OYMA 4YXHH 2NY7H 3IJEB 3NJHA 2XNAA 3O6LL 4HIIA 4DP6X 2HJFA 2OTWB 3BVUA 4BK5C 4Z77B 3QEQA 4H88L 2OMYB 3LNEA 3P11H 3IAQA 3CSBA 3T8VA 1U92B 5F9OH 1PZAA 2G75A 4YH6A 4TNWF 3DX8B 1CQYA 3E80A 3IPBA 4LU5H 2I5YH 4NBZB 3JT2A 2V8LA 3K1KC 3Q6GH 4I3RL 4FKEA 5FUZH 5AWNL 4O2EB 2Z8RA 1Q72H 2GVYA 4P2QE 4QHMA 3ZSTA 5DRZA 2V2TB 3EZ8A 5DJDA 1AO7D 1MJ7H 2HFFB 1WITA 2LABA 5C0RH 2HJFB 5AZEL 4JFDE 3MRFB 2A6JA 3UBGA 1UJ3C 3CVIL 3F7PC 5HYFA 1NINA 3VWJB 1RQ5A 3T3PB 1Z3GH 4YBQD 3EHBB 4XNAA 1G7IB 3K8MA 4M7ZC 5HHNB 4J39A 2ZAHA 3ZDYE 4RGND 1OSYA 1FC2D 5CSGA 1H3WM 3KDMB 3NSYA 1CTNA 1X5KA 5DHXB 1F56A 1KCBA 25C8L 2CRZA 2X4RB 3NABL 3D69B 4HZLA 4FJ6A 2CZNA 2M2DA 4JAMA 3LZNA 2QPSA 3KYNB 3GYRA 5J1SC 2BLFA 1YEWA 2A6KA 2LU7A 3MRFA 3QIUB 1ZT4B 2B77A 3DK0A 2Y5TB 3VU1A 3WLBA 2FJGA 4AZ8B 3VQMA 3OKDA 3OM3B 4HUUA 4POYA 1G0DA 3P30L 3S8GB 4LLMA 1AZNA 5DF0A 2OSWA 2GI0A 2DOCA 3KL0A 3QP3A 5JHMA 3RWDA 2PTTB 4DK3A 2W38A 3OVUB 4QLWA 3AFLA 1X4ZA 3EOBB 1OZUA 4R26H 5IW3A 3V0WH 4AK1A 3QJXA 4NQXA 4XP5H 1JZFA 1AGFA 5CSZA 4PLKD 5IJDC 4WHTB 1ZTXL 1ED3A 4BELD 4KKBC 1Q9WB 2ZKHH 3QQ9D 4IOFD 1JNNH 3QIUA 3PNRB 3UG3A 3N5AA 2IQAA 2MSPA 4IBZA 5DK3A 3BPNC 1Z9SA 2EDRA 3O9WA 2EVHA 1JFQH 1E3FA 1RAMA 2CO1A 1S7SB 4PJXA 4XVUD 4JFXB 3RGBA 5T1DL 3G5VB 5KSBB 1GGIH 2NLJA 3HHRB 1BZOA 1LO3H 5E6IA 2XX0A 3TCLB 4E36A 1JF5A 4KUZL 1A3RL 4XO5A 1ASOA 5LJYH 3VXQB 4JVWA 5CJQH 4CJ0A 1LEIB 4JK0D 3EO1B 2FHBA 3KBHE 1IBGL 1RIVL 1YYLH 1UOKA 3TX4A 2ZZUT 3SHSA 2MKLC 4XTRC 4LGRB 2VLLA 3ZDWA 5BW7A 1INDH 4PTUA 1ITCA 1NCAL 5BJTB 5FCSH 2H2PC 4OLXL 4PJXB 4F7PB 4JRWA 4A6YH 4UU9B 2ZG1A 1BLNA 3QRGH 1NOFA 3TFKC 5E24E 2VLRE 1VZIA 1HXMA 1JZ8A 1XB8A 3GLEA 2OMVB 1BZ9A 2WBWB 4LB8A 4BRVA 5MHSD 2EKSA 1C08A 1LEIA 4JPKH 4OZGB 2X4UB 3BXNB 4NN5C 2NQ3A 5JOFB 3HFFA 3F5WA 1KBKA 1U95A 3T65B 4WUUA 3FHAA 2A4CA 5F1SA 5CKAA 1N8ZB 5D7KD 2CNZA 3IDYC 1UB6A 3BWUF 1ZT7A 3NZ8B 1BP3B 1ZA3B 1FVCA 3ATBA 4M48H 4OSUL 3H2PA 5DD5H 2XSKA 4I5BA 2BY2A 2DLGA 4XODA 5JUEH 3U7YL 3I6KA 4AM0B 1W8OA 1I3GH 1VESA 5F9WC 4OI9A 1D7DA 3IDUA 2ODIA 4NQTA 1T0MB 3X1EA 1U2YA 5IF0B 5C6TH 1EBPA 3S98A 1U95B 2G3NA 3LNGA 1DQLL 1HWWA 4OZFH 3MO1A 1OK0A 3NZ8A 2R4SH 3BYTA 2IMMA 5TD4A 3TLRA 4FQCL 2DMKA 3BSZH 5C0AB 4ODSL 1ITBB 2CLRA 2GJZA 5F7WC 2WMPA 4DP8X 4E42A 4FXGC 1JXGA 2CDEA 3CH8A 1BWMA 2FBRA 2LE9A 1N19A 2FX7L 5F44A 5I1KH 3RGVC 3EGDB 1XH0A 2NSMA 3GSUB 4HK3J 3RWGA 3WHE0 1H3VA 4KJWC 1HXYB 3QARA 5F9JA 4PREB 1AXSB 3MI6A 3RTQD 3MRNA 4ZUUA 2WVVA 4JVPA 3VJ6A 3BISA 1HYRC 2GY5A 3OAYH 4WK0B 3SKNB 4F27A 2G0LA 1D5MB 2NY0D 3C60A 3EFFB 1NEPA 3MLUL 1JV5A 1BQHB 4PJ8A 3FB8B 3GRBA 4RMSA 5CO1A 4PS3A 3AJ7A 4K9JA 3TA3A 2DI7A 3WCYA 4Z7UF 3MRLB 5BCAA 1F8TL 2J1WA 1K8DA 1CFVL 3ASOB 2PO6A 4RH4A 2AK4E 3FAXA 4PW4A 3P3SA 2QLYA 5FA4A 4PLJC 3CQQA 1NICA 2NY6D 3B3IA 1FZKA 2ZXAA 3D52A 4JFDD 3QZMA 5FO9B 3Q8FA 5DJXA 4YX2L 3JTTA 2BSTB 3O6MH 1AQMA 2FWUA 1J8HB 1Z9NA 4JHWH 4KK6D 4FTVA 4NKOB 2R2EA 1IV8A 4L4VE 4HX1B 1X6LA 4DFHA 3ZPDA 2ZCHH 3NH7H 2XFXA 4AIZA 3MBEB 4U7MA 3MLWH 2GHWB 4KO7A 3SDYH 3MV9A 1KIPA 5DEFB 4K73A 5EUKA 1BW8A 2Y07H 3BN9D 5HHQA 3AT9A 3V4VB 5B7MA 5J4MA 3SJVA 1Z2KA 5DUBA 1SM3H 1UG9A 2ZP9A 3CSYB 5D2NE 2CGRH 1KV7A 3S36L 1LO0H 4ZQKB 4J7RA 3RGVB 2EVFA 5T1KB 5C0NC 4BWWA 4NKOA 1EV2E 4GAFB 4ODBD 5F89A 3VMNA 5A2FA 3QWOA 3ULAB 1G7PA 4AJWA 4M8RA 3BP4B 4B9JA 2R69A 4FJYA 2Y6SD 3GXUB 5DI8B 3QCVH 4EIBA 4F7EA 1LJMA 5I82A 3WD5H 3QQDB 4YDLC 1A4JB 1AI1L 1YN7A 4ENED 1DN2A 5F7UA 3QJTB 3IMRA 4P5MB 4UZUA 4ZX5A 4PWKA 3SDAD 5EB9A 1JPFA 3HR6A 3QORD 1NEZA 5I18H 1J87A 1E5BA 2YARA 5HI3D 3ETBJ 1MAJA 3L2MA 3TN0D 3VACA 6FABL 2O5ZH 3AQXA 3C9NB 2YPVH 3DSNA 2C3VA 1A3LH 1F6FB 4K5PA 4N5EC 4JM2A 5HI5C 4M1GL 4MHHI 4QRTB 3FUNA 2A0LD 5CFAA 1RUPH 4MD4B 2B39A 1L9RA 5DI8A 4F7EB 1BF8A 3WAKA 1GYCA 3UIYA 4Z0BH 3M88A 4ALAC 1QNZL 3K0YA 1LK3H 3FZUC 5E5MB 4Z5RB 1HSBB 1HN1A 1NEZB 3FSOA 4EUPG 2A5UA 5DMJB 1CICA 2YSTA 3DSFH 3R8BB 5C07E 4Y4KA 3EUDA 4IKNA 3TL5A 4XP5L 2F08A 1NIFA 1IVLA 2D2OA 1THAA 3ORJA 4HKXB 4BSWA 4QHLB 3U6RB 5G4NA 1JK8A 4JEGB 4O2EA 1QR1A 1O9VA 1JVLA 2CJTA 5HHOB 4N9GB 1E2VA 5EBLA 4ZAKA 1XZ0A 1A5FH 2DRUA 4X9FA 4B96A 1RJLA 4KMTH 2YRPA 2IPKB 2VYRE 2A6JB 5K59F 4P04A 3H3BC 1OVZA 1UB5A 3WIAA 5CEYA 2ZX9A 5F7KC 3EF4A 2FR4A 3PWNA 2Q10A 1UOVA 4MLIA 2KQMA 5KSAD 1KFAH 4DAGH 7CGTA 1OWWA 2B4CL 4PJ8C 4L05A 4HWBL 1UADC 5JHLH 1WBYB 1G6RL 1QHQA 3WHXA 4FG4A 3P0VH 1QLRB 3KYNA 4AEIH 5I6LA 1F4XL 2GJ6E 3G08A 4QGTA 4RMRA 5JOPD 3VD1A 1WF5A 2FSEA 4GKLA 1IAKA 3DGDA 3PV6A 5INDA 2JB5L 2ZXCA 2XG5B 1AIZA 2YJLA 3KCPB 3KLDA 1IC7L 3L4VA 4HW6A 5CN2A 4BRJA 1AO7E 4TVPL 5DTFA 4RDQF 3I3BA 3AXIA 3MXWL 3SDCD 4NQSA 3TBSA 4QWWD 2FO1A 1QLEH 4QRPE 1RU9L 5I74B 2LT9A 2X1WL 3EOBA 3RGVD 2QSQA 3I2CH 4LCCC 3SDCB 4LOUD 1G7LA 4HEMA 2AC0A 3VWKD 1QW9A 2QPUA 3UO1H 2HJKB 3BKJH 4M5SA 3H0TB 3MRDB 3DV4B 4FNPA 3OJMB 2FSEB 4GI6A 4UWQB 5CD3B 2IQAB 1IAKB 4NN6B 3VG9B 3WFEL 5JIMA 5I9QB 3VGBA 2NDGA 3DNKA 4AW7A 1Z9LA 1AIFA 3MV9D 4K8RC 4J3XA 4BZ2A 4FQIL 4H0HB 3VXMA 5KANI 2ZPKH 4JFYA 3G5VA 4HH9A 2HFGH 3BP7A 4LSUL 3BRDA 5EIIA 2NY6C 3S48A 4F58L 4OF7A 3BAJA 4G3YL 4KROB 3MPCA 4LLDA 2CBOA 2JCWA 4UOJA 1XSKA 4DK5A 4FQPA 1X7QB 3MUZ1 4Z7VE 1NBQA 3UTQB 1IM9B 3DX7B 2ZX6A 3GMOB 4UT7L 5L4IA 4PI0A 5BRZE 5HPMA 1FG9C 1LO3L 5DRWB 5FB8B 3A5VA 4ZOAA 4Q0XL 1TPXB 2AXGA 4NLHA 3MGTA 3S3JA 1FH2A 1H8SA 3R4RA 4JFZH 4UF7C 2NY0B 3X17A 4D0CB 5I18L 2IFFL 5KEZA 1ORSA 3FT3A 1I3VA 3NSCA 2GC4C 4MYPA 5BRPA 1ZHLA 3CVHL 5GJSL 3B37A 3CZNA 3TONA 3SE3A 4JFVA 1P7BA 4XPBH 4AH2B 5SWZD 5ISZB 2MIZA 3ILQC 4ALAH 3QJUB 1MIML 2KZ1B 2DQTH 1JZHA 3MLVL 2R0LH 3TU6A 5CNHA 4PJGB 1KT2B 2XWJA 5I5IA 2UZXA 3VW3L 4QOKD 3K80A 2BVQB 4FGMA 1ETA1 1BBDH 3WE6B 4XBMA 3RA7H 3MRKB 2AQSA 3C2AL 4KRPC 2OSXA 1ORSB 1A64A 4FFYH 1DO6A 4NRXA 4BSJA 4Y5XB 3FRUB 2KLSA 4LRNH 3MUHL 5C09A 1H15A 3N42B 2BW4A 3BN9C 4RGOL 1I3RA 2PXYA 3CV5A 3GBNL 1J86A 2FWOA 4FG0A 4OFIA 3B4NA 3GXTA 4PY7B 4S1SL 3FC8A 3ESPA 3LXBA 4UZGA 3TN0B 4P2QB 4ZW3A 2AQNA 3BMVA 2E6JA 1FWXA 4P4KC 1XDTT 3X3GL 5JMOC 5IJKC 3FO0H 2UZXB 1AQHA 3SDXA 2HTKD 2R69H 2UY7B 3VD5A 1BAFH 1JGDA 4LF3A 3RVWD 2J7LA 4RGOH 1NIEA 5CAYB 2Y6SC 1YPZF 1OHZA 1AZZC 4B9PA 1MHHA 3BLKA 1Q0YL 1EHKB 4K7PY 3T3PE 3CGTA 2CLRB 2GJZB 3KPPA 4NNXA 4MKTA 4XMZA 4P59L 3NSDA 3HB3B 3MLTA 1XGUB 5TQ0H 3MNMA 1FFNB 2J1ZA 5D7KE 1I3RB 2PXYB 5BO1H 1CL7H 1L9OA 4PY7A 5JPMA 3V7AE 1U0QA 1COBA 1V3LA 1RUQL 4F3FA 4XMLL 3LHPL 3P4NB 3UYPB 3WNIA 2OCFD 3FFDB 3MRNB 3GJFK 2X12A 4KRMB 4JHZA 2HVKA 4QGYA 5DK0A 5K69A 2AI0L 1HHJB 3RB5A 3EGXB 5EOTA 3QDME 2AEPL 4JM4H 1QSFB 3IDJB 2NTFB 4YUEL 1EJOH 3ERXA 3LZRA 5I26A 3WSQH 4YHML 3WJLC 5IVXB 4KVNH 1UC6A 2E75C 2COQA 4P9MH 4GAGL 1K8DB 5C07B 4FQJH 3GUTA 3AS1A 3KYKH 3O0RH 4BZYA 5CCHE 5HGDB 3NMEA 3EOAA 5EBWA 3ELQA 4RMWA 3US9A 1XGQB 1JD9A 3BT0A 3ULUF 2BSTA 1FH5L 2GIMA 2LU4A 3C5XA 3N2JA 5FYLL 1L3NA 1OB1B 4XX1G 2EIZB 5FGSA 1DE4B 4UQ3B 1LK2B 2VMEA 4Y19E 4CNIB 5FO2A 4YDLB 4UQ2B 4BD4A 1P5UA 3MBEA 5C0IA 1HIMH 3DUSA 4HS8L 1B0WA 1T83A 1HZHH 2O6FA 3GKWH 3H9SB 4R97B 4EN3B 4XNYL 1XQ4A 1UM5L 2F5AH 5EUKB 3RTQC 3EOAB 1WP6A 2P5WE 4M48L 1DBJL 2VR5A 1VGKA 4PYGA 4WW2B 3V4VA 2D3LA 3FTVA 5EA0L 3JYCA 2EIZA 3DBXA 4CRPA 4YHNB 1CGVA 5LAXB 4ONFL 4EAEA 2WO3B 4M6MH 3UO1L 1OAKL 4HC1H 4JFFA 3ECUA 4JJOA 2ZCZA 2VIRA 3DGGB 3LJ3A 4IW4C 2J43A 3CDGA 2ZUYA 1H8OA 2ATAA 1NAMH 2VE6A 2X4QA 1JPFB 1D5IL 3M45A 3NCWA 3T2NL 5IEHB 1NLDH 2ZOLB 1TETL 1ETZB 1MAML 3K46A 4NKIH 3SDCC 4KI5E 1NC2B 3PXLA 1EAPA 2VJXA 2ZXEB 4JM2B 5A3ID 5CGTA 2EIJB 2OS7A 4N2MA 3V7AG 4CBPA 4JFFB 1T0PB 5HGBB 3WO4C 3RUGB 4W9JC 1L0YA 3L4CA 1RHFA 1FN4B 1YY8B 4PVLA 3FFCB 5GGVL 2A6DB 1ZXQA 4WI0A 5T33H 1S46A 4P2CG 2W0LA 4GINA 2C34A 5KSBF 4K71C 2XPYA 4XNUH 3CLFH 1C12B 2NR6D 3CVHB 5I1HH 2W5PA 1NUFA 1S9WA 4P2OB 3QYNA 2F5BH 1A7BA 3D6GA 3VQ1C 2NXYB 4AXWA 1N64L 4N8PA 1S7TB 3T6ZA 4KQ0A 1FFPB 1MRCL 1I1FA 1E8WA 1JNNL 5AZUA 2CM6A 1PD0A 3NTCL 1CLZL 4N9GA 4ZPTB 1QW8A 3OMIB 4TNFA 4Z7WE 2XQBH 3GXPA 3RDTC 4MAUH 2JCCE 4LLYA 3VSQA 2FIKA 5AAWA 2F9BT 3LB6D 4TQ8A 5AW7B 5GPRA 1SFHA 2DAVA 1GRWA 3II2A 3EFOB 3NSFA 3WTYA 2CKBB 1AZUA 2QSTA 3GSRB 3SGJC 3U1SL 4KRPD 1IMHC 4Y5YB 4OJDH 2ZCLH 4OKVA 3PREA 1P4LB 4GRLD 4MMZC 3RX8A 1TSRA 1UUNA 1FFPA 4Y4FD 1I1FB 3MRBA 2X4TB 4LXFA 1PEWA 2NUPB 3WMPA 3VNZA 3TVMD 4HIHA 5DO2D 3CHQA 1RJYA 1DBKL 4ZS6D 2K6ZA 3SGDH 4KKCD 4WUUE 1WA1X 4OLYH 4J3BA 4FABH 1ZVNA 2JJSA 3L3OC 4MVBD 4JUTA 3BPCA 1QD0A 4HIXH 2EXSA 3QJFB 1PF3A 2DWYA 1KB5B 2SEBA 5F3BA 1NOLA 5TQ2L 4CVZA 2GJ6B 4HLEA 3AROA 3G9AB 2A6IA 4FNRA 4MCYB 2CHNA 4N9OB 4XVTH 1XCTA 2H3NB 4E9YA 1KCWA 1M7UA 1IGMH 3DVNB 3FB5B 1MXGA 3IJ9A 3Q8CA 3S3SA 5JOPE 1MIEH 4EQ3A 3GS7A 1F11A 4FYTA 3PWJA 2J57A 1ZAGA 4BZ1A 4WWKD 1HHGB 3WV0A 3BPCB 4YZFE 3HE7B 1P7QD 2FLBT 2HTKC 3BPOB 1MFAH 4PJFA 3V0IA 3QW9A 1I8IB 4Y1AB 2OMNA 1E3ZA 3SDAB 3QUZD 4MASA 2VUOA 4Z7VF 1MCEA 3PL6C 1YEFL 3H6AA 2QMKA 5IB4A 2MEJB 4H88H 1TJIH 1EO8H 2Z7ZA 3TIDA 4JFYB 4N8VA 1MW0A 4DO5A 2K3TA 5EIIB 3SOBH 2HT3D 1EWHA 2HSIA 1LQBC 3ET9F 2WLZA 2ZXDA 1CURA 5BV7H 4WU7B 1OTTC 1WWBX 4M5YL 4QJ5B 4E41A 5KN5A 2AQ3A 1RJZB 2WBKA 4L3CA 4KI5C 3F83A 1Q0YH 4ZSOB 2DYRB 1FL3A 3HPLA 3C09B 3OC5A 1I8IA 5DT1L 3FQWA 4QT5A 3U83A 2H2SC 2HAZA 2FUTA 4P59H 3KW7A 2DQUH 3GWJA 3CMOH 4FNTA 5MERB 5IGXH 1BEXA 1AVAA 1EO7A 5CJXA 4WK2B 4JCLA 2G5UA 5KUMA 4PUBL 4ELKB 1YEGH 2VR3A 3H3KA 3EDKA 4FYQA 3Q43A 4F2FA 5DEJA 3LRSA 2OMTA 3DV6B 3MRGB 2RCSH 4PH8A 4YSQA 3PRZA 1N4XH 1NBVL 4PJGA 4CSSA 1QSED 2EZ0D 3DYOA 3SCMB 3GGWA 2XPGA 3IDYB 3K2UL 4JG1L 2NY3C 2RIKA 3K5RA 2P7TB 5ID1A 2XZAH 5E9DE 2VLKE 2DQTL 5DEZA 1A4AA 1MHEA 2DIJA 4IMLA 2FVNA 4A66A 1OCCB 1DP0A 1BBJB 3B1UA 2PCFB 4C59B 4YJZL 4YSCA 2KS0A 2ZKYA 2ENYA 1HJBC 2UWEF 4NSKB 3NN8A 3QK0A 3VXNB 2X3AA 1LEKB 1QUPA 4G8AC 1TENA 3PXJA 3QORB 4Q7DA 5D5MA 5HJ3A 4K71B 1CD0A 3AXHA 4I0PC 3RVXD 1OAYL 2JLPA 2JJTC 1UM5H 1FAIH 2VDNL 4WSKA 5I15H 3BRFA 1DBJH 2YD6A 3V4VL 5IFHL 3T0ED 3OAUL 1NC4D 3VI4E 2WLKA 2VABB 2NR6C 5L7XL 4N0UB 4XN4A 5DJAB 4NJAH 3UCQA 3ESOA 4JM2C 3PP4H 5IUCA 4NSKA 4LDCA 4LNRA 2YRBA 4L37A 2MH4A 5F88A 4W68A 4F3FB 1PQZB 3CFKA 3RIFF 3C5JA 5I0WA 3WTWA 4WZ9A 1SYVA 4LGSB 1B0GB 3MJGX 5F7EH 4L4TB 5DUML 3QZNA 4A63A 2WXKA 3E1ZA 1DN0B 2UVFA 3B9KC 4W9IC 3U79A 1K4CA 1SEQH 1KGXA 1SM3L 2OJZH 5EC2A 3VI3F 5C07A 5GS1A 3RPIA 2VXSH 5AOZA 2QBWA 1J8HD 5TDPB 1JWUB 2J56A 5A6MA 4OZIF 3AU1A 2HKHL 3OQ3B 3LEVL 4K07A 1WLHA 4TOYL 3DHMA 4KXBA 1QFUH 3CFKB 3MACL 5I23A 1JPTH 1EXUA 1EJFA 3BVXA 1SYVB 5GZND 4KXZI 3WEBA 4L4TA 2FO4A 4KTDH 2X2IA 5DD1H 3EXJA 4NQEA 4TNWK 4ZK8A 3GO1H 1RV6X 3NRQA 1NLBL 4RAUA 2Z64C 4GAYB 3LEYL 4PB0L 1BIIA 3O3BB 3P73A 2ZNXA 3C8DA 3NIFE 3RHWF 1D6VH 3IWVA 2XTJD 3VXSE 2NYYC 1GPOH 3TJEL 1MRCH 1JAEA 4G71B 1EPFA 1JUFA 4GRWF 1XAUA 4KAQH 1JZGA 1VGKB 4PJDE 5TE7H 2YMOA 2C8NA 4O4YH 3OKNA 1XB6A 3A0OA 4A1RA 3LS5H 3WO3B 3HRZC 1RKRA 3QNZB 2Q7YA 4MWFA 5L6YL 3UMTA 2BWQA 1JXJA 1KIQA 3T77B 3P77B 5D1QB 1OCWH 3HN8A 2DQJH 2H26A 4R90H 3V2AR 2OL3B 1P7HL 1QAWA 4IOIB 1LGVA 3O3BA 3QZPA 2HKFL 2F58L 4P3DB 2XN9B 2WZPA 4AQ1C 2OPCA 3AG1B 4XVSL 4UDUA 3UZVA 2XACC 3RIAK 4RIRA 5LWYL 2J73A 3M1BB 5HXMA 1WTLA 3PE9A 4JX0A 4LO9A 4OT1L 1RK7A 1MPAH 4UIMB 2BNQD 1YNTF 5IMLB 4KTYA 4U6YB 3J7HA 2ZICA 4EJ1C 1YEHH 3NT0A 1TTBA 3RL2A 3QNZA 1P6FA 1NAMB 1NSNL 2D73A 4UM8A 2PCYA 2YQGA 4XCNB 4XNZB 5E2UH 1KIQB 4DGIL 5HGBA 4YZWA 4O58L 4CC1A 5EPMB 3QULB 1WAAF 4GXUN 2J55A 3FAWA 4XAKE 2O5XH 4M00A 1MCJA 2F53B 3QAQA 4ICXA 4RFOL 3EG9B 4RIRB 4FXKA 3D12B 4ANVA 3GSNB 2WAHA 3CVHA 4UT9H 2WN3A 3LDBB 4EKJA 5BQ7B 3VXRA 1OAJA 2F19L 3KVQA 3OWEA 3US1A 2AEWA 4ZPVB 5HHXL 4DKTA 4MRBA 2E46A 2H6UA 4APQB 4IEFA 3RZCC 1FFOA 3L3HB 2AITA 2XZZA 1JMZA 3GPEA 1HCVA 3TIEB 3HMXH 1RZ7H 1DUYB 4HT1L 4KI5D 1MHPL 1Z9OA 1AR1B 5JPNA 1JXKA 3OB8A 4MQSB 3SO3C 4OD2B 3RNQB 1E0OB 1Y1DA 3QO0A 4TTDC 4ENEC 1QTSA 2A77H 4K4KA 2IH3B 3DRQB 3TT3H 4QRQA 2VWEC 2FLMA 3IJSB 3PGCB 4NN7B 4FFVC 4IRZA 4M7LL 5EH1A 5A6LA 3IDXH 1XO8A 5GXBB 4JQIL 3UPRB 3HE7D 2WXNA 2BO0A 1TOXA 4F15C 5C0CD 1IE5A 4GKSB 3BKJL 4XOBA 3AXLA 3IMTA 4DP1X 5I1CH 3UAJA 4P23A 1T0OA 5H94A 4UNVA 1MCIA 3KLHD 2CGRL 1KGJA 3B2UD 1GCYA 4I48A 2R29H 3ARTA 3O45A 2ROXA 3TA3C 2C4XA 3X3FH 4IJTA 3KGUA 5D7JA 2VSDA 2YRLA 3UBFA 2VDRB 3QO0B 4MNGE 5I1CL 2BERA 2MPVA 2GCYB 1KPVA 4XGZB 3WUZA 1QUNA 2O93L 1F41A 1H5BA 3M8OL 3E0GA 3OAZK 1CVSC 4GLRH 1FVDB 3R4DA 4CVUA 5CINH 4OLEA 1PD6A 1X5JA 5CJQL 1FI8C 1IFHH 4N2IA 5FPIA 3LB6C 4PJ5E 1VEMA 3KPRA 1CU4L 4HZ1A 2UXVA 4I77L 3STBA 1CJYA 5D72H 3T3MF 2V5YA 2XKSA 3U2SB 2BP8B 4HAGA 4N2LA 2OR9L 2VXUH 4ZYKA 3OR7A 1CBVL 3FO9B 1WISA 4MJIE 4KX7A 1RERA 4HWBA 3N44F 4PB0H 4HXBL 5L9DH 4HPOH 5HYSB 1AHMA 3QDGA 3L16A 4WAFA 5H4YA 3SGEH 5F96H 2G5BA 1QVOA 4JG5A 1CD9B 4HWEL 1AMXA 2JKTM 1ESOA 3B7RL 3B7TA 3JWDL 3MLPA 3S5ZA 4H2CA 5KSAA 3GSOB 1MDAA 1LL1A 4WJ5B 1SEBA 1MWOA 3L3GB 5C8JB 1H6FA 4RGNB 2K78A 1VGEH 4YDMA 4JFDA 2V17H 5K93A 3O8XB 4AV4A 3RIKA 1CG9B 3QDJE 5L8KB 2AEOA 1A3ZA 1WBZA 1ZT1A 5LKNA 3HPLB 5GS0H 1OQOA 4PRPD 4CUCA 1M7XA 3HS0A 4H0IA 1CT8B 5F71A 3MV7E 4EZMA 1VFAB 1DLFH 1XGPA 1YUKB 4QF1B 4LQ1A 6TAAA 1PD1A 1MW3A 4MKMA 5BMFH 4O4YL 4J3OC 1UZ6E 4JPSA 5FWQA 2RHEA 2NY0C 2EABA 3A24A 3CD4A 1G7JB 2TRHA 4KKRA 3SPGA 4AVJA 4ELKA 3VXSD 1S7RA 1T7XA 4MQ7B 5IFAL 1S7XB 3ESNA 4PVBA 1P1ZB 5F0PB 2IWKA 5JO5B 4AVIA 4LOFA 3UO8B 3KGTA 5ENWB 2VNCA 4F9PC 4ZG1A 4PYHA 3VQ2C 3TP4A 4XNXL 4PAZA 4IIZA 3U7YH 3V6FB 3SGKC 1FNHA 4L0PB 3IS1X 3GGWB 2KPNA 4YFLF 2AJSH 3NIFB 5F1NB 4PV1C 1EAQA 2J88L 2Q20A 4CDGC 4KFZC 1C5DA 2NXZB 2COVD 3QCUH 3SPVB 3HBZA 3TVMB 1KXHA 4FFYA 3IGAB 3WO4B 5D1XB 1IQWL 5DSCB 1TVDA 2NNAA 3BFOA 1CFSB 4IKLA 1B9ZA 3MODL 5E08L 2H2SD 3DXAD 3U4BH 4JHBA 1G7MA 2PO6D 1XH3A 2WWNA 2AK4A 3QEUB 4H1LG 3X1FA 4FYRA 1MFVA 5DDHB 2JCCB 4B9KC 4Z7NF 1NCTA 1TZIB 2JJVA 4F8QA 5LNGA 3HKZA 1HDMB 2ESVB 3I74A 4ONOA 1HE7A 2A77L 4M3KB 3TT3L 4JMNA 5CIPB 4A7GA 3IN2A 4EBQH 4FTVD 3GHEH 4XH2B 2GUOA 4NKDA 1GMIA 1MFAL 5JIHA 3SDDD 3V10A 2P43B 3ZL4H 3IGAA 1QFHA 3SSGA 1ND0A 1JN6B 2Z93A 1J88A 4FHKA 4QRFA 5E94A 5DJAA 3HN5A 2A73A 2VSCA 4RAHA 1BDYA 4FS0A 3ZHKA 5BO0D 1RZQA 3ISRA 1T1XA 2GAZA 1J9CT 2W0FA 1EAJA 1J1OL 3T0EE 2NY5L 4JRXB 3CHRA 1KJVB 4QRRB 4GKNB 4C55A 3N1MC 4HEPA 3C5JB 3QXVA 1D2OA 4BCXA 5C86A 5FKAB 4M8QA 3IJYA 2YEVB 1LDPL 1S2EA 1HQ4A 2PYEE 2YD3A 5HDQL 2LVCA 1R3IL 4M9OA 4ZUWB 5LNEA 1WCBB 2EXWC 3ZT6A 1ACZA 1JNJA 1Y0LA 4HCFA 1LO5B 5ANME 5EU6D 4BQBA 3G5YA 3QG6A 5EBMA 3IXAB 4PMEA 3MLZH 1BM3H 1IKOP 3BPLB 2I60H 3PABB 2MTAA 4LSPL 2Z93B 4G6AD 2Q2LA 3IDGA 1MF2L 3WNLA 3D0VB 4GYBA 1URIA 3IFPB 1JHKL 5DC2A 3G04B 4XZ4A 4QCIB 5HGAB 4BV1A 5J12C 1CTOA 2Y7SA 5DD0L 1TJMA 3OZ9L 2MTPA 1KJVA 3MV8B 8CGTA 4N6RA 1L0QA 2CG9X 1KCVL 2F15A 4KK9C 5ETUB 4YLQT 3PAUA 1MCCA 4JFOB 3CK0H 1T7YA 2QTVA 1HI6A 1SXNA 5EMYA 4JM2D 3ZK0A 1WRFA 5IJKA 3ESUF 2PLTA 3P73B 4HWEH 3D0VA 5D1ZB 1C16A 1JPEA 5AW2B 3DPBB 4NQUA 1I3UA 3GXDA 1CUOA 4WV1A 4HYTB 2IAMD 3HS0C 3F58L 3IKCA 5SWSD 4YHLH 2PP9A 1BFSA 3ROLB 2YWYA 4XN1A 1LK3L 1HCZA 4A67A 2DQDH 1NEUA 1M7IB 1RZKC 3L4XA 2HTLD 2WXGA 1F2XK 3HI6L 4AJVA 4W9KC 2X6UA 4BQCA 2EYTA 2XYCA 1Q9OA 1E6OL 1NCBL 2P24B 4DW2H 4GI9A 2C9VA 4FQ1L 4CC4A 2Z0UA 5LB1A 2LQRA 1ZVHA 2NPLX 2WTRA 1GYAA 2GABA 4F8LA 2P47B 2VDRL 4CILA 3WUWA 2BVPB 3OKKA 4ZOBA 3ECWA 4KDTA 3WFDH 4HWUA 2Z4QA 4UM8B 3A47A 3EDJA 1BSIA 4HISA 1NMBH 1KLUB 3GMRA 4LLUA 1R4XA 2B15A 1JGUL 3ZYZA 4B50A 1AS6A 2BFGA 4X6CA 4WKZA 1BXUA 1MAKA 4BZ2H 5J1TC 4N2CA 4OJCA 4CSTA 3P0YL 4DPAX 2IBZX 4U7KA 2A74B 3QNXA 1MFCL 5BQ7A 2CD0A 4LAQL 1A7NH 1EJ6A 3INUH 4Q6KA 1B0RA 5EDXA 4DK6A 3ULVC 4TNGA 4KZCA 5TQ0L 5K9QG 5E08H 1EJ8A 1A6ZA 2KZBA 3WFZA 1Y1UA 4AE0A 3T4YA 3BH9A 4IRJB 4P2OC 1FFOB 2FZ3B 3IK2A 1T7ZA 4ZTOH 4FTDA 5FX3A 2X9WA 3QJRB 3HLAB 4XP9H 4ETQA 2WXPA 2V5MA 4JRXE 4KMLB 5HHXH 1NIBA 3ETSA 3IMUA 4TLKA 2FATH 5JPNB 3FUKA 3GI8H 5EOCL 4BZ1H 4KC3B 3VFNA 5DYOB 3LH2L 3M7OA 3MNWA 1MCLA 2NCEA 2OSLB 3INOA 1BVZA 2A74A 3MZGB 3QNXB 5D1ZD 2QGEA 3NCYS 4Y5YC 5D2NA 3DROB 3QR2A 4N1CA 1WZ1H 4Z7QE 4JQXC 1BJ1H 4XAKD 2Y1ZA 3QCTH 4C8XA 5JORA 1JZJA 5GQBA 1EAOA 2FZ3A 5G55A 1KC5L 4ZMTA 4YO0B 5I1IH 1DQIA 3HLAA 2EC9U 3U2JA 1C5BL 4WDIB 1YSOA 1QBLL 1IGFL 2R0WL 5AB0A 2IV8A 4HFUL 4NZTH 1JERA 1YNTA 4PS8A 4F33A 1S7QB 2D4DA 3GD1C 3MNWB 1G9NH 5IR1A 1QLFA 4YEFA 3QWRD 4NKQB 4RLDA 5M95B 1MVUA 1SLXA 4OGAD 2FK9A 3GPSA 5CWSB 5B1JA 1NM4A 4U1JB 2MNJB 2OXGA 2X44D 4RMVA 5EU6B 5AVZB 4Z76B 2MKWA 4NZUH 4NXSA 5DUPL 2W65B 4OVUA 4IRSD 3EJUA 1N4XL 1NBVH 5HDWA 2EQDA 4DOHE 3UDWA 3QUXC 4ERSH 1RZFL 3CN2A 3U2SA 4DEPC 4NQDA 2JJTA 1IEAA 1X3DA 3PP3K 3STLA 4P57A 4PJCA 3HE7C 3DUUB 5DA0B 1Z66A 2W91A 2VDPH 2ZJSH 3WS6C 4LSQL 4D8PB 3U0WL 5IR1B 1A21A 4MD0A 2K8MA 2WZAA 3BFQG 1MJJA 2I60L 4PW3A 2OX5A 1QO3A 4NIKB 4NPJA 1GL4B 3P0GB 1IGYB 1XD0A 2BVOB 4UQDA 3VQLA 3WHE1 4P3WA 4Z76A 1A7PL 1L9PA 1JMXA 5BRQA 5KSAB 5C9JA 4LSQH 4U1NA 4YR6A 3E6HB 1TYRA 1V7MH 2WZ5A 3WN5B 2Q8BH 4FHJA 1WO2A 5E8DL 3V6OC 3G6JA 2ZYRA 1ECZA 1AQKH 2BMKA 2WXOA 3GO1L 1H3GA 2MCPL 4V11A 4MS6A 1UXMA 5C7XH 2DIBA 4DVRH 1DQDL 3UBXA 1BYPA 2XOTA 1ZEAL 2ARWA 1DLHB 1G7QA 2ZWZA 4PJEE 3RL1A 4H2AA 5AKRA 4FQLL 2QVMA 2OMWA 2WWOA 3FB6B 4U6HB 4XMKH 4URKA 2NXZC 2YC1B 3DLQR 1ZLUH 3UJTL 5FFLA 4DETA 1ZPLA 4DTGH 1Z5LA 3WBDA 2R0ZH 2P52A 1XWVA 3PL6B 3MKGA 3G6DL 3HPJA 1INDL 1JZ3A 1T21A 3IMWA 1JI2A 4X8CA 5CILL 1GGIL 4NQEE 4A39A 4PJ9C 1BXVA 2O61A 2I27N 3GSQB 4P2YA 3WGVB 4AI7A 2P5EE 1EIBA 5HPOA 2X6MA 4HSAC 1A9EB 3ECBA 1DJZA 1RPQA 3KXFD 5JXAL 5C0CB 3TNNB 3APNA 2X70A 1BFOA 4PRPB 1HVXA 4QNPF 2G9HB 3UEZA 5EO1B 2NUTB 2CA4A 3PL6A 1DZBA 5T3XE 4PJBA 1O6SA 4S0SD 4PJAA 3ARGB 4PJFE 2NT1A 5I8CA 1G1OA 1NWOA 4TS6A 4Z7UB 3MA7A 3BDYL 3I6LD 4PSPA 4C4UA 2MRYA 3RZWA 2GSIB 4JQXA 1CWVA 4G6KH 4NQCA 1HINL 1DBAH 2R59A 3T09A 3DHUA 3WFHB 1A9EA 3ECBB 5A43C 4HJJH 4F2MB 1JK9B 3RFZC 2YEQA 3RP1A 4OJEH 3GT6A 1K5WA 5I17B 4EOWH 3B9KA 3L3DB 3CBKB 3RRQA 3WNKA 1GMEA 3VRJB 1RZJC 3UP1A 4JG1H 5EO1A 4E5XG 1NDMA 4XCFL 4JNXA 1KTCA 2XPZA 3PY9A 4M02A 4P4KD 5I8CB 4FAAB 1LO4H 1YMMB 1JBJA 1N6QH 2DF3A 2P5WD 25C8H 2DQCH 2N7BA 1NKRA 3CXDH 3RVVC 2GBVA 1E2WA 3IN0A 4NRYA 4KTGA 3KGRA 3WY2A 2FB4H 1ZLSL 4IGBC 3EOYG 4UQBA 4F2MA 2X2UA 5D6DC 2CA3A 2VMJA 4NO0A 1Y0LB 3LZFH 5MENB 1MVFA 4O02L 2DWTA 1AGCB 3ZDZF 3D39D 1KG0B 3CVIH 5ANMB 1QKZH 3T4AB 5F7LB 2Y2TA 2WO2B 3RJOA 4JGMA 3BSHA 4E9LA 1ZRUA 3CFMA 3MTRA 5AVTB 1RUML 3BXNA 3RTQB 4IDJH 2OYPA 3CC5A 3U82B 4N6RB 4NRYB 3ZL4L 4X42A 5ITBH 2FJUB 3O2WL 4W6WB 1HI6B 4Q8BA 1N0XH 1V3JA 4K3GA 5GJTL 1S5HA 3VWJC 4LCUA 4RGNC 2LAGB 4J3OH 3KPQA 2AV7A 1UA6L 4P9HC 1XSOA 2WLNA 3BWAA 5EU3A 2CXKA 2G2NA 4MMYB 1OGSA 4HC1L 3DTXA 1IIKA 2WO4A 1LXMA 1MWAH 3CVHH 1J9TA 1KEML 1BX2B 3ARVA 2HRPH 3QXAA 4YDVA 3B34A 1G5GA 2IADA 4S1DD 4GO6B 2VXSL 3BD5A 4Z7QF 1B3JA 2H8PB 1DEDA 2AJVL 1WUZA 2NNCA 1ONQB 4N6QA 4OZHE 4MXQC 5IB3B 1J12A 1J9QA 2AJUH 2IF7A 5MI0B 5GSRB 3U30C 1XAKA 1NFDE 4PRHA 3U4BL 5DD0H 4JO4H 4Q9RH 1JD7A 1IKFL 3WEXB 4K15A 3BAYA 4G1EB 4TPRH 1WA2X 2HLEB 3V5KA 1QI4A 1FNEA 1ZVSA 2IG2L 3BVDB 1NA8A 1SXZA 3PWLB 4I7ZC 2OCCB 4WFFE 3MV8E 1CC3A 3UTSB 1UTDA 2GC7C 3L5HA 3F7KA 4HCGA 4OW6A 1JPSH 3TBYA 2BHUA 3W2DL 3ARBC 3C5SA 1ZA6B 3D2UB 2Q3XA 3E6FB 4MJIA 4KKBD 4POUB 2K9FB 6PAZA 2OZ4H 1EA9C 2EINB 2VSKB 1HILA 4PJHE 2GK0A 4A68A 1UM6L 4L4TD 4W9LC 2VDLL 5KYXB 1BQHG 2E74C 3ZKQD 5DD3L 4MJ5A 1IJNA 2MHAB 3TA3B 1JPGA 1EVUA 3UG5A 2BNQB 1E50A 4WUUD 1V8HA 4G1EA 3SBWC 2CALA 1OAYH 4IJ3C 5KVFH 3PJSB 3TN0C 5CM1A 1MJ8H 1P5VA 1SYSA 3FRPA 2MOGA 1R5WA 4KZDH 1LP9F 4ZRGA 2EVJA 4BFEA 2Q7AA 4WEUD 4X0KB 1DVFB 4FTVB 5D7IB 2QSCL 1QASA 1FV1A 4P48A 4KXZH 5IVXF 4D7BA 1QI3A 1GGTA 1I1YA 1O7DE 2QVKA 3RKPA 4ZMWA 5I1AB 1BM7A 3VGFA 2ZUWA 1ETJA 3CZUB 1IU1A 1U2HA 4PJ9D 2YD4A 3HAEH 1GH7A 4U6TA 2DLTA 4WSJA 4AIEA 1V7NL 1JYVA 3UYRL 1A14H 3HC2A 4OCXH 8FABA 4ZQKA 3RGVA 4KUZH 1CE1H 2Z8SA 2R1YA 5IG7A 4P5SA 3E8UH 1F4XH 1EEYA 2Q8AH 3KXFE 3BSGA 5ESQB 4QHPA 5FM5M 2YWZA 4WDIA 1LM8V 3CCHA 1ZLSH 4ZMXA 4IRZL 2FNBA 2IIJA 3MNVA 4H8WH 4HQQH 4OCXL 2Z0BA 1FVEA 1V5JA 2F74A 4DAGL 4D7PA 3GHEL 1DJHA 4AENB 1OSEA 1ZV9A 2KZWA 4YIQB 5DURB 3IKKA 2R2HA 3I6LE 2QGDA 1X9RA 3LEYH 5ALBL 5ID0B 2Q0ZX 4PJ8D 3S3BB 1M6OB 4PJ7B 3TBVA 1KLFA 1EH9A 1I7ZA 1KDIA 4KKCC 2JJUA 2R8SH 4ADGA 4AYMC 1MCNA 3WKNA 2HN7B 3KWWA 2AVFA 3BVNA 3Q2NA 4J3SA 3A6CH 2E86A 2QSVA 3AS3A 4HDIA 4AG4L 3VH8G 1NFAA 1TIUA 1UA7A 3KWXA 2NY2B 4YN3A 1SFDA 3K7UA 4Y4KC 2BCKB 3STLB 3GS4A 1HSBA 4RX4D 2X4SB 1VACB 4HUCA 3VE0B 3MLWL 4TUKL 5C7ZA 1KJMB 3C8KB 1J1XL 1EMTL 4PJBF 4PY8J 3APFA 2R2HB 5CLWA 4N2HA 4B0MM 2VERN 1JRHL 2VL4A 5AOLA 4OM1H 3GKWL 5CCKL 1D2PA 2EE9A 4HGWA 5TE4L 3SO3B 4UT7H 1NBZA 4NM4L 4I0PD 4YL9A 3RVXC 4B7IA 2M1KA 4ZFFB 4YR6B 3K81A 3LRLA 2BIPA 2PYEA 1QACA 2OULB 2BP3A 1R33A 5AOJA 3QXUA 1AYRA 3O4OB 3WL9A 1BPVA 1W0YT 1U8LA 3G6JB 3BVWA 1SVCP 5HDQH 1SXAA 3OMAB 4I0KA 1MW1A 2P48B 3PHOA 4J4PD 5FR3A 1U42A 1VACA 2A1WL 3A67L 4XN2A 3W39A 3VE0A 3QEGH 3FO2A 1AHWC 43C9B 3NOIA 2WOBA 3H54A 3L1EA 1M6UA 2EH7H 2J44A 3JT0A 4IRSC 5FO7A 4FQJL 5D5ME 1N2RB 4XBGB 3I75A 3RY6A 3M07A 2YHGA 3VNYA 3MROB 5FV1L 3RZCB 3SE8H 1KV3A 2CSPA 2W07A 1YEIH 1RIHL 3OJDB 1CZ8H 4P5TA 1GGBL 1RZ8B 2BIHA 4LZKA 3QI9D 1NCDH 4LASL 3K2UH 5JLZA 3HPJB 5BZWB 4OAWA 3ARGC 4UQCA 4HPHA 1DVZA 3G08B 2BS9A 7PCYA 3RILA 4Q97A 1DBBH 4MMZA 5DHMC 3LRKA 4X6FA 3AUWB 4EDXB 1TQUA 2EDMA 5FO7B 5JHAA 3D3VD 1OAQH 3OLGA 5D1XD 3GI9H 3AADB 3WS6A 3EBAA 4EQ2A 5LLIC 1S5IH 1A1NB 4ZMYA 4EN2A 5C2BL 2VC2H 1JI1A 2VDMB 4HGMA 1NBCA 4I13B 4TQEL 4P5TB 3L1FA 3I84A 2QKIB 3SDCA 1BAFL 3MCLL 1J8HE 4K5LA 1CTMA 4Y5VC 4LDEB 5JPNC 3NFPB 4Z7UA 3MV8D 3VWKA 3HMWH 2VC2L 3N0AA 1GS8A 2G3XA 2D0HA 4OFPA 3GDBA 5F3HB 3S35L 3BCDA 3CWGA 4H20L 4L1HA 4RZKA 1AIFB 5ESAB 1KPUA 3MCLH 4OCWH 4S1QL 3CFTA 3KGSA 1F18A 3HMXA 3FOLA 3M17B 4L4TE 4NWTH 2A9AA 4URTB 4HOZA 4JFUA 3HHSB 1VFMA 4NQED 4M62L 4XOAA 1ZSDA 4WGWB 1P69B 5DMYA 3VRJA 4AW4A 1HX0A 4XPAH 3CK0L 2K70A 1S7UB 3I6GB 2WANA 1ZJAA 3VXSA 1B4RA 3LZLA 2WVTA 3RIAF 4ZUTB 2ZWLT 2NY4C 2L4OA 1NIDA 2CPCA 1A5FL 1MI5D 3KS0H 4MMXA 5AW6B 5KYWB 4F7MB 5D9SB 4NO0B 5SV4A 2XU9A 3ZKMD 4MCZB 2ISDA 2JIXB 2WIIA 3F7VA 1WWCA 3M17A 4F7TA 3VM7A 3S6CA 5HYIA 1QPXA 3OTTA 3TCLA 4FA6A 4DKFL 4ODVL 4G6KL 4L2YA 4AYDC 4AH2A 5AYUH 4U1LA 3N41F 3MZTA 5IQNA 4BKLB 3JUZA 3P69A 4W9FC 5AALA 3MQIA 1CGWA 1SBSL 3QFJB 3U1QA 4G8GB 5DHVA 3HEIB 4UB0H 2VDKH 3MMEA 2W60B 1PY4A 3WE6A 1E6JL 4C56A 1ZIBA 4XC1H 1UD3A 2EYSB 1KB9J 1S3KH 5BJTA 1L7IL 1NGPH 4NRXB 2O6EA 2CK0H 1UOWA 4OI7A 2N7SA 4HUXA 3I9GL 1M1XA 3HW7A 2AV7B 4P5RA 1H0DB 1PLGH 2EDYA 3FB7B 2G5RA 3HUJF 2Z6FA 5JW3H 1PY9A 3ILDA 1QHPA 1P4BH 3QIBD 1T2XA 1OCRB 2EIEA 4WUUB 4ADIA 2BSRB 1UWGL 1SBBA 1OP3H 2EKJA 3PUUA 4FFWD 4BSVA 3TBTB 5FGBC 3D39A 5ECJE 4N0YL 3OKMA 3C09C 4XX5A 2Z7WA 2AQQA 4YNYA 2AS5M 5DK2A 4AGNA 3LHPH 5DXWA 4ZDHA 3SYCA 4AT6A 3D2UD 1Q1JL 1FFNA 2DWXA 4TVPH 1KSRA 4RDQG 1FE8L 4QUOA 2AJSL 3RVTD 1QLEL 2IOOA 4L29A 2O30A 3LSOB 5J6HA 4NPYB 1ZA6A 3ZTDC 2WPGA 5L8JB 4PJXF 4ICWA 2HVJB 4MJIB 4YK4C 3TBTA 1OCZB 3MO1B 4QHUA 5A16A 5L2JA 2BCMA 2WQVA 1RUMH 1U8IA 1VJSA 1XF5A 2N3JA 4FDWA 1L7TH 3IJ7A 4P5TD 5D4QA 2VL5A 3BPOC 3UAJD 2QQLH 4OZ4A 5IQ9B 2APWA 4X5QA 4C83B 1WV7T 2GIXA 4ZFZB 1NMAH 4ZJ9A 3S96A 4MNQB 2VWEE 5IBTH 3FSZA 1P5VB 1SYSB 5EBWB 5A3IC 2V9QA 4Y89A 1R5WB 3HZYA 4X99B 5BUAA 3DETC 5B3JF 2Y2YA 4LRNL 4K94C 4QRPB 1RZFH 4JKNA 1NJ9A 1SUHA 4GSQA 5C09D 1FV1B 1XF5B 4MX7A 2C1PA 3FQTB 2EO9A 1M3JA 3OSVA 2QDVA 1VKXA 1CLCA 5DMGD 4NKIL 3DUSB 5FDYA 2CRMA 1AC6A 4KPHL 5D4JA 3VO0A 3T0BA 1INEL 2ED8A 2G2PA 1ZLVH 1N3NA 2GJPA 2KL6A 3B3IB 1SHWA 3FL7A 4NHUA 3ABZA 5A2KH 5GJSH 1UACL 3GIZH 5DD3H 1PNDA 5KVFE 4FFZA 1IL1B 2FJSA 1WZLA 4LSPH 4Y2OA 4I85A 2R1YB 5IG7B 4PJ6A 1MJ8L 1YECH 3BUQA 3BC9A 5HHME 3D50A 1HHKA 3OZ9H 3D33A 2QPFA 4Q0XH 2YLHA 1ADQA 1UHVA 4P4RB 3TNMA 2AEIT 1KIPB 1OE1A 1YQVL 3LN5B 4AV0A 2E27L 2EH7L 4G9FD 2XDHA 3QUZA 2VLRB 1IGTA 4FFVD 4M5ZL 2OSYA 3S37L 5ISZD 3GM8A 4PGBB 4TVUA 5T5FL 2V7HB 3GNML 3QEQE 2ILLA 4PM1A 3IGFA 4Q2ZA 3CH1B 4PJIA 3HJEA 5LGJA 2K6WA 3AITA 2CLVA 4Y2OB 2XTJB 1WK0A 1QSFD 3B7YA 3ABKB 3NIGE 2DMGA 2VM3A 4JDTL 2H32H 3QEHA 3C12A 1T22A 1G7PB 5AL8A 5K1JA 3SDDA 3OB0K 4PJAE 4UOQA 3L5JA 4GXFA 2FT6A 4TRPL 3MJWA 1PKQA 4JANB 3TV3L 4A7GF 5I2IA 4NQCE 2AI0H 3MJ7B 3P2DA 2IWGA 2D31A 5IFJA 1UQSB 3SJVE 4YPGB 4ZNEE 5JIIA 2Z31A 2ADFL 5J0BA 3MN8A 3TYGL 1GW0A 4GUPA 2FX9H 5CLZA 1WIUA 3DSNB 2GIYA 4LDOB 1TNNA 1CFNB 4X7TA 5FYJU 4Z95H 3KXFB 2D2CC 1HL8A 2YD2A 1MCWM 5CZKA 3GHBH 5F9DC 1PZUB 2XIBA 2W59A 4QHMB 4EDWH 2HRHA 4E68A 4EI6A 1E7UA 1FBIH 4NQVB 5E2VL 1DHKA 4OKDA 4ZUSB 3O2WH 3MTXA 1AZCA 2ZT9C 3UJIL 2Z91A 2WWKO 1EXGA 1ZS2A 2D31B 4HLZH 3VSTA 5SX4H 1KYDA 1MCHA 2BNRE 3LZPA 3QCUL 4M6OH 4Z78B 5FECA 2OK0L 3ILPB 4IBTA 2X28A 3GSNH 1G9MC 4UDTA 4OD3H 4GG6A 2GT9B 2D7QA 3EBIA 3P0VL 3PFUA 3H42H 1X9LA 3EJYD 3EO9H 2EO7A 3P9WB 4NYLB 4GT0A 3IEAA 4DQOL 1RJYB 4GRLA 1XCWA 4EI6B 2HP4A 4Q9QH 2BY1A 2R15A 5GGSA 4JAMB 1WFUA 3EJZC 4LSVH 2AXHA 3MUGB 1P53A 3OJ2C 1GGCH 1JVKA 4A7VA 4CU8A 3LZFL 1NSNH 4OH2A 2YD9A 3KYMB 3ZMEA 4B0MB 2X1XR 4ZMLA 1ORQA 4MXVF 1CDHA 4N5UA 3OKDB 4HUUB 1GC1L 2ITDA 2Z35A 3NSXA 3T0EA 4WTWA 2AQRA 1PZ3A 3ZE2F 1M71A 2CIKB 2VR8A 5CZXC 4CC0A 5B39A 2YZ8A 2ZF8A 3MOAL 1OTSC 4R5VA 4AIXA 3SEPA 1H3XA 1SPDA 1KB5L 4GRLB 4P46A 3UFIA 3RVTC 4Z7QB 3VW3H 2E4TA 3MFFA 2BXYA 3ARXA 5KVDL 1YEEL 3FU7A 3HB3C 4Q6YA 5D7IE 3V52L 2VDMH 3H4HA 5B8CC 1FNAA 1NGZA 5FUCE 1AD0B 5I1GL 1UM6H 5DA4A 3WNJA 5EU7C 1ORQB 4CN4A 1BM3L 5GGTH 1KC5H 4ELDA 1OALA 2CMRL 4Y1AA 2E9GA 5T3XH 3K2KA 3AREB 2WTOA 1KN2H 2YAEA 5F3HA 5IVZB 4CSZA 5F7DA 4GLRI 4X4XA 2YR3A 2EYRB 2DKSA 3MU3A 4WI9A 1AY1H 1NUNB 3KH4A 5E6IC 2NXYC 3CZKA 4YC2B 1TEGA 3WFBL 1UZ8B 3S35X 2WBJA 2WLJA 3GXFA 4Z7OE 4ZW5A 3T2OA 5TPWL 2XY2A 4E41B 3RY6C 5KYNA 3FYIB 3I6GA 1T66C 4A2EA 4L3CB 4I77H 4GFXA 2XLLA 1FL3B 4DOHB 2QTEA 3WD5L 4OQTL 4OF3A 4P5TC 3WKQA 4ANXA 1MJ7L 9CGTA 4MMXB 2OJ1A 5L0QC 1UEMA 5L88H 1B4JH 1F45A 3AMLA 1K5NB 4GO9A 3QQ4B 1LP9B 2EUVA 2JIXA 2WIIB 3F7VB 5HYJD 3BP7B 1G4MA 1D7CA 1ZS8B 4OGZA 2DH2A 5F6IB 1CFTA 5F7AA 2EKSB 2H0FA 4QYAA 1JZDC 5TH2B 3LRSB 3QFJA 2YAPA 3GEFA 4G43B 5KSVA 3CX5J 3B7UX 1YAIA 1WEJH 4M1CC 2TAAA 2YAQA 1EGJH 2B16A 3BP6A 3T8XA 4D9LH 4DZBA 1R34A 2BSDA 5E5RB 4FQ1H 3GTTA 2CIIA 1AQKL 1K5NA 2WIMA 1UD4A 2WQWA 2XT1B 3CLFL 4EE2A 3AM8C 2QPEB 4WFHE 3ZDXB 2V5TA 4HJ1A 5EF1A 3WTSA 2WJ5A 3I6KB 5C6PB 3L3JB 3SYOA 1QABA 5F21B 4ZX4A 2DLIA 2VMFA 4LPUA 3FBQA 2WLLA 5CEZD 2I24N 4XXCC 4YE0A 3D08A 1RZGA 3HNVH 1QBBA 1QRND 4RISH 3JV6B 3W0WD 4WFGD 4D8OA 1S4IA 2QQKL 3HZVA 3LOWA 4NP9A 5ADPH 1S9KC 4AL8C 3D18B 1BQSA 5CR8A 4OIBA 1CS6A 1M05A 5C0AA 4OF0A 43CAA 3KEHA 2BIIA 3CLWA 4ZDHB 4AT6B 1M53A 4L1BA 4BFKA 3VXRE 1MZYA 1UD8A 2ZWYA 5BW7C 1MCWW 2CO7A 5CJXC 1YEFH 4Y2NA 3TN0A 3K6DA 3KPSD 4AQOA 3Q06A 4C4BA 2IDTA 2WQUA 2R56L 3EXLA 4FLRA 3FSAA 4FN0A 2GBAA 3UOAB 4I4WB 4QHUB 2AGJL 3EDEA 5ALCH 1I8KA 1U8QA 4HXAH 2ARJA 3D18A 1NL0H 3EFFA 3BIBX 4AQAB 1YDPA 2GBUA 2R2CA 1B2YA 4OF5A 3FB8A 15C8L 5JQHC 3MC0A 4OZ4B 2QQNH 5IQ9A 2XVKA 2EE3A 3ZU8A 5IBLC 1U8OA 5FOBB 1CDYA 1OPGH 4B95C 3G6JF 3S37X 5JNYB 4PU2A 2PW2B 1O5PA 3S0PA 3ARFD 3U9WA 4Q9QL 4ZO8A 4JFEA 4P46D 4U33A 4C57C 1W6WA 4PV8B 1JDDA 4WW1A 1FGNL 4NENB 4XE5B 3FFCD 5GZOA 1OWRM 2VXVL 4S1DC 4OJAA 2GFBB 5HDBF 5T1KD 3LKNB 2EILB 4YDIH 4HKZB 5ICZB 1FYHB 1Q8MA 4YSOA 3S2CA 5K5YA 2RR3A 4YFLI 2EXTA 1BIIB 3HAEA 4EI5D 4DP4X 3GUTB 1A4BA 4NT6A 4GKZB 3DURA 3OBAA 2I9TA 5AWNH 3CDFA 5KSBE 1B0IA 1GOFA 2PYFB 4DPCX 5I1DA 2NW2B 2X88A 4QO1A 4KXAA 1Z6JT 5I9QC 4QPEA 3F3HA 3FU0A 4X4YB 4K23L 4NI6A 2VXQA 2H41A 4LL4A 3IVKA 3REVB 5F89B 4JCMA 3LKPA 4DEWA 3ABMB 3V6ZB 4WEEA 1UJ3A 2EZ0C 1HHKB 4QI3A 3R1GL 4DZ8A 3FQYA 4NAQA 4WHYG 1DANT 4IRJD 3HRPA 4UZSA 5KOVC 1V27A 5D7HA 5TF1L 1BAWA 3FQ2A 4X80H 1SZNA 3LN4B 3MNDA 4M6ML 1TT6A 5HHMD 3DA0A 3C6EA 2H1PL 2IANE 4KK6C 2V7HA 4QO1B 2PCXA 4MAYC 4P0DA 5TK4A 3VX0A 5DHYB 1Y6NR 2WYZA 3BZEB 3VM5A 2JKWA 4KQ3L 2C3VB 2HMID 3MBXH 5DMGC 4HBQA 3WMQA 3EO0A 3JUYA 1YEJL 4P5KB 3REVA 5TPWH 4IMKC 4R3SB 5C0BE 4G8GE 1T22B 3MLYL 4MJJA 3WNPA 4ZFQA 5I0VA 4MD4A 4GG8B 3VH8B 4AYID 3F58H 3MX0B 5TDOA 3L5WB 5EU5B 4GIAA 1DJWA 1FFTB 5JTWA 3X1BA 3B5GA 1T20B 1OCOB 3DYMA 4K7PX 1HHHB 3LQAC 2ZOLA 2IQ9L 3EOTH 4AQ8A 2YLKA 1JV2A 1EZVX 2UYLB 4JO4L 4UOW1 2DL2A 2VZOA 3W3BA 1E8XA 4F80A 1CGSL 1TSHA 3WTXA 4G9FE 3U6RA 2YA2A 1Q94A 5GS3A 1PSKL 2ZCKH 2NTSP 3HAEG 2YQ3A 2HFEA 1YY8A 4F8OA 1XZ0B 3LNFA 2JKNA 4JO2L 1OAZL 4XXDB 1FHGA 2BP5M 2PPFA 2OR8A 4NIYE 5T3XD 1HHIB 1T20A 1TITA 4FCHA 2R8SL 4MDRA 4QRQB 2IAMB 1UB5B 2ZWNA 5GRXG 2EC9T 1MELA 3VD4A 2OXHB 4JZJB 3MLZL 4PI2A 1OL0A 3SGKA 4HSQA 3FSVA 4GKSA 1KYUA 3MRIB 1SGKA 1YVLA 2WUCL 2Q86A 5E5LA 1TO5A 3B9DA 2H0PA 3QPQD 5LG1A 3KJ6L 3RI5K 1KGUA 2NYKA 5TE7L 1DQLH 3UTZB 3PQYD 1A0QL 1ZTXE 5GS2D 1KBPA 2YD8A 3IJHA 4YSRA 5HI4C 2CO6B 3EFOA 1IZKA 1SN5A 1IFHL 2R0KL 3WN6A 3MRPA 5KYYB 5I66B 4B9FA 1H5BB 2QFRA 1R3KB 3UPAA 1RZPA 1AG0A 4RX4A 2UXFA 1PBYA 2BX5A 5E2VH 1G7IA 2OBGA 3GC3A 3QPKA 1I9RH 4MJ6A 3RUGF 2X4TA 3U36B 2DEWX 3U1PA 2L7JA 4N2AA 4QY8B 5EC1B 1THCA 5TFSL 3D39E 3LEVH 4E9VA 2K1MA 4GOSA 5DC9B 5ABAA 4JFHE 4QAMB 1WEJL 4JRYD 1PZSA 4XNQB 3VWJD 3NSJA 3PGDA 5F6HJ 1UYWH 1E4WH 1NUGA 2CO6A 5AQ0A 2ZYSA 3ARFA 3BO8A 5LBVA 2A6KB 3QGVA 4DT2A 1D7BA 2VW7A 2WNXA 3L5IA 4KDVA 2EECA 4OLUL 3ZO9A 4GQ9H 3LVTA 4AKOA 5TFSH 2V7NA 4UTBA 2Q6WB 3P3RA 1G87A 5IVZA 3DVNA 4F2EA 2EYRA 1SMOA 1XTMA 3I6SA 4MJ6B 4X7EC 5J5EA 1E4WL 4KI1A 3BMWA 1YPZE 3V0VB 5K9OA 2GG1A 3QXDB 2W9LA 1SDYA 5IBLD 4Y2DC 3ROOB 4E9SA 2PR4L 5EIIG 3V4UL 5C8JA 2WBJB 3PWJB 3N9GH 4OGXL 3WJLA 1MNUH 1PG7L 3SCMC 5E03A 2F8OA 3HE7A 4WKXA 5IHUH 3KPNB 1CG9A 4RFNC 1WHOA 3GMOA 4XVOA 5HPMB 1IE4A 3E8VA 1TR7A 4JZNB 4JHVA 2Z8VC 3AS2A 3L1GA 3ARGD 3HS0B 2VN5A 3E9TA 3V0JA 5KVEH 4FL4C 5IB1B 1OQXA 3U46B 5C08D 2XZQH 3QPXL 2Y5QA 1W16A 3EYQD 3WDIA 3HB3D 2IPUG 2RQEA 4GIOA 3TIDB 4OZHA 2EIDA 3B6SA 4AQEB 2A74C 2NLJB 3SBRA 5I75C 4J2XA 3O3UN 5F1IB 4MZRA 3QH3B 1KXTA 1YC7A 4PD4J 1CK0H 4N8VG 4OVVA 1E5CA 4Z3JA 3OMZA 1HL9A 5IJCC 2ZX5A 3RVVD 4U1MA 1BZ7B 5DWUL 1S9YB 5TK2A 3BZ4B 3MOQA 4DHLA 5FV2A 1K6QL 3SE9L 1DVTA 5CBEB 5F3FA 4PRIB 2JV6A 3ZYJA 4HVBA 4R26L 2D3NA 3DVFA 3V52H 5BNXD 2EEFA 4EO5A 5HYJB 3SDXE 3QUHA 4N3TA 5MERA 1AZRA 1U3HD 4A55A 4QJ4B 5JXEC 3B6SB 3NJMA 3VWKC 2OMUA 3N6YA 1XF4B 3SKJL 1K85A 4JO1L 3F00A 2OMVA 1HTYA 4IHBA 4U1IB 4AK2A 5L2KA 4JFZL 2F7PA 2WLLB 3D09A 3WTUA 1NIAA 4P2QA 2UZPA 4ODWA 1RUPL 3T1FA 2BWIA 3CG8A 3UX9B 2P5EB 1IJ9A 1ZTMA 1HNGA 3ZGHA 3FCGA 2Y24A 1KLGA 1MF2H 1MOEA 5GGVH 1NCBH 5HYJA 4FYSA 4G83A 2VXQL 2YOAA 1U8NA 4JRFA 3J27A 1UFGA 5C0BD 5IHZB 3U9UB 4PLNC 4TTGA 4UYPA 4XB8A 2DM2A 5DMIL 4B9CA 2J1XA 2P44B 1JN6A 3OHXC 4YHIA 5LDUA 1H3PL 4HCRL 4M1CD 2WD0A 1MY5A 2VGLM 4ODWB 4Z0XB 1HL5A 3UACA 2ZUUA 4WI5A 3WOVA 1CF1A 3P4NA 3MFGB 3IAPA 4HUMB 3SD2A 2WYIA 3O6LH 2B1AH 2FQEA 1R19A 1CR9L 1TMQA 2XZCH 3NYKA 4K3JL 1IO4C 4U3SB 3W9DA 1XF2A 4WW2C 3ZKSD 2R56H 3HZMB 2C9XA 3CSPA 3ALPA 5D8JL 4HHGA 1RUKH 1QRNE 3F64A 3W0WE 1N59A 4LLQB 2YUVA 5BVJA 1U8OB 5HDBE 3Q5TA 1XCXA 3O3EA 4G9FB 4Z6AT 5F88B 3PIQA 2ZSVB 4MQXD 4YHZL 1X5HA 2NY4B 3PWVB 2WVVB 5ESVA 3T1WA 4JFEB 3VXTA 1E5YA 1GAFH 5C0AD 4AUUA 1I82A 2FNWA 5EZLB 4NENA 1RCYA 4QIRA 2B1HH 1ADQH 2W8CA 3HG5A 4TLTA 3CTTA 2R2BB 3K72B 3MREB 5SWQB 1FYTB 1BQHA 1JV5B 1RLBA 4HKZA 5ICZA 3CQPA 3MRLA 1S9XA 5EZIL 1I1AA 3PQYE 4YDZA 3H9SA 3GB7B 4JDZB 4AQ8C 4EN3A 4YSAA 4GKZA 1S3KL 3E7JA 3CX5K 3DPBA 3TCXA 5BVJB 5J12B 3NZSA 1ZK9A 1KBWA 2EIKB 4U7SA 3GK8H 4YHOL 2EDEA 3UERA 3BPNB 1IKNA 1SXSA 3HZ3A 3JTTB 3DO7A 1ACYL 1E5UI 2VDML 1EXUB 2DW5A 1RURL 1PG7H 2B14A 2ALAA 2JE8A 3HHMA 2XV6B 1CDUA 3VFRB 4X6BA 4XZUB 1M7IA 2X40A 3LKPB 4KZEH 5IV2A 4UQIM 4X4ZA 5CSBA 1UJ3B 5DVPA 1FYTA 5GGTL 4ZMNA 2VR7A 2KLTA 4MVBC 5LO7A 4K94L 5IMKA 2AEQL 1AE6L 3MHZA 1KCSL 2UWEA 1GY2A 1A6WL 3MXWH 5GRVL 4FZ8L 1FFQA 2X4QB 1UATA 5GJTH 3DJZA 1KCLA 3GLAA 5F7FA 1IIIA 5INCB 2AJXL 3SJVB 5GS0C 1O6VA 3RE0A 3CSYA 4KPHH 1G1KA 4JPWH 1EAPB 3MODH 5T1KA 1VPOH 5I6XB 3QUML 1UASA 3FU9A 2AJ3A 1YN6A 3AS0A 1T3FB 3L8QA 4IDJL 1L5GB 2ENPA 3TBWA 2XQYG 3MX0A 3WJJC 3X2QB 3CFUA 3WXVH 3L4TA 1VADA 3KS0J 1FNGA 2A6DA 4K9EL 3JVGC 5EF0A 4X6EB 2DBJA 3IE4A 2ADJA 3EJJX 5FK9B 2CGZA