2H1WA

Crystal structure of the his183ala mutant variant of bacillus subtilis ferrochelatase
Total Genus 112
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
112
sequence length
309
structure length
309
Chain Sequence
SRKKMGLLVMAYGTPYKEEDIERYYTHIRRGRKPEPEMLQDLKDRYEAIGGISPLAQITEQQAHNLEQHLNEIQDEITFKAYIGLKHIEPFIEDAVAEMHKDGITEAVSIVLAPHFSTFSVQSYNKRAKEEAEKLGGLTITSVESWYDEPKFVTYWVDRVKETYASMPEDERENAMLIVSAASLPEKIKEFGDPYPDQLHESAKLIAEGAGVSEYAVGWQSEGNTPDPWLGPDVQDLTRDLFEQKGYQAFVYVPVGFVADHLEVLYDNDYECKVVTDDIGASYYRPEMPNAKPEFIDALATVVLKKLGR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Amino Acid Residues His183 and Glu264 in Bacillus subtilis Ferrochelatase Direct and Facilitate the Insertion of Metal Ion into Protoporphyrin IX
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Lyase
molecule keywords Ferrochelatase
total genus 112
structure length 309
sequence length 309
ec nomenclature ec 4.99.1.1: Protoporphyrin ferrochelatase.
pdb deposition date 2006-05-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00762 Ferrochelatase Ferrochelatase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1400 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2h1wA01
3.40.50.1400 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2h1wA02
3GOQA 3AQIA 3M4ZA 4KLCA 4KLRA 1C9EA 2Q3JA 1L8XA 3HCPA 3HCNA 1LD3A 1TJNA 2PO5A 2AC2A 4KMMA 2PNJA 2HREA 2XWQA 2HRCA 2XVYA 1HRKA 2XVXA 3HCRA 4KLAA 2PO7A 2XWSA 2QD5A 3HCOA 4F4DA 2QD4A 2XWPA 2HK6A 2Q2OA 1QGOA 3W1WA 2AC4A 2H1VA 2H1WA 2XVZA 4CCSA 1C1HA 2C8JA 1AK1A 4MK4A 1N0IA 2Q2NA 1LBQA 2DJ5A 2QD1A 3LYHA 1DOZA 2QD3A 2QD2A 2JH3A
chains in the Genus database with same CATH superfamily
5FTLA 3MTEA 2ORVA 5D3ZA 1E3MA 2KMLA 1PVDA 2PLNA 3H0CA 4HDNA 1Y1TA 1D7OA 3LXXA 4QOHA 4P81A 1LI7A 3REQB 4A4DA 2E7ZA 3B3AA 1KK1A 2VYQA 3A0RB 3R3SA 2YTZA 4PO9A 1XAHA 1JIKA 4R71A 3JPYA 5D6OA 1PFQA 4A92A 1ZGGA 3FNHA 1OXBB 4MJ7A 4LF4B 2Y27A 4KJZA 1KSFX 1WP9A 2F43A 1SUAA 2C42A 4UKDA 5DSTA 2QTAA 2PGAA 3IO3A 4RAQA 5F35A 2RH5A 4OQPA 4Z51A 1FP6A 3HYTA 2NXJA 2FZWA 4RFSA 1F4PA 3TCNA 3RC1A 2BKEA 1VLVA 2WJAA 4P33A 1EK0A 4RVUA 5JS2A 4FZ5A 2ORED 4GOLD 2PLWA 1XTQA 2OO5A 2FMXA 1Z2PX 3DQQA 3ILYA 3KJEA 4RHEA 2WWRA 3DBVO 5F3DA 1Y8QB 4QTZA 1F0NA 1JLLB 1D2NA 4C5CA 4NMLA 1ZFNA 1YZYA 2Q6LA 2NG1A 4KQKA 4BX8A 5LYJA 5C37A 4Q93A 2IEIA 2XQFA 1XPUA 2I7XA 3EPRA 1H2AS 4OQNA 2BHNA 3HACA 4B76A 3EFEA 1XJWA 3GNTA 3SXUB 1AGPA 3JQRA 1QV7A 3C39A 4V1CB 1GAJA 1AGRA 4TX1A 3UATA 1AGYA 1XTSA 1C9KA 4CWAA 1IZ0A 1OI2A 1B76A 3QSYA 4G56A 2DFDA 2ZJ2A 3NHJA 5GVRA 1BS2A 4I5GA 3UB2A 3G1UA 5K20A 1ISPA 4RQAA 4B33A 2PV7A 1M2EA 2OAGA 3HABA 3A2NA 1XGKA 1JEOA 2A7XA 2ZW9A 4KXWA 5BV7A 1NDUA 3R5XA 4K03A 1N33B 2JHPA 4RQBA 4WERA 1WZNA 2NP7A 2HC9A 3AVOA 4OU5A 4Q19A 4CQLB 4KK3A 3OIYA 2X4IA 2D59A 1U8XX 3OU7A 1GKLA 4S1WA 1LDGA 2MYTA 1A98A 5DTQA 4B4OA 1GTRA 3RAEC 1IBLB 4XWKA 3EOBI 1UFQA 3M49A 1IATA 2ZK7A 2Q5QA 1BVUA 2E85A 1UMDA 4B6EA 5I5EA 4DM7A 4GBJA 8ATCA 5A2GA 1FDOA 1JDTA 1II9A 4OHPA 4LAFA 3QU9A 4IZ6A 4U6QA 2OO3A 2C59A 2QNBA 2DFPA 3DOHA 3BHNA 4MV7A 4LWPA 1DOZA 1JWAB 4H60A 4J9VA 3C4VA 4XLLA 1I4OA 4NKRA 4GUAA 1OV4A 2DHEA 3I4CA 4RTJA 1SB9A 2Y1GA 3SF0A 4LOAA 2J6CA 1FYFA 5G53C 4BRSA 2PS3A 4M7RA 1W5FA 4JL8A 3UJHA 3HM2A 1WTCA 2GVZC 5PGMA 3RU2A 1MOQA 1WDWB 4Y2XA 3QEMB 4AWBA 1F1BA 1X7WA 3MK31 1KEVA 4L51A 4QFBA 3VKFA 1GUYA 1SQ5A 3O9MA 5BVHB 5KOIA 3CUYA 1WX1A 3X1ZA 5LP1A 2ON6A 5EJAA 2B37A 2C5LA 5LBUA 1KJQA 1M8FA 1ZJJA 3KE9A 2HWUA 3L49A 3P0FA 4R68A 5AOBA 2PX2A 2QU8A 2GSDA 3IURA 3WC4A 2XNDD 3GUCA 3D6MA 4HMQA 4OAPA 3RJMA 3BMQA 4AG6A 2QPAA 4A27A 2OSVA 2Z0MA 3MM4A 2XEDA 2B5OA 4LE1A 1VECA 3ZYCA 3DE0X 4QFCA 5DM4A 1L6IA 4JXXA 1SBYA 4UNRA 4ZJZA 5MGNA 2GM3A 1T2VA 1P0CA 2GX6A 2HSEA 4OLFA 3UK0A 3ZS8A 2OL4A 4R41A 3UCFA 1VPTA 2ZRLA 1GGNA 4FFDA 5CAEB 4QHTA 2IUUA 1DMSA 4O2BA 1I7LA 2IBMA 3M4JA 2F48A 4EEXA 2MMGA 1NW6A 5KYNA 4DEVA 1CUXA 3IVXA 1WSAA 4G0WA 4ZO7A 4NRDA 2XMZA 1B16A 3MWGA 5L3RA 1CXZA 1QIMA 3EBPA 3ETDA 1F20A 3V1TC 4YHHB 5JOQA 4N3GA 2YFYA 2C9DA 3PXAA 1IN1A 2WF9A 1Z25A 3ENQA 2UZAA 3DA8A 5DM2A 4Z2AA 2GM9A 3TUJC 1JDVA 1RPNA 1YZHA 2ODPA 4MV6A 4N8DA 2ADOA 1VJTA 2XKBA 3VOAA 1ZA2A 1U3TA 3FAZA 3CA8A 4B75A 4Q7MB 1ZONA 4BNTA 5FBVB 2PXAA 3OT1B 2JD2A 3CCCA 3P5BA 4U6NA 4BB0A 5F1YA 4XWOA 3E0QA 3ZGZA 1OGYA 3ICPA 2WD8A 5LKAA 4D74A 2G0AA 4XVRA 4LE0A 1V6AA 1UQRA 2ZPTX 3LLVA 5TQ0B 3IOEA 4XQEA 4B35A 2JGNA 3NWEA 4RE6A 2H8GA 1XTUA 4DM4A 4R1SA 3MW8A 4EHHA 1P33A 1CR1A 2C5AA 3EODA 3E6AA 4PEVA 4BMOB 2MCFA 4D0LB 2WB2A 3W1VA 1JXAA 2DPLA 3ANMA 4WOJA 1TW3A 3JQBC 4MPPA 3KQLA 2EGUA 4HAWA 1JRLA 3STUA 1AKMA 1C9DB 1DHRA 1WP4A 3BFPA 4Z9FA 1ZVJA 4MB2A 3HGMA 3U3XA 5JRJA 1XVAA 2YUIA 2ZIUB 2R2AA 4R7TA 2VBCA 5JZMA 2ZYIA 3LL4A 5EZSA 5HZGA 4D44A 3RF6A 1UJCA 2QQ5A 3A9WA 3WK4A 2ZT7A 3T9AA 2ZRAA 1RWVA 3HDVA 3G9QA 2WWGA 3LG2A 3SKXA 2Y92A 5FAKA 4GXQA 2AJCA 2VVTA 1UPTA 3DR5A 1RXIA 4KUEA 1C7ZA 3PU6A 5IJ9B 3BT7A 2NU7A 2XDQA 4HUTA 4CL8A 4CF7A 5IVKA 1R66A 1THTA 2MOKA 4OI0A 1X7DA 3UHOA 2X1VA 3WLKX 5J47A 5CLQA 1JHAA 2PBZA 3EMBA 1E92A 5EIWA 3UT6A 3NAMA 4PG6A 2YDYA 1NLYA 3TFOA 4CKZA 3GQVA 2GH1A 2BZ1A 4FEEA 3WLQA 5CA0B 3D7RA 3V97A 1JKXA 3HB4X 1PR2A 3G2PA 1GZDA 4UUNA 1PR5A 3OESA 2HY7A 4LXTA 3R5FA 4U2EA 2IHJA 3E8XA 1Z2OX 3FOFC 5JCXA 1IXSB 2Y0DA 2Q9AA 1NNUA 7REQA 1BMQA 4YRQA 4RPGA 4UUQA 3O9ZA 1MZVA 2TMKA 3PPIA 1T0PA 2OGWA 1E63A 2BMAA 2HCRA 3F1KA 3KJIA 4G84A 3GU3A 2QLNA 4L6IA 4C6HA 1YL7A 5BY2A 2WLTA 4TTJA 5IJAA 1PT6A 2YQ5A 2IWHA 5TMDA 5JQGA 4XUGB 1Z4JA 2C4KA 4P7FA 4ZI7B 4KFRA 2ACVA 2P2GA 1KARA 1QH1B 3EDOA 4B48A 3HL4A 2FXIA 1G3MA 1ACJA 4Y0AA 3GJ0A 3ZDYB 2GJ4A 4M99A 5B2EA 1NVUQ 2A1TR 2JA1A 1VCMA 2UUOA 4IXMA 4RPCA 4PGHA 2ZCUA 2OCLA 1GQ2A 3CF4G 4H3HB 2IYFA 3ASUA 4PS0A 1F8GA 2PQ6A 4X8LA 2BHLA 1N9GB 2WSMA 4G07A 3N2GB 4GOJA 2DY1A 3WGKA 5B3LA 1TZMA 2B25A 3FFWA 4F12A 3VHQA 3MHTA 4UXJA 5HGXA 2V7XA 3RNOA 5DW0A 5HPYB 2O3RA 1X0VA 3K1TA 4I55B 2FRVA 4ND4A 1X1CA 3PD7A 4LXQA 2WICA 1O94A 2POQX 1I24A 1BMTA 2G6TA 4ZV9A 2IS1A 4YMTA 2ERXA 4DCPA 1CJTC 3ZC3A 1T4DA 1XRPA 4XGKA 3UH1A 3TTWA 5CM8B 2JFFA 2FXVA 3ABOB 4Y30A 1CQWA 1MENA 2VP9A 3LC7O 2P2ZA 2F4NA 4JNKA 4D9FA 3PFNA 4IF4A 5LLDA 2X1LA 4PSCA 3EPHA 1P7PA 5BQPA 2JH3A 5L4LA 2H31A 2I71A 2WOJA 3VKHA 3EB9A 4H3SA 1TU4A 4MVJF 3U7QA 6NULA 3OOYA 2TECE 1WCWA 3V2IA 3W5BA 3VTAA 1GPDG 2CGEA 4RFSB 3RSLA 3HCAA 3SR3A 1KI6A 2I2WA 5J2UA 1V7PC 2Q0HA 2G71A 3FYUC 4FCVA 4YCMA 1ESMA 3R3JA 2R2GA 4CM3A 3OJOA 3H99A 1TLLA 2DP4E 5BSUA 1I7QB 3BRWA 4BRWA 2H48A 5FX2A 2RFLA 1EFDN 1H0HA 5BV0A 2BR4A 1L7PA 5AW5A 3LZCA 1R6VA 1JYFA 4AX8A 3DKRA 2M6LA 1AUQA 4YO8A 4UU8A 5DNCA 4B3BA 1GGHA 4V1CA 1RAEA 4L7QA 2A5LA 3PNKA 5I7FA 2JD1A 3OZFA 1Z73A 4MAAA 2IZ1A 3TZQA 1ITZA 2VUIB 1N2BA 3T34A 2BKAA 1OX6A 2FP4B 3CLUC 3T1OA 2EBWA 3VTKA 5JZBA 1ZSVA 3UAVA 4ZWNA 4I4TF 1ESZA 1PR0A 2MSKA 4IIXA 2DUUA 1T0BA 2FHSA 3HB7A 4PXYA 1X1RA 1SUWA 1BA3A 1Q1ZA 2CSUA 2VH2A 2V0CA 3HWX1 4LDZA 1RE1A 1TNDA 2WUGA 3N0RA 3MQ4A 4YLGA 5FWXA 3IUPA 5CG2A 4XJTA 5HKKA 3KALA 2XVZA 4HNAA 3BJRA 2PKWA 3ET4A 4Z4QA 4QOIA 5H4GA 5DM70 2GLUA 3H9BA 3R44A 3PQ7A 1OFUX 4O4HB 2HWWA 3RWBA 2A0UA 1IEVA 1BGWA 4WOBA 1VPWA 2YXBA 1QF6A 1NSTA 1JXQA 1VBMA 2W6IA 1DO0A 2AF3C 5EWMA 4HDSA 3U3KA 3U4QB 1G8PA 2REXB 2R9VA 1OHHA 3P0HA 4LJ7A 1QGDA 2XDAA 5K09A 1W36D 4N3BA 4C7JA 3UGJA 2IHUA 3RSHA 4COKA 1V6SA 2QU7A 4C89A 2P6NA 1FP4A 1BVHA 1CUBA 3DFKA 1LDEA 2Y9MB 2B69A 3ZVLA 2GBPA 3A1WA 3E03A 1GTMA 3D8UA 5GV8A 3TOVA 1HH4A 3RUHA 3H4IA 1IBRA 5CVDA 4DLYA 5KX5F 2W2VA 2YYZA 3QMVA 4AQYB 3UKOA 1N3BA 4OL0A 1Y7PA 3BCHA 4UHKA 5CNKA 3O4RA 2WFLB 4MV8A 4AYTA 4NCJA 3U7FB 1E6EA 4J16C 2YWFA 3WGUA 2WWYA 3HRKA 1DIGA 3KEFA 4ALLA 3HQ4O 3NEYA 3WGLA 4BO5A 2DHRA 1OHHD 1PJCA 5DM60 1EFHA 4R3WA 2DR0A 4G5GA 4INPA 3WDSA 2ZUFA 4Q9AA 2R60A 1KNXA 4F2PA 1KI2A 1JG6A 2XB8A 4WVFA 3PVZA 1X1QA 4XUCA 3S68A 1EWTA 5C5CA 3LRPA 3GZJA 1TQDA 4X90A 3I52A 2H2HA 4Q7KA 3DM9B 4GI7A 3I2GA 4KE9A 4HS9A 2OFOA 1NNI1 1ZRNA 2B7LA 3WNQA 2H06A 4BO6A 1D2MA 2BE9A 3S8YA 5CG1A 1D5WA 2G63A 3G49A 4IM7A 1ZZGA 2PY6A 3DDWA 5JC8A 1ODTC 5K1ZA 2QMEA 1J22A 1IYZA 1YRLA 2J87A 3HMQA 3TCXB 1E62A 1NYRA 4GYJA 1UF9A 1N2JA 1VG0B 2BMFA 2O2IA 1BROA 2IPMA 3F6EX 2X5XA 4RV4A 1F6WA 3QOFA 4V02A 3TQIA 3OO0A 1NPDA 3HNPA 2GN4A 5BNZA 3KYDB 2UYGA 4QEKA 4A8JB 2D0OB 1UT6A 3GLGA 1GN9A 2P27A 3KDPA 1S2NA 1RYZA 4KXYA 1KR2A 1XXLA 1X15A 4EYSA 2PX6A 1EDOA 4D4MA 5D5PA 3L8HA 1W2HA 2VCEA 2YNMC 3AUJB 3IQDB 3PT5A 5ICMA 3UZUA 1OFIA 4MZXA 1T36A 3WL3A 1QZZA 2XNJA 3LGXA 2VZ0A 3OQHA 3TDNA 2BCGY 2CHQA 3P8ZA 3PGLA 4WNAB 4F45A 5C0OE 4JJ7A 2I1WA 1N6PA 1NNSA 3G0OA 3I3SR 4FS8A 4EHDA 5J2UF 2QR2A 2DZDA 3QVTA 4O4JF 4PONA 4R0NA 5EWLA 1JN0A 1RWWA 3FMPB 3E7WA 2IWRA 3PX7A 3C1TA 4L4ZA 2REBA 1SBZA 1K8YB 2G9VA 3EXIA 4AW9A 1XNGA 5LP6B 3DAFA 3E5NA 1K8RA 2Y1CA 1PE0A 2N46A 3GWZA 3NTVA 4LYGA 4MPDA 1RACA 2X2FA 4NH0A 4XB1A 2ADMA 5C31A 3TIVA 3E4CA 3JQAD 2XKKA 2P6RA 4XM2A 4CG0A 4G0OA 1SBIA 2CDAA 3PRJA 4IAOA 3OI7A 1ODSA 1OXKB 4D3SA 2OR3A 1BHO1 4UHFA 2BMJA 2QN6A 4QDJA 2NUTA 1MW9X 4QODA 4UATA 3ZEAA 1PJZA 2NYRA 3B7PA 1N9KA 1OVGA 3OIUA 3M9XA 2P40A 3LPMA 3PNSA 2AG6A 3R9XA 1M1YB 3JAMA 2ORWA 3OTHA 1BQEA 1ETUA 1WXQA 1ULTA 1NJFA 3FCEA 5DHTA 4EKDA 3DDOA 5E3JA 2GMWA 3RROA 3DD1A 1JIUA 1LI5A 1P1JA 4IGIA 4UEQA 5I9NA 4J1TA 1XLWA 4DCNA 4M1KA 3CEPB 4PLPA 3E9NA 4OHBA 5ESXA 3Q4GA 2NACA 1B2RA 1R0SA 1PV1A 2R1UA 3KSUA 3O8NA 4KYUA 2RMKA 4LV5B 4XAQA 4G1EB 4FNAA 1J9EA 4D81A 5E2AA 3WAGA 1LSUA 1EB8A 2GT1A 1CFJA 3I42A 1TEHA 3V3TA 2YWJA 4EW2A 3ASVA 1FMCA 3RAFC 2CF5A 1ML4A 2EF1A 1Y8ZA 1Z56C 1H6DA 1OBFO 1T6BY 1FTGA 1QJ4A 1XC7A 621PA 1O7JA 5AVZA 4G5XA 1J2JA 1SY7A 1TXGA 4Y2JA 2I33A 1CZKA 4R2XA 4B2PA 4N6GA 2JAXA 2GPTA 5DHPA 1XJCA 3CNLA 3WFZA 4OHMA 1YKFA 2NIPA 3C4QA 1KHHA 3DVAA 3EGXB 3OFJA 4GD3Q 3KPUA 3HYCA 2NO6A 1VBNA 4QBKA 3L8FA 2GASA 1NQTA 1RT9A 4PXAA 4PG4A 1L3BA 2Y1LA 3O90A 4W9NC 3NPMA 1RWQA 3RVBA 3FPBA 4LFBB 4K9OA 4BNGA 3ETGA 4Q3KA 4IJVA 3QEBZ 1GNPA 1RD4A 2QG9A 2X5JO 3CPHA 1NULA 3EG9A 2YV5A 4IEIA 3RS7A 4AJOA 5HWSA 3A9VA 2JH9A 4BO3A 1XZCA 4DA7A 4EUNA 4PC3A 4DBVO 1IHXA 4IGEA 2XMGA 4IWXA 4RKRA 1HETA 2CYCA 4BLRA 5KYYB 4HLNA 5LMCA 3ROQA 2WG0A 1GILA 4BMDA 4GS5A 4HQFA 4M0DA 2V3WA 4ZOLB 4RA6A 4DLNA 3A1SA 1Y37A 3TOZA 3R7WB 2HDOA 2IVFA 3D6TB 4IO1A 3ZK9A 1OV6A 3IV9A 3AH8A 4H1WA 4JXZA 3CNNA 3F5MA 4L5JA 4NH4A 3AI1A 3FGZA 1KY3A 2A0FA 3REQA 3RS4A 3GCDA 3F9IA 4ZCPA 3SOZA 3HSKA 1GRVA 2EYUA 4L8GA 4COOA 1KMQA 2VJMA 1Y4SA 3MTBA 3HEBA 4GEKA 3LLSA 3UAYA 4IFEA 4A6EA 3MJDA 4DV0B 3TRDA 4EW1A 3C8MA 4ZT4A 5KKCA 1TKBA 3E82A 3ZV7A 4JBLA 4YT2A 4U39A 1FX0A 4E5DA 1XTTA 3CPEA 3G0GA 1IZYA 2GNOA 3Q5EA 4UAJA 4D9NA 1JGTA 3GJ7A 2VJKA 2AN4A 3L9XA 3PEVA 3SNKA 5IEJA 3RTDA 4CM4A 1X80A 2KJQA 1QGUB 3GVCA 3PQDA 3R7FA 1A82A 1YR2A 1L5RA 3TQSA 2PO5A 5AJTA 2XJ9A 4M9UA 1N8TA 1U0GA 2HDNB 2OOSA 1P0QA 4R51A 4CFSA 3FMOB 3IT3A 4X1KB 1FTWA 1WMBA 2WINI 1VYTA 1F8XA 2BL4A 2VJYA 1Q6ZA 3RC8A 2IEZA 5FT9A 2F1KA 1WZCA 3T52A 4LJ9A 1KPHA 1IVYA 2WSYB 4BE4A 2ID8A 2L17A 3KT6A 3SIPA 2GBCA 2O3JA 3U62A 4Q7LA 1FOEB 2AFIE 3BMNA 2ODEA 2PR7A 5BWOA 4TWBA 1CZLA 3EQ7A 4F93B 4GT1A 4AF8A 2Z6QA 1W85B 3DXXA 4GVPA 3KZOA 3HUEA 2QRVA 4DAEA 2ZI9A 1R5BA 1CR2A 1SOUA 4W6QA 1U0EA 2FZEA 1KWGA 4AVYA 1QO7A 3FXAA 3SZ3A 2ZEJA 3FVVA 1LPBB 3CZPA 3TUZC 4G4IA 4QBFA 5BUSA 4UHDA 4JBIA 3FDIA 1NM5A 2V96A 2GZ3A 4Y9SA 3PXGA 1W5SA 5ALSA 1V16A 1XRLA 1UBEA 1RR6A 3LP5A 4FNOA 4Q3BA 3QVJA 2C2WA 3UK1A 3VO8A 4ARBA 3GN2A 5IF9A 5U4QA 1TF7A 3DMTA 3F90A 4N3CA 2NNWB 2OY0A 4K6KA 2HZBA 1Y5MA 4IDHA 3GELA 5A7GA 1W0KD 3KSBC 1UK9A 5BN3A 2QTWB 1V71A 2QW0X 2VEOA 4MEAA 1C8VB 1ZKMA 4PCLA 1RQNA 3BD8A 3EEOA 1BDIA 2VQFB 4LFCB 1M74A 2IXAA 4F5ZA 2YUTA 5EXDA 5IC4A 1B74A 4RK4A 1H94A 3VDRA 1E2BA 2WFLA 2W7TA 3K20A 3EFBA 3UAWA 3OLYA 2J0EA 3DVRX 3K3PA 1LY1A 4UNNA 2QVYX 2YR0A 3KR1A 3KUDA 1KE2A 3NTLA 5H5JA 1V9LA 2UVQA 1VXOA 3D59A 3HN6A 1T4MA 1EBUA 2BP7A 3MCTA 4UFOA 4IJ5A 1IN4A 3L3BA 4M9QA 3T54A 4I5FA 5C1BA 1Z0IA 4BASA 2PZLA 4A9AA 4W1RA 3ZHUA 2X58A 4N3NA 5G4LA 4Z3DA 2XBMA 1UAGA 4AN1A 5F64A 2RHOA 2WJHA 5AQ1A 4R1UA 4IOLA 4KDFA 2BT4A 3JRNA 4LDNA 4UBLA 4FYHA 5TMBA 2Y1OA 5DBEX 1MAVA 1CKEA 2JK0A 3BIJA 5FUQA 1W0CA 4GLBA 2NWQA 3RUIA 3ZHVA 1L1RA 3BIXA 1BXRA 1K3TA 4CMIA 3DKIA 3PNMA 1M7HA 4TN5A 2HF8A 3AEUA 3D5EA 3QYJA 3K8YA 4HVAA 1L7OA 1O58A 2OA0A 2W6JA 3L8YA 1MR3F 5JC1A 4X0EA 4FKBA 3AY3A 4RD3A 4UTZA 1B73A 1QQ6A 4IYJA 4K2AA 2XOKA 1WXDA 3L1UA 4OGFA 5J2UB 4LF7B 4PYRA 3W4JA 4M22A 4RJKA 5D2CA 5K2OA 2IF2A 1VKNA 4D2IA 4D4KA 4BO7A 1DQRA 3TW0A 5AJXA 3MGGA 2VZ8A 4CEJB 1U9YA 3KQYA 4HQ6A 4HATA 4IDBA 5D3MA 4DCSA 2A9RA 4OFBA 4EB0A 4LI3X 1C7IA 1RQGA 1W75A 4GQIA 4DWWA 3UA3A 3Q0EA 2AHOA 5HX7A 1SAYA 2YXDA 1RYFA 3H4TA 2SCUA 2CYAA 2PWBA 2VA8A 4AS1A 2KW5A 5EHXA 2OD7A 3HEMA 3RF7A 1K63A 2I7VA 2O6LA 3UHFA 1NW9B 1DPGA 3WYFA 1QHGA 1EDZA 4L5CA 2RK4A 3HP7A 4BGIA 3BF7A 3QVUA 3IPAA 4YALA 5HCNA 5ALPA 4O5AA 1T10A 3OFKA 4QDTA 3ANYB 4CIYA 3GPLA 2AI3A 1JJ7A 4G5SA 2BGUA 3WB1A 5T5QA 1HPLA 2WF7A 4QM6A 1D6SA 2K4MA 5DU2A 4C05A 3DXZA 3I0NA 1H1LA 5C32A 5JSZA 3EAQA 4ZCMA 1JALA 4J1QA 3DXFA 1ZK2A 2Q4BA 4WEOA 5EERA 3T3MB 4OQYA 2QIOA 2ZJ5A 2X15A 3K8ZA 2ATCA 4QDUA 2GZRA 2NTEA 2HSJA 3O8BA 3ZN2A 2GZ1A 3ZE0B 3V7NA 2RJNA 3IXLA 4C20A 1XEAA 4Q3CA 3W6ZA 1Z7YA 4CF6A 1V3QE 3LUGA 2QYTA 4N4AA 1OIVA 4BO9A 4EELA 3AIKA 3DUFB 4WZBA 1GNQA 2Q4OA 2ZETA 4IVRA 2CXRA 3FKSD 4TGLA 1WKBA 1Q7TA 3A4TA 2KWIA 3DZBA 3G2OA 3JQ8A 4YMIA 1ZGBA 2G3YA 2QTGA 3NVKI 4K2HA 4EFNA 2LXNA 1JQBA 2PL3A 1PTJA 2D5CA 3WRVA 2IYLD 4LJ6A 4BYMA 3IAHA 5A6SB 3DOFA 4TV8A 4ER3A 3AX6A 3CB2A 4US0R 3W77A 1FSFA 4HRVA 4Q3LA 1B1AA 1LVGA 1G1MA 1OR8A 1MO5A 3A4NA 3H8JA 1Q7BA 1X1AA 3FSRA 3Q9NA 1JNXX 3TR6A 4B0OA 4ZFNA 2I4MA 1LB1B 3LV8A 3O95A 3L6EA 1BX3A 4L95C 1XXHA 2ONKA 4IDAA 5IFKA 3P9PA 5F52A 4J0GA 1WOMA 1L8LA 2R5FA 2VBIA 4JS0A 5CTJA 4FZJA 2V45A 3A58B 2VF7A 2M6KA 1PK8A 4F4FA 3CUVA 2Q3LA 1KYZA 3CPSA 3MFQA 3PC8C 4MKZA 4WV3A 4ROSA 4BQFA 2PK3A 1AS0A 3TL2A 2I7TA 2HA2A 5LXTF 4X1OA 2DH6A 2YRFA 4TXJA 5IDVA 1SXJE 3NU1A 4NV0A 3C1UA 3RIGA 3V7FA 2ZTSA 3O84A 2D3TA 1VJGA 1G8GA 1QVZA 2VRNA 3GLHB 4OIMA 1X86B 4TUYF 1N32B 4M88A 3HGQA 4KQWA 4L76A 4BB5A 2OECA 4FE3A 4LDJA 2CUNA 3WIVA 4CTOA 2ZM5A 3OP1A 1YA4A 2C9CA 2QJOA 3A70A 3C6YA 1QQBA 1W88B 2WILA 4RESA 2WUFA 3MYYA 1SFRA 4M8LA 2CUKA 4FN4A 1Q50A 3FYTA 1S0UA 1ILEA 2WIGA 4OP1A 3KX2A 1RDFA 1BQ3A 1FTQA 1GPLA 3BTVA 4OHVA 3RKSA 4B3DA 1DFHA 1HQYE 5BSFA 2VPXA 3HO6A 3VM6A 3JW8A 3O31A 3D8HA 3QPUA 3Q7PA 4E22A 1I7PA 3N6RA 2ZCVA 2HGSA 1TKCA 2H6EA 5BNIA 5KU1A 5J58A 2W5UA 2DBZA 5HIAA 3ELUA 2CEKA 4N41A 1TGYA 3C3WA 3U7QB 4LXHA 3IQXA 1SVLA 2I66A 1I1NA 1X7ZA 2IU3A 3TLBA 4DXAA 1EESA 2INGX 4V0RA 4R7ZA 1PU2A 2QM0A 1W4AA 4C2TA 3MTIA 3MINA 4YPVA 4GR5A 4C1BA 1KYQA 2IKQA 3O1JC 4ENPA 2XZLA 3R3ZA 5DJ5A 2IV2X 4YXWD 4JMPA 1NGSA 2CF6A 4U3JA 3K5HA 2R84A 4Q00A 1KI4A 1UBGA 4NCBA 2PGLA 3HYLA 4NC9A 2PMEA 2VK4A 5BSGA 3SZUA 2JGJA 3AF5A 1IL0A 3MVEA 4RDHA 1K5DA 2CVZA 2IOYA 3G2IA 3KB6A 1JSXA 2ZVPX 3MERA 3PFBA 2XRYA 3QY9A 2CL6X 5CP8A 3BGIA 2IXDA 3M1LA 4MYHA 2H00A 1K9SA 1DIAA 1ZD5A 4MARA 4AP5A 2GFIA 5U4XA 3LWNA 3ZCVA 1VA5A 1WHSA 1SOAA 3BWMA 2FPPA 3HSYA 1PZMA 3QLEA 2VYCA 4MA5A 5AXAA 1CIPA 3F3KA 4MP8A 3GDFA 2O8FA 1GCIA 4OP3A 1EXMA 1J9ZA 4O2BF 5EUQB 5ARBA 3KSAC 3ZVRA 1D2CA 3PE4A 5KYWA 5DISB 3ESQA 4Z1MA 3WWEA 1KBZA 2JEYA 3SG0A 5JNSA 1OXVA 3DEIA 1IC6A 4TLDA 2AFIA 1N7HA 1T4BA 1EE1A 2FF7A 2ZB7A 2FPMA 2AG0A 3AUTA 3ILVA 3P2IA 1D6MA 1FNMA 1VKRA 2AG8A 3D7KA 3EVGA 3MB8A 4I1SA 4YO7A 1O97D 4EO7A 5ALKA 1I2CA 1L4HA 5J43A 5J2TF 3H7AA 2NU6A 1FSSA 2DE0X 2GWHA 1QGYA 1Y3HA 2Z30A 4HWOA 1J4AA 4KMRA 1N5LA 3OZSA 1ECJA 2DFLA 1GR0A 3CRMA 3E5RA 3M2TA 2BKVA 1WHTB 1ZOPA 2VCYA 3NV9A 4QDOA 3W5SA 1P4SA 4XA8A 3FX2A 1KIFA 5BWNA 3W7AA 1QTNA 2PZGA 3FPJA 3JQDA 1YBAA 4N03A 1Z13A 5JLAA 1CQPA 1QMGA 3B6IA 5THXA 4CIVA 3HY6A 4CRWB 4YV1A 5CCXA 4KVFA 1LQUA 2GQ0A 2GLXA 1YFJA 4RPIA 4KEAA 1U9ZA 2VYVD 5DHFA 2PFKA 1ZCBA 3PKIA 5FBHA 5JW6A 4DBZA 1HE5A 3I0MA 3O1IC 3NWPA 3GLGE 2V6IA 3KXLA 2OBFA 3ITNA 3NAQA 5E7MA 1VSVA 2J33A 4YV0A 1DKUA 2GKGA 5KTPA 1GPH1 4RXMA 2CB9A 1RWNA 1ONNA 3EASA 3DBRA 4MW0A 1BVYF 2G17A 3D4IA 4LXYA 3TG2A 1NQXA 4BP3A 4E5VA 5JCOC 3T15A 4C4PA 4G0XA 1XD8A 3ZV5A 1ODKA 1Z26A 2O52A 3QHAA 5THQA 1YI1A 1YRBA 1GIAA 2K87A 3ZDZB 4I5EA 1B7GO 1ORWA 1M2NA 1R50A 3COVA 4G8DA 2D0DA 4RVDA 1U7WA 2ZUVA 1MO6A 3TSAA 3ZE9A 4LCBA 2A9QA 1GXSA 1CUYA 4S1VA 1W2WB 4Q4CA 4XFJA 5CDUA 5AHOA 5DK4A 1T9GR 1D0VA 1LH0A 1JP7A 2Q8QA 3ETNA 3GH1A 3G2KA 4UFPA 821PA 4ZHSA 1WPQA 2QMYA 1KQOA 3O3NB 3PNQA 1EBFA 4JOSA 16PKA 3KV1A 1P0MA 1Z5GA 5A9SB 2ZJBA 1X80B 1Y9AA 2QLLA 3MT9A 3UB4A 2LE0A 4A1FA 2A3NA 2ZWVA 3KP1A 4WW0A 4Y18A 2B83A 4C2BA 3C3CA 4H1VA 3RK4A 5JARA 4LECA 4YV2A 1G6KA 3A1TA 3QEKA 3SHFA 3QUQA 4BVLA 5BW4A 3OOHA 4MYSA 3K70D 2A5JA 3QVGA 3QYFA 3IQWA 1GARA 4P38A 1KWKA 4YP7A 3MLEA 5DCYA 3GRAA 5E6SA 3QFRA 4NCIA 1OIXA 2ZYDA 3TQTA 2J8ZA 2DHCA 4ZEXA 3V4VB 4YLEA 4BVAA 5ALRA 1UWKA 4DLKA 3BMNB 2YRWA 3H5LA 3PI6A 2YCBA 2PJUA 5SZJA 5A06A 3CSSA 3WIUA 5IHXA 4HGPA 1WLYA 4FGLA 3GG9A 1GY8A 3IR6A 4LZLA 3WYEA 3KDAA 3QPAA 4EHNA 5AUPB 2F64A 5DGCA 2X7HA 4CUJA 4YRIA 3WMRA 6PFKA 2NNLD 1USUA 2H2AA 4GWLA 4EA6A 5JATA 3OHPA 1M2FA 2C9ZA 3Q2KA 1S3SA 3FB4A 1Q22A 4XW2A 3W5HA 1BHJA 4Y2YA 3EX7C 3DE7X 1V16B 4RD2A 1RIIA 4RZQA 1XRQA 3T5TA 4L9AA 5DLPA 3ZNOA 2DR3A 4XZ3A 2VPYA 4MQLA 1B4DA 2XHZA 3GJ4A 5HUHA 3ZVNA 1TCUA 1HE2A 4QQNA 1A7AA 1EUZA 4FZVA 1I3CA 1YJXA 1OWNA 3LHFA 5TR9A 3SF8B 5CFMA 5JSUA 1H65A 1NRXA 3QMPA 1JEYB 1C41A 3QPCA 3OX4A 4XKJA 3WJAA 4BQPA 3G79A 1VHWA 3ZHZA 2G70A 5L53A 1LI4A 1PO7A 5CH5A 2PO7A 3B82A 4BVEA 1J0XO 2PH5A 3OQIB 5JYDA 1DCMA 1PD1A 3JQGA 2FYTA 3EHDA 4FQ5A 3KK0A 3CLTC 5LXTB 2IY8A 4FYWA 3MQFA 1VSBA 2I55A 3VSCA 1RFLA 1Z8HA 2IYTA 2OZEA 3CGWA 3E7FA 3WX0A 5JRDS 1PL8A 5BSEA 1ZQ1A 4M21A 1NTRA 2YN2A 4G0YA 2ACWA 2ZYTX 4CV2A 4JAVC 3LHIA 2JLCA 2ZT6A 3ZW7A 3AUAA 3U1BA 1E8DA 2DSNA 1IIRA 1G21A 1JPJA 3EH1A 3F71A 4J1SA 2HOQA 4X97A 3VR3A 1KEEB 2FPRA 1FTYA 2AD1A 5EL0A 3W5VA 3QOYA 5B3KA 3KEOA 1QHNA 2O8VA 1PYGA 4S1TA 5H9VA 2YHSA 3G0DA 3VU0A 1YACA 3P97A 1HA3A 1TVMA 3Q40A 4P83A 1VP3A 2VLIA 1KZ4A 4PC1A 5EKTA 5CVEA 2VT6A 3Q9LA 5C8VA 3FZGA 3E1GA 2CXUA 3DBIA 4WE3A 4BQEA 4YUZA 3U56A 2I87A 3F6SA 3H1BA 2JCBA 4DSZA 3AM1A 1FXWA 5BMVA 2CLKB 2GBGA 1X39A 4NZYA 4OREX 1P8AA 3AEUB 1JU4A 2FX5A 4MITA 2GN1A 2OLKA 2VJPA 2BEWA 5KBYA 4ARIA 4DBLC 1KFEB 1Y8CA 2WKWA 3EXG2 4K6GA 1ENPA 4PM4A 1YDGA 1YRYE 4DQXA 4DIMA 4XCQA 5A5GA 3GAMA 4BZQA 5GVSA 1G18A 1MDFA 2CCJA 4FYMA 4EPXA 3KIPA 1LDMA 1SZDA 1U0SY 2OGZA 1KZYC 2ZDQA 3IIMA 4LSWA 2A6PA 3WMGA 1KPIA 4RABA 1VQ1A 4DRYA 1VIYA 1YDEA 2HEIA 3ZXYA 4AQDA 1Z4KA 3EQ2A 4JENA 1LCIA 1VGRA 1YE8A 2ECFA 3JATB 3O2QB 5C35A 1RHRA 5IN4A 1RXSA 1ZWKA 2BLNA 3FMVA 4J7UA 2H1WA 3UBMA 5F98A 2F3TA 1PT8A 3K35A 2FX3A 2PL1A 2GD2A 2OXCA 3T41A 1KMMA 2AA3A 2EZ9A 2EFJA 2HX1A 3C4JA 4QGBA 3V7UA 2CY0A 2Z3VA 3W6PA 4B71A 3S70A 4GSYA 1YZLA 3S27A 2G5PA 3KUXA 2G9QA 5C3UA 1M67A 1IY0A 4YAFA 2X0DA 2BJHA 5EFOA 2FW1A 3UOGA 1I5RA 3MT7A 1XZMA 3LKVA 4RNDB 1EG2A 5I47A 4A15A 1XEFA 3B3JA 3FGPA 4MVJH 1TOAA 3CWCA 1VFNA 5BSVA 3ZGLA 2Q1TA 2VDWB 3CMMA 1YFKA 5ELLA 1GEEA 4MUXA 3V6LA 5KYKA 5ALIA 3AB8A 4TYMA 1FDTA 3R3VA 3MGCA 2IZ5A 3UJDA 1L7MA 4JT4A 2Y4OA 1G5HA 3RSSA 5B7PA 1D8TA 1G7RA 1ONPA 2HZ7A 3DC2A 4RUKA 1EZ4A 1E0SA 2GXQA 4XWAA 4EKGA 1P4GA 1AA6A 1GPJA 2R00C 1KEPA 4O08A 3KZVA 2O1EA 3UPDA 2OB1A 2QTCA 5KIAA 3NR2A 4CODB 2IEYA 5HRUA 3PEUA 2C2BA 2P2YA 2WU8A 1IK4A 3IUEA 4GMGA 4HN9A 4KIJA 1I4WA 4PYKA 4Q9KA 3BWCA 4PZLA 1JR6A 1DKPA 2AJDA 3EDQA 3M3PA 4JSRA 3OPVA 1W5TA 1TIPA 4ENTA 2C2ZA 3PGMA 4WBNB 4XB6B 2G36A 5IANA 3BPSA 2VCHA 3IYLW 4NI5A 2YNMA 2JI4A 3NKVA 4PYJA 2DEUA 3UK6A 5ARDA 1VM6A 2J5RA 1Q20A 2I6UA 4WX2B 5CNMA 3GLIB 1QONA 3CWZA 4UXIA 1Z4NA 4ALJA 2FF5A 5FWYB 1NBEA 1KOGA 5FCDA 3GJQA 1QE0A 1EXWA 2XJ4A 3VYWA 2GNPA 4IDNA 5AXCA 2ODQA 1Y33E 2PKRA 3UMMA 1V5WA 1IVNA 4MUFA 5CJJA 4PC2A 3PHHA 1BKDR 3A1NA 1ADFA 5AK4A 4OK5A 4BB9A 4PBRA 2ES4A 3L06A 3RRBA 4B85A 2QSYA 4KITB 1OH5A 1A8IA 2CN1A 1TT5A 3Q3CA 4BQIA 3H6GA 4C7OB 3SVLA 3N2IA 3BXPA 2ZIVB 1NUTA 2P3LA 3CSUA 4BXOA 4DNXA 1LZKA 4NBWA 3QLVA 1WKCA 4RELA 1TPZA 3VBCA 4HAOA 2FSVC 1R9NA 4DB2A 3AILA 3QYPA 4DE5A 4BEJA 3SHVA 5TY0A 1S7GA 1P9OA 4N9QA 4LC9A 4RKWA 3KFVA 5KMGB 1VE9A 4I66A 1A88A 4EPYA 5B58T 4DT1B 1CV2A 1JQLB 2OP0A 3A6DA 3I83A 3JYOA 4N5HX 4ND7A 1T5OA 4Q1FA 2QVXX 1Q14A 2VP2A 1E7YA 2RK6A 3ITEA 3K6KA 4AZWA 2BTEA 1UC9A 3C6KA 3KUCA 4W63A 1BXZA 5BN4B 2EKZA 2ST1A 3ACDA 3WQHA 2BFOA 1PJ4A 4GRAA 3R76A 3O8OB 4YCBA 3JARB 3TW6A 3O6VA 4H6WA 5AJUA 4ZI7A 1PT7A 1RHJA 1S2DA 3T5AA 3MMSA 4GBMA 5GWXA 8ADHA 1KA9H 2HXGA 3D8RA 5AHRA 1DTWA 4M49A 1U8EA 2BKLA 4XM0A 3X1KA 1F2UA 5FI1B 1G2OA 3ZWAA 3B3GA 3RYCB 2ROQA 2NUPB 3AW8A 3G8AA 3UENA 3C97A 3QUSA 2R65A 3EIXA 2K5UA 3ACBA 4B3TB 3OPYB 1A4XA 2CZCA 3BMXA 3HNOA 2V7WA 2XSZD 3JWHA 3QW4B 2FQYA 3ZHBA 1H9CA 2VYFA 3PS9A 4JOBA 3PQEA 1GTJ1 5EWJA 3WBBA 5F3WB 2GDJA 3PGA1 1VHJA 2FSGA 4JEMA 4PG7A 1PQWA 2B98A 3D8SA 1W5AA 3HZZA 4RH3A 1T8RA 3KZKA 1C14A 1RYHA 3N58A 2BFBB 4E13A 1Z0KA 1EFAA 4OAQA 1NDQA 2XXBA 3VUEA 5LP6C 3U80A 5BR7A 4N18A 1EFRD 1EP2B 3DZDA 3SBDA 4N0PA 4N8EA 1UXGA 7MHTA 3SBOA 4D0RA 2FJPA 2LKDA 3EQ8A 2E4AA 4KWCA 1PHRA 2NOAA 4MRVA 1DAGA 3DEHA 3LGAA 3R0QA 2FUCA 3EXFB 1ZUWA 1B00A 1QYCA 3OEED 3OVMA 4Y3UA 3LPLA 3JAWA 4IKEA 4RHXA 4W5QA 2EZ4A 1WR8A 1SD2A 2HCJB 2H0AA 3CXUA 3Q6IA 3X0DA 5L3QA 1SB8A 4QXMA 1E4OA 1YL5A 5KX5A 1TUIA 4C3ZA 2GXAA 4E5MA 3MJRA 3BTSA 2ZS9A 1UZUA 3UG6A 3KELA 2B2XA 3LKBA 3ZBUA 2D3WA 2QGZA 1RYNA 4OHXA 3DO8A 1IN5A 4KODA 4FHEA 4KWHA 1CTQA 1O0SA 3G23A 1XVUA 1EK6A 1PUIA 2R8OA 1OROA 1RXCA 2XXJA 1ZDMA 5TEWA 3GLIE 5G4KB 3RH0A 4WK6A 4FIZA 4WN9A 5CVUA 1NVAA 1OBCA 1TO2E 1FYWA 2V5VA 3B8EA 3E8SA 2XLCA 3LK6A 3QE9Y 4JJEA 5TNXA 2XITA 1MRNA 2VUTA 1QKIA 2R3SA 3AHHA 3VNRA 4J16A 4AMYA 3OQPA 2ZIAA 3NOQA 2ILVA 4Z86A 4WEQA 4JJIA 4E2ZA 4LJ8A 4ZC1A 2X6RA 1Y7HA 3PZRA 1H05A 1MVOA 2FG7C 2GFHA 5DZSA 4J6FA 1O1YA 4DHWA 5A4KA 4DMHA 3QBVA 1NZJA 4L57A 1NLUA 4Z7OB 2Q6KA 1G21E 4OLJA 1V43A 3PD1A 2MINB 4QJBA 3V80A 1EDBA 121PA 2HU8A 3KR0A 5IASA 1P72A 1P1BA 1UKVY 2DWQA 2ZITA 3ZLUA 4MYRA 2W2LA 2GEUA 3M5WA 3FJOA 1DQYA 1PK7A 3ILSA 2HMUA 1RWXA 4WI1A 5TT1A 3LUFA 4M2LA 4WTOA 5FAXA 2XRZA 4WZAB 5J5VA 5CLFA 3COJA 2X86A 1YXMA 4WCDA 4EJ2A 4C0BA 1CUEA 1O4WA 1CUHA 1V5FA 4I1UA 1U3CA 3M9WA 5ELXA 2NYUA 2IE0A 2HBYA 1DLJA 4IJKA 3PFGA 3RIXA 4DDHA 2C4VA 3H65A 2DECA 1HDIA 1NRIA 4I14A 5AK6A 4DMGA 1QYRA 4ZRNA 1LF0A 1U7OA 4LDRA 3LFTA 3AV0B 2C2XA 3IV7A 2W2KB 4TRRA 2V7UA 4X92A 4Q66C 3RD5A 1ZK3A 2QN1A 2ZUSA 5CA0A 3OURA 3ZDBA 2HNBA 4DTIA 1ZUNA 3DMTC 4CHGA 2JI9A 3WLHA 3LBAA 3CB4A 1XZFA 1PX0A 4CUZA 3ZS9A 3X43A 3GGOA 5K4GA 1HFJA 1I14A 1LU9A 2ADFA 2RAFA 4MV5A 4ARVA 5LOVA 5B4VA 1QO0D 2RBGA 4WLFA 2CJYA 4CKEA 1P0FA 1X7XB 5ALOA 3U4DA 1E99A 1KZ7B 2ZBQA 1O08A 3E2IA 3X1DA 1W19A 2AC2A 1JKIA 3GDHA 2ATEA 2I4TA 2MSCB 3Q72A 1T5HX 5CX1A 3I9LA 4O4HF 3UICA 2WMOB 3S2GA 3VDXA 2GCPA 2H5EA 3FHOA 4PXSA 4MQUA 3TNFA 2HQRA 2KPOA 4TTIA 1J00A 2AKAB 4P4UA 4CDRA 1UP6A 1YE5A 3OQVA 5CPFA 2R7LA 1QANA 4HB2A 4V24A 5JI2E 4ZYTA 4NU8X 3KDSE 4A0HA 4Y2TA 3SLKA 1C9NA 1M2GA 2IPNA 3L4KA 4D4IA 4ZOLA 4LVNA 3FUCA 5E4TA 3C1AA 1DBVO 3JQFA 3KEQA 2DUNA 1R37A 3HMKA 4KLCA 3SIRA 3SZOA 2IUTA 4A0FA 5TLSA 1F1JA 2YNMD 3OE7D 3C74A 2BUAA 2CHEA 1YR7A 1D1PA 2VS1A 3CEAA 5GJCA 1O94D 1Z5ZA 1I01A 2J3MA 3W90A 5CFPA 1GNRA 1B15A 1NLFA 4E1VA 3SZGA 1OFGA 4DR1B 3G5AA 1Z5NA 1NIPA 1N2XA 1AS3A 2QJFA 3VPGA 4W9MC 5AI8A 2V9PA 1R0RE 3Q9SA 1Z2EA 3ND8A 3AOEA 1GWNA 2QVLA 3IMEA 3PTLA 4D9GA 1QHSA 4WDQA 5JY6A 4OGWA 2CKDA 4FJ1A 2UZ1A 4FCWA 5CMLA 2FN9A 4ARZB 1IHUA 3LECA 5JAUA 4JT2A 4UE3S 3CR7A 3P4UA 3RS3A 4YBRA 1GRNA 5KYWB 2WKQA 2ZUCA 4E03A 5K0GA 4IIDA 3T8YA 4S1NA 3KQHA 2XIJA 1N5OX 1TQ8A 3PWTA 3V00A 3H5TA 3SVTA 3NVMB 1KP2A 3WXBA 1EK5A 4V1CI 3WXMA 2HK7A 1U1GA 4XDZA 1AO3A 2VDVE 4FEGA 1DEAA 5HQ3A 3FOZA 1Z4QA 4QYXA 1X7GA 2RHJA 3KXPA 1P75A 3M34A 4O4IF 4S2UA 3CH7A 1MB9A 4J03A 3BREA 4EYGA 2HLNA 4UULA 4JY7A 4QOSA 3K73O 3K0FA 5AI9A 1E8MA 2X1MA 1DRJA 4BLTA 3IOCA 5DX8A 4RFVA 4G23A 2XI4A 4MHSA 4KQHA 4EQZA 1OH6A 3KXIA 1V6CA 1ZLXA 3AR7A 3CJRA 1W52X 2ZB3A 1EWVA 4M4SA 4MVWA 3MSCA 2Q4TA 2WYIA 5DTJA 4Z0NA 4L08A 4X7RA 4B3CA 2MJLA 1KF0A 3VPFA 5JRZA 1UFVA 1V4BA 2C2OA 3SX2A 3CLRC 3I9KA 2DOKA 4YECA 2P9ZA 3ROGA 5C2JB 3PLNA 1JDPA 1Y81A 4NXMB 1UMCB 4PPYA 3N3BC 3S44A 4UTOA 4MB0A 5JJIA 3NIGB 2VJNA 4L3WA 4ER0A 4Y6RA 1TFUA 1YUNA 3WRYA 4QRHA 3WB9A 2D5LA 3CUEF 2D74A 1VJ1A 4HFJA 3WWYA 2ISSD 3HB9A 1Z6ZA 4CT4B 1CF4A 4YCCA 3DHYA 3PWKA 4CKYA 1YS1X 1N2SA 2C5EA 2PS9A 1JKJB 4X20B 3FDZB 3ANSA 4JVLA 5KB3A 4GAEA 4R05A 4Z0TA 4I8IA 3WYDA 1I7SB 1JQ5A 5EGNA 1QLHA 1IUKA 3AP2A 2AEJA 2CWWA 4K8RB 2JANA 3DO5A 3GNLA 4Q4JA 5JFOA 4E5UA 3SCZA 2VF2A 1SVNA 2ZRDA 3RFXA 2P9BA 3TM5A 3U40A 1DRKA 4CBVA 2E3JA 4MS1B 5JI3E 2I0FA 5L3QB 1ZOIA 3OHMA 2CXQA 4PV7A 3AHEA 4JVOA 4L3VA 4A2WA 1QXSA 4RETA 1RE0A 2G09A 1WXEA 1X1BA 1LW6E 1XCPA 2EKDA 2VDLB 2WDPA 1GT6A 2JVIA 2ZTLA 3EXEA 1E9RA 1Z47A 3HRHA 4L50A 1IM2A 4BKPA 5JISA 4EW3A 1EK2A 4UCWA 1XXHE 3P4YA 1BTOA 2FFJA 2I6FA 4DREA 4E46A 1NKVA 4QXPA 1VYHA 2O0HA 3IQIX 2Z95A 4S3MA 1GGMA 2WU0A 4ZDWA 4MKIA 1FFEA 1MQAA 3R6TA 5IT9A 1T24A 1H0RA 2QVZX 3ROXA 1J23A 2PUVA 1E9SA 3H1PA 2HCFA 4AJNA 4R1QA 2H1HA 1NVGA 4WCFB 3MT0A 3SIXA 1VL8A 5A0VA 4MR8A 4ATNA 2W2XA 2FLWA 3AU8A 1O4VA 4YLYA 1H69A 2C78A 3V34A 1YCGA 1QFYA 2FETA 2VQSA 3H9JA 3JQQA 5EPEA 1R8YA 4TUYA 4GL2A 2UYOA 4UHHA 1ENOA 3DMDA 3HJFA 1X70A 2FFRA 2QMOA 4ZOLF 5TSDA 4OGKA 2IBTA 3KKMA 2PVPA 4IL5A 4LY9A 1UBJS 1VMIA 5DEOA 5G0SA 3D6JA 3KKPA 4A0GA 3UV6A 1KYWA 3UW1A 1IWPB 1KZ1A 4E30A 4EY7A 5I7RA 1Q1EA 1GOTA 1MGPA 3SQLA 1PR6A 2C97A 3VC7A 2JG3A 1G8HA 4NJMB 4PQEA 1PJ8A 5HF9A 3GLGB 1HUQA 4KO8A 4RPHA 1NFQA 2EC5A 4AKIA 4JH0A 1U2SA 4BBZA 3LP8A 5JO0A 3AC0A 1FB5A 1NOJA 2HA5A 2I1LA 4XI9A 4UVIA 2WTEA 3IHTA 4XQCA 4BNHA 3KT3A 4CKWB 2ZRMA 5LU9A 1TU0A 3WV4A 3ZWMA 3DZKA 1E79D 4UEWA 4R0VA 2BDUA 4TSFD 1YQTA 2YICA 3KZMA 4ARSA 4CVNA 2IS4A 1FDIA 3UWOA 3PG5A 5LL6P 1J8FA 5IULC 3SFZA 2XYPA 4B47A 4E88A 4M9RA 2C96A 2PXHA 3GMIA 4DVGA 2BW0A 1XJ5A 2J3KA 3MXTA 4KYVA 3NUQA 1SK8A 3GEPA 3IPXA 4U7PB 3F7NA 3SI7A 3ZJ5A 1EYZA 1I1OA 3I76A 1W76A 2PXCA 2Z08A 3IPYA 4UBJA 4M1QA 4XD7D 3VR2A 5IXSA 4OMDA 4R5MA 3AERB 4OGLA 2B4TO 1A2OA 2PZEA 3WAJA 2G25A 2AG1A 1BGXT 1NHWA 2B6HA 1YFZA 2AR7A 2IXGA 4HF7A 1E2IA 1LTQA 1XMPA 1YE3A 2SECE 3IE0A 5C4GB 1VIVA 4HDQB 1OC2A 1M2VA 5A05A 4AU1A 4PLVA 1I94B 2H1SA 4EY4A 3GIDA 3KLNA 4HCJA 3DPIA 4WNCA 5EIEA 1HNZB 1JAXA 5BQFA 4I9NA 5EAIA 1E3DA 1ODJA 2HJVA 1PGJA 1PN3A 3JZMA 1U5BA 4JJ4A 4OBEA 1SKBA 4NZNA 4RS3A 5AM5A 3D4BA 3GRCA 3IDZA 4YI5A 4CLRA 3P9YA 4I46A 3TLXA 2RAVA 1XFDA 1B0UA 1ZEJA 2FFBA 4H0FA 4LYDA 1QU2A 4E7OA 2C3OA 2XQGA 3QBJA 4Q48A 5G41A 5LVAA 3B12A 4DFDA 2QUHA 2D8AA 1SCIA 2NADA 4JYAB 1EZZA 4YQYA 2Z2ZA 3C8DA 4XYEA 2M1ZA 3I2KA 1F38A 3O8QB 4U6SA 4X44A 4GP7A 1OLSA 2G9ZA 5DH9A 5FO0A 3GRRA 4WFJA 2I2CA 3LMKA 4MB6A 1X7YB 2R96A 1N2CB 2YV3A 4BFSA 4YYZA 1UINA 2YS6A 1KVRA 3QIVA 4RSGA 5FFMA 4ZVRA 1GAWA 3QU5A 1QGZA 4F84A 3OZVA 4E1AA 1YUBA 3M83A 1U2GA 3IUNA 3PCTA 3LA6A 2CNWA 2Z3ZA 2WV7A 2GD1O 4IFTA 5FBWB 3OLWA 1YASA 5EIXA 4O3MA 1JG4A 2H16A 4NCNA 4PLYA 4P0PB 2A3RA 2FPIB 2Q6TA 3QX8A 3ZU2A 3N0VA 3QK7A 4R8VA 4M0UA 2GERA 3GGCA 4U8GA 4W7HA 1YI0A 4OJMX 1JL3A 1ZMBA 3OF2A 1GAXA 1U6IA 1DIOB 5KC9A 5HK9A 3HJTA 2FA9A 3S2FA 5FV4A 1TVCA 4J94A 4Q12A 1FL9A 2XUJA 4I4CA 1Q2UA 1QS0B 2R1VA 3BYZA 3NHAA 3VZSA 2FQ1A 1AJEA 4MVCA 2O4CA 4P98A 4IY1A 3WK7A 3WSTA 1AKUA 1J6UA 3K8QA 1L5WA 1ZWLA 3X2EA 4RJTA 4BGDA 1U3WA 3R3HA 1B93A 2YQ4A 3GFTA 2O2SA 2COKA 1VKJA 1CY8A 3L1HA 2O0MA 3L7JA 5IABA 1T0IA 3ERCA 1YZTA 3PA8A 4IR7A 4L9RA 4TMVA 2HV8A 3P9XA 4G4JA 2PR2A 3TZCA 2ECOA 2IC5A 4R2KA 4UUPA 4AQ7A 2JIPA 3I1YA 5CTAA 3RRNA 4WHMA 2Q7OE 3F97A 4NE9A 1F0YA 1TKAA 2P2LA 5DBHX 1B0PA 4BNNA 1TAUA 3M4XA 4NOLA 1KZGB 2CFRA 1FRZA 3V8MA 1U3FA 1PX2A 4U9HS 1E8NA 4TKVB 1IU9A 2Q4EA 1KGDA 4CU5A 5GJBA 2JGEA 3QTLA 4MZDA 2BMEA 3G02A 5CGQB 4ZVNA 3L79A 3WNZA 3GXOA 3Q6MA 3FE2A 3S3TA 1BCRB 5LIPA 1KR5A 1XCOA 3DH0A 1QP8A 3LI2A 1WQ3A 4ZEMA 1DFGA 4DNQA 3K0CA 3EF0A 4BNFA 4HEA1 4Q5IA 5H3LA 3A9RA 2KYRA 3IXMA 5JANA 1POXA 3GRPA 2HBRA 3NDRA 4E5YA 3KETA 5B4TA 5DM1A 1OFTA 3RG8A 4P80A 4XIGS 1I3OA 3SYKA 3HXTA 4CMGA 4WZAA 5F2KA 1P73A 4EG3A 4R84A 4Q3AA 1PW5A 2TYSB 5AVQA 3B7WA 1FFAA 4GMDA 3JCZA 1EFLA 1Z5VA 2QKYA 2ZUDA 3FFXA 1FBTA 3IT0A 3K09A 3K8OE 4J0HA 4JZKA 1EX9A 5P21A 4M54A 3TJRA 3VPCA 3K92A 2YXPX 3L41A 4KMSA 3IHKA 1DC5A 1L4YA 5B3JC 5ER9A 5A4IS 3QX3A 4Z1OA 4PQYA 5FTKA 2HN9A 3V1LA 4F4JA 3K53A 1KYYA 3UWMA 4WLOA 2RI6A 1C3OB 2ZR0A 2VZ9A 3QTBA 1IZ8A 1DUSA 4KNWA 4W99A 1FF9A 4B09A 1GLVA 5A6VA 2CV0A 1IY8A 2XLBA 2N42A 1JAHA 2POCA 3WLIA 2QGFA 3KR9A 4E4YA 3E9RA 3R7SA 3TKLA 1NIJA 4XIFA 5EJFA 5E6RA 3ONDA 3IP7A 4OFWA 4KH1A 2QL9A 1GL6A 3P5SA 4NNOA 5AKIA 4ZAWA 3ADBA 3KVNA 3NBKA 3RVPA 5AD1A 1AVTA 1YR3A 2XR1A 2Z98A 3CU5A 4ZYLA 4JP1A 5HZKA 1U9JA 2P0YA 5FI0B 2LDXA 3ZXXA 3BMCA 1NPTO 5FR1A 1BEZA 1D07A 5L3ZA 2CVPA 4CDMA 5JDIA 3V48A 3ZLVA 2UUCB 2BEVB 5COBA 1E60A 2NSDA 3KKKA 5NULA 1JQDA 2YOHA 4HC4A 5B7QA 2XB2A 1U99A 3PLRA 4YMGA 3MD9A 2JAQA 1E9EA 4GQAA 3QX9A 1SUBA 1JEDA 4B3IA 5BYKA 5JYBA 3ZUPA 2L82A 5EWJB 1DKNA 1ZVMA 1K6XA 1N5IA 2WPNA 2QNIA 3IP3A 1E1QA 1EKXA 4BE7B 4DLAA 3U61B 4Q7QA 1FW8A 1JMKC 4RYLA 3CZMA 3P45A 4V03A 4ID3A 4JODA 2BFMA 1ZNYA 2IOFA 3P2YA 1MV5A 4GWGA 4WK4B 3WSWA 1BKSB 3SQNA 2ZVQX 5LJLA 2WG2A 4EG7A 3IH5A 1GA6A 5L6LB 2E48A 1K4KA 4G09A 2XT6A 2OM2A 2VRCA 3WQQA 1R18A 3O8LA 2PXXA 4I6EA 4RMGA 4IRMA 4ZQHA 3BZUA 2KHZA 1SMKA 1ZOSA 3BK1A 4LHXA 4QAJA 5AKJA 2JK1A 4I19A 1Z82A 2ZE8A 4RKYA 1YS4A 4TWRA 1X74A 3LCUA 3GPCA 3I12A 2WSSD 1G20A 3WLEA 2A88A 4C0SA 1M6EX 2CKMA 1II8A 2WF5A 2YZGA 2FMFA 1ZRSA 3TAHA 4PNEA 3J7AC 1Z4MA 5LUAA 1OB5A 3H1GA 1L7VC 1U8ZA 1XO1A 4WN3A 4DEXA 2CDCA 2PLRA 1V1RB 4GL4A 4MRPA 5AW9A 5JDIC 1Y7LA 5JD6A 1ENYA 4EB3A 2ZZNA 5DNAA 1WPRA 4Y98A 3TKAA 5DTIA 3WQSB 3JYNA 3AETB 5JWOA 3C48A 3BD6A 5LLTA 4KNYA 2FRDC 3WDMA 4D46A 4Q7JB 1Q0LA 1TGVA 1CVRA 3O9VA 3OM8A 1G5IA 1IONA 4MMXB 4OEHA 4H6XA 5EJGA 3ZW9A 4AUMA 3CT6A 3UHJA 1AC5A 3CZQA 3L7KA 4A03A 1PVOA 4CQJA 3WGTA 4GSKA 4WY8A 1UQTA 1H85A 5F78A 5CB8A 3CVYA 1HLGA 4P3YA 1G20E 2PZKA 4P2BA 4NBSA 2FB9A 5ENDA 3ZLBA 1G0NA 3ZQ6A 4CJXA 2YVAA 4EG0A 1CY6A 3LS2A 1MUUA 4G9GA 4QUEA 2YYYA 3F5DA 3HL0A 4HNVA 3X2FA 4QEDA 1V5IA 1QWSA 2JHGA 4YV7A 4J49A 1MB3A 5B4UA 1M2KA 3GNSA 3SS7X 1RPAA 2OK7A 3V8QA 2EW8A 2BMDA 1J56A 1X3SA 4AX4A 5BNWA 4LK2A 1W36C 4XJXA 4JLUA 4H35A 1KVQA 4G41A 2RHRA 4WKOA 3DHWC 3P9CA 3TM4A 5AKGA 4MWTA 2BR5A 4JLWA 1O2DA 1UANA 4POAA 4A2PA 4CF4A 2QQEA 1QIHA 2PRZA 2Q5IA 3DUFA 4PZUA 3EDCA 4XGRA 3TRKA 5B36A 5KO2A 1WZEA 3I23A 1JTFA 3Q85A 1TJ5A 1JR3D 4RHTA 4B4DA 3PWZA 1DAHA 1HI9A 1W9MA 3G6KA 3QKIA 1FX1A 1Y34E 1D2AA 2MTBA 4K9LA 1DTEA 1MQ8B 1XF1A 2W6OA 4QARA 1HWYA 5FI3A 1VG1A 3O2SB 4D3FA 1MIOA 1Z0ZA 4NCHA 1WETA 1RMYA 3NBQA 3Q2OA 3H5AA 4G1MB 4JK3A 1DXOA 3EISA 3IKLA 5K8IA 5JNLA 1BOFA 1X7XA 4TSRA 2CJWA 4TWJA 4AYXA 4D6PA 2XUQA 5DLQC 3LCMA 3ZZUA 1HX7A 2PWZA 2BSQA 1U2PA 1MX3A 5IDYA 4HMPA 1CX9B 2LBPA 2VC2B 1YQWA 4KN9S 3TZLA 3WOVA 1NLZA 4F2DA 4MDFA 1NVMB 4FQ7A 2P5TB 4Y2RA 2UVPA 3CONA 2ODAA 3NC1C 5DX0A 2VH1A 2P67A 2HLDA 5HRCA 4GPTA 3UJPA 3PXXA 1H42A 1Q1AA 4WXYB 2JAHA 2H2WA 3HJCA 3L40A 1VMEA 1OTHA 1OX5A 5FL7A 4MRMA 4AWAA 3LDUA 5MGBA 1XPRA 2XE4A 2QRJA 3J81k 3NHFA 1QS0A 2IUYA 2CDNA 1XQXA 1AQ6A 1FUKA 2R1VB 4Y1GA 1NMQA 3N6VA 4CL3A 5HSGA 1I6LA 4K6HA 4YGYA 5KSOA 4YJDA 2FWMX 5COQA 4AKHA 2XQIA 4LBVA 4Q3EA 3E22A 4WACA 3G0HA 4MW9A 4DN6A 3IJPA 3WG9A 2HA0A 1DG9A 2PT7A 2ZAMA 1L4BA 5FFNA 1C7EA 1U2QA 2GRUA 3A7DA 2N47A 3HGTA 1RLIA 1SQ6A 4MKGA 4P53A 2XKAA 2P7IA 5C34B 3TWOA 5FUWA 3HG7A 2IYUA 2R5NA 1WB5A 2G5CA 5TE9A 1XCJA 4P58A 5HIJA 2JFWA 3OY7A 4MUBA 5CJPA 4A6DA 3IAM6 3QXCA 5J4HA 1SKYE 1E3WB 2FY8A 3BGVA 1NC3A 2OEPA 2OHXA 3Q2IA 1Y8RB 3EE6A 4OI4A 2AMYA 3RPEA 7AT1A 1X7ZB 4TKLA 5TV2A 3L7IA 5FA5A 2JNWA 1AT1A 4JUAA 1R0ZA 1BVRA 3E4DA 1QTRA 2XZDA 1EHIA 1V35A 1CUAA 2AWOA 3N8HA 4LC1A 4JDPA 1ISMA 3TXXA 1OB2A 2R66A 4ZVLA 4YUYA 5CB4F 4PSVA 2X9LA 1DOHA 4Y7CA 4MR7B 2Y77A 4MCAA 1ZYUA 1MAHA 3PKZA 4LE2A 3TB4A 1YAHA 4IICA 2JJMA 4LHVA 3TIGA 2FCAA 1MDBA 1SD5A 2FZ4A 3BXZA 3VVCA 2CNBA 1X9GA 2GPAA 3BXGA 3OOEA 3V8PA 1DARA 3BSWA 4BLSA 4KI7A 3OPXA 1U0FA 3QXHA 2IU6A 2UYHA 1Y42X 3D6FA 4YRFA 2E4WA 4XVHA 3I8XA 2WKSA 4WT7A 2ZU6A 4G89A 2QTLA 2XTMA 2OYRA 1DCFA 3K0KA 1RJDA 1ISFA 1R5OA 3MTGA 2IEBA 3OTOB 1Z68A 2ZI7A 3FDXA 2C84A 4WZ6A 1SU6A 3TAXA 3BIWA 1KFCB 2BGNA 3ORRA 4IIEA 5E9AA 2G1KA 5CBPA 2IU4A 1NBMA 3V4SA 2CUZA 1E6LA 1ZMXA 3UB3A 8LDHA 1FS4A 1QCYA 1JYSA 4UMVA 2QF7A 2D2IA 2ODWA 3HJAA 3ZIAD 4KUGA 5K0BA 1QE3A 3NLLA 4X54A 5AW4A 2X9VA 3FVTA 1LV8A 1Q95A 3I6BA 3KLOA 2Q6IA 3F6PA 1MD9A 2NTVA 4OXQA 4U2BA 1PS8A 3LOUA 2HJ9A 3R77A 3WLJA 1JJVA 2I3AA 4A36A 4X7BA 4BECA 1P17A 1TJ4A 4HWTA 4PZDA 4AZVA 5KWJA 3O1HB 1NR5A 4ZJUA 4JI8B 3W5CA 3K30A 1P1FA 2ZI5A 1IOLA 3C7CB 1BEUB 4KQCA 3ZKWB 1TADA 5JROA 4QC2A 1JR3E 1O9BA 4QDXA 4HY3A 4E11A 4EPRA 1FFWA 2HF2A 2J0UB 4ON9A 3EGDA 3W2TA 2ENWA 1TE2A 4UEJA 2Z2YA 4Q4AA 4LHWA 5JAPA 4HK4A 4UDXX 4QQRA 2HDWA 2BI8A 3ESCA 4BBPA 5ECDA 4KDRA 4KRYA 4LYHA 4UUAA 3K9GA 2QR5A 1ZHHA 2HH9A 2PPLA 5A4AA 4WJLA 1OQAA 4M9XA 4CDNA 3WLAA 3H16A 2J5BA 3ET5A 4MICA 4RK6A 2XYQA 1FXSA 4ETNA 5B6JA 2Z5LA 4P3XA 3WK8A 4LRSB 3KTDA 1NSFA 2Z5VA 1JXMA 4LMBA 3T9CA 1BHSA 1RJWA 2J5QA 1BJTA 4ZOBA 1IXZA 3QWBA 4IKOA 4NJOA 2FEKA 2GHIA 5C8YB 5CEEA 2ACKA 5EJ8A 1UH5A 4IIYA 1GZUA 1DPFA 4OQFA 4XRRA 2H2DA 2JGIA 5M34A 3MTDA 4OU4A 3W3ZB 1XCMA 3VAZA 1PL0A 3KPYA 1MTOA 2PYIA 3I28A 2CWDA 2Y0EA 1ZNWA 3ND9A 4QLOA 5T64A 4DR5B 2FRXA 3L9WA 2XCQA 3OWXA 4JA2A 4ZP1A 2YJNA 4U9IS 4YONB 5IVDA 2OQVA 3FPGA 3H5WA 3WHKA 2RAPA 5CM2Z 4D80A 5FNVB 1W36B 3L8EA 4IF6A 1RLOA 2XOXA 3PR3A 1F7UA 4FOLA 2ZJ6A 3DM5A 5SZHB 3IQEA 4ZQFA 1J5EB 4PYNA 4D3DA 2FFAA 3QNWA 4W8OA 3TZ6A 4LQ4A 3OFND 3RUFA 2I2DA 4ZJPA 1TYEB 3AHGA 1R9GA 3P9IA 3D0RA 3THYB 1CP3A 2ZIEA 3U1VA 4B5KA 1OPRA 4GFDA 4FDLA 4BJ5A 3RT7A 2MSLA 3C87A 3KKLA 1GUAA 4IGKA 3OG9A 4R2IA 4CMJA 3V8RA 1JIVA 4OMUA 1F4VA 4ZD6A 3OSZA 2XWJI 2X9QA 1NG1A 2IYSA 3PITA 4WLUA 5E38A 2ZP1A 3KLPX 5LDDC 1VE7A 2RGUA 3EWAA 2WT8A 3RQSA 3SXUA 3B36A 3L01A 3OC6A 5NLLA 2SNIE 3S81A 4HAIA 1R6DA 3RIYA 2EVWX 1J5PA 3ORSA 3WNBA 3N07A 1ZIOA 3NCTA 5EIFA 3FLBA 3FROA 4X41A 5JADA 1CY1A 1RM4A 1QYWA 2PIAA 5ENVA 3THWB 2WFZA 1M0TA 5EP4A 4TTSA 5KX5B 2O2DA 5BRAA 3RYIA 1KMHB 3Q3JB 1XK7A 2QK4A 2P68A 3HR7A 3HKDB 2UUBB 1CDEA 2JFZA 4E5SA 1JH8A 1KDRA 1W1IA 4RVFA 2JIRA 2IH4A 3R3YA 1DEXA 4NL4H 5K0TA 2VYNA 4Z5XA 2ZWPA 5CVTA 1U7PA 4EA7A 3VKGA 1PSWA 1TA9A 1CF2O 2WZQA 3B1YA 2GEDA 4ILEA 3E3MA 4JYCA 4X7MA 3Q3HA 1TC1A 2IF0A 3CR8A 3CW8X 2W9XA 3N2NA 4B7AA 5ALYA 2IEAA 5CK4A 2NUBA 1GYPA 3H42B 3IUSA 4URWR 3R4CA 1W1WA 4JASB 4EYQA 2HCTA 4JYMA 1OA1A 3LZDA 1IVSA 1XZ8A 2BGLA 3MIIA 1LSSA 2IX3A 2X6QA 2OG1A 1YQGA 3JALB 3FNQA 3CV3A 3DL7A 3ORFA 1OI4A 3RTEA 2WI8A 1ZBQA 1SCQA 1WMEA 3H1FA 3FCAA 1OZFA 1Q44A 2ZPUA 1DQZA 2BHSA 2BMVA 1CWUA 2PKQO 1IN6A 2H3EA 2JS7A 3L7DA 4MO9A 2C4WA 3FCXA 2HPZA 1EFCA 4HG2A 5KMGA 1YUMA 2VRBA 4TOIA 2YH2A 4XWYA 2QD1A 2I78A 4DIOA 2AN5A 2ZIFA 3HDGA 2A0YA 3D6HA 1RXUA 4YRJA 4HGQA 3HE3A 5INTA 1XQYA 3HKBA 5TPWA 2FPIA 2QW8A 2W4QA 1SU7A 3O8OA 2H4WA 1UPXA 5D7NA 1ISGA 1DBPA 4BMCA 3RRYA 4DXDA 1E1CA 1OFVA 3GFVA 3ZY3A 1NBMD 2GUWA 2Q5EA 3C43A 1CSEE 3O3MB 1EVJA 2D62A 1EM6A 4J0CA 4MGEA 4ME6A 3W2EA 4U2DA 4X64B 5LN1A 4KQGA 1EJ2A 3RM3A 5LOVB 1EVLA 1N1GA 3DNMA 1F2DA 3FCYA 3CIOA 2C83A 3V7WA 5KTMA 3TTTA 2P9FA 1OXSC 3VPXA 1D6NA 5BOSA 1MABB 4B3HA 1RKQA 4MS4B 3IUBA 2QUAA 5CFZA 3P2JA 4EJSB 3W9SA 1OI7A 3OH8A 3PNYA 4IJWA 4U4AA 1QZTA 1MC8A 4YAJA 2Z43A 2J3HA 4WKNA 1R0KA 3OLZA 2RGDA 4EQ6B 2PSSA 4Q4DA 1H2XA 4EKIA 2LUOA 2PRIA 5IUJC 3HBJA 4GI5A 1HLPA 3C3XA 1OH7A 1JJFA 3EPPA 3ZZ1A 1YGYA 2PLFA 1JA1A 1LFAA 4ZVKA 3USZA 3CZRA 2EL7A 4D8UA 1DAEA 3WLMA 2J85A 2XCIA 4U7HA 1SZPA 2OHHA 1MPTA 1Q0HA 5JZSA 4JVSB 1P8JA 3L7NA 1D0IA 1VXRA 4H4EA 1XA0A 3MSXA 1IPHA 1BW9A 1XUOA 5JIBA 5JSHA 2BUCA 3PNOA 3ZZTA 1I8TA 1I3MA 1G5FA 1A04A 1KAHA 3COWA 3FWYA 3LQFA 5EG5A 1YVDA 2F55A 4BTVA 2J1LA 4HDCA 3I2IA 3AIOA 2C2GA 2RJ3A 2VT2A 1NJ8A 1JG3A 4DLXA 1R10A 3E3LA 3VDNB 5KOYA 1SQSA 3TIXB 1IDOA 5EJMA 3ZLJA 2JFGA 1WMDA 1RQ7A 4CFZA 2JZNA 2RKOA 4Y9TA 2OBMA 2XTNA 3IAUA 2JRCA 1ZH4A 3MF4A 4LC0A 5LDGA 2H11A 3GFRA 3SFTA 4AY5A 5FDFA 5IJWA 5EFZA 1T8SA 5FBZA 4BRUA 5IRCD 3HJBA 4IO0A 5TT0A 2XMCA 1WCYA 3FYUB 3H97A 1VB5A 2JLUA 4HFMA 3JD2A 1J8MF 2PA3A 3M4YA 2Y6UA 1IZ7A 1DJNA 4GOMD 1L5QA 1YR8A 4XGNA 1LPAB 3RS8A 4BTLA 3HA7A 4YRMA 3AIIA 3UAGA 3LBNA 3LUAA 1HFKA 4NBLA 4RPKA 3CZ9A 1F2TB 2WKPA 4MA4A 1XZGA 2VAVA 4OBWA 4F2WA 2VJQA 1KORA 3BRWD 4XTRA 4BO2A 4I55F 4JB2A 4Q24A 3ZGOA 3U26A 2CL7X 2F2TA 1E7MA 2OILA 4BO8A 4HP8A 2WIAA 2FMTA 1D04A 3RKUA 3N0TA 2CNOA 2PWYA 5A3SA 1FLAA 1RVV1 1E5QA 5FA6A 1NVFA 4BNVA 1QVAA 5T4BA 1EUYA 5I8ZA 4ZOCA 2BKXA 5ES4B 3PEWA 3S8MA 1WUIS 4O1IA 3UT5A 1FFHA 1IHDA 4D02A 3EVDA 2G1AA 2W4IA 1Y3FE 3C98A 1J06A 1TL7C 1MH1A 1XCGB 3FMIA 1ZX1A 1JLRA 4K9NA 4WJZA 2HF7A 5G1OA 4OO3A 1A8HA 1D2EA 2NZ2A 3C7AA 1O95A 1SU8A 5CB0A 3HA2A 1TIBA 1TCAA 4RA9A 4RQUA 2B1GA 2WJWA 2ISQA 4X1YB 4EHJA 1BOOA 1L4EA 3ADPA 3FOCA 1JR3A 3N7TA 3PDIA 4LDPA 1RRGA 4ZARA 5FFFA 2HU5A 4GX2A 3ZE1B 1GDTA 1N9ZA 1I4TD 1YVPA 3LD9A 3JAKA 3HXLA 3T1HB 1EFUA 4TVKA 1S8AA 4DY4A 2CB0A 1YHNA 5CDTA 1X7HA 1KMCA 2HF9A 2HSGA 4REMA 3UCXA 3S2IA 3I8OA 1XALA 5KVVA 2QE7D 1N6HA 2J32A 2NO7A 3DUWA 3FKQA 1D03A 1KY2A 1JAYA 2JFYA 3IFSA 4I4NA 1G4UR 3D3NA 4N49A 4O0MA 1R1DA 1U1CA 1EJBA 1W46A 3O4HA 3OLXA 5GOTA 3ZKAA 1J0DA 2B1JA 3DULA 5TJ9A 3WL5A 3GLFB 3D3EA 1K75A 4H6PA 1SQ0A 5K05A 2VJMB 1NXVA 3LIPA 5CX4A 3OCJA 4C30A 2C03A 1Z33A 4C5AA 1VIAA 2QP4A 3ZCRA 2GAIA 2G82A 3EXHA 3ER9A 1TQ6A 1UXKA 3DT8A 2G1PA 4HB0A 2AK2A 5FBLB 3BWEA 4X6XA 4XSHA 5F51A 2A5DA 3D4LA 2PUBA 4FR5A 1KI9A 3C2QA 4MUJA 1XU7A 3AJDA 3VZDA 1Q16A 2H9YA 2PUJA 2Y1XA 3FA2A 3QVWA 4IEEA 5HDQA 3JVEA 4DMFA 2Z9CA 1JFRA 2WWFA 1JEEA 1HOTA 1WQ4A 2IDJA 2ZYGA 1KJZA 1X8LA 1ZN8A 3ITDA 2P4EA 1MFPA 4JI6B 2HK6A 5A3VA 4BFTA 5BMVF 1F2UB 4MNTA 2UZ4A 4G0ZA 2R8XA 2QLJA 1SA0A 4TKUA 5AO9A 4JQSA 1ST2A 4R2WA 3SM9A 1IUPA 4OXYA 3CRQA 3PHBE 5BV1A 4NOJA 1E1MA 5LWQA 3GJXC 3GRFA 4ZQCB 2M2IA 2PQ0A 3R8CA 2C0PA 4BCCA 4BCBA 4BX3A 3RADC 3I5AA 4C4TA 1ONBA 3B9QA 4K1XA 4IIFA 1JHXA 3H5OA 3O7WA 2G7MC 4R16A 5FADA 1EINA 3CFYA 4KXQA 4EMSA 4R1MA 2RHGB 1S7CA 4D8YA 1NVBA 1CUIA 5DBFA 2VUUA 2GNAA 1M2OB 1LPPA 4LHZA 4C7VA 3BE4A 2JDIA 2AXNA 1TCVA 2UZ1B 4KDCA 5CYGA 2QD4A 1K88A 1U3UA 4GKAA 1MKYA 4JN6B 2WHRA 1PYOA 3H2JA 3N2LA 4EI7A 3FHCB 2IUFA 1V1MB 3FPAA 4FC7A 1UMBA 4M0MA 4LZWA 1G5QA 3B5JA 4MR9B 1HDEA 4KX5A 4NJMA 4EGSA 1N0IA 1YQUA 3PYMA 4CV3A 1GQSA 5UKDA 5EY5B 4BS9A 4EGFA 1ZGJA 1JECA 1INLA 2HJGA 3NGMA 3I04M 1V3UA 2EX1A 4PWZA 5ALTA 3EMDA 3JSXA 1EGAA 4RY0A 3EQ9A 2YZMA 4MIYA 4V38A 3KQWA 5KDDA 2CDRA 2F17A 2V7GA 4KGXA 4EA8A 3JZAA 3GFFA 5DV9A 1QGAA 5LD2B 4KH0A 1TFRA 3K9WA 2BGMA 2GN6A 2Q46A 3H18A 1I0IA 3OQBA 2QDXA 4LN1A 4PAQA 4Q9DA 3GFBA 4Q9LA 1EM8B 1TX4B 5FLKA 1PR1A 1V26A 2BY4A 2G88A 2XUDA 1UPFA 3TX2A 4B7XA 3LTNC 2DETA 3E81A 3OD5A 4AROA 1Q17A 5TXGA 2QNRA 3ANNA 2BCEA 2CK3A 4M9SA 3RBAA 2WWXA 3QXJA 3OMLA 4QKQA 1QM5A 2FW6A 3VNAA 3DG9A 4W82A 1G17A 4H7DA 4P4NA 1J1UA 2XNCA 4K9RA 1ABEA 2E4ZA 4PPFA 1E3QA 3AUYA 4TL7A 5AM2A 3A4MA 4FSDA 5CYOA 5A5EA 4X8OA 1RSZA 4L74A 1K92A 2J6HA 1P3DA 2I6XA 2VJDA 4ML3A 3WGGA 3UC5A 3VJRA 3CM0A 2AG5A 5C8YA 2V6MA 5KC8A 5CXQA 3TQQA 2MSWA 3OQMA 4KVAA 2A5YB 4ZVSA 1QHHA 4ZDJA 5AW1A 2FSHA 2ZJFA 2ENUA 4ZPXA 2FQWA 2GF9A 4RY8A 1PHPA 1PJLA 1QAMA 3HP4A 5B3JA 4P7KA 2ZG6A 2XE7A 4NY1A 1GL9B 4CQMB 5DT2A 1JLSA 4HXEB 4U5XA 4ZPJA 3HFSA 4PC6A 2R0QC 2PBRA 1DBSA 4JLVA 2XMPA 3LO5A 3ON5A 2JAOA 4HUQA 1WO8A 1DWQA 1WUTA 1FDWA 4JBNA 5BXQC 3LVBA 1ZXLA 1P45A 4K81B 3F3SA 5BWBA 2D5BA 1C30A 2AXEA 2QTBA 3JWEA 2OCPA 5ICGA 3SS9X 2F6RA 1M72A 1P7ZA 2V7BA 3NYQA 3RGWS 1N2CA 3NT2A 1V2GA 1QPZA 1V45E 1L3CA 3DBOB 3FB1A 1GA4A 1TD9A 4ZI5A 2IRWA 3ZD8A 4BY9E 4RULA 1Z6AA 5T6MA 4EUFA 1YJBA 5I9BA 4MLCA 3FHLA 4PF1A 2QRHA 5IBQA 3FOBA 1VIDA 2BM1A 1L3IA 3AU9A 1VIMA 4C14A 2ID4A 1BMFD 1FRFS 3T7CA 2RBKA 3AZOA 4BNIA 1JUDA 2QMHA 2QRQA 4GX5A 4WNAA 3O91A 3QKRA 1V39A 2HEGA 1K7SN 3LLUA 3JRWA 2VR1A 4UXHA 4EI8A 1KP9A 3SXJA 4DSTA 5CAEA 1P3Y1 2Y0BA 1XZEA 2V1XA 3DE5X 2ZRIA 1FSPA 1TVKB 4P35A 4LQDA 5EXPA 4BB6A 3FIUA 2HADA 5IYZF 3W79A 5IAOA 3O2NA 3TD9A 2ZBGA 3AOEC 1R0LA 4MVYA 4UAVA 4YDSA 4CF5A 1M2WA 1XROA 1QNFA 1TJYA 1HV8A 1U2TA 2CJXA 3P26A 3SC4A 1EGQA 5F23A 1P0IA 1JLMA 5BN5A 3R8XA 1IHPA 5B30A 4GH5A 4B84A 2A67A 2A94A 1KP3A 2BD0A 5HBRA 4QJIA 3PGJA 3EDRA 5CDGA 4C5BA 3TO5A 3DE1X 1XNJA 2JPDA 1O0BA 3IPLA 4BWFB 2DT5A 1CFZA 2CCGA 4NENB 1RYBA 1HDXA 3JVIA 3LCVB 2B3TA 5C7OO 1Z29A 2B36A 1UM8A 5KINB 3TL3A 2ZTHA 4K9QA 4PHCA 1HBJA 5CFRA 1C4XA 5IVIA 2C5SA 1KAOA 4TV8B 2NPOA 4LEIA 3GJSA 3HUTA 1E89A 1M6WA 3DC7A 5DN6D 4EHIA 3LXRA 4FQ8A 1JG2A 2ZYAA 1RWMA 2VK2A 5LIRA 2B1QA 2EJBA 1VHTA 5B1HA 1KL7A 4C43A 4JNCA 4IEFB 3A1CA 1EUQA 5J1SB 3NP9A 4ESVA 4EY5A 4HPXB 1C9YA 4XX0A 4A2CA 2JLZA 2X76A 4WA8A 4CCWA 2QLMA 3IERA 1DRVA 2Q27A 4RJIA 3ZR4B 4MRSA 4XUEA 2COUA 4EGQA 2FMIA 1NNEA 3D1VA 2VNSA 2QBYA 2OOKA 3BJIC 4JYPA 5LLSA 1N34B 2X8JB 2H51A 3O3CA 3P32A 1MNAA 3EGXA 3IIKA 4P4GA 3ZPXA 3QE2A 4ALKA 5BQ3A 4F91B 1BXGB 1UR5A 4NESA 2QYHA 3C3YA 2ZSAA 4WBSA 4PTZA 1WB9A 3HKBB 3DHEA 5TPWB 1HOXA 3OCUA 4MQEB 4KFTA 4QGHA 7YASA 4TTAA 4BL5A 1L2TA 3LY9A 3ZK8A 1QORA 1RP7A 1EWRA 2GJKA 2IV3A 3CUTA 2BHRA 1L6RA 4B44A 3OP4A 5IEBA 4KR2A 4UBOA 1PGPA 2QD2A 2ZANA 4P82A 3TIIA 3A9UA 4YCSA 3EF1A 3SZRA 1S6YA 5M2QA 1O54A 1L9XA 2V7QD 4WLVA 1LD3A 4ZAXA 3EPKA 1EIWA 4FUQA 1HTTA 4ZYYA 1AURA 1D9ZA 2O5CA 2J4CA 1QIEA 2FSIA 4KX3A 1SHJA 1T2CA 2GM5A 4D9BA 1KC3A 5K8UA 1JWBB 2B4AA 5IMSA 2EFEB 1HEIA 1Z2CA 3R7BA 2HV9A 4F3RA 2XRMA 3JQCA 4RIFA 4UBKA 1FJXA 1OZHA 2Z57A 2WTNA 4ASUD 2B94A 1NKTA 3EPJA 1TLFA 2GK7A 2R6ZA 3E15A 4LRWA 1NR1A 1GUDA 4Z7JA 3MHPA 5CA1A 2GCNA 1E9CA 1LDNA 1DX9A 3EXEB 1SC1A 2RB4A 5EZYB 2R6DA 1XYGA