2H2AA

Crystal structure of nicotinic acid mononucleotide adenylyltransferase from staphylococcus aureus: product bound form 2
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
189
structure length
188
Chain Sequence
MKKIVLYGGQFNPIHTAHMIVASEVFHELQPDEFYFLPSFMSPLKKHHDFIDVQHRLTMIQMIIDELGFGDIDDEIKRGGQSYTYDTIKAFKEQHKDSELYFVIGTDQYNQLEKWYQIEYLKEMVTFVVVNRDKNSQNVENAMIAIQIPRVDISSTMIRQRVSEGKSIQVLVPKSVENYIKGEGLYEH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Probable nicotinate-nucleotide adenylyltransferase
publication title Crystal Structure of Nicotinic Acid Mononucleotide Adenylyltransferase from Staphyloccocus aureus: Structural Basis for NaAD Interaction in Functional Dimer.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Transferase
total genus 55
structure length 188
sequence length 189
chains with identical sequence B
ec nomenclature ec 2.7.7.18: Nicotinate-nucleotide adenylyltransferase.
pdb deposition date 2006-05-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01467 CTP_transf_like Cytidylyltransferase-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.620 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HUPs 2h2aA00
4ZT4A 1QJCA 4MUIA 3N2YA 4MUEA 3SEQA 3K9WA 3QTTA 2V0GA 2DLCX 1K97A 2CUZA 1J20A 5IJXA 2A1UA 2QJTA 3A04A 3COWA 3Q4GA 1TYBE 1F4LA 1KH3A 1M1ZA 1PFUA 4EG4A 4OUDA 1O0CA 2QUKA 3C8ZA 3H9BA 5LM3A 1VL2A 1WXHA 2BTEA 3N9IA 5JBNA 4YP6A 2ZP1A 1GZUA 3QTBA 1COZA 2IELA 4J75A 4L2IB 4MVWA 2AKEA 4DJAA 3IVXA 1EJ2A 4NDAA 1B6TA 3RBAA 1EUYA 1T9GS 3CVXA 1WQ3A 1DNPA 3NBKA 2HMAA 1VBNA 2CYBA 2J4DA 3HV0A 1Y42X 2OV4A 3IOCA 3IUBA 2X3FA 3OP1A 3MLAA 1R6XA 1GLNA 5K0SA 3MUEA 4HPWA 1O94C 2AZXA 4ZT5A 3FH0A 1NYLA 1N2OA 1RQGA 1T6XA 1NUPA 1TYDE 4MUFA 2R5WA 2CT8A 2PZAA 4EG7A 2DUMA 1Q77A 1EFPA 4MVXA 2A88A 1OWPA 3KT6A 5FNZA 2A7XA 2X0KA 5H16A 4ND7A 1M83A 1KQOA 2HGZA 1GTRA 1JMVA 1O6BA 3BL5A 1I6MA 4J76A 1R6UA 3IH5A 3KT3A 3LCJA 4MQ6A 4XSVA 1O97C 1MB2A 3RK1A 1G8FA 1EXDA 1KKUA 1O95D 1FYDA 3IODA 5DASA 2Z09A 3HFJA 4EG8A 4DDHA 4DDMA 3FY4A 3UY4A 4OJMX 3IMEA 5EKDA 2IJGX 2D54A 3G6KA 5FO1A 4KR9A 3ZJUA 3ZJVA 4QBTA 3TZLA 2BYTA 4MUKA 3AG6A 3P52A 4TS1A 5J5AA 1LW7A 3CVVA 4MUNA 1JIKA 2VTBB 5BNZA 3P0JA 4U7JA 2CFOA 3CVYA 4YMIA 1ZUNA 1I6KA 2YXNA 4BWVA 4FZJA 3SDBA 1F7VA 4ZT2A 4JXXA 2HZ7A 2PZBA 3IOBA 3GUZA 1Q19A 1XNGA 3DLAA 1D2RA 4DNXA 3ISJA 3SZ3A 4XFJA 3A4IA 2GKSA 3CLRC 4P2BA 2PXHA 2XRYA 3JXEA 3LOQA 1M8JA 4MUJA 1J09A 1TYAE 4DE5A 4MVYA 4NAUA 4U63A 3ZUGA 5TGTA 1WJGA 3H97A 1S4MA 1H3FA 1EFVA 3G59A 3ZIUA 3AKZA 1N75A 4Q16A 3TQIA 1GAXA 5KWVA 1OWLA 1O0BA 1O97D 1PFVA 3A05A 3QE4A 4AS1A 2YWBA 3AL0C 3IVCA 4PBSA 2JANA 2Z3VA 1U0BB 1KAMA 2QUIA 1HYBA 3MLBA 4S1OA 2O8VA 1G8GA 3UC5A 1CT9A 1O95C 2CYCA 4MUHA 4ZCPA 1NURA 4KPUB 4I6GA 4MAFA 5TEVA 5H7XA 1WXGA 5AHWA 1U7DA 3E27A 4Q93A 5J59A 3RJZA 2A1TR 4MW7A 1FFYA 1KH2A 4R0NA 1WKBA 3FETA 4MLPA 2A4MA 5HG0A 3IMGA 1YUMA 2WQ6A 1TYCA 1QQTA 4EG6A 2PG3A 3SEZA 3H05A 3CLSD 2DR2A 2H29A 1KAQA 2G36A 1MJHA 1VBKA 2V0CA 4K03A 4X0EA 1JZQA 1MB9A 1YIAA 1JEEA 1TEZA 3CLRD 4YP7A 3GMIA 4ZCTA 3PXUA 2A1TS 5LFAA 1M8GA 2QTRA 1EE1A 4AQ7A 5FO0A 3FNRA 5J58A 4DDKA 5DK4A 1H3NA 2CV1A 1OWOA 2J08A 4K0RA 2NSYA 4DLPA 1MC1A 2PFSA 3DPIA 2CV0A 3F3MA 2J5BA 1QU2A 4CDMA 1I2DA 4CT0A 1N2JA 3KT0A 1NUQA 1QU3A 3TZEA 4MWEA 4G5FA 4NZPA 4ZCSA 1VBMA 2DETA 4MW5A 1K4KA 1IQ0A 3MMXA 3U1VA 1O96B 3Q10A 1N2HA 3DO8A 2A86A 2B7LA 1JECA 2ZUFA 4ZCQA 4G5YA 3INNA 3CLUC 1GTSA 3IUEA 1M8PA 2A1UB 3UMVA 1IQRA 1WXIA 1JIIA 4JYZA 1IH8A 1N2IA 5F23A 1N2GA 1A8HA 3AFHA 4YP5A 2XRZA 1YI8A 1TQ8A 1IHOA 4NATA 4EG1A 1YUNA 2RD2A 2VXOA 4MUGA 4MWDA 4MWBA 1G59A 2A84A 3HZRA 3D6VA 1N78A 2WSIA 4UZEA 3M5WA 3CLSC 1JEDA 1WZ2A 4I6EA 4ARCA 1JHDA 2JAXA 3VGJA 1NUSA 3ND5A 3KFLA 3CR8A 1MBZA 4L2IA 4WSOA 1N1DA 1IFXA 1SURA 3LE8A 1MAUA 3H9CA 3HMQA 2AG6A 3IMCA 1KQNA 1V47A 1XNJA 3OTWA 3AG5A 1ZJWA 1NI5A 1ZH6A 1J70A 1EFPB 1NZJA 1LI7A 1TFUA 3HL4A 3ILVA 3Q12A 4ARIA 3ND6A 1GN8A 3IVGA 1M8KA 1WOYA 3ZXSA 1J21A 4KKVA 4NX2A 4PY2A 4EGAA 1P7PA 2H2AA 1VLHA 3P0IA 3CLUD 1WQ4A 1QRUA 4EFKA 2EJCA 1IVSA 3AIIA 1YULA 5HUHA 1N3LA 4EG5A 1QRSA 4KR6A 1XNHA 2NZ2A 2TS1A 1OBCA 4I6JA 3CA8A 1K4MA 2E21A 3FHJA 3H99A 1X8XA 2PZ8A 4H3SA 2JA2A 1PFYA 1NUUA 3VRHA 1OWNA 3P0HA 1JZSA 3PNYA 1O96A 2QUJA 4QRDA 4NAHA 4GRIA 4CDNA 2OQ2A 3RHSA 1LI5A 3NBAA 1T9GR 3FI0A 3RK0A 2DERA 2DPLA 1KP2A 5IHXA 3TNJA 1WXFA 1H1TA 4MW1A 5DEOA 1IQUA 1OWMA 1YIDA 2VTBA 1MRZA 4ZT3A 2DXIA 3TQOA 3DV2A 1ZH0A 1N2BA 4ZCRA 1Q15A 3RFFA 1NP7A 2WQ7A 3PRHA 1QTQA 2GM3A 1NUTA 3N05A 3FG9A 1BS2A 5HUJA 5KHAA 1O5TA 1K92A 2WB2A 4GU5A 4UZFA 4R2LA 3CVUA 1EFVB 3A2KA 1I6LA 1U3DA 2CV2A 1F7UA 2PIDA 4CQNA 1PG0A 3N8HA 1JGTA 4MW4A 2O5RA 3G5AA 3UK2A 1MOPA 1F9AA 2ZUEA 1J1ZA 1OBHA 5DB4A 2E18A 3I05A 3CVWA 4PBRA 4PBTA 2D5BA 1Q11A 2QTNA 3K32A 4RPIA 1H3EA 2YY5A 1KQPA 4EF6A 3IOEA 1OD6A 2J09A 4MW9A 3MXTA 2QTMA 4WNYA 4MW2A 3FDXA 2QJFA 4ZT7A 3VU8A 4HJXA 4F3RA 4MVCA 3ND7A 3CLTC 1QRTA 4ZT6A 4RUKA 4OUDB 1KORA 2YWCA 1IRXA 1KR2A 2I1LA 5LLTA 2IP1A 2E0IA 2QJOA 4R2MA 3SP1A 1KP3A 4JXZA 4KPUA 2J07A 1X6VA 1ULHA 3X1KA 2E89A 1WY5A 4YBRA 1M8FA 4EG3A 4JZYA 3FOCA 4JFAA 1KH1A 4MULA 4MW0A 1ILEA 1R6TA 1UFVA 1MAWA 2CSXA 2EL7A 4HJRA 5KCMA 2GOYA 4MW6A 1G8HA 3PNVA 2C5SA 4HK4A 5TS2A 3ZXIA 3ZGZA 3X1JA 1J1UA 1N77A 1PG2A 3S3TA 1U3CA 3COYA 2X1LA 3GLVA 3KT8A 3IDFA 5TEWA 1N2EA 4MWCA 1XJQA 3SYTA 3FIUA 1O94D 3COVA 4E1AA 4G6ZA 4F4HA 1U7XA 1T6YA 2D13A 3PNBA 3X1MA 1WXEA 3TS1A 3ZJTA 3UOWA 4KR7A 1PFWA 1T6ZA 2QUHA 1NSYA 4ND6A 1JILA 3D6UA 1JIJA 1V8FA 2CYAA 5K0TA 2DEUA 3CLTD 4QREA 1GPMA 2X1MA 3FWKA 3SZGA 3ELBA 4U8HA 4XFDA 3NV7A 3L93A 1QNFA 1EUQA 4A91A 3L92A 2Z08A 2RE8A 3HGMA 3COZA
chains in the Genus database with same CATH superfamily
2Q9UA 4XQ9A 1PZHA 3HBAA 5KHOC 3G9QA 3LCVB 3CKYA 3OPNA 4MUIA 1WXWA 4ZZIA 3SEQA 5FPKA 2D3TA 1A5TA 2HA0A 4YUAA 5KINB 3Q8MA 1RFLA 4XASA 1IWPB 5AKXA 1OAAA 4OHCA 4OQMA 1FLNA 1DQNA 3ZH9B 4PO1A 4BGIA 5IJXA 4RV5A 3HB1A 1AGNA 2BI4A 2V7TA 3F6PA 1X42A 5EIXA 3PG5A 5ECDA 1KH3A 2JNWA 4WLOA 3VNVA 3LWZA 4NV0A 5IC6A 4EWLA 2YNMC 3V8NA 4OMCA 1VL2A 2GCIA 1LSUA 3LP5A 1ST2A 3ACDA 2PKEA 5F5NA 1AA9A 2H0QA 3U7RA 4W5NA 2ILVA 3ZQ4A 1DADA 2PRYA 1EBUA 3Q7PA 1W1IA 4WOJA 3RVBA 3IVXA 3MTAA 4XVUA 5LP6B 4XQEA 1O95A 3BOSA 4HGNA 3OFVA 3ZIDA 4ZMRA 4AMGA 5KSWB 1DG3A 1LWOA 3RYTC 4JJFA 4W6QA 5DLDA 2D5LA 2Y66A 2XB2A 3EYWA 1E61A 1F3LA 2J4DA 4Z0HO 5TS3A 1QIMA 4H16A 2R4QA 4HUQA 3WK9A 1CUXA 4CXMA 3E8MA 3T61A 4EFLA 6GPBA 2CXPA 1A1SA 3VDMA 2AJCA 2WIKA 5BV8A 3QY9A 1ZSNA 5ERYA 3IUNA 2PCLA 2ETVA 3VR6A 5FTKA 3P2MA 4RKQA 5B7PA 1OB2A 5E7IA 2XTZA 5HILA 2YHAA 2G9ZA 3DZIA 1VLZA 3E4CA 4OU4A 1QH0A 1RACA 2AIRA 2HYDA 2AN3A 2XHEA 3LUPA 4H7KA 5KVAA 4DIUA 2H7YA 4EW3A 4Z4FA 4UAVA 4R05A 2E87A 1PEDA 3DBRA 1DFIA 5A2GA 1XZJA 2JHFA 1EK5A 1TLFA 4R68A 4P0PB 1RADA 2JJYA 1KKUA 2JD2A 5TNXA 1ZC3A 3RVKA 3IODA 4UM7A 3KV1A 1NQOA 4EF4A 3SHFA 4DR4B 5BSUA 3M81A 3M6AA 5BOSA 3V4ZA 2PAAA 3FD8A 1QX4A 4JUCA 1F3OA 1K4YA 2PRZA 2QN8A 3LZDA 3CN9A 4PW0A 5FORA 5IK2A 3CNBA 3GEPA 4CU5A 2YNMD 1GG5A 1RJWA 4JB0A 4KXNA 3W5AA 1H2FA 3QJ5A 4D3ZA 5CMLA 4GSLA 4DIDA 4E21A 1O4VA 4KXLA 2EF1A 1YB1A 1MO3A 1GPUA 2YMQA 2XGGA 5G0SA 3U4CA 3OQBA 5BNZA 4QQFA 4PSCA 3HS3A 3SJ7A 7AT1A 2MR5A 4DXHA 5KYXA 3LI2A 1BCRA 2P2DA 4V2UA 1TK2A 5IN5A 2IY9A 3P9SA 3GOHA 4PF1A 2BI8A 4HLCA 4AY3A 2L42A 1TVKB 1GAWA 2CXHA 2I6TA 3BGDA 4QQNA 5D8DA 5GV8A 2WAXA 4JC0A 2FUEA 4HYTA 3K4QA 1Q0LA 1K7XB 3EGXB 4FB5A 3HCAA 2PKRA 3FX2A 3DLAA 4MR7B 3SBDA 2BDTA 1QG4A 1GYRA 1RWXA 4KE6A 2V3WA 2A1IA 2GKSA 1YMVA 4I5GA 3S68A 4DIFA 2CN1A 4FSHA 1CIPA 5KJFA 3N3BC 5LP6A 4UTPA 2P78A 5F7ZA 1TC1A 4HL6A 3ZDFA 5A5DA 3THXA 1ZGJA 1CUGA 3UKJA 3QBJA 3T52A 2QD4A 5AQEA 2XD9A 1P2TA 1N3BA 2KB0A 3ROPA 1ZI8A 2X8JB 1ZI6A 2NYRA 3IEPA 2QRHA 1GCAA 3VU9B 2NTNA 2BMAA 3BMOB 3AF0A 4IIBA 1R6DA 1GAXA 1VE5A 2AWOA 1TO1E 4C3UA 5G2OA 2HMSA 2GCPA 5B2ZA 4H1WA 2JANA 4IDEA 2FPUA 2W98A 4JLSA 5LYJA 1L9XA 2ZXFA 4OU5A 4F93B 2BUAA 1HYBA 3U61B 4BY9E 4F5ZA 4HV4A 1NP3A 2QSYA 2Z6UA 2HKIA 4AD8A 2CBZA 4GXQA 3CF4A 4WINA 5JDCC 2CE2X 3UC5A 4DMMA 3A9UA 3HG7A 5C5DA 2AL7A 2JS7A 4TMTA 4YCBA 1V2GA 5DM70 1XTZA 2QP9X 3A9RA 1VGRA 1OE0A 2GRUA 4JP5A 2GYUA 2B8NA 3D0RA 4LOKA 1UZAA 1AXGA 4IMIB 4OLBA 4PVDA 1TM1E 3K2IA 4QNRA 4D3SA 3JQGB 3HXOA 4PHTA 3SBEA 3LA6A 1BU5A 1HDYA 1HDEA 4CMEA 4DB2A 4I5FA 1WCYA 1ENYA 3IMGA 1QZTA 4R2XA 3WJ1A 3A36A 3CT4A 4YJDA 3KHSA 3MRSA 1XAIA 3LLUA 1KFCB 3T06B 2WNIA 2ZXEA 4P5EA 2YIDA 5AK3A 1MJGM 2G36A 3LIPA 4L50A 4X0EA 3VJMA 1DX6A 5KQGA 2LCIA 1MJNA 2QMYA 4B1FA 5L3QA 3LC1O 3MF4A 4P80A 2C1ZA 1VHDA 1U2ZA 4YJ2F 1P1HA 5DGXA 1M8GA 4L75A 5ETJA 2QTRA 2VA8A 1NF9A 4RY2A 3VAAA 4MMXB 5TARA 2D2FA 1A4UA 2R4TA 3BWEA 3FNRA 1I4LD 1N8NA 1X77A 4BMPB 1HM5A 1WY7A 4EHHA 3EH2A 3CO0S 4BQSA 1L7AA 1IIRA 1NA5A 2F55A 4JBXA 1KJNA 3GP5A 4AICA 4RFSB 1GNPA 3G5MA 3EGXA 4RAOA 4WEQA 1ZOPA 2ZG6A 4MR7A 2OENG 3ZCRA 4OAQA 2Q2OA 4D96A 4LV6A 4LF9B 4BMCA 4UD6A 5G0VA 3TOCA 1RBMA 4ECEA 2JGRA 2XIJA 3USZA 4RVSA 1KY3A 3NP9A 3LLMA 4MR8A 3WLRA 4ZHSA 4ERNA 1J8DA 4OSPA 3WWOA 5JFTA 1SVWA 4KXYA 1EVEA 4Q12A 1JSXA 4LRUA 1ABEA 2ID8A 3QOWA 4KUHA 4MP6A 5TF4A 5BSHA 4F0JA 4E1BA 4EIWA 2C7GA 3CB4A 3FVWA 1RT9A 4D9HA 5DNDA 1W36D 1M7GA 3BMOA 5C3UA 1V6SA 2XQVA 1AN0A 1E3QA 1Y9AA 2C4TA 2FUCA 3K20A 3MA0A 2BV3A 5IDVA 1CY1A 3DOOA 4Q05A 3NOXA 3EMVA 2D1TA 1Y9DA 2NMVA 2I0FA 5EIAA 1D2AA 4EKNB 3Q9UA 5I7SA 2JI8A 4C6RA 2QZZA 2IYVA 1PJBA 4J16C 4FC7A 1P1FA 1LC0A 2QW8A 2CD9A 2ZRIA 3VC2A 1S6YA 1C7JA 2CY0A 3IDOA 3RUEA 2HU2A 3WA6A 4DUZB 1AVTA 5CTJA 1GTZA 1N2IA 5DYWA 4LMRA 3OOJA 2XYPA 4WKPA 3DXXA 3U6KA 4D45A 2WUGA 2C3YA 4UVEA 4ZJPA 3CRNA 5G1PA 2WI8A 4GP6A 5LD2C 1O54A 2Q6KA 2MOKA 1Q2UA 2JFGA 3PT5A 3TR0A 2FSGA 1TGYA 1SIUA 5CM2Z 4KE9A 3GVIA 2XJ9A 3PQ6A 3EOAI 3GEBA 4R8LA 1G21E 5DTQA 2MSKA 2W5UA 3BJEA 3HJCA 4GBJA 1BU8A 5YASA 5B6JA 5IABA 3RW9A 2GD1O 2FGJA 3DPUA 4JJ8A 2H3EA 3UWSA 5DM0A 1FEZA 4WSOA 4EP1A 4CKEB 2VNKA 1UBJS 3UXHA 5CR9A 4WOPA 1OVGA 2OSVA 4J43A 2JZCA 2AJBA 3LE8A 3LFUA 2XLBA 5IDYA 2OA0A 3WRXA 2BGKA 4YQFA 5JFOA 2AG6A 2CFCA 2KPOA 1PDWA 3IP3A 3OTWA 3DJYA 2PV0A 4P7KA 3AG5A 4HG2A 1GADO 1LPNA 3FDJA 4B4VA 5EMMA 4AB1A 4COKA 4E5UA 5KC8A 1LLFA 3EQZA 3FLEA 3TUJC 1J70A 1D2MA 1VCMA 2W6MA 2OM2A 4MVJI 2QNRA 3PLAE 4PX9A 1RKUA 1FFXB 3UFXB 1ZM7A 3HR8A 2Y0EA 5H9WA 3KQLA 1XEXB 1WUYA 4M7RA 4BE4A 4U00A 2G67A 5CFPA 3KYDA 2YN4A 3DCNA 3LQ2A 4NU8X 3ADOA 3ZWWA 1HC7A 1HFKA 3WIVA 4HH0A 2IZ1A 4B6FA 5G3ZA 3KSBC 1N5LA 1L7MA 2W6ID 3EZ9A 3HA2A 5D6NA 5BXYA 1O8BA 1TZKA 3D9QX 2YY7A 3OZAA 4WZAB 3WNBA 5CA1B 3BXPA 5JXWA 3PBKA 1YR8A 3RVQA 1JDJA 1P3Y1 4RWEA 2O8FB 1PKEA 2FK8A 1GGEA 2EGGA 3HYRA 4K46A 3N5CA 4P3NA 5IAGA 5BSGA 1A5SB 2NZ2A 2BTQB 4JC5A 3UMRA 3ZWQA 1OBCA 5AW5A 2GYVA 4NBVA 4DM7A 4QJ3A 1K4MA 4RTNA 4HRXA 1P31A 2VNHA 3Q7SA 3B1JA 4UFNA 4D82A 1EGVB 5CDHA 1Z0JA 3TOZA 1XXLA 2QRVB 4P7GA 2NU8B 1DOHA 1HSZA 3VR3A 5HYVA 1NW8A 5KVSA 1T8SA 2VRCA 1SBCA 3R24A 4IW3B 4Z1OA 1YUBA 4MHOA 3I5UA 4QOSA 3I04M 1TW3A 1YRLA 2FWPA 3KEQA 2WP0A 3RRZA 1K3FA 4FFSA 4RA6B 3B78A 4YCLA 2BP7B 4QJ5A 2GJ8A 5FR1A 1B0ZA 3F5MA 2UDPA 4JDUA 5COBA 4E22A 2OVBA 2G77B 4L15A 4LDAA 1K98A 4LOIA 4RD2A 2DWOA 5B1YA 4IH4A 5B30A 4NZYA 4JEUA 1PFGA 2FI1A 2BFDB 3T7KA 3AH8A 4JMPA 3TE7A 2QRMA 4M1YA 2ZSBA 2WWYA 3EGDA 2FJUA 4M99A 5CLIA 2EZUA 1RWQA 3H1EA 3OT5A 3R75A 4DJ5X 4L4YA 4KV9A 2QL6A 3FTNA 1QG2A 2FG5A 3M3PA 5C8YF 4OJQA 1GPNA 1BS2A 3G0BA 1C1YA 4GYYA 1L7RA 2H31A 3BIJA 1MX1A 4L4UA 2CVPA 3LKDA 4LX8A 4NVRA 4PAGA 4XGIA 3UA4A 5JHHB 4NXNB 1QGUA 4N03A 3GLUA 1M0EA 1BJRE 1IHPA 4P0TA 4BWGA 2HK9A 4QGGA 2FOLA 5GJVC 2DFLA 1PG0A 1YASA 2DH5A 2AYYA 4CL3A 5C81A 1C80A 5BQXA 4AKSA 2P2CA 3TTWA 2PPVA 5IRCD 3FHLA 5P8WA 5IMSA 5EIEA 1JHZA 4GI5A 3OC6A 1EBFA 1EFTA 1NJ1A 3F6BX 1H3EA 2FAXA 3BXFA 2JI6A 4OQYA 1YZHA 2J6CA 3QKRA 4MQUA 3R6TA 2J09A 2QXUA 3LCCA 3PRKE 1FFXA 4JB2A 3A7DA 4HYEA 1XMSA 2OBNA 4MW9A 5G02A 3UFXA 5BV0A 4OA8A 4NCKA 4C30A 2B94A 4O2RA 4HTFB 4IO0A 4LZJA 1SBIA 2PUGA 1U0FA 4Y98A 1JHQA 4A0QA 4EW6A 4WK6A 1PT9A 1T25A 2BKAA 1XRSB 1DQZA 4ZVPA 5INTA 1ICIA 4KYTA 3OOHA 4ZV7A 2JD1A 3LK6A 4WZAA 1J22A 1Z74A 2ODPA 3L0PA 3O74A 5AKJA 5GZ1A 2WOJA 5MGNA 4AP5A 1F0KA 2J07A 2QD5A 2WWIA 4QVKA 3OSUA 2FPWA 1ZJ6A 2ZYVX 1Z22A 2K2WA 3EEYA 5AVOA 2BHSA 1L8XA 2DLNA 2RCYA 4GMHA 3FE2A 3L01A 4FM9A 1R8XA 2I4IA 4B09A 4XD7D 1W87A 4HNUA 2HWUA 2NZVG 1TX4B 4MVJE 1GDDA 3O3OB 1M10A 4PHFA 4UJ3A 4MW6A 1U6JA 3TYXA 3D3JA 2ZIXB 3OIVA 3DFMA 4Q03A 2ZK7A 4RA6A 5ADUS 5JY6A 1OFTA 4NY1A 1R1DA 3E1SA 1KOFA 3SC4A 3SQOA 4ZJZA 1Y7IA 2BONA 2W00A 3KT8A 1ZN2A 1B3BA 2VHJA 5LB4A 1F2UB 4ZVSA 3VZBA 1QR2A 3ADDA 4QPPA 5JTUA 2K7FA 4MX8A 1WBJB 4QDXA 1NXWA 3GWGA 4BVKA 2X7HA 3JQ9C 3NBUA 3BWBA 2P6PA 1BE8A 1BG6A 2Q9AA 2BGWA 2Q5LA 1M2JA 2MINB 1OYYA 1TEVA 1ZM9A 2PJDA 3R3WA 4DZTA 2V6FA 2PL1A 3TS1A 3PX7A 5IFKA 3HO1A 1VXRA 1E1KA 2FPPB 5LWHA 3IBCA 4WLNA 2QAGB 5LBUA 3IBYA 3RFTA 2EZ4A 3H83A 2OPHA 3TO5A 5CFNA 1LTHR 3WA7A 1L1EA 1YR2A 3U56A 1QP7A 3ICCA 5ER9A 3RV4A 3N0VA 4G84A 4U7FA 5EUQB 5EEGA 2B99A 1NBME 2P5YA 3Q8XB 1FUKA 2QX9A 3C5WP 3K0CA 5KO2A 3FOBA 1E6WA 4FW9A 4MA4A 1PS8A 3SZGA 1Z4IA 5TPZD 3JPWA 2REQA 1WZEA 1E60A 2QN3A 1J0DA 2X5NA 1DUVG 1P73A 1URPA 3D0KA 3K35A 1UT8A 3BDAA 2F2TA 3M4JA 4P6VF 4RJIA 5CFZA 3EHEA 1QTNA 5GQSA 2ZAIA 4IDBA 3RF7A 4B4UA 1NDUA 3BK7A 2FMUA 5LZ7A 2C94A 2C5FA 2PD3A 2P0YA 4QUAA 4UC0A 3WGKA 3HSKA 5BUZA 4O25A 4F8JA 1UAAA 1K97A 1RPAA 4IDGA 1XALA 3DMFA 2VHEA 4NZNA 4EX7A 3GNTA 1BWRA 4GKAA 4B8YA 2C92A 2FLVA 2J8ZA 4F2DA 4ZK6A 2OG2A 3U3KA 2PKXA 3N2GB 4P81A 5KTNA 2XRFA 1QH9A 4RTJA 4OVKA 2IS2A 1FDVA 1FQJA 3C14C 5AH0A 4O6VA 1RHQA 3FMVA 4YHBA 3U3RA 3UA3A 1L4NA 5JAPA 2QW1A 5KSPA 1I32A 1WXHA 2BTEA 2X15A 3R3UA 3GLGA 1Z6PA 3NB0A 4YJHA 3UJ9A 1RTKA 1M3SA 2NTVA 2QD1A 4A03A 2C04A 4OO3A 4DKJA 1E9EA 4A0GA 2H1RA 1CUVA 2I9PA 3QPAA 1G5FA 3P9XA 1KI3A 4PEVA 4P4SB 4EAAA 1YRQA 2SNIE 3CVXA 2GEJA 4X97A 1Y7TA 4FE7A 4P31A 3QX3A 2Q9BA 5AJYA 3IQWA 5ANRB 1XIVA 1ZIYA 4CIXA 4EB8A 4ENQA 2OO7A 2P5UA 2POQX 8OHMA 3IQZA 3HV0A 2FUG1 1HBJA 2ZIXA 4MWGA 3T5BA 2GZAA 5JXHA 2P41A 2GZ3A 3G0DA 2V98A 4K40A 2OCIA 4M76B 5I51A 1I5EA 3BCRA 3H4VA 2BPOA 3D8NA 1R8QA 5A06A 4CN9A 1EK0A 3IAM6 5CVDA 2DUMA 4NBRA 1Q77A 4XR4A 2G0NA 1F2UA 4O29A 5HF9A 5REQB 3R8XA 3DE3X 3Q2OA 4BNIA 5P21A 5G0UA 4WFKA 1TTQB 4NOJA 2Q3BA 3DYBA 3SHTA 4WKBA 1G5PA 3SFTA 3K6RA 3Q0EA 1T3TA 1AUOA 1KVSA 1N6PA 2P40A 2HGZA 3ZC3A 4BVAA 2MINA 4KU4A 2JJ1D 3CJRA 3DV9A 2X8LA 5G53C 2GFIA 2HREA 2ZTSA 4RHEA 4ALJA 3D8UA 5LMZA 3FUVA 3N28A 1EXDA 4UTRA 1G6Q1 3MMZA 1NQXA 1JU3A 3B89A 1PN3A 2W93A 4NIMA 4W1QA 4XIFA 3QVGB 4KAAA 2CMDA 3Q7EA 2CL6X 4UMDA 1KL7A 2O1EA 5ALHA 1K8XB 1CYDA 2DBQA 2F90A 2DUUA 2OPBA 2JPDA 3MTQA 1GPDG 3ESCA 5KWJA 1Y4UA 3BULA 4YMHA 2XUQA 1GUZA 1NOKA 5D1NA 5DLPA 1FE8A 2ZB4A 5EPEA 1ODCA 3VPGA 1WB9A 3BXGA 2PMKA 5KU7A 3KLBA 3WAJA 1ULZA 1XCJA 3EQ7A 3JZAA 5J63A 2UYOA 1SEPA 3GCXA 1B16A 3TLCA 1U8UA 2X76A 5DBIA 3U0VA 2WICA 4BFTA 1ISJA 1LK5A 1BXGB 1DEKA 4NJEA 1F7VA 1W4AA 4TWZA 4D46A 3PWSA 3DDCA 3GJQA 1L4UA 2WUEA 1EXNA 3C1AA 2G0AA 1QFMA 1R0YA 2HZ7A 3KFVA 3NHZA 3KYCA 3VNAA 5L7YA 3PSAA 4FWIB 4B71A 2R79A 4LBZA 1PWZA 1SKUA 4X3CA 3ZY6A 1CIVA 1X15A 2ENWA 2YJGA 3W79A 1IHDA 5ICEA 4YMTA 5AJTA 3UAYA 5U9CA 2VTVA 1FTYA 4I1RA 3SQXA 1ZGCA 1AXRA 2PSSA 2GYYA 1NZFA 1U90A 1O87A 2QWXA 3AL2A 1H94A 2B1JA 2J0QA 1VLLA 1XXHB 1Z3CA 3N8GA 1TYEB 1VG8A 3WTCA 3WLJA 2XZTA 3URMA 1DRUA 4P4SA 2O0LA 1LRLA 4ZKEA 3MCWA 3OQVA 4A1OA 3IQDB 1BIFA 3U7QB 3SG0A 3P19A 4G9GA 2FGKA 4Y0NA 2WT9A 4WOBA 4AZVA 4KR7A 1F4PA 1N2CB 1JKXA 3SX0A 4LXGA 3K0KA 5I48A 5LP6F 4R2WA 1CQJA 2C61A 1CP3A 2PX3A 4Q16A 4TRMA 1QHFA 2EG9A 4G4IA 4F97A 3Q7IA 4HNTA 2OCBA 1HKUA 1FNBA 3OTGA 1JQAA 4DLNA 1P9OA 4OFXA 4RO0A 4AS1A 3IOYA 4JB8A 1XPUA 1E4VA 1CZHA 3NIDB 3BICA 3BB4A 4NCIA 2H4HA 4PLZA 1U0BB 3H1PA 3JALB 5IEBA 3EIFA 3W78A 3AM1A 2ODBA 4V39A 5H4GA 1U2EA 2HLDA 4RLHA 2OC9A 4MP3A 5REQA 5DWQA 3AR9A 2Z04A 16PKA 3RJ5A 3S44A 5K4GA 4J2HA 5KVVA 2H7VA 1EFKA 1CT9A 2ZR9A 1YC2A 3NALA 3INYA 4Z7QB 3VAYA 4TV9B 4IL5A 3TNLA 1KRXA 5TEVA 2C1EA 1DKLA 2F43A 2PSHA 4QBFA 1SRQA 5GVSA 1FTGA 2O2GA 2FPRA 2OLEA 3OTIA 3R20A 1AQJA 2CHUA 2DPXA 2F7SA 5KOJB 4WX2B 2JKYA 2CVOA 4OG2A 2QRGA 4ZCIA 1NPTO 1B6SA 2VJDA 2GEFA 4YAOA 2EQBA 3GY0A 1F8UA 4UU7A 5EHXA 3QVGA 2JGEA 2MDTA 1JI0A 1KBZA 3PR1A 3ZZTA 1ISHA 1QE0A 1M5UA 2CHQA 1SY7A 4QX6A 1VC2A 3ZEIA 1LX7A 5JDCA 3OZFA 1L8LA 2FSHA 4TLCA 3LUFA 1C7QA 5MN4A 3L41A 3EDCA 5GINE 2O0KA 4CLRB 1GQFA 1IG0A 1T2VA 1U9ZA 2ZBQA 1AKWA 1CEXA 1BC5A 4UNIA 1J39A 3JQRA 4W82A 3UGQA 3LIIA 1HDGO 3TIFA 2O2HA 3SNHA 4DVGA 4H17A 1AK1A 1BS1A 2VDMB 3JVUA 4O2BA 1D4AA 1G5RA 3U5TA 5H5JA 3WJ2A 4JJAA 1N7JA 3WP0A 3PXCX 1M0SA 2BH9A 3MJHA 3C3YA 1PQUA 2FMFA 1RYNA 3O82A 2PA0A 1LWNA 4QJ4A 2VP9A 5FBVB 3LC7O 1OJLA 3QIVA 4EEKA 2BEVA 4IKEA 3PKZA 5KQMA 3E5RA 2PFSA 2OL4A 2FFBA 4ZYTA 2H11A 4RSMA 1QORA 2VSYA 2D59A 4GKJB 1L1RA 1OOEA 1AKMA 3E22A 3QWBA 1JBEA 1XXHA 3FPSA 4I8XA 4CHTA 4KQEA 1N6HA 2PMCA 4MWEA 2WJIA 4UXHA 2GX6A 4W9NC 1TKAA 3VBCA 1R8JA 1W4RA 1X70A 3EIUA 4RFVA 5HS4A 1IJBA 2JHGA 1KPGA 4MW5A 4ZK2A 4MA5A 4DB4A 1N2CA 3B3JA 3QNUA 3VO1A 5BW8A 4RZQA 3QU7A 3TWOA 4D02A 5HF5A 4V1CB 1K88A 1TJNA 3EEOA 1UBRS 5AVSA 5AXBA 1BHJA 1BQ3A 2GCGA 1D7OA 1EDOA 4LWOA 3O03A 1UADA 7MHTA 2BMFA 1MG5A 4I3FA 1M8PA 4YCSA 5JW6A 3JALA 3NTRA 1AY0A 5T7BA 2PWAA 3AESA 4WESB 2FRXA 1N2GA 2V6BA 4LYFA 2Y05A 3E9YA 3NETA 3L7JA 4RGQA 3LVFO 4ENWA 1P4JA 3W6UA 4PAOA 3ZWAA 4N3BA 1G9TA 4M0PA 3DEIA 1J0BA 3D8BA 3G9XA 1E20A 3LKZA 1U31A 2C99A 3WQHA 2M9MA 4P08A 3DAGA 1JLSA 4ATNA 2GZ1A 2OKCA 2L18A 4IS2A 2FFJA 5KNDH 4FHZA 5CVVA 3BWVA 2PO7A 5FOQA 1LSJA 2VQEB 2HA6A 2JAXA 3JARB 3LX6A 3TTXA 2P1DA 2Y1OA 4RQUA 4YWJA 5MGBA 1SZPA 2PL9A 4N3GA 4V0NA 2IY7A 4DIEA 4URUR 4ZO4A 1VM6A 3N0RA 2UYQA 2QRZA 2HM7A 4B48A 1MTOA 1NQAO 4PLGA 1MAUA 3GJ5A 2LV8A 2ZWMA 3H9CA 3O75A 2PGXA 5CJPA 4AF7A 3G89A 4CLRA 2EARA 4D5EA 1US8A 4MIEA 1TKBA 3VFDA 2D1RA 1SOVA 1MORA 4QUJA 3MJ4A 5KNDD 1EFPB 4M2LA 1KC1A 3U39A 4TRNA 3TL2A 3EDMA 3L04A 4BV3A 1YRHA 2A78A 4BLPA 1B76A 2HMWA 4GECA 1T10A 2BE7A 2R8XA 3DL7A 3UNXA 5KYNA 1U5AA 2F3TA 2JIZA 1DWOA 1DMSA 1Q3KA 2X9GA 3EG9B 3ND6A 1QYRA 4EY5A 5A3QA 1CYEA 1DPGA 3MW8A 1B4DA 4ITRC 3A3KA 3CX8A 3E70C 3IAFA 4Q19A 1EX9A 1TOAA 4ZC8A 5BR8B 1U8XX 3OPVA 3R0XA 4R81A 1VB3A 1VPTA 2Z56A 5HIIA 3N39C 3V55A 5C9ZA 4PO8A 1AQ6A 3JWJA 3WLHA 4ILEA 3EZYA 3ICQB 5DN6A 3ASUA 4I2VA 2FEWB 1O9HA 2PRKA 2B98A 1G66A 2H1FA 1DEHA 4HNHA 4ND4A 2YL2A 4ITUA 4WRRA 2CWWA 1JS1X 2ESRA 3BRQA 3BGVA 1DHTA 2ZJBA 1KDZA 1V1MA 4F9FA 2YC4C 3I9V1 1ORVA 2QEQA 1LPPA 2I4TA 3DL4A 2VH1A 4FR5A 4KW7A 2H92A 1ONPA 2FUNB 2XKAA 2FOIA 3D64A 4LOHA 3L1VA 5JAIA 2EJTA 4G5HA 1VL1A 2HUNA 2IIBA 3DGEC 3HJUA 4B0PA 1PJQA 4BN0A 4IVRA 4GG1A 1FDIA 1S2LA 4BRZA 2DJIA 3LY5A 4I08A 3NHFA 1T5LA 1EDEA 2C2OA 3WLMA 4AM8A 4FZVA 2OUIA 1Q1NA 1EB8A 1Q0SA 1QFXA 4RE5A 4KAFA 5H81A 3G1UA 4LHSA 2UZ3A 1LDGA 1OREA 1TYZA 1WXFA 2ERYA 3FMFA 3HO8A 4WESA 5DEOA 5DHRA 3NDBB 1P5FA 4MINA 2JFOA 3DFUA 3K53A 2O57A 4YR7A 1GZ7A 5BVGB 1BWSA 4J0HA 4DLYA 1NP7A 3DKIA 3PRHA 4LE1A 2GM3A 1NWHA 2B5OA 4Z9AA 4G8BA 3ZE9A 1JJBA 4UFPA 5BRJA 4IV8A 2DFKB 4BMDA 3AVVA 2PD6A 2ZRPA 1DC4A 3L4SO 4YRBA 1T4BA 4AJOA 1SU8A 3DZJA 5FULA 5T4FA 2C84A 2V9PA 2GCOA 5T8KC 4R2LA 5I7VA 4Z54A 2RSLA 2QMEA 4XJXA 4CMHA 3A2KA 1KEZA 1M6EX 1E6UA 2YXPX 3JARA 3RRBA 5JH7B 1N3IA 2ACKA 4WHMA 4R9VA 5FX2A 1K5PA 4RELA 1J1ZA 4XD7A 4PLYA 2VDVE 3IKMB 4JQZA 4TUYB 3DP7A 1X1RA 4L9AA 4EB6B 1VIDA 1WHSA 2PBZA 4AECA 3BTVA 5ALMA 2VAPA 4GBGA 2VXYA 5CW2A 3F9CA 4OYRA 1UINA 2O8DA 2QP3A 5AKEA 1NW5A 3MSXA 4GPD1 1RMTA 5EJ4A 3H5OA 1L5LA 3FAKA 3IJRA 4FP9A 3IO3A 3FDXA 3OUZA 1UPFA 3D6HA 4DMUB 2I3AA 2VCHA 1M74A 1FFSA 3FKJA 4GZ5A 4OFZA 4QEDA 3OKPA 1YE5A 4M46A 3ND7A 4JJZA 4D4IA 2IHKA 4DN6A 2AOUA 3EG9A 3QUQA 4ZGBA 5HZKA 1L8QA 1UMCB 1W30A 3HHEA 4GLFA 3ZLVA 4PYJA 1J2YA 5AOCA 1RXIA 3CYFA 3U7JA 1HT2E 3ORQA 4D0LB 3OX3A 3T9CA 2V4UA 5EJFA 1QG6A 3SP1A 1KP3A 3B60A 4JXZA 1L3CA 3BKWA 3WB9A 3A9TA 1P9RA 3H8SA 2DPMA 3P2EA 4BP8A 2WZDA 1NGSA 3MS4A 4Q34A 3ZBUA 4KX3A 1ZEMA 2ZT6A 4A8JB 1NQTA 4EO9A 1CR2A 2II6A 3L6BA 4WNIA 5CA1F 3KWFA 4DV3B 3N0WA 5ALKA 1KETA 1T0HB 2P68A 4GI3A 4MRSA 4OGWA 4JGBA 3TRJA 3ZHSA 1Z62A 5TDHA 1RM5A 3L7OA 4FNAA 1MDFA 4UNSA 3ZK8A 3G8YA 3VHLB 4NYIR 2JLUA 1VI6A 2XXJA 5TPZA 2FXIA 4MGIR 1A9ZA 1E77A 1M2OB 1RPJA 2JKVA 1S8OA 5CT6A 1DCKA 4E31A 5FLEX 4PNEA 1XA0A 3HGTA 2VSXA 2WSYB 4KKXB 4CL0A 5C46F 3UJ6A 2J30A 1RJFA 3P0EA 3DT9A 3S2IA 4M1OA 3EGIA 4G1EB 4XEHA 5DPMA 1GA4A 3DH0A 3OY7A 4MGEA 4UPDA 4DCSA 2EW8A 3VNUA 3VOBA 5BVGA 1EHIA 2GS9A 2GNOA 3C3AA 2QMZA 5ENDA 3FKQA 2HEIA 4M83A 4MYTA 3EY9A 3W3AH 2M98A 2PCJA 5BRNA 4D3DA 1ZFNA 1YS2X 2PZKA 2RHJA 3ANNA 5AVUA 1KVRA 4J3FA 5HKAA 1YFJA 2XZLA 2X42A 4DJTA 2PXXA 2R96A 3NIWA 4MYRA 3HNRA 3IRVA 5I9LA 1ZMXA 1X9HA 4M3NA 1UDWA 4E5NA 1JILA 2F6RA 1F0PA 4HAIA 4IG9A 5JH7A 1CRQA 2P8SA 2ZYIA 5JS7A 1AHHA 1QAMA 3KKMA 3X3HA 1VJTA 3ZWDA 4Y8VA 3FUUA 3JQ9A 2QXTA 3MG9A 1YNOA 4MJ3A 3NHWA 2IU0A 3W3AD 1H2XA 3ZDQA 4RFLA 2ZB7A 3TBKA 4N5IX 1UXOA 4EGFA 2BJWA 5ALQA 5CXUA 3K0BA 4XGNA 4D44A 3AI7A 3PPWA 2WDPA 1IUKA 5KYYB 1EHYA 3I2KA 3E3AA 1KMQA 2R11A 2DWQA 2HFJA 3Q6NA 1FYEA 4ZT4A 1FTSA 1UH5A 3ZNPA 2YXEA 3N2YA 5LA6B 1AKYA 3OI7A 5DYIA 4WNAB 2NO1A 5BNFA 2VQFB 4L0CA 2OV8A 4MLDA 4X45A 4DLKA 1U8FO 1V8PA 2ZUSA 1OT3A 3VYRB 3RM3A 3OU6A 3WXMA 3DR5A 3IPYA 3ZWNA 2L19A 3B5IA 3DHYA 3OJWA 1U1EA 1R6BX 5ALDA 3AY0A 2QDXA 1GCOA 2JFYA 2QYHA 3EDQA 3HSSA 3Q88A 2J9FA 1ZK1A 1N0WA 3SIRA 1Z38A 5KS2A 4WZ6A 5E1MA 3SHVA 3FF4A 1U2RA 3HCCA 1I2AA 4Q6BA 2A30A 4WDRA 3J7AC 3WDLA 5EE3A 2P2NA 2JJ1A 2GCNA 1EWQA 2ACEA 3BSSA 3O9MA 1I0ZA 3JZDA 4EHAA 1JIVA 2I4NA 2XGOA 2HDWA 3IERA 4ACAA 2XUGA 2XJ4A 1M67A 1UC8A 4GOLD 2B69A 3Q7TA 3HWRA 1SO8A 2CBGA 2QOEA 6YASA 4EGSA 1X92A 3UK1A 1WVIA 4AZ0B 4D0RA 3NBKA 2WJWA 4KWIA 3KQNA 4PQYA 121PA 3FPAA 4WL0A 1XC7A 1T1SA 4LJ8A 1W73A 1IN6A 4IMPA 4RQBA 1DX4A 1YXMA 3K5WA 4OXYA 4B3TB 1PR1A 1M2OA 2FPSA 4LJ9A 1FLAA 5TJHA 1NYLA 1VG1A 4GZMA 3LVRE 3OSZA 3G9ZA 1KKLA 5JZ9A 1NY5A 3STUA 4IICA 2P7HA 4CEHB 4M21A 3FB1A 1I7QB 3Q9LA 5EFZA 4N47A 1HMPA 4B5LA 1O2DA 2JW5A 3PHCA 2CLCX 2YY6A 1NM5C 2AZDA 2EP5A 3EOZA 3KAKA 4NI5A 1RKXA 5I6DA 1J5EB 1M83A 4KFCA 4G8CA 2DPHA 3L82B 4WDQA 4YLEA 3SDZA 4ZC1A 3E9QA 4C89A 3AUUA 1ECGA 3NTXA 5EEHA 3NV9A 1JA0A 3P45A 1X1CA 2NSLA 2AJLI 3QELB 3HI6A 3HYNA 1W75A 3DTYA 4B17A 5JJBA 2Z1NA 3O0TA 4OYHA 4CR8A 1ZINA 5CDFE 1A9SA 1CEEA 3SHOA 4R2JA 4TLEA 1R4MA 5EKDA 4EA6A 2QTWB 2QUZA 4JV5B 2NZUG 1EDDA 4P4GA 3LQ1A 5C7YA 2QRJA 5JS6A 4B31A 2BD0A 4KWCA 3JAKB 2G8LA 3TKAA 4JZKA 4I1YA 1MJ5A 4BUJA 3WB2A 1PNQA 5JZOA 2XBMA 4BKUA 2RH8A 2BRUA 5KYYA 1XQXA 5LNK6 2WJ3A 1N6LA 4B3MB 4JC4A 3ZTYA 5SZIA 4BFXA 3AJEA 3B7PA 2JLCA 4OI2A 3IVRA 4II7A 1W94A 3NTQA 5LA6A 4JI5B 1JIXA 2YVAA 3DWFA 3JTMA 4LF6B 2Q21A 1RJGA 2WAOA 4KE8A 4RKWA 2OBFA 2PMWB 3GIWA 3WL3A 4BP9A 3GUZA 4EDHA 4KIGA 3PDIB 4IILA 4RHYA 3K96A 1YS6A 1FDUA 2XB9A 4AN4A 4ASUA 3QUCA 4J3NA 4K88A 4DS3A 1HV8A 1MA0A 4GX2A 3HFRA 4RSRA 4AJJA 2AYXA 5E6SB 1QONA 3W05A 1W5FA 2PO5A 2XT6A 1QFSA 3G2PA 3ZD6A 1NQWA 3QU2A 4NAUA 4RX1A 4EUFA 1CZNA 1YKGA 1ZUD1 2RGUA 1TZMA 3H97A 1X7GA 3IAS1 1S4MA 4IFTA 1X1TA 4WLUA 4YAWA 3VNSA 4AZ0A 3TG2A 4DGSA 4RF4A 1AURA 1VDMA 5JNSA 1E2EA 1L7NA 3GN2A 3ADKA 3NOQA 1G64A 2JASA 1OWLA 4EABA 2BEJA 4M0KA 1UQUA 1UJNA 5K3OA 3E5HA 4RD1A 4BV9A 4DMCA 2ANBA 3Q6IA 2GSDA 4IRMA 1KNXA 4IXNA 4QC2A 2YIJA 2WC1A 1CUBA 4HWRA 4UHDA 3RTBA 4Z3DA 3TTVA 4CEHA 1D6NA 1M1NB 4OOEA 3PK0A 3TZCA 1PR9A 1OFHA 2O2YA 1XX6A 5EHIA 1YZYA 1T0BA 2AEMA 2D4AA 2P2GA 5L3ZA 2W2KB 3FJYA 3CEMA 2JGKA 5ED4A 5A9RA 1WXGA 1Z37A 1KI8A 3BSFA 5ELLA 2OFOA 2WAYA 3QLTA 4HXYA 2FP4A 4IIDA 1E32A 1JSLA 2VLIA 3ID6C 3ICPA 3LXRA 1GKUB 3QELA 4KZKA 5UKDA 3X1XA 4DCJA 4PG8A 2I65A 4YRJA 4F1WA 4URVR 3K6JA 4KXFB 5IWAB 2O59A 1EU1A 1ND6A 3ZV3A 2W83A 2WE7A 3T7JA 1QK4A 4C9BA 4NESA 5CHEA 4HB0A 4ZMSA 1Q7CA 3CUEF 4X1KB 3JAKA 1G5IA 2OECA 2WFMA 2CF5A 2DR2A 2AOXA 3K09C 3D59A 2G06A 1VE3A 1AK2A 1C4KA 4GOMD 3RBVA 4BJHB 2IOFA 4N41A 2JRLA 2QSZA 3A3NA 5DOZA 1TEZA 4PFJA 3IAS6 1C2YA 4QUEA 4D9MA 1VKJA 4PONA 4EPYA 1I3LA 3PQ7A 1EGHA 1PE0A 1H8ED 3E23A 3ED1A 4RKEA 3UO8B 3ZR4B 1OFIA 3NR2A 3OO1A 2AOVA 3HADA 3I5XA 2XT0A 3L49A 1UDAA 3U6BA 4YRFA 1CS0A 1VMDA 4K0RA 1DLJA 4DLPA 3FFBA 2YWXA 3DPIA 1DINA 3GIDA 3VA7A 5EGNA 1P7ZA 3DS8A 2FF7A 3ITEA 4L7QA 1XZFA 4GPEA 3K0FB 4OP3A 3UK7A 3V7UA 4CMCA 2YYAA 3F90A 3PE6A 1GJRA 4HGOA 3O1IC 5D3MB 5E6SA 4ZJUA 2QA5A 5JQGB 4L27A 3GRZA 3MGAA 4CZ2A 5LBIA 1GZSA 1K5HA 2AE1A 3IPLA 3OLWA 4G5OA 5IANA 3OEHD 4RZSA 1G7CA 4R98A 3PXDA 1JP7A 3TCXB 3VTKA 4DR7B 2PUWA 2EJBA 2LNDA 3GQVA 3ZWBA 4UU1A 1JEQA 4BQNA 1UJ6A 2Z98A 3J80A 3C16C 1YAHA 4CUKA 3V7YA 5B7NA 1OMOA 1QV9A 4ALKA 2H5EA 1IBSA 2IYYA 4G1BA 4CIDA 1N34B 4I46A 4O3MA 4HNGA 4GL2A 3BMCB 3L7BA 3VXKA 1FNCA 2N0SA 3MJFA 1H9AA 1YGPA 3EQ9A 1P7WA 2HJHA 3O47A 4WEOA 3AEQB 5KNDA 2OCAA 2XAUA 3A10A 3SQNA 1PGJA 1CY0A 1XRNA 3ZDZB 1NMQA 4D6XA 1B8OA 1Z36A 3GZTB 4WT7A 4ZI5A 1SU7A 1PP4A 4WKOA 2Q62A 2VVTA 3AHIA 2QDKA 2I4OA 5JXJA 3KJHA 2WU0A 1LGYA 1JNYA 1VLQA 2QSUA 2ZUUA 3AW9A 3OVMA 1GT91 3FPHA 4PGHA 1JYEA 2BDUA 4R9SA 4PPGA 4BEJA 3B7WA 4Q6WA 3VUFA 1G59A 4LF7B 2HIMA 1BYUA 5L8VA 1YQXA 2QIOA 3L77A 4LBWA 4M0FA 1MTZA 1Y33E 4FSDA 4TV9F 4ARBA 1TPZA 4E3WA 5FFNA 2DBYA 2WJVA 2HRDA 3CZ9A 1ZX1A 2LUOA 3DWEX 4J07A 1YZFA 3TPZA 4UATA 3CRQA 4L2IA 2IU6A 2QY9A 3CO5A 1YF3A 4M1QA 3VJRA 1A27A 3LZCA 4ARUA 3FRJA 3KHTA 5TMEA 1RZVA 4LRYA 2M6LA 3RIXA 1RC0A 4DGQA 1NT2A 2OLJA 2ZANA 3BIWA 5AI4A 4X7RA 1JAHA 1K2VN 1W6RA 3P8ZA 1VXOA 3WK6A 4S1NA 2E4VA 3T3OA 3RE1A 1ICEA 3G7UA 3WNZA 4PSAA 5JPCA 1MEJA 3EXG1 2R8ZA 3OCYA 4I9UA 3DMPA 4KOAA 1NG9A 2IH4A 2WWHA 1DO0A 1O9GA 4KRYA 4XEUA 2O8NA 1AS3A 1KMMA 3D0QA 2RGNA 3SJAA 1GTL1 3ZNOA 1N7GA 1IY0A 3KIPA 1CJTC 4XWWA 4BGUA 4ZTZB 2WMDA 3LOUA 1GNTA 2PK3A 2MYUA 4KGDA 1WEHA 2WWRA 3LX8A 1QWOA 1CZOA 3TRDA 5A4AA 4IJ6A 4PY2A 5M3BA 4QSHA 4FI3C 1L7DA 4F96A 2UKDA 5LLSA 1Y7HA 5KJ6A 3K0FA 2CJWA 4QSMA 1U0OC 5FA5A 3QK7A 3GEIA 5JQGA 2C2MA 4JJIA 4V02A 5JY1A 4P84A 1V41E 1LVGA 1ORTA 2XWJI 4O4HA 1GQQA 3RVPA 1XYYA 4BNYA 4BX3A 4BX9A 5L6MB 1DXQA 2WG1A 3B2NA 1GSHA 4KYIB 2AI3A 3G5TA 5FPPA 2IRWA 3CWZA 4AF8A 5HQ3A 2SHKA 2PZEA 3RWBA 4E03A 3NHYA 2NQTA 5I7OA 4FHCA 4GNKA 3QFCA 5EC8A 1SC9A 4HMQA 4PYKA 3TGPA 2P8JA 4DMKA 3JS5A 1XR3A 3W9BA 2VXCA 1WMFA 3QFHA 2QAIA 1H9BA 4HOYA 3JQCA 4QVGA 5KMGA 5EKTA 2WJGA 5IF9A 1A9YA 3AEQA 1THTA 1PS0A 4TWJA 3GPLA 2LCFA 2GM4A 3H1GA 5DRYA 2HAEA 5TIIA 1CQXA 4PC2A 4AXBA 3W5SA 1TXGA 1UM9B 2ZKIA 3CNQS 3PUXA 2X4GA 1VL8A 4IJWA 4NBNA 1ZMOA 1E66A 1ZICA 3LT4A 1L4KA 1ITZA 2QPLA 5AM0A 3U9SA 2ZZMA 3FCXA 4DRXB 4ZYXA 5DNEA 2EKQA 3TLJA 4RHXA 1Q17A 3MSCA 3NGMA 2XMRA 3AUFA 5DVZA 3ESQA 2G76A 5DM2A 1I5RA 2IYLD 1G1AA 1Q1AA 4JSTA 5KHAA 4DUYB 2OBXA 4D9FA 1EGQA 1LCIA 1Z39A 2G9RA 2WVAA 4P8RA 1CE8B 2F9FA 1C81A 2VHYA 4UDYX 1XRLA 4NPHA 1ZD8A 2X5OA 3DVRX 1BKSB 3QTLA 3HP1A 3HXLA 3MMNA 4CQNA 3AY6A 3WWCA 5EJ7A 2OORA 2DWPA 3HVIA 1JGTA 4HDCA 3UZUA 3OZIA 3KSDO 3N76A 3SYNA 1MOPA 1SIWA 5GONB 4BO4A 1FYVA 1OBHA 4Y9DA 3DAHA 1RS0A 2DWUA 4DR6B 2GETA 2X9VA 3F97A 1PLKA 2I8CA 2C31A 5JAQA 1Q11A 1RI4A 1W4BA 2N46A 2PVSA 4X1IB 5DOVA 5A04A 1HKHA 3K6KA 2QT0A 3JASA 5IKMA 3J81k 3W6ZA 5M5BA 5T8KA 1W9MA 3AIMA 3UT6A 1A3CA 5A7HA 3ZBTA 2PNJA 4WTOA 2F3PA 5J4HA 1TJ5A 2HO5A 2W2QA 3I64A 5U4XA 4OTZA 2J33A 1B2LA 5J5CA 3ENQA 5FOXA 3HA3A 1UKZA 2R1TA 4E5KA 1XPRA 3TIVA 1CS4C 1J2EA 4OL9A 1E2MA 3SJCA 4GGPA 1CRLA 4IUBS 1UFQA 3UJHA 2AD1A 2QJOA 1DKUA 3H9QA 3L9WA 3V4LA 3DF7A 1Y3FE 4KPUA 4C0XA 4B81A 2DR0A 3BMQB 4HAZA 4WKCA 1JPUA 1ZUWA 4PRLA 3T9DA 3WFZA 1TK3A 4DBLE 3DNFA 3M70A 4JIGA 4YV7A 2BFCB 2VZ8A 3ZNNA 4CVNA 1Q7TA 2J9RA 3BFVA 1PJTA 4WASA 4EO4A 5DDIP 3ENZA 3E9DA 4N5MA 3HK2A 3NC0C 4I14A 1XRRA 4JU8A 2PMFA 3KUDA 3QOYA 3ZE6A 5I7HA 1MMFB 2C4UA 3ZN2A 3PE3A 5LMCA 2IYEA 1R5BA 1XPOA 4Z8YA 1J8VA 3DBVO 5EHQA 1SH7A 3GDWA 3W3AA 5FUQA 4A26A 1DV1A 1DX9A 1JNXX 4Z0TA 2AI1A 5FHQA 2IF2A 2P27A 1U3CA 2HLNA 4OB6A 1W6UA 3LXXA 4BS9A 1PQWA 1HA3A 1VMAA 3N8KA 2VYFA 1T1RA 5C52B 4M8SA 2HA4A 4AJ9A 2YHSA 1FOEB 3G85A 3QKSB 4MYUA 4A8PA 3QHPA 5JCJD 4EUHA 5IUNC 2QTAA 2Q3EA 2VNSA 1XQ9A 3HV2A 1H6CA 2G5CA 1SKAA 3HCWA 3SYTA 1SELA 1KK3A 1U0GA 2AEJA 2JFZA 1PGNA 3BD9A 3ZE7A 1GD1O 4IV0A 3T5AA 5CFOA 1B15A 5FJJA 3FTQA 4FNGA 4NJMB 2I76A 1DAGA 3PL5A 3X1MA 4K6HA 2B4AA 3GJXC 1PV4A 3WBKA 1MO5A 1H8HA 1L5HB 3TAUA 1H6BA 2DQZA 3GUCA 3ONNA 4U1RA 2Q0SA 1WA5A 3AI1A 4OHVA 1JX6A 3MTGA 4KDEA 5F21A 2CNBA 2WHPA 4F06A 2BGTA 2TYSB 5FCDA 2FWIA 2PT6A 3JSXA 1EVYA 2QUBA 3FSEA 1PVDA 5K0TA 1UBMS 2REXB 2H4ZA 3PFNA 5A9TA 4AC9A 3FWKA 4BJ3A 2WZCA 3O93A 2OG1A 1MFPA 1XRMA 3R7LA 3K9FC 4WLVA 2FCAA 2DSTA 3PNSA 3QSGA 4NYMQ 5JH7F 1J06A 1BE6A 3W7BA 3ZE0B 3AIOA 4QUHA 2YJ4A 2IS6A 1GEEA 4OQ4A 2IWRA 3HDQA 1PVVA 3PC3A 3NH9A 4MS4B 3IUQA 4TUYF 4DQDA 3H5LA 5LKRA 3IP8A 1K8ZB 1KE1A 4FD2A 3TQCA 1QHHA 2H4YA 2WMNB 3WYDA 3BXEA 1Z68A 2QMOA 5IAOA 1TCAA 3NDJA 3RRFA 2R2GA 4GYJA 4B6EA 1T9ZA 4RTKA 3MERA 2RAFA 4OLFA 3Q4GA 2D4HA 3MWDB 4MRRA 4IIGA 4NQZA 5IBQA 3W2IA 3ZKWB 1GAEO 1M1ZA 1FYXA 4CIVA 4PQRA 3B6KA 3ZHVA 4E13A 3L0DA 3FPGA 1KEUA 4RHUA 3I9KA 2SICE 5JNRA 1UK9A 1QE5A 1IN8A 1II9A 1JDNA 1NONA 1COZA 2O06A 1KKMA 4QWWA 4YT5A 1XI2A 4C7XA 3OIWA 2I7VA 1Q6ZA 4RL4A 4MVJH 3PSHA 2QVBA 1D1SA 1YHZA 2C9BA 1JBQA 2RHCA 2WU8A 4I50B 3RT9A 3WSVA 4ZHQA 5JJKA 1NOIA 1DCMA 2K7ZA 4X8OA 3ZWCA 2N3ZA 2ZU6A 3UHPA 3R7DA 1VLJA 2CZCA 5LU8A 1VB5A 2QX6A 5LUAA 1ZH4A 4W8HA 3RVDA 3WNVA 5J47A 3EXIA 2V7BA 2WF8A 2X23A 1ZPDA 3LT5A 5K0SA 3OE5A 3HQ4O 3ORRA 4QU8A 3O84A 1V48A 5G41A 4Q7QA 1VI2A 1TMOA 3ASVA 3UJCA 3EJ6A 4MVJD 5K05A 4NZZA 3JVVA 4NCXA 4Q4AA 3GJ6A 1I2CA 2ZIWB 4FN5A 5THQA 2VDPB 3HBJA 4CN8A 1KRHA 2OFFA 2JLSA 4B3RB 2YWFA 3T94A 3RS7A 5HM6A 5GIPE 2FZEA 1DT3A 1JV2B 2P2SA 3NANA 3MGBA 1VRCA 2OXFA 3NBZC 2ZW9A 4C4TA 3JR3A 2B3TA 3P1JA 5IJZA 2HRBA 3ROKA 3BMNA 4NJMA 4FCVA 1P81A 4R71A 3GEDA 3RTEA 3GFSA 2ZBEA 1JU4A 2X77A 2XEXA 3H16A 4HAXA 3FZYA 4OBWA 1RE0A 1Y7PA 1GRQA 1I9CA 2GK3A 4MS1B 1E6CA 1FP4A 4NNJA 4WK4B 2PR2A 1L5HA 4DCNA 2R7NA 1CF9A 1Z08A 3PC8A 2Q1XA 5BMVB 3VJKA 1N92A 4OJMX 1M1YE 3IMEA 4RVUA 4C3ZA 3RD5A 1GP2A 1IJFA 3ONWA 3AYZB 2PL3A 5JPIA 2FW0A 4Z3OA 3RGGA 2O3RA 1NM5A 3H65A 4YAKA 4IIJB 3CUKA 2P9ZA 2AHRA 1SCQA 2C9OA 3BFJA 3LUGA 3AG6A 2WIDA 4G26A 4X84A 4CMIB 1PZXA 1QPGA 2QV7A 4U7PB 1KYZA 4P4TA 2X40A 2R2AA 3ABIA 1NBMD 4GHWA 4MUBA 4RVGA 3OEED 4Y6LA 4TWAA 5LXTA 2F8TA 4F86A 1Y6QA 4FCCA 2D0DA 3SM3A 2H57A 3C6KA 3HSYA 3T4PA 1F8FA 1YRWA 5ITZB 2IXDA 3TVYA 3FM9A 3OLCX 1JDVA 3AFMA 5H3LA 1RRVA 1PYOA 4FT2A 2DFTA 2Z8XA 3IOBA 1Q19A 2VPWA 5LA6F 3NIFB 1X1DA 2O07A 3CMMA 4WLEA 2ZJ3A 5FA6A 2OCXA 3UJPA 4GYWA 2ZWVA 2PUEA 1JLRA 2YJ6A 4FHDA 2QVGA 3KP1A 2XNJA 3LOPA 4JR2A 1I3KA 1RYYA 2J48A 4DCVA 1BVHA 4LZLA 1QHSA 1F60A 4HZIA 3NRJA 3SLKA 4DV2B 2R62A 3EVZA 1DAMA 3HB0A 5CIQA 1ML3A 1XGKA 2NSDA 1TYAE 1VKHA 3KQQA 4LG1A 2ODQA 3B9QA 3VYSB 1JHRA 3SF8B 4A2WA 1U99A 2D74A 3D4NA 1LPSA 1UBCA 1U5CA 2NU7A 2Y77A 3M34A 3RVJA 4ZDKA 3ZS8A 5CA0B 2FDCA 2HPAA 4MUAA 4LE2A 1BO6A 1QKJA 4Z2YA 3HU2A 5KJ1A 3H2KA 3WRWA 3MTBA 5AI0A 1PZEA 1R9MA 4LYJA 3RASA 1WD5A 2VJQA 3HKCB 5BQ3A 5KWVA 2ZCJA 1PJRA 2VJOA 1P29A 3E7FA 3SMVA 3C3WA 3QE4A 2NUBA 1TMGE 2VATA 3Q5GA 4JODA 3USES 2OSBA 4ENUA 3RAFC 2JHAA 3CH6A 3BT7A 2FPIA 1I33A 5EZ5A 5BQPA 1J8QA 4JMLA 3KSRA 4ZAWA 4D74A 1NX6A 1U5BB 3CINA 1BH2A 1D3AA 5EJAA 3V2IA 1SBNE 2RGBA 1P2GA 1G8GA 1XDWA 3ONDA 2QJWA 4CCYA 2O4UX 1PR2A 1PAUA 3TIGA 4A0HA 2VNJA 5BWCA 3OBIA 1C3XA 3P2IA 2M2IA 3BF7A 4HQOA 4PG5A 1FMCA 3B2EA 1FU4A 2C7BA 1PDVA 1OCEA 1YD7A 3C5EA 3NAMA 4LJ4A 4CKBA 5BSEA 2C03A 1BFUA 2NU9B 2D2XA 1BHO1 3MUFA 4X93A 3A58B 2A1TR 3KLNA 3E7XA 3BZUA 3CF6R 5G0TA 5BMVA 3HB9A 5FRDA 3K4HA 2GILA 4J0CA 5HJ7A 4RTMA 1XZCA 2Y9PB 3HVJA 3OEHA 3T8YA 2KHZA 1W44A 1PDOA 2OZEA 3GDGA 2OCKA 5HJ5A 1S8NA 4IIJA 4AX4A 2OAQ1 2G70A 3AERB 2VA9A 3M3DA 4BUCA 3QMWA 2C3PA 1SU6A 3B13B 1MQSA 4OJKA 5EZYB 1NJ8A 2AB0A 3LQ4A 1V3VA 4FFBB 3UG7A 1EJBA 5CLJA 4J0JA 3WI7A 1QGAA 5DXJA 2NPFA 3CJTA 3EPPA 1JJFA 1QZZA 2AN5A 2ZT7A 1F8XA 4NARA 1RBYA 4X1OA 2O54A 5ITZA 5ERGB 1VSTA 2V5VA 3M6IA 2HIAA 5EZQA 4G0NA 1VE7A 5KOHB 3U3MA 3GEMA 1X7WB 3OOYA 3SZMA 1TJPB 3JVEA 5EJ5A 4H7JA 1R9NA 4I9FA 1AZSC 3KQVA 3RTDA 3GZNA 4DQXA 3KOYA 2YWDA 5SZKB 1Z16A 1EDZA 3ANYB 2DSNA 3P2JA 4ZVLA 3K09A 1K86A 1QVRA 3F3MA 3PEUA 5TMDA 1QB8A 3JU3A 1QAOA 4MP8A 3BGSA 4MARA 5LQSA 4YMUA 5A3VA 2BFFA 2PX6A 3KV3O 1AQNA 1AX9A 4LRXA 3KT0A 4ID3A 1A8QA 1XTSA 1SKBA 2XDAA 2ZSIA 3I5MA 3PVZA 4EW1A 1B8UA 2ATEA 4EH1A 2I6UA 4YYZA 4QGHA 4AO8A 4IIVA 2HH9A 3TTTA 4GOXA 3V1NA 4R8VA 4PAMA 3NYQA 3OOEA 5LZ4A 2IYWA 5CA0A 1NYRA 4GLBA 4LSMA 3GG2A 3L43A 1O96B 3U1VA 4LJ5A 4N0DA 3GVPA 4EB3A 1U9IC 4FILA 1N2HA 1Q14A 3AU8A 1XEWX 4XLTA 5JATA 3EGEA 4D6PA 4LF4B 2A59A 2XNDD 4Z4QA 1G21B 1CDEA 1XQ1A 5HCIA 2WWTA 5JMWA 4UDOA 3QEKA 1XA3A 1DIOB 4B6OA 4HNRA 3K1JA 4OMFG 3S2GA 3V7FA 3U7EB 2DBVO 3AXTA 2Z8YA 4UMEA 1IQRA 1KIFA 4D56A 4JYZA 4DIBA 3P0RA 2JJMA 5AO9A 5JMOA 2JCYA 3R7NA 2RONA 4YJFB 5K6AC 1NVDA 3BCUA 4LFCB 2XRZA 2KW5A 3KL2A 1U8AA 6REQA 1XZMA 4WE3A 1KWKA 4R54A 5ARCA 1XWWA 3RYHA 3W2GA 3IEIA 4D41A 5TJ9A 3E5MA 3ILHA 3OKAA 4KWTA 4OK5A 4PCUA 1MNQA 1PW5A 4C6SA 2CK3A 5EJ2A 5C34B 3UMCA 2H4FA 4M9UA 1N25A 5FXMA 1CHDA 1IHUA 1R7RA 2BM9A 3FPCA 3NCTA 4DDTA 1U63A 2H00A 2EZ9A 2VYVD 4MPTA 3V8QA 3R40A 3KQOA 3GF4A 3IEMA 5CIWA 2HT1A 3EDRA 4I6EA 4W5JA 3VGJA 2R7AA 3GH3A 3V97A 4WJLA 2AH5A 5GY7A 4YAEA 4NG4A 2G82A 1TAHA 3PHBE 1OILA 4JR0A 1Z5VA 1E7WA 3PCRB 4HN9A 2AFRA 1WVGA 1BMFD 2VBIA 1SHLA 1G9XA 1F9EA 3MHPA 1RP1A 3A6HA 5HIMA 1U3WA 1KQNA 5LIPA 1IXZA 3BWYA 2R97A 2ATCA 1T4DA 2J0UB 3ZCSA 5FTLA 2IHYA 3AVYA 2G4VA 2W6QA 3I01M 2HA5A 2P2ZA 1EYZA 3RF6A 4NU6A 3ASYA 3AP3A 1H5QA 4PLWA 3WSTA 4C5CA 1WSAA 3G9TA 3I6MA 4BMXA 3W90A 4E7PA 2C7QA 3LMKA 5FF9A 1WNTA 3ILXA 3DM5A 3CUTA 4QM7A 2BFEA 2HJVA 5PGMA 1PFQA 1OKKD 4GXRA 1I13A 1RAAA 4R9RA 1AS2A 1KQFA 3PFBA 5DIFA 3IEVA 1ZSYA 4D0GA 3GGSA 2WYUA 3TLAA 1P7PA 1C3JA 4S24A 5CXSA 2BTOA 3P0IA 3ZHOA 4XUDA 4AUKA 2O3UA 1SD5A 1MEOA 5F3RA 5DO9A 2G3YA 4BJ1A 3K92A 4N3AA 4EVQA 1CY8A 1XQWA 4P53A 1WDTA 2A2ZA 2GZDA 4WA7A 2AW3A 4RANA 3AV0B 2HRCA 2XB8A 3FHJA 3I4CA 3GX1A 3HCNA 1V4NA 4BLVA 3LA8A 1ETHA 3EXHC 3BE5A 4BQOA 1NXOA 2HV8A 4MI9A 3RR2A 1O96A 4R8KA 4A2CA 4LDQA 5JQGF 3MHTA 1MO6A 3W34A 4QRDA 4GRAA 5SY9A 5L3RA 3TD2A 2QP4A 2PQ2A 1G21A 1M2VB 5HP4A 1ZVVA 3IE2A 1ZIDA 3HEAA 4WXPA 1R5NA 3NEJA 2GTIA 2YMLA 1BMDA 1SCKA 2B0CA 4UXIA 1TJ4A 3GBVA 1N1GA 1IOZA 2AEEA 4K2HA 3S2FA 1VIVA 1YNSA 3E5NA 1G5TA 2GHQA 2WTMA 4EF5A 2ZTVA 4BRWA 1O58A 5I8WA 2VTBA 3QSYA 2OOSA 3FF1A 4ZU1X 3TQQA 3AWDA 2Y76A 1Q15A 4P7FA 4PLVA 4C21A 2VRNA 1C9DB 1P1CA 1C3OA 2F3UA 1GZDA 3VYTB 3U09A 1U28A 4HXFB 4M9QA 4R2HA 1O7JA 1ATIA 1ZD2P 3GXBA 3MYYA 5BSFA 5AW6A 5H1YA 5E1DA 5COQA 3WKCA 4A9AA 4DNFA 2XUZA 4TTSA 5DHQA 2Y2UA 5FWNA 1E96A 2Z2JA 3L02A 3UHAA 4U0JA 1PU2A 1A5ZA 3NBFA 1S2MA 1NUAA 4RNDB 1Z6ZA 4C7VA 3G2LA 3V3TA 3QPCA 3OHPA 4PR0A 3D2AA 3KSZO 3SXUA 4R1PA 3OIUA 3V34A 5JAUA 1I7SB 1B7GO 3E2PA 3E3LA 1VMEA 2WPNA 2O5RA 2Q0HA 3E0QA 1YTLA 1ZGAA 3FZQA 1OQAA 4OHFA 2D06A 1QOQB 4JVLA 5MN6A 1WV1A 1R4NB 2PA3A 4M8IA 6AT1A 3KB2A 1SCNE 1OT5A 1EQAA 2GJ9A 3QPWA 2J0UA 2ZCUA 3OM9A 4Q4DA 5CG2A 1HX7A 4Q1AA 3TI7A 2P6NA 1QDEA 1C3LA 1QNLA 5FV7A 4QOHA 4BMYA 4DR1B 2A9OA 3MXTA 3H9GA 2QTMA 4JVSB 1GU0A 3Q3JB 1HH4A 1U1GA 3U49A 2BSQA 3SHWA 2GN6A 3RFVA 3ACBA 2ZQ5A 5JCJA 1TKRA 4Q5IA 4F3KA 3CNOA 1L3BA 3SKYA 3TLGA 1UOEA 4L5CA 3ZVNA 1J0AA 3FA2A 3BM5A 3LBYA 1T5SA 5LQUA 1BVRA 3I1FA 4OUDB 2AT1A 2BZ1A 4B79A 3OQ6A 2C88A 1JQ5A 1KR2A 2MYPA 1KBQA 1T4CB 1W4CA 3QJYA 3I09A 2I1VB 1LS1A 4NU5A 4N6GA 4ZOCA 5FWDA 1ULHA 3I3SR 4X90A 2HGSA 1JR6A 1CZKA 3DD1A 4JLVA 4YHHB 1SPBS 3O8QB 1DAHA 2V8OA 5EQJB 1ZHFA 2HHCA 4JFAA 1BDMA 1CRPA 4Z4HA 2PSDA 3AFOA 1E63A 4Q82A 2I2BA 3WADA 1AGXA 4DIKA 2GCEA 4Q9KA 1DHRA 2JH9A 3HDVA 5FOTA 1GPAA 3E7DA 2NACA 4HGYA 2EZ8A 3AP1A 2XB6A 1Q16A 3GHYA 2C5SA 2OZLB 3DTVB 4P35A 3ZGZA 2FYTA 5BRAA 1N77A 5DJ5A 2XBUA 2I4RA 2HHAA 4EJFA 1QZXA 3K6SB 4TTRA 1KSGA 2CMHA 3RYCA 3L0OA 2DQYA 2PLRA 3UATA 5DNYB 2CWDA 1VPLA 5L4SA 1J2RA 4MPJA 3BWMA 1KDYA 3W4IA 1JT2A 1OSNA 1YS7A 4IG4A 2F67A 1CR1A 2GD2A 3QZUA 1PO7A 2DCUA 3HWX1 1K8YB 4P7BA 1D0SA 2R4UA 1U0HC 1BWPA 1QOPB 1ZP6A 1NSFA 5U4QA 1P1IA 1SBYA 2G9VA 1BW9A 4KO2S 4UHKA 2F48A 3JAWB 4ZOLB 2P3OA 4Q21A 2UYYA 1RLMA 3ZCXA 5B37A 5FOWA 1ZUHA 3OQNA 1EFCA 2DP4E 3RU9A 5EQFA 3UOAB 3VNBA 1XZKA 1D6JA 5T6BA 4KSCA 4RXMA 4LX0A 4ND6A 3W5VA 3M9LA 4C0HA 3A28A 1DG1G 4YV0A 5J4KA 5JHGB 1MAAA 1PKXA 1Z82A 2RK6A 4F4DA 1P2UA 4L0DA 4CV1A 1W0JD 1N8TA 3UC9A 1H65A 1Z6TA 1KOJA 2NTJA 3IA7A 3E61A 1ENOA 2NXNA 1CUDA 1CY4A 3H0EA 3D02A 4TRJA 4AJPA 4XFDA 1KXJA 4G0QA 4UE2A 4EGAA 5HKKA 1GV0A 5CH5A 1U9CA 4OHPA 3UH0A 1IB6A 2X7XA 3TF5A 2AN9A 4PWZA 2EBHX 2YV4A 1VLVA 5GONF 4FDUA 3VI3B 3A9VA 2GBCA 3DTNA 3HJHA 4R2IA 4ENRA 1DGQA 1XU9A 5EJ8A 3IDSA 1J25A 1LV7A 1F0YA 1XCMA 3QVKA 3BJZA 3FFAA 1RAFA 4I1PA 4LIPD 4MVJA 2PX5A 3T99A 2GZMA 1SQ5A 4W99A 1QLHA 4TS9A 4XE5A 3KUXA 2QE6A 1FMLA 3FDFA 3PD0A 4NHEA 5G1OA 1ZXLA 1H5NA 4CKZA 1J7KA 1UJBA 1EJ6A 2CVQA 4OUDA 1X8JA 2QD3A 1EBBA 3GCWA 5SYAA 3ZLUA 3L7IA 2JI4A 4LXXA 5TGZA 2R1UA 4WV3A 1CD5A 2OQIA 2W6NA 4B44A 2GPBA 5KYGA 3FDZB 2XMBA 4ZOEA 2J3EA 1C7IA 4PS1A 4DEXA 2AF3C 4DJAA 6LDHA 1SCBA 5ICSA 3D5QA 1Z35A 4L6IA 1T9GS 2WWGA 1WMBA 1JH9A 1WQ3A 2C9YA 4GS5A 3BSWA 4KSYA 4RVFA 5EIBD 3CLVA 5KAMA 4H15A 5JPDA 1NVKA 1SB9A 4ZEVA 4F5EA 2K2QB 1F2TA 3TX6A 2YJ5A 4ER6A 3BFKA 1Z7YA 3JZFA 2Y9MB 3W5JA 3LT1A 4MGHA 3C6ZA 3EK2A 3L8FA 1Z0UA 2HQOA 3MUEA 3QOXA 2JLVA 3LUDA 4U2GA 3KB8A 3IV7A 4JXKA 3ZU4A 4E70A 1N2OA 4PYLA 1JW9B 2AR7A 2HSEA 4RW0A 5JSKA 1NBMA 3BN3A 1E2NA 3OEEA 4WADA 2UVQA 3A31A 4MLCA 1QG0A 4HPXB 1O8CA 1KNQA 3K70B 1L4HA 1LXCA 3BZWA 1XUOA 4KO4S 1Z56C 1XMXA 3ELDA 4F91B 5DHAA 1AE1A 1N1EA 4E2YA 4LOAA 1ZOOA 5K2MA 4C4XA 5AW2A 2IE0A 2QM7A 2A5YB 5FJIA 1YAJA 3V6LA 1WNFA 1JJIA 3PHLA 4FGUA 4HR7A 1QHNA 4HDRB 5IKXA 1KHTA 1FS5A 3ECCA 3OICA 3MQ2A 4NFHA 4R01A 4UNQA 1JEAA 4KR3A 5IDWA 1ESCA 1KYQA 2H5IA 4P36A 4QG3A 2VUTA 4AURA 3CZQA 5DP1A 3FI9A 5BR7A 3KZCA 3KWJA 4L9SA 4CL8A 3KWLA 4EG8A 6CHYA 1KK2A 2XKBA 3DUFA 4HADA 1IE3A 4RMHA 1MX9A 4YO8A 4CKWA 1G98A 1XQVA 3I9NA 5KNBH 3G02A 4MUMA 1RHUA 3B8EA 1AKNA 1OBOA 1XDBA 4U3JB 4YUVA 2Q3HA 4DSZA 2A9RA 4JI6B 2VSOA 1U8ZA 4PXSA 3HCBA 4M49A 4V0MA 5GJWC 4MDHA 4B7ZA 1RI5A 1WDLA 5J5AA 4HUTA 2H6EA 2V55B 4JKOA 5I9TA 3U19A 5ARBA 1FFBA 2GVDC 4YMIA 1UZNA 1G291 2YJTD 5L51A 3U62A 2Q4BA 2AE2A 1SUIA 2I7DA 3UF0A 5KNBD 1FJXA 1TQ4A 2HIHA 3PGA1 1WRBA 3D5EA 3R23A 2AN1A 1JLMA 4QA9A 2V74B 3R3XA 5CB6A 2IX9A 3CUYA 3IDQA 4LGYA 1D2RA 3TFOA 4MKFA 4TKUB 4UAGA 5DCUA 3ZU6A 2XODA 3AW8A 3H17A 4BLTA 3FTCA 2Q29A 2Z43A 1ZW1A 3FDZA 3QXHA 1L5MA 4GOND 1FMTA 4P2BA 1HQCA 4AUMA 4YK7A 2OESA 2X8WA 4ZQGA 5FPSA 5EP1A 2J5RA 3GA7A 5HXAA 1MV5A 3AFGA 3X2EA 4JLWA 5JYBA 3IAXA 3X2SA 2IYXA 3D4OA 3DAOA 2I6XA 1IATA 4WJZA 2ODNA 1NX9A 4MK4A 4W9MC 4GBED 4L8YA 4UDNA 2GA9A 2RC6A 4I50F 5CDTA 2JFBA 3WLPA 4D4MA 4E2WA 4F3CA 2B4KA 1YVEI 1P77A 2JZNA 2H2WA 4QL3A 3W04A 4W1PA 1WVMA 1CEQA 2RB5A 4Z3KA 1VFPA 1GG8A 2NUTB 2EHJA 3KQYA 3RHZA 1YDHA 5FEUA 1XELA 2E4YA 3TECE 4M60A 3STXA 4CJXA 3RADC 3T3EA 1GN9A 4Y2VA 1T5IA 1XN4A 2C2XA 1PCXA 1SIBE 1FB5A 2E4UA 5IYZF 3ZI4A 4AMYA 4PYOA 2HJRA 4Q1FA 4IIXA 5FPQA 2J4CA 3N6RA 5TVKA 1I3NA 3NHPA 1WPQA 3UT5B 3MJCA 3HLKA 1RBQA 1JHPA 3EUFA 2PWYA 1RJDA 1WDWB 4LMBA 4X6YA 1G7TA 3VYVA 4HDRA 2GF2A 1TQDA 2A9KA 3E27A 1R6VA 4X7BA 4DLTA 2NU6A 3LC2O 4KSBA 1USGA 1LNSA 3GFFA 4HQRA 4QDJA 5SICE 3L6UA 2C57A 2NXWA 2H5LA 5J59A 1DDGA 2J4FA 3MCTA 4H6WA 4CGYA 1KY5A 2HBQA 1IMJA 5EIHA 1HQDA 2FRDC 1P8AA 3OQIB 1XLUA 4IZIA 4LCEA 4MIOA 4HAOA 4QM6A 2N9UA 3QRWA 3FETA 1M75A 4G1VA 2NUPA 4LDZA 2PX2A 4IRUB 3L8DA 2WWVD 2C4WA 1TUIA 3FLAA 4XLZA 3F1LA 3URKA 2F64A 4RNCA 2DCMA 1L1FA 1GNVA 5BMVF 2EKZA 5AKKA 2SCUB 4XTRA 2J85A 1KAQA 2QR5A 4PG6A 2GAOA 2JCXA 5C5IA 2V0CA 4FYIA 4PLPA 1JZQA 4PHCA 1ZKDA 1JEEA 5MFZA 2REOA 2YKGA 2PMBA 1X7ZA 5DIZA 4DLXA 1KSFX 3AUKA 4IIJF 2GRJA 5FLKA 3RVSA 2BFWA 4G5XA 4MICA 2CHEA 3P2YA 4CV2A 2O6LA 1FUIA 1XLVA 1TZJA 3IP5A 4WN9A 4DLAA 1L7OA 4Y2YA 4HCJA 1GZ6A 1UBEA 5JXIA 1H3NA 3TD6A 3E6AA 2XQGA 1GAJA 1UBUS 5T4HA 4CM9D 3AVPA 5E8JA 1QBKC 3T7TA 3KKQA 3R6GA 3SCZA 3Q40A 5F2OA 5EJEA 2J5BA 2GZRA 1SVMA 4BLWA 1IWOA 1TMKA 1YB5A 2OZKA 4IWYA 1XFAA 2PGJA 4Z9BA 1V39A 5FKJA 1MLDA 4HQFA 4REQB 1UDXA 4CQJA 1TM2A 2B30A 4B8WA 3H5AA 2VP6A 4NC9A 4DABA 5I4BA 1ODLA 3H11A 2VYVA 1SCUA 4KVZA 3ZDDA 4UUNA 3GJ7A 1KJJA 4PM4A 4LQLA 3LTNC 1GARA 3Q3CA 4NYJR 1ZLYA 1ODIA 3PEEA 2X0EA 1JL3A 1NU6A 2EYQA 2AMYA 3TL6A 3W5HA 3I53A 1BMFA 5LOVB 4W5TA 4IOJA 4RPJA 3RC7A 1WABA 2PEZA 1GA6A 3S2UA 5CA0F 5A3RA 2NUTA 5A0FA 4IIUA 1XMQB 5DX1A 2V3CC 4QTZA 1KPIA 3NHJA 3LK7A 4O4JB 5FWXA 1V16B 5BSRA 2O7RA 2YUIA 3U0BA 3B1FA 4UBIA 4YMLA 2APJA 4IWXA 3ZTWA 3T38A 2C83A 2JEOA 3THOA 2GBGA 4L74A 1OKKA 3UT5A 4E33A 4QXMA 1U9IA 1Q1EA 3IHWA 4C2AA 5CXQA 1SG0A 1T1JA 2WJYA 4HLQB 1OIXA 1XTRA 2A84A 4KQGA 4L4XA 4M1ZA 4QAJA 4TV8B 5E4FA 1IB0A 1L5ZA 1JXQA 4C0LA 1BSVA 3PD1A 4BGEA 3ZV5A 4E51A 2YV5A 2HCBA 3QE9Y 5A1JA 3DBOB 2QG4A 4PZPA 3PFGA 4C2UA 4EKYA 2OD9A 4PQEA 1PHRA 2O2JA 3U4DA 4A6XA 2W2TA 1SXIA 4EECA 3AFNA 1NYTA 5AHOA 1K3TA 4ND2A 4KTVE 5K6AA 3VV3A 5KAPA 5KTRA 4BQRA 3TDMA 5LZ2A 1QP0A 5I7AA 5E7QA 3HJRA 4WZZA 1WKVA 2HTEA 3IMCA 4X3PA 2R8RA 3ODGA 3WKAA 3GLGE 1SC1A 2R6AA 2PPLA 3SFZA 4GE0A 2JFVA 2BGNA 2DUWA 3GAZA 2XCIA 2Q1SA 4FXPA 4HDSB 2ZWIA 3CF0A 5DKFA 4CWAA 2C0QA 3T3IA 1VCHA 2YRXA 3I62A 1RWPA 3ILVA 4QDKA 5EZYF 5F35A 3CKKA 4JOQA 1G7RA 3WISA 1JFTA 2P9BA 3BIXA 3HCPA 3ZCTA 2XXAA 1RABA 3T7SA 5K0ZA 3FGNA 1J8YF 6ADHA 1EQUA 3L8YA 1EUCB 2BWJA 5FFFA 3W9UA 4ZYYA 2I7XA 5KSOA 3K5IA 3V8EA 4RTQA 1EE9A 3EPKA 1AB6A 2VN8A 1TZ2A 1ZSVA 1ZM3A 2GBIA 2RCNA 3GV0A 4HWPA 4REQA 4X44A 2WDZA 4GVPA 2IEDA 3ZNQA 3GJ3A 3RRNA 1B0AA 2KE5A 3RU2A 1NTRA 4Q48A 2Y1XA 2PU7A 1PHPA 3MJTA 4QQ8A 1KR5A 1PJCA 4WY2A 3ZGYA 2UZAA 5JCXA 2K4MA 2AC4A 2ZYUX 1BKDR 1CK4A 1DAEA 1SULA 1OI2A 1A2QA