2H2SC

Crystal structure of e148a mutant of clc-ec1 in secn-
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
221
structure length
221
Chain Sequence
VRLLESGGGLVQPGGSLKLSCAASGFDYSRYWMSWVRQAPGKGLKWIGEINPVSSTINYTPSLKDKFIISRDNAKDTLYLQISKVRSEDTALYYCARLYYGYGYWYFDVWGAGTTVTVSSAKTTPPSVYPLAPGSAAAAASMVTLGCLVKGYFPEPVTVTWNSGSLAAGVHTFPAVLQAALYTLSSSVTVPSSSWPSETVTCNVAHPASSTKVDKKIVPRA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Uncoupling of a CLC Cl(-)/H(+) Exchange Transporter by Polyatomic Anions
pubmed doi rcsb
source organism Escherichia coli
molecule tags Ion transport
molecule keywords CLC Cl transporter
total genus 37
structure length 221
sequence length 221
chains with identical sequence E
ec nomenclature
pdb deposition date 2006-05-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF07654 C1-set Immunoglobulin C1-set domain
C PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2h2sC02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2h2sC01
4NZTH 3LY6A 3GIVA 5IMMA 3QFJA 1V8HA 2NTFA 1A7BA 3TH3T 1IC5H 2A6KA 4KTEL 1S7WA 1IVLA 4UNVA 2ENYA 2IFGA 3W9EB 3SQOH 4YXKH 2ZUQC 3OF6D 3RA7L 1XGPA 3WNLA 2ADGB 1CE6A 4HKJA 1FFNB 3MRDA 3EDKA 1FL6A 3ZE2F 4FQJL 2KZ1B 4GLRI 2W1NA 1P7QD 4PP1D 4YWGL 1S78D 3GBML 4JFED 5L6YH 3DVGB 2DTML 1F5WA 1ZWIB 2Z8SA 5IWLA 1OT1A 5AEAA 4F9PA 1D6VH 1LO0H 4L3EE 4RAVB 3MV9A 5SV4A 1HIML 1ZTXL 3H3BC 4NO3A 4FQQB 1CL7I 2Z91B 1CICA 1DZBA 1AE6L 2R8SH 1IARB 2XN9B 3NACH 3UTPE 1S7VB 1CI5A 2BXZA 4CDGC 5T1LB 2VQ1B 1HI6A 2ITDA 3ZKXC 4K3JH 4ODXB 4UQ3A 4D9RD 1LP9B 4RQQB 4BFIA 1M05A 3RL1B 3L6FB 4NM4H 2NNAB 3LEYL 3T1WA 1U8QB 3QDMD 4UTAH 2XTJD 1XCQA 4Y2DD 5EBLB 4H8WH 2AEQL 2HFEA 4Z7WB 3MO1A 1LK2B 3P4NB 4LSUH 1FZJA 1MNUH 1FORH 4S1DD 1A7NL 4APQA 5FGCE 2VISA 4L8SB 1PY4A 3QO0A 3RX7A 3FFCA 5C09B 1I1FA 5IFHL 1GOHA 1E28B 1ZS8A 3ARBB 1MUJB 3OKOA 5BQ7B 2HYMA 1CBVL 1CTOA 1QR1A 3H9HB 4NOFA 2B39A 3WFHB 3GUTA 4XH2B 5TDNB 3VGAB 1Z6JT 1ZA3A 3HLAA 2JELL 5IOPA 4DWHA 3ZYJA 3KPRB 5C0DB 5DUML 3VFVA 2ZUQB 4OZIF 5JIPA 4MMZC 1FZJB 3QRGH 4ODWA 4I2XE 4QHKI 3MYZA 3I3DA 5CINH 1ZSDB 2A74A 1CXHA 1SJEB 2XACC 4R2GB 5HDLA 1NGZB 5F7NC 5EWIH 5D1ZD 5K59F 3VGAC 4PGBA 1HHGA 5FM4A 3NIGE 4Q9RH 3S88L 3VA2C 4OLWH 3UO1L 3WJLA 5LCVL 1RZ8A 5BS0E 1K3ZA 3C60D 3R0MA 5KJRL 3G6JF 5DK0B 3U9PH 4LLDB 1P69B 6FABL 43C9A 3RFZC 5CIPB 2BNRA 4Q9RL 2PR4L 1NMAL 4NWTL 4EOWL 5DO2D 2GY5A 1D5BB 4KJWC 3C5ZB 4PJIB 3HC0A 4GW5B 3WLWD 1UCBL 4NJ9H 2AV1B 4NPYB 4XPBH 2XG5A 4ONHA 4FS0A 3UJIL 5D96C 1N8ZA 5DUMH 2QQLL 5AG9A 5DD5H 1OSZB 3BJ91 4I18A 4YIQB 2QADC 2PXYB 3L9RA 2H45A 2GI7A 4NRZA 4MA1B 3DBXA 5F6HI 4HK0B 3WE6A 2IBZY 4HKJB 3RJDA 4N5EC 5D93B 4KC3B 4I18C 4GFTB 4L5FL 2AV7A 4OQTA 3TO4B 3C5JA 4WO4A 4EJ1C 5IHZB 1NLBH 4P2OA 1R6VA 3GSOA 5EU7E 5D71H 4JHWH 5BZWB 3HPJB 2OJEA 4NQUA 4YLQT 1IM9A 4GAGL 5CJ8A 3OJVC 3PL6D 4WFHE 2DQDL 4E9LA 4PJFE 1ZHLB 4CDHA 3J7HA 3MUJA 1AHWC 3IRZA 5FYJD 3KPQB 3IDIB 1MLBA 1RUAH 1ZXQA 3REVA 2C3XA 1K9TA 1B3JA 3P4OA 4FFYH 4FXKA 3FQWA 1ZVYA 1IEBB 5F9OL 3ILPB 4GT7A 4I2XA 4MNHB 1GGUA 5FUZH 4DVRL 2MQ3A 4AEIH 1J1PL 1MVFA 4K3DH 3X17A 4LCWB 2X42A 1FO0H 1UVQA 1AGEA 3FQTB 4M8QA 1S7XB 4MWFB 4PYGA 5BS0A 1FL5B 4K3GA 3ROLB 3OJ2C 2ZOLB 4X7SH 4ZFGH 4V2CB 3FB6B 2YXMA 1VHPA 4OCMC 4Z5RA 4PJHF 5L2KB 1PJ9A 2NNAA 5D7IA 1H3VA 2NZ9D 2RCSH 3MXWH 3A6CH 5T3ZE 4M02A 4ODXA 5EBLA 1QNZH 5T3ZD 3BGMA 5I16B 1BFOA 2B7DT 3IGAA 1U8QA 2IANA 2X4UA 2VL5A 3FTGB 4RGOL 3OKLB 3JWDL 5DWUL 3CVIL 5D1XC 2LU4A 2I5YH 2C3VA 4X6CB 4YR6B 2ZWLT 4XPFL 5D1ZC 1QSEB 3M8OH 1AGEB 1KIQB 2XQBL 4E5XB 3QNYA 5F71A 4RFEA 1OM3L 1OTUC 1I1FB 4ZUUB 2CDEA 2VR5A 2AJXH 4PJ7E 5DMGD 1DDHB 3VXMD 5H2BA 2R2HB 3DOSA 3T0XA 2IEPA 3QI9D 3D87B 2N7AA 4D0BA 3S35H 4L4VE 1J0ZA 2AEWA 4KJQD 4YHZL 1GCFA 5B38G 3HE7C 4L4TE 5ETUA 2BOBA 1U41A 4O4YL 1B0RB 4R4ND 4ONOA 2Y7QA 1CZ8L 5HD8C 4ETYA 2EO9A 4P5MB 2OR7A 3RWHA 3KWWB 1EIBA 1S8DA 4YBHA 1M7DA 3H42H 4H1LG 4W4NA 1ZANL 3GBNL 5E8PB 1IGYA 3R0NA 2YEZA 3ARPA 1CQKA 4LMQE 4WGVB 1O7SA 5GRUL 5F3HA 5F9DC 4TPRL 1FCGA 1L7TL 2FIKB 1BPVA 5J3HC 1MCFA 4YIQA 1I3RA 5M7QA 4O2EA 3V6OC 4F9LA 1G7QA 3RVXD 4TVPE 4ELMF 2CH8A 1BQLL 1NUFA 1JPGB 5HHMD 3QPXL 5T1KD 4LCCB 4HWBA 3QG6B 1UWGH 3BXNB 4GKSB 4EVNB 4N0RA 5H8DA 4WU5B 4OLYH 1LNUA 3SDXB 3B2UC 3HFML 4GG6E 3ALWA 3QO1B 3VFGL 2BRQA 4JY4B 1RFDL 4OCLC 3EGSA 3DRTA 3PWLA 4NC0B 1GZPA 3PP3H 3MLPA 1IGMH 3VWKB 3MBEA 3WLBA 3BPCA 5CBEB 3BKCH 3OL2A 3FO1A 4TOYL 1H0DB 2NW3A 5DEFB 3GMPB 4PJFF 1E27A 1P2CA 2ZPKH 4DN4H 3PQYB 4EI5C 1KJMB 5ID1B 4WWKB 3KS0H 4WEMB 1H8NA 3TBVA 2D7OA 3OG4B 2D4DA 1BGXH 1QEWA 4LEOB 1T1YB 1JWUB 5FA4B 5F70A 2P46B 3I2CH 4HT1L 5CHNA 4RWYH 3V8CA 4QRSA 3MNVB 4OZHA 4OM0L 4M8QB 5L2KA 3O6LH 5MENE 5B22A 4WWID 2EKSB 4M62H 4LSVH 3MRHB 4YO0B 5L6YL 4YQXH 2WBJB 3MROA 2CLVA 4JGMA 1UJTA 1RZ7H 4YFLF 4GJTB 3GFUA 1EUUA 4LHUA 3LSOB 3ARTA 3AY4A 4OCYH 4PBVC 5LG1A 1HILA 2PYFA 2CDEB 3VGEA 1KCSL 1QYGH 2DIAA 4PJEF 4DEPB 3CSYB 5BV7L 5ACMA 5DUBB 1MFAH 3CJJA 3MQIA 2EXWC 1TJHL 2R1XA 1IC1A 4PD4K 1EEYB 1CGSL 5MEQB 4TOYH 4PRIE 1J1XL 5DQJB 2QQNL 3JV4A 2P5EA 3EO9L 5F6IC 5DXWA 3LD8B 5TH2A 4YH6A 3TBYB 2EKSA 3HN3A 1VEMA 4FQ2H 2OR8A 3MRLB 3TN0C 1RZ7L 1MFDH 4PJ7F 2NQCA 2CLVB 3PG2A 2FATL 3VXRD 1GXEA 1PVHA 4PJEB 2J5LB 5DRXB 4RFOL 3DROB 3CDCA 3WHE0 4IMKC 3T0EE 2AK1H 4PB0L 3L95B 4LHUD 1Q72H 4JLRA 5CAYB 4MGXA 1TZIA 1CDUA 1EDQA 3VCLB 3HUJE 4HIXH 3QUZC 5KOVC 1I4FA 1NCBL 3IKKA 1ONQA 3QIUD 3DVFA 3ZKQD 3GBMH 4XNMB 1JFQL 5J11B 4MYWB 1IILE 1G7PB 1NAMB 5IR1A 5FO7A 1QQDB 3C6LC 2KZWA 1I9RH 2AJZA 1QFWM 3UJTH 3MRQA 4PJ5A 1BVLA 5F7LB 1QVOB 3VFWA 4Z76A 8CGTA 2PW1A 5E1AB 3C6LA 2V17H 3PHOB 3MZGB 4XBGA 3WNPA 4X8XA 5D7SH 5I73C 4KI5D 4BUGA 4NZDA 2DLIA 3F12B 5C2BL 3BN9D 5BVJB 4X4ZA 4OCWH 4XXCA 5D7IE 1A7OH 4NQDA 3TCXA 2C1OB 5IG7A 2NX5A 1YPZE 5GGTH 3KPSE 2P24A 1FL3A 2BSTA 3N85L 1MAJA 4KUCD 2AGJH 1CF8H 2AJUH 1BVKA 3QIUA 2G60L 4K2UL 3DUUA 4I3SL 5GS0L 1DVFD 1OLZA 5A2JH 4DFHA 3BMVA 4HIIB 4L1HA 4NN5C 3A6CL 3V6ZA 2XY2A 1D5IH 1EV2E 2PW1B 4H1LB 4HZLB 1MCHA 5MHSD 1FFPB 3K8KA 4S1SH 3GGWA 4PJGF 2FR4B 3T8XB 4DK3A 1A4KB 4DKFL 4ONFH 3L3DB 2B2XL 1KT2B 1C1EL 2R1YA 3P4MA 2F54E 5K9KB 2XKNB 3PWPD 3B6SB 4JPWH 2P45B 4KK5C 3STLA 1OPGL 2JLLA 3VFGH 5FYKE 1PG7W 3HC4H 3WHE1 3ZTJH 4JO1H 4M7ZC 3V0AC 1MQKL 1M1SA 1AKJD 5EUOA 5FKAB 1Q9WB 4D0BB 2OL3H 2W07A 5HHMB 5KN5B 2NZ9C 2VWEC 3C8KB 3RWDA 4ZOBA 4FQXB 4LPCA 1AC6A 1H15B 2R29H 2R15A 3MRHA 3OGCA 1A7QL 2FGWL 1FNSL 5KANI 1QSFE 4P2OC 4OLZH 4G6AC 2DIBA 4LMQI 3U0PA 2CLRB 5DHVA 3RHWF 2P8MA 2CDFA 2ZUXA 3V7AG 3LSOA 3QISA 3DTXB 3HMXA 5E6IA 3FB5B 1N5AA 12E8L 4HXAL 1LO4H 2Y1VA 3NH7H 1EMTH 2IQ9H 1Q0XH 5DFTA 4EIGB 2E9IA 3NZHL 4JQIH 3QZWG 4FZEL 1OHQA 1OW0A 1V7NH 2VXUL 4P59L 5I1AB 1H8SA 2VZVA 3MLUH 4FQCL 4NQEE 3D69A 5JOEA 3BPOC 3KG5A 4Y2OA 5D1ZB 1B4JL 5T1KB 4UILH 2Z0BA 1NDGB 2G75A 1D5XA 3E3QC 4L4JA 1F58L 5GRVK 1AJ7L 1GZQB 5CLTA 3TJEL 2IPTL 4BFGA 3KPTA 5ERWA 5AYUH 4ZFOA 4IDLA 1JZ7A 2VN4A 4R8WL 5GRVL 4UBDC 4H0IA 4AIOA 1CWVA 4Z7NE 4O2FB 2IMMA 4Q9BA 5D2LB 1Y6KR 5EOTA 4F15B 1DQLL 3L5XL 3RWJA 2VE6B 1K8DB 4NQXB 3O4LA 1OM3H 4XC1L 5GPRA 1OLLA 3GSNA 5EUOF 3ZT7A 4DFIA 5IROC 4YHZH 3JTSA 1BJ1J 5F89A 4AH2A 4MNGB 1FG9C 3EJZC 3WKML 4RAUB 4M7LL 1NFIA 3FZUD 1OSZA 2QLVB 4LNRA 1DUZA 3C08L 4ONHB 5C08D 5L9DL 5I15L 4MQTB 2YMXL 3NABH 2F5BL 3FAWA 4ORZC 4ZSOE 5BZDB 4X6DE 1AQKH 1UH3A 4BQCA 4X4ME 3EOYG 1F4AA 5FUCE 5BVJA 5BO1H 4S1RH 1FL3B 2BSTB 4XVTH 4LU5H 5MEOA 1YC8A 3SDDC 3MA9H 3X13B 4WO4B 1UFUA 4P2OB 1X5LA 3ZHLA 3SDDA 5GGSY 4F9PC 1HYSC 2QBWA 4XBPA 4NT6B 4IMLA 2F5BH 1TZGL 1U93A 4J8RB 1IC5L 1JP5A 2R1YB 3BVNB 3P4MB 2FHFA 5GJTL 1I3UA 1GC1H 1KCSH 3ECBB 2ARWA 2MNUA 1MPAL 1QSVA 4C83A 1L6ZA 3L3GB 1W0VB 4XCFL 3MUGB 2G60H 3VWJC 1S7RA 3GJFB 4XP9L 2X4PA 5IQ9B 3T4AB 1DQTA 4LSTL 4QWWC 4YHIB 1FL6B 4MD0B 5ALBL 2AJSL 3WFDL 1HSAB 1LEKA 3P0YL 1LD9B 2BY0A 2PXYD 4CUCA 1WBXA 4KKCC 4KZEH 1RZJH 2UWEB 1J8HA 2AEIT 3JUYA 3LOWA 4JPKL 2P43B 3PL6C 5DMJB 3X3GL 5AWNH 3MRMB 2DBLL 3WXVL 4MQXD 5HGGS 2ICCA 4O2CB 1LO3L 4J3SA 3UJTL 3V5DB 4JM4L 3RWCA 4PRDB 1A4JA 4LAQH 3DI2B 1DE4A 1OCWL 2BSRA 4FQXD 2B0SL 4YDJB 5DUPL 2WNGA 1RJCA 4FHBD 5A3IC 1I3VA 1K4CB 4LL9A 5DEZA 5EULV 5E2UL 2ZKHL 1J05B 1EBPA 4XP5H 3QUXC 2FO1A 3QCTH 4M5YL 4PG2C 2AERT 3VFUB 5LXGH 2E27L 5HI3C 3ZKNC 1J8HD 4Z7WA 1G84A 4ODHL 4FTVD 3V6OE 1T6VN 3F7VA 1T22A 2C7UB 3VGGA 3B9AA 5EN2B 5KSBB 4PTUB 1OGAB 1J7VR 1D6EA 3KR3L 1X4YA 3GO1H 3QZWA 2M1KA 3PGDB 5TH2B 4JKPH 1N26A 1VCAA 1N2RA 4OLUH 5EC1A 3VRJA 1RIHH 3F7YB 3MRIB 4YFDB 1X5FA 3IJSA 3G6JA 2DQIH 3FQXA 4GAYA 1P9MA 5I71B 4GW4A 2IG2L 4NQCB 4WFGE 4U1LA 5MERA 3CX2A 4UV4H 4HPYL 4F37K 3V4PH 1Q0YL 3LMJH 3REWB 3RGVB 4EI6A 3IDYC 4YHYC 3OAYH 1MAML 1TXKA 2HKHL 3BE1L 5IMOA 2O61B 2JCCA 3PGDA 5E0QA 4Z8FL 4TNWK 1FHGA 4ZFFA 1NSNH 2DMKA 1XGQB 4JO1L 1DLHA 4Z7UE 3QDGA 4Y4HA 4OI8A 3SKNA 3G6JE 3ZDZE 1INEL 1VFOA 2R0ZL 1Z9SA 4GAYB 2NW2A 1S9XA 3UTTA 3HMWL 5C9KA 3W5MA 2BC4A 4XTRC 3E2HC 4JRXA 4QHKJ 5IG7B 2OR9L 3O8XA 5ITBH 3GMRA 1P2CB 1U93B 1KJMA 1KGCD 3EO0A 4XCCL 3U7AA 5GZNC 2HMIC 4ONGL 5GJSL 5F9WB 5JQ6L 4ZDHA 2ZNWA 4YXLH 4HXBH 2FX9L 1R5IA 2RHEA 3DNKA 4DGIL 1OAUH 1YEDB 4BZ2H 1ZVSA 1YUHA 4Q6YA 3TO4A 1T2QL 4HZLA 4LRIA 1YEKL 2E5EA 2HT3D 1YMMB 1U36A 3MOAH 4FQ2L 3DYMA 1MI5B 1BHGA 4ZFZA 1J5OL 1LO5A 2VLLA 5L8KB 1BJ8A 3TT3H 2UUDK 3MO1B 2HRPH 1A21A 2QTEA 3ULUL 3FONB 1JPSH 2YA2A 2HT2D 3GB7A 1YPZA 4X7SL 5JHDA 4R9HA 4Y5YB 4XPAH 1G9NH 3ARBC 2JCCF 2I27N 2H2PC 5F6HJ 3S37L 5I74B 3RZWA 1MRDH 1YY8B 2P47B 1G9MC 4TUKH 5GGSB 1F4YL 1HE7A 2VDOH 3GRWH 5E8NA 2X4UB 3MV7E 1VFAB 4FN0A 4HBCH 4LFHG 1I8MB 2QR0A 1N0XH 3T08A 2VNCA 5HI3D 5D7IB 1QBLH 4UU9A 1DBML 1YPZB 3WDHA 3GKWL 3DTXA 4R4BA 3TYFB 2IPKB 4PJXF 5I1DA 1FIGL 1MFEL 2WIIB 3IJHB 1RHFA 4WWKD 4MLSA 3D0LA 3HRZB 4W70A 4RMUA 4EXKA 3R06B 5DD3L 4JFDE 5CIPH 1KULA 3HE7A 5J4MA 3VGFA 1CLYH 2VXTH 5L8LB 5ACLA 1CIUA 2DQGL 3U4BL 2J6EA 3O9WD 4XP6H 3AS2A 4UDTB 1ZTXH 2R2CA 3C5ZA 3CIQA 4PJIA 1BREA 4JREB 1KJ2H 5JPMA 3GSXB 3QEGH 3HNTH 1N4XH 1AGCB 3DUSB 1Q1JH 4PUBL 4IRZL 5GQBA 3U0WH 3SY0A 1TZHA 3ES6B 3PHOA 3G6JB 3D0VA 1HWGB 2MPAH 2NY3C 1U8OB 2VDQH 4Y1AD 2CIKA 5J1AB 4YXHL 2AV7B 3QDJD 1N6VA 1I7TB 1A3LH 3WDJA 1HCVA 1FPTH 4M7KH 4P5MA 1R3IL 3O4LE 2NX5B 3QPXH 4YBLC 4J12A 4LLUB 4YBQD 4KHTL 3O2DH 5I75B 4IDJL 3O6MH 1A1MA 4JO3L 1P1ZA 3KXFA 1NFDB 5T33H 3G5YB 1J0JA 1MSPA 4AIXA 1G1CA 4YEEA 4QXGL 1LNUB 1CDCA 1GVIA 5EB9A 4X6CE 3HR5B 3RNQA 4MB4A 5C0EA 4UT7H 1TVHA 4AEHH 3ZE2E 1B2WL 4NNPH 1AO7A 4D2NA 2G5RA 4P3DA 3TJHC 1ZVSB 2HKHH 3BE1H 3IF1B 5DJYA 3WFBH 4P49A 3MBEC 4YUEH 4HH9A 2WBKA 4TVSa 3QFDA 2BSED 4NKIH 1NCCL 4MVBD 4Y5XC 3LIZH 4Y8AA 4AEFA 3ULUD 3QG7H 1IQWL 4IEFB 4UTAL 4N0FA 4NN6B 5BCAA 3RWDB 1MCDA 1EX0A 3U46A 4Y2DC 4AMKH 2FLBT 5F7WC 5KSVB 4K7FB 5J0BA 4JPIA 3MV7B 3P0VL 1FFOA 1MHHB 5KVFH 3ARBD 3SKOB 5E8EA 2ESVB 1F90H 2A1WH 4PLKD 4PTUA 3O6KL 1A7RH 2H8PA 2Q76A 5E4IA 1EXUA 1NGYA 5BRZE 3NACL 2ORBL 1J0HA 1GGYA 4HLZG 5E6IB 5AAWA 2GSGA 1RSFA 1T1YA 4JDVA 4KZEL 4OQTH 4EUPH 1ITCA 4QTHB 4LOUC 1KBGL 4A6YL 1OAZL 1TVDA 3A67H 2HKFL 3FQXB 4PLOB 3V2AR 4KK9C 2QR0B 2QKIB 4JPIB 4CVUA 1DLFH 4OZ4A 1YMHA 2HTKC 1CGYA 2N7BA 1A1NB 3G9AB 1TQCB 4YDJA 2W0FB 1G9EA 4M1DH 2VLMD 3EBAA 4NUGH 1H3PL 1QD0A 5IBLC 4AL8L 3EYQC 3LKOB 3RWHB 4ZFOB 3WXVH 1S7TA 4ORGA 3T3PE 5TFSL 5IB1B 4WRLA 4KH2A 3VXOB 5I0ZA 2VH5H 5SWZD 2HFTA 1N7ML 2R39A 4WW2B 3D85B 5KANG 3VFUA 4QWWD 3VFVB 5ICXA 3L3KB 5F1KC 5MHSE 4K3DL 2C3HA 3CPLB 4OAWA 5L88L 3EYSH 3HE6A 5F89B 1I3GL 1JGUH 3RKPA 3AFLA 4OLXL 4U3XA 2HJFA 1X7QA 3EJJX 4KXZH 5ESAA 3WN5A 4G9DA 4NN5B 3FFDB 5EOQL 4R4FL 4JZNA 1MFCL 1KIUA 2EDOA 1BX2A 4HV8B 1CDHA 1MI5E 4LSPH 5IJKC 3EHBD 1XH3B 1UJ3B 5IESH 4JFQB 4ZUSA 2KPNA 1N6UA 12E8H 3EOTH 1A6WH 5J11C 3RTQC 1ZGLA 1U8MA 4MXWH 5ISZE 1ORQB 3GNMH 3SKUD 2NW3B 4C54A 1SEQL 5HYJE 2R23B 3QUKA 1C7TA 3TPKA 4I18B 2HJFB 3VFWB 4Z76B 1KIPB 2V5RA 3FO1B 4JM2A 4CNIA 2VQ1A 4HK0A 4X4YA 1M7IA 5IFAL 1D5IL 3AB0B 2QSCH 3MNWA 1ZK9A 4HW6A 3PJSB 3SKNB 5C0EB 2YD1A 4LARL 1I8IA 1Y6MR 4P2QA 4X83A 2FR4A 4WW1B 2HRLA 5AUMB 1FNEA 4IOFD 4ODSL 2EH8L 4WHTB 1G1YA 1IQDA 2WBJD 4XT1C 1LK2A 1EVUA 1Z5LA 5CGTA 4OTXH 3OKEA 4PREA 3SKOA 1GHFL 5BJTA 4U6HB 4KJYA 3QSKB 3O6FA 4NWUH 2WIIA 3IJHA 4OUOA 5EC2A 3THML 2FDBP 4JM2D 3WV0A 2X89A 2YBRB 4PJCB 3MGOA 4DGYL 1CFNA 1FYTE 1WJ3A 1WISA 1PLGH 4Z95L 3QIBD 4XPFH 3IDMB 1MCJA 5F9OH 5D6CA 2VITB 1FL5A 1QFPA 3SOBH 5T1MA 1F45A 3P30L 1DBAL 1NCBH 3LKPA 1EFXB 4ZXBB 2WUBL 1IQWH 4OUUA 4JDVB 4WUUA 3LKQB 4I13B 4UNTA 4J3TA 1BFTA 4LIQE 1DN2A 2DJSA 5E8DH 2BNRE 1CXEA 5GIRA 4Q9QL 2F5AL 2CO7B 3EOBB 5CEZL 5HGBA 1BEYH 5FXCH 1R5WA 2E3VA 3VW3H 1SVZA 3KDMB 4P2OD 2AI0H 5TDOA 4X6CA 4PRHE 5TF1H 3ZTNH 5KS9A 1FGVH 2H6PB 5I8EA 4WW2A 5K9OB 2DM2A 1LO4L 2APBA 3ARDA 3H9SE 4KKAC 2FHBA 1I8MA 5IK3B 4LLUA 1QFOA 1QO3A 4L3CA 1A5FH 1D5MB 1JYXA 3LKOA 2I25N 2X10A 2CRZA 2X40A 4ORGB 2YSSA 4JFOB 1U8IB 5L0QB 4KJQC 2YPKB 2CUMA 4TTGA 1U3HB 4LFHD 1KN4L 2ZG3A 1R5WB 3L5HA 4NRZB 2YUZA 1TTGA 1NGPL 4TTDD 3ARFB 3X12A 4J7RA 2W9EH 3NBNA 1KPUB 1FSKC 1EJOH 3VRLF 4DOHE 3BEWB 3U30B 5C3TA 2R2BA 4ISVA 4I9WE 4P23C 5ACZB 2MQ0A 3ARDD 3N1GC 4G6FB 3TNMA 1G0DA 1QHOA 4HUUA 4R2GC 1EZVX 2WV3A 1RVFL 2Q20A 3QUKB 4KAQH 5E94B 3U0TA 3H7BA 5F7KC 3TFKD 4XP6L 1ZT7B 1UXWA 5HDOA 3QDHA 3TA3D 2CJUL 3O3DB 5KSVA 3VH8A 2OQJA 5D7LB 4KMLB 5K33A 4FABH 2R9HC 1EJOL 1UYWL 4G9FE 4UAOB 4OD2B 5DQ9B 5HVGB 1FPTL 5D6DC 3O8XB 4X4YB 5HHPB 1FZOA 4OLZL 5C70A 3W0WE 4M4RA 1G6RB 5JOPE 5INCA 2X05A 3AXLA 4G80B 4Y7MA 1GC1L 3MV7D 5JOFA 4KY1L 2R4RL 5JW4N 4GUPA 4J6RL 3WUWG 4OD1H 2D31B 1PFCA 1OD7A 4KUZH 3IDXL 4ZSOA 4GXUM 5TF0A 5E00A 4P3DB 3FRUA 5D5MA 5JW4Q 1S7RB 2NY0C 4J6RH 3QEQD 4U1IB 3OJMB 1C8PA 4ELKA 2NY5H 4LQFL 1P7HL 1LQSR 4P5KA 3WS6A 3LZFL 3L3JB 4G80A 3QXVA 4CW1A 3DSFL 1VFAA 3QDMB 4YUEL 2HJLA 1DFBL 2NY4C 3I50L 3RPIB 5FOJA 4ZTPH 4NJAH 2BK8A 3HE6B 2VLKD 3CH1B 4HT1H 3PWNA 3BRFA 5D7JA 4ZNCD 3V4PL 1OQXA 1H3GA 3STZA 2BY2A 2AGJL 3ZLQC 3EO9H 2HTKD 3KWWA 3ARDB 1QFWH 3ARVA 4JY6A 2E8YA 4BKLB 4JZNB 2PW2A 1HILB 3AMKA 4M7ZB 1JGDA 4JQVC 1SYVA 4F7EA 3O2DL 5K9OA 2HT2C 4TVPL 1RUML 1JF1A 4FQHA 4JKKA 5EZJA 3I50H 3RZCB 3T0EC 1N6QL 2R0ZH 5B8CB 5F6IB 4OLEA 3MSPA 3O45B 1D6VL 4X8JA 1JPGA 3CH1A 3PWPB 4GS7B 4JFOA 3UTSD 1PZUB 1U6AL 3QXAB 5E2VL 1BAFH 1NCUA 1U3HC 4CJ0A 1J11A 5D8JH 3L5JA 3P4LA 4TULL 4MA3B 4HWUA 1BIIA 4IIQC 5IT2L 5FM5M 4YHML 3QUMA 3VMNA 1U3HA 2ZUVA 2QQQA 4RGMB 4PS4L 4WTXA 1T1WB 4X99A 5HHME 4MA8H 4TVPD 1S7QB 1CXFA 4G43B 4X6DB 1MCLA 3VFOA 1L9MA 5FGCB 3U0TB 4G8GA 2OMBA 3ILQC 2GTWA 1Q9OB 2Z93A 5KSAA 4ODUB 5B8CC 3GSNL 2WUCL 1UXWB 1A2YB 3ZKND 3C09B 1FLRL 3LCYA 1JI2A 2RAMA 1Z5LB 3HZYB 5ACZA 4XWOD 1KTRL 5CEZE 3FHAA 2DN7A 3TNMB 4NQTA 3ULUH 4G8IB 3TIDA 4HUUB 5FF6B 4HKXB 3ECBA 4KK6D 4FA8A 5SWZB 3HS0A 1WAAE 3GSVA 3RVWD 4LF3B 5H35A 5JW4R 1RZKC 4R0LA 4WUKH 5H37H 3VJ6B 4O9HL 4TULH 2I60H 1LGVA 2GY7B 1MHCB 4F80A 1XGUA 1FZOB 2J4WL 4D9LH 5C7XH 2P5ED 1F42A 4UOW0 1HINL 3T4YA 1U6AH 3VU2A 4PJ8C 1L7IL 1NAKH 1RVFH 2VSCA 2VZ3A 1IAKA 1JRHL 1MRDL 4XPGL 2K7PA 1J1PH 5D2LE 5HVHC 4KRPB 4MHHI 5HJ3B 4XCNB 4U1IA 4N8VG 5DZLA 1EAPB 3B3IB 3HS0B 4ZOAA 3WHXA 1PX3A 1I85C 5TDPA 4JRXB 3ZDZF 3Q6FB 4R4NC 1AH1A 2AJVH 4XNYL 1JZ8A 3S36X 1LO2L 3QUML 1S7XA 1X6NA 2O5XL 1F8TL 4QKXB 3ROLA 4GRMA 3UP1A 2IAMC 4U2YA 1J05A 1YEKH 4HS8L 1IKFH 1FRGL 3B9KC 2JF1A 1B0GA 2YD8A 2VRAA 3L7FA 3MLYL 1T5XB 2YN3A 4LSQL 2P5WA 3PXHA 1CD1A 4E0RA 2W9EL 3I75B 1LP9F 1RUPL 4UAOC 3TT3L 1CFQB 2PO6B 4UUJA 4TSCH 4PJAB 4H20L 3TVMA 3MV01 2GQHA 1DQML 4PJCF 5DMIL 3UTZA 3TH2T 2J6EH 3MRRA 3GI9L 4X80L 3TPUA 3W2DL 2YPLE 4B53A 3GBLA 3NIFF 4PTTB 1IGFH 1SM3H 3JTTB 2NXYC 2OTWA 1U42A 3BKCL 3SGEI 3O3UN 1T2JA 4KDWA 2LU3A 1MCEA 4NNXA 3LH2H 4X4XB 4RGND 3MV9D 3CXHJ 2GAZB 4NM8L 1BIIB 1KELL 4S1DC 3Q3GA 1RJLA 5IM7A 3GKWH 5F8QC 5AYQA 4OCXL 3DXAB 2JTDA 4QGYA 3QXAA 5FM8A 5B39B 4GG8A 4UU9B 4XP9H 2DQEL 4KFZC 3PWPA 1BM3H 5DEGA 1VACB 5C07E 3DX8B 1AQDA 5FA3A 1RJZB 4PGDA 2DMCA 4LLMA 5E56A 4XVUD 2CR3A 5EOTB 4HIIA 1N59A 2IBGA 2P7TA 3HCVB 4OTXL 4X4MA 5B3JF 1RUQL 1ZGLB 5A16B 4PV9A 2NTFB 1CD9B 4KPHH 1MJUL 1U8PB 2F58H 4ZUSB 3GI9H 4KROD 4R90L 2L7JA 4I1NB 1MCPL 1A0QH 4FTVE 2WINB 4NO2B 1DQLH 1U8MB 1EBAA 2NYYC 3BHBA 4W81A 2R0WL 5IFJA 1U8LB 1TITA 2ZCHH 2BOCB 5DDHB 2FYYB 4ZDHB 5E6ID 4NQEB 4WUUE 2HP4A 4ZD3H 1I1CA 3RI5K 4NUGL 4XP5L 1EHXA 1CDIA 3LEYH 4NM8H 4S1RL 3KYNA 3CK0L 1N64L 4F3FB 2OSLA 2X7LB 3EYUL 5AUMA 5B21A 2XT1B 3HR5A 1A0QL 4NNPL 4Q7DA 5ADPL 1TVHB 4LVNC 1DQQA 1IKNA 5IB3A 1UT9A 1RUQH 5CBEA 4BQ8A 3KLAA 2ZCKH 4OLVL 3GSRA 2FRGP 5DHYB 2NY1D 3ROOB 2ARJB 3O2WH 4BFIB 4DZBB 4Y5XB 4BZ1L 1GPOH 3C09C 5TGBA 4RA3A 5E8OA 4MA7L 2DBLH 3GZKA 2YPLA 3DUHA 4ZSOB 3DGGA 2UY6A 1RURL 5CINL 4M61B 3UAJD 4X9IA 3RWGA 1W8NA 4Z0BH 1OTSC 3SDCB 3AU1B 2OZ4H 4WCYL 1E28A 2WBJA 3PWVA 3L7FB 1C5CL 3JBG7 1J0IA 4U49A 4LHUB 2AEPL 3HRZA 1UM5L 2AJ3B 5K93A 5JA9A 4WO4D 2VB5A 4L4VA 5ANMA 2F53D 1KG0B 5D2NA 4PJAF 4PLKC 2XZAH 1BP3B 2B2XH 5ICYB 1DE4B 1NC2D 2BSRB 3ZL4H 4J4PC 1I1RA 3PL6A 4MLIA 4PGZA 4YC2B 3VRIA 2V2TA 3KPSB 3DX7A 4QNPE 2DTSA 1L6XA 1A2YA 3MOBL 1RJYA 1QSZA 3BP5B 3DX6A 3Q5TA 1OAYL 3HR6A 4Y19D 3MRLA 4TNVF 5EO9B 5ITFA 1HHGB 2FECL 2BHUA 2J4WH 5C7XL 3NPZB 1YYLL 2DRUA 3ZDXE 1MCKA 2DL9A 1AXSA 2ZSWA 4U7KA 2AEQH 2JK5A 1AQDB 2CKBL 4OZGA 1TZHB 4M6NL 2PYEE 4GG8B 4R0LB 1SBSL 5EN2A 1XGRA 4RFNC 3BI9X 1FGNL 2F74B 3MOBH 4DAGL 4OAWB 1CL7H 1JPTL 3W39A 4KY1H 1N7MH 1AKJB 1LK3H 3WN5C 3ZL4L 4CGTA 3GIZL 4QXTB 4MAUL 5HI4D 1IAMA 4YHPA 1XIWD 1A1MB 2VLRE 4JFFE 4M7JH 4YGVA 4IMLB 5FGRA 1JMXA 4MXQC 1VGKB 1MJJA 5E2WH 1XIWB 1FV1B 3TT1H 5B38B 2CKNA 2GTZA 1KJ2B 3QEQB 2GIYA 3VXUB 4JQVA 5AZ2H 5IHZA 1CF8L 2AJUL 3N0PB 4NQDB 4QRQB 4RCAA 2I07A 3WIIH 5DMGC 4M8VA 5I1HH 1FQ9C 1QSFB 1NCDL 1UB5A 4EI5B 2X4PB 2FJHA 1X5YA 4YXLL 3ULVH 5K9JH 1G9NC 2P42B 2R0KL 5BRZD 1HYRC 1JGLH 4XCCH 1DQDH 3QDGB 2PO6D 5KW9H 1LK3L 1C1EH 4G5ZL 5L7XL 3LVEA 4MDIB 5DTFA 3GSVB 1RIUL 5D5MB 3MNWB 1RUAL 3RUGE 1MEXH 2DYPA 2J88H 1KT2A 2X70A 1H3UA 5HY9B 1IAIL 2VTFA 2Q76B 4ALAH 2XPGB 5DD5L 4LLWB 1RZ8B 3W2DH 3GMQB 4RMTA 3BESR 1J8KA 4CVWA 3I9GH 4KZDL 3MTRA 2DWDA 5E2WL 1T3FB 3EYUH 2EYRA 4NQVA 2FWOA 5SWSB 1K6QL 1RI8A 2C26A 5BJTB 4KDVA 2NLJA 4KRNA 1PYWB 4Q2ZA 1TVBA 5HYJD 5C8JB 2EXWD 2XRAH 1C16A 2ICWI 1U58A 1KFAL 4PPTA 35C8L 3NFPA 4WI2A 4OSUH 1XF4B 5E6YA 5DI8B 4OFKA 5GGUB 3BKMH 4RBPH 1LEGB 4HF5H 3MRGA 2C7UA 3HHRB 2O5XH 3IFNL 3O6FB 1LWRA 1K2DA 1WT5A 2IQAA 1UWXH 5DK2A 4ALAL 5J6HB 1T3FA 1RD6A 2PUQT 1KJVB 1UXSA 4U1HB 2OS7A 3MCLH 5I0DA 4ETQA 4PJBB 4JFDD 5GS0H 5C6TL 3DETC 1JGDB 4NFCA 1N59B 4Y2DB 4G8EB 5ICXB 3KPSD 1KF9B 5GISL 5CMAA 1A6TB 3QQ9C 4NZUL 1OTTC 5CEXA 1JYNA 3KDMA 1NBQA 4WJ5A 1C5DB 2HFFB 4JJ5A 3P0GB 3RVXC 3PP3K 3QULB 3CD4A 4Q9QH 2P8PB 1T83C 4R96B 1NMCB 1KPVB 4GRWE 1G0XA 1FH5L 4V1DA 5ERWB 4HZAA 1XF3B 3S7GA 4U4BA 3LHPH 5DJ8A 2GYSA 1KTKE 2DQUH 1D5MA 3CFCL 2E7BA 2EYTB 1RHHA 5HYSB 1INDH 3B9KA 2X4QA 2B1HL 5F3HB 3RAJL 5BW7A 1ZHKB 2WANA 2YPKA 4NNXB 2VAJA 2DDQH 4GH7B 2IPUK 4Y4FB 5IVOA 3A0OA 5M95B 3C6SA 5L2KD 4C56B 3HZKB 3U83A 2HFFA 4JJ5B 5HYQA 4HCRH 2AK4B 1I7RB 1A6ZB 1CDBA 4MXQD 1PGRB 2PN5A 1KJ2A 3UYPA 1JZ3A 2E6JA 2DM4A 4I0PA 4Z77B 3L3HA 2CKBH 4EKXA 4QGTA 4WI4A 2EDYA 1X6LA 5E5MA 2WWMD 3PJSA 4EQ3A 1JWSA 5DGQA 4OQTL 1RZIA 4QXUH 1D5ZB 4WW1A 2ITCA 5ADOH 5HHXH 3X12B 1J10A 5CILL 4P3CH 2AK1L 2B0SH 5DUPH 4ZUUA 2FB4H 2FJHB 2E27H 5HYQB 1CE1L 5I8CB 2I24N 1IGIH 3KPMB 1WFOA 3C2AL 2VLKB 5CWSB 1M6OA 2QV2A 2ZPKL 2X4NA 1CFVL 4JFFD 3QIWD 4RGNB 3OKEB 4WWKA 4N5ED 2PTTA 4NKQB 1CLYL 3GB7B 4F8TA 4U6HA 1ZT7A 3EJYC 3BN9C 4QRPE 5KJRH 3DO3A 1EAPA 5ANMB 3HE7D 1YY8A 4LLWA 3BO8B 4HJ0C 4UV4L 2VO5A 4I3RL 3Q6FA 4X5LA 5JORA 1WITA 5I66A 2VZOA 4PLJC 5C71A 4XHQA 3ZDXF 2W0PA 1RZFH 4KTEH 3DV4B 3U4EA 1E4WH 3S34L 3LKQA 4C57C 5T1DL 3UAJC 4WI5A 4DKDC 4NGHL 2XTLA 5JOFB 1PAMA 1B90A 4JFFA 1SJHA 2BERA 2IH3A 4IRSA 1FG2A 4JG1L 5F9WC 4NQDD 1GPOL 1XF4A 4LCCA 1IFHL 1SYSA 5GGUA 1XGPB 4P4RB 1A4JB 5SX5H 4G7VL 1UWXK 5IK3A 4BFEA 1QO3B 4L3CB 1KCVH 1DVFA 5BO1L 2I60L 1T6WA 4Z0XA 1KB5H 4P9HL 4RGOH 3NN8B 1NSNL 1A9EB 3RJQB 3WUWA 43CAA 1H3PH 2UWEF 2NR6D 1F3DH 1AD9A 1G7JB 4OF3A 2OYPA 1CICB 1AO7D 4I3RH 4BH7B 1DQJA 4QOKA 3UBXG 4BM7A 3B5TA 4U1KB 1KBGH 3Q3GB 5IM7B 3GMOA 4A6YH 5GGVY 1ONQB 5D4QA 4PRPE 3ARFC 4U2ZA 5HHNB 1UKTA 3R4DA 4ONGH 5ENWB 1KPUA 1KCUH 1CN4A 5D1QC 5L0QC 4NGHH 2YD6A 4L8SC 3V5HA 1CYGA 4NRXA 5IT2H 5I17A 1ND0B 3IS0X 5TQ0L 4JJHA 3O3DA 4BUHA 1YMME 4OZFH 4FP8H 1NC2B 1QLFA 1ZT4A 1CDYA 3GSQA 3KNBB 4YO0A 2DB8A 1S9VA 4EUPA 5GGQL 4ZO6A 1XR8A 4XHJC 3WL9A 4NSKA 4HUXB 4XP1H 5LGKA 1TTFA 2XA8L 1OPGH 4MA3A 4AG4L 5HVHB 2GT9B 4K7PL 5GRWA 5HHVL 5JDSB 1NGXA 4YHOH 2BY3A 4F3FA 1KCRL 5JO5A 4NFDA 5CS7A 4X6EB 4OM1H 1MCOH 1BVZA 1BZ9B 3ET9F 3RTQB 3T8XA 4RDQG 4AL8H 4BJLA 2V9QA 4PJ9B 3SE8H 3EYVA 1OAXH 2I07B 1T1XA 4U6XB 2BY1A 5DMIH 2IAMB 1YN7B 3HMXH 4ELME 2V9RA 5KSUA 2WWKT 3FKUS 2M8XA 2VXQH 3L3JA 1H8OA 5I15H 4PJ9C 1FNSH 3IDUA 2PCPA 2VQUA 3HFMH 4Y5VC 2EECA 2RR3A 3KPNB 3QJFB 1QA9B 3O4LD 1FE8L 3H7LA 5J6GA 1XGUB 3SGDI 3VFTA 3O9WC 3ULSB 1W8OA 3HNVL 5EIQA 3BJLA 3WJLC 2VDLL 3P40A 1KEMH 1AIFB 3DV4A 5I66B 3ARGB 3KYMB 4P9HC 3HNTL 1LHZA 1I9IH 2IGFH 3LQZA 3PWVB 3AAZA 4PRIA 4ENED 1N5AB 4RZCA 2IALB 4QRUB 2YPVL 3OKMA 3R1GL 1KB9J 4LHUG 4K94L 4NWUL 1BD2E 2WP3O 5HI4C 2R2EB 5D6CB 3PGFL 4XNZB 5LQBL 5HHOD 2ZOKB 1JV5B 4L4TB 2R1WA 4R3SB 3V0WL 4PYHA 3VMPA 4YNYB 4OI9A 4EEEA 5FYJH 1FIGH 1MFEH 3BX7C 2AW2A 7FABL 5DA0B 2GK0B 2DJ4A 4I5BB 4D3CL 5DJ6A 4ZOEA 1AGBA 3QUMB 2PF6A 4AY0A 3QNXB 4NBYB 4WEBH 3IT8D 3DXAD 5FDWB 4LVHB 4KKLC 2MFNA 4HV8A 2FGWH 1D5ZA 3HE7B 4IIQB 3CDYA 5CZXD 1GGBH 2VDLH 3CX5J 5ENWA 3NTCH 5FKPA 4KUZL 1HHKB 1IM3B 1RJLB 3QUZD 1K3IA 4ZTOH 3LQMA 4YDVB 1J5OH 2XA3A 1ZWIA 4GBXA 3FB7A 1V3LA 2DMBA 1CBVH 2WWMC 1NANH 1CIDA 1EHLH 4E41B 4LHJB 1JZ6A 2NY2B 1WZMA 4K71C 4Y5YC 3UPRA 2VL5B 2J5LC 2YWZA 2BVQA 3BAEL 3G5VA 3L5WA 4KRLB 4OFYA 2F19H 3OJDB 1ETZB 2NY6D 3A67L 1S9VB 1ED3B 1SMAA 3RIFK 2NXZD 5EOCJ 4PV9B 5CKGA 2F19L 1AFVH 4N9GA 3PIQB 4I4WA 5E99L 3DX8A 4NP4H 1EHLL 4J3VA 2ZUSA 3UTPD 1ZHBA 4HUWB 2K7QA 3CFKA 4JHAL 1BQSA 2OI9B 3RIAF 3IB4A 3U4EB 3A6BH 2IADB 3BZFB 4ZPVB 3QQ9D 4L9DA 3TZVC 2V9TA 1S5IL 1OP5H 3KXFE 1ETZA 3QO0B 3W0WD 4JE4B 2SEBB 4S2SA 1BF8A 4CVZA 1BZ9A 1RK0B 3MLWH 3OKOB 4XAWH 3O6LL 3MGTB 5D7LD 4PJXA 1YDPA 3BUYA 3E6FA 1ACYH 1XF1A 1UJ3C 5HY9A 1HKLH 2EDHA 5C0BE 4FQXC 2A83B 1HSBB 4PRHA 4MD0A 4P46B 3V95A 4UT6L 1K4DA 4AJ0A 2EZ0D 3BW9A 1ES0B 4Z0XB 4JHAH 1EEZA 4HIEB 3DLQR 4K55A 5I1CH 2C5DC 1X5AA 3BDYL 4DW2L 5IWLC 5D6DA 5INCB 2V5YA 5HPMA 1A7NH 4GSDL 3UTSE 3KAAA 2GJZA 1X5JA 2NLJB 4OCRH 2YD7A 5CJXA 1T89A 2VKWA 2PO6A 3CFIC 4UUJB 3LZFH 3W9EA 1TCRA 2BFVL 3VFNB 1PG7H 5A1AA 4PJIE 5KOMC 3WNOA 3W5NA 4FNLH 3UTZB 2DYPD 1P7QB 4LPUA 5DYOB 2XWJA 4M7LT 3CDGA 3MCG1 3IDJB 4PRIB 4JZOA 1NGYB 3ARGA 3KYMA 2EDXA 1WWCA 2ARJA 4FFVC 1EEZB 2XOTA 3MREA 5E7BA 4EOWH 2FZ3A 1NMAH 2VL4A 2XZCH 5DC9B 3BP4A 4LPYA 1HCFX 4MX7B 5ESQB 1KXTB 3UTTD 3S6CA 2RCSL 3HPLA 1HK6A 1T2QH 3BEVA 4U31A 5KVMC 2UV3A 3D3VB 2BXYA 4Y16B 5GSRB 4JGJA 4D8PA 2NY4B 3ARYA 5IVXF 2HAZA 4NQSB 1WV7T 3STZB 4QEGA 1WIPA 4XMPL 4PJ5E 3TN0B 2WQRA 2JIXD 2YWYA 3AROA 1LP9A 3B9KB 2E8ZA 4U3CA 2GJ6E 3QEUB 2L0DA 2F8XC 5D7JC 4XB7A 4PGEA 5IMLB 2GHWB 2P8LB 3LRGA 4AM0A 3ZHKA 1INEH 2HFEB 5FCSH 4KKAD 3RVUD 1AXSB 3VXUD 5I1HL 1FNGB 5TQ2L 3GMLA 2Y06H 4RNRB 4ZYKB 1XGYL 2C4FU 3BPOB 3KPSA 4W6YB 4JR9L 1X5XA 3MZTA 4KUCF 1FNAA 1KV3A 5J9PB 1LO2H 3QUMH 4P46C 4IRJD 3QUXA 4RX4A 4HFWA 4HUNB 1JMZA 1J88A 4OF0A 5ESAB 1N5YH 4G42A 4I0PB 3FMGL 2WLYA 5C86A 4M6OH 4X0KB 4XC3L 4ZFFB 2XTJC 4WV1C 3LDBC 1FNFA 4LQ1A 5FK9B 5BS0B 5CUSL 4OCSH 2MWCA 25C8L 4Y1AB 4XCEA 3NIDE 4FP8L 1P9MC 5I8OH 4GKOA 3TBYA 4ODUA 1AGDB 4YHNB 4N9GB 3ZYZA 3HUJF 4UB0H 2J6EL 3IFOB 3UROR 2P49B 3H8NA 3UDWC 3VXQB 4N0UB 4IHOA 3DECA 2BJML 2ZUWA 1QFUH 1S7UA 2H3NA 4ZS7H 5IEKB 3I02A 3Q6GL 1IEAA 3PWUA 3PQYD 3IAQA 1KB5B 1HWHB 4AQ1B 4L8BB 5FYKD 1XF2A 3VG9C 1Z9LA 1Z3GH 5FYJL 3ROOA 5KVDH 1JIBA 3T0WA 3M8OL 4P23B 4HIEA 3MA7B 4D0CA 3V0VB 3WSQH 4H25B 1Q0YH 3LMJL 3CLFL 1KCKA 4ZPTB 5I30L 4LCWD 3EUUA 4J4PD 1F13A 3QBTB 1UENA 5KSAC 4MS8C 2BVPB 1FNEB 4WHTA 1YEJL 3EAKA 1KC5L 5IB2B 3A6BL 2AJVL 1U92A 4QHMB 1X5KA 1KCRH 5I71C 5DMYA 1CFSA 4IMKA 5E4EC 1JHTB 4OGZA 5L9DH 1OQOA 4M00A 1GGBL 2E7LA 3MRBB 5I1KL 4U6VH 4BQ9A 1QUNA 1ZEAL 4F58H 3EYFA 3PE9A 3T1FB 4PY7B 1SEBB 3CFCH 4LCUA 3QUYD 3P3YA 1INDL 5C07D 4IRSB 1G9NL 5J6GB 2X4TA 3MCKA 4WFED 4CMMB 4ZO8A 1QKZH 2HH0L 3L5IA 3EFFA 2FIKA 2AXJA 3NN8A 4LSUL 4KRMB 4DOHB 1CD8A 5E9DB 3RWIA 3E3QE 4B41A 1JBJA 2AQ1A 1GGCL 4EN3A 1UYWH 1YEFH 2JE8A 4P5TD 1K85A 1KTDB 4KKNA 3UPRB 1PBYA 1UZ8A 4LLQB 3NMEA 1T0NB 3OMZA 3G5VB 1FVCA 4JRYA 5GSRA 4MQ7A 3CXDL 3IFNH 5DD0H 4MJIE 5IFAH 3QEQE 1YEJH 5EUKA 2XV6B 5GGTA 4NKMA 4AM0B 1LEGA 3BP6A 4FFWC 1YUHB 3QEHB 4OLVH 2PNDA 2EICA 2DQEH 4JEGB 2BSSB 4NC1C 2ESVE 4GKZB 4NRYB 3WFZA 3KPOA 4I5BA 1UZ8B 1C08B 2EYSA 4LLQA 2DM7A 3FTGA 1O7VA 4QO1A 3E8UH 4KKBC 4XVTL 4DQOL 3RU8H 4QRQA 3N1MC 2ICWJ 3T09A 3OSKA 1NL0L 4K23L 1MCSA 4LEXH 1OGTB 5B38A 3LH2L 2DLTA 1KNOA 3WL9B 4XCYA 4QRPD 2IBBA 5MEPA 5DQDL 1JNJA 3RVTD 5ELIA 4JM2F 3K0WA 2CXGA 4G9FA 2Q7YA 2J88L 2J3SA 3RL1A 4DTGH 3CGTA 2A83A 4X0KA 3M17B 4LOUD 4HGMA 5FA3B 1BQHG 1SJVA 2DD8L 4NZJA 2GSIB 4WCYH 5T33L 3PHSA 4HCRL 3I3EA 4NO5A 3FQNB 1OB1A 5D7IF 4BSVA 4Y4FA 5DZNA 3B9VA 4C56A 3MJ8A 4APQD 3J8F7 3MV8A 4EUPG 2Y72A 1WCBA 15C8H 3SN6N 1AD0A 4N0UA 1IZJA 3FFCB 3MRJA 3P0YH 4DTGL 2ADFL 1RZFL 3JWOH 4PRNA 2D7TL 3ZE1E 1RAMA 4BH8B 2G9HB 3RWFA 1J9CT 1HHJA 5JHLL 2V17L 1CFVH 1QLEL 1C7SA 2APXA 3RVTC 1AP2A 4H88H 3QFJB 5AAMA 5IIEA 3TV3L 2YKLH 4W6XB 3UYOD 4JFEA 3MLTA 5CEZD 1TCMA 3CLEL 5EO1B 1F3JA 1WVZA 2HKFH 2OTUB 2CDGA 3MYJA 4HKZA 4LVEA 4ZS6D 1S7WB 3O2WL 5IVXE 3FO2A 4GQ9H 5IF0B 2NTSP 3D2UA 1IT9L 5IB3B 3MLXH 1F90L 3QJHB 3AS0A 4PJDB 4DKEL 2VKXA 4LIQL 4QTIL 5I1EH 1IAII 2R4SH 2PYEB 1S9YB 3D25B 2OR9H 4ZAKA 1WWWX 4MAYB 1Z3GL 4N1CA 2B1AH 5DGRA 2OXGA 4IBLT 5DR5L 4PLNC 4EBQH 1HXYB 1KPRB 4PJ8B 1IL1A 5ILTL 2BNRD 2V2XB 2FNBA 43C9B 5BMFH 5EWIL 3BQUC 3LEXA 2VDRL 4EN3B 2AV1A 2WAHA 4NPYA 3QDMA 4Y16D 3UTTE 4Y2DA 4HGWB 3MACH 1YNKL 1FVCB 3BQUA 3LPGA 2R0LL 4LIQH 4QTIH 4ZUVB 4CMMA 5C0BD 1P1ZB 4XVJL 4H5SB 1JV5A 3EYQD 4OLXH 5DFWH 1IE5A 4G6MH 1KCVL 1RZKL 4MCYA 4UOJA 3FFCD 5C1MB 1X5ZA 1T20B 3TO2A 1A14H 3MRNB 3SO5A 4RQQA 2Y9RT 4PFEA 1QR4A 4L1DA 4ZAKD 3VXTA 3VWJB 5ICZB 4P57B 3FOMA 3FQRA 4MQXC 4B7LA 2ZUTA 2WW8A 1L7IH 3E2HB 5JNYA 1GRWA 3UJIH 1V3MA 4K7PH 3LS4L 5GRJL 5HHVH 1SYSB 4P2QD 2R29L 2AXHA 2XKSA 1FC2D 4K2UH 5CP3H 4XCEB 5C0GB 4HKBA 5L7XH 2JELH 4WVRA 2VLKE 2CUIA 2N4IA 2LU7A 3OR7A 2EEBA 3D5OF 2M26A 4Y16A 1ZKAA 2XFXB 4P4KA 5DJ2A 2DQDH 3GMOB 1AY1L 4HFUL 1CZ8H 5C0BA 3O6FD 3OAUL 5D1QA 4HWNA 2KQNA 3BPNC 4M7JL 2XY1A 4X5WB 4XPTL 2ENSA 2W59A 3WIHH 2EDNA 3WYRA 1MCNA 4IRJC 1FFOB 3EOAA 5KVDL 3QDME 1I7UA 5AZ2L 2WUCH 3GSNH 4JFQA 3X3FL 2EXYD 4H25A 1WZKA 3WDIA 1YEEH 5CD5D 1MIMH 4KMTH 3F58L 1FNGA 4IOIA 4F58L 1XT5A 2XRAL 4R0LC 4GXVL 2Q87A 5JW5A 3MRCA 4IJ3C 1FGVL 4LSRL 1ZA3B 3SE9H 3DVNA 4YHPB 1QACA 1F4XH 1V7MH 3KLAB 2DBJA 3RU8L 3D39D 5KG9A 3IGAB 3LQAH 3GKZA 3MJ9A 4LSSL 5FYLD 4M7KL 5GSVB 2GT9A 3K2UL 1OB1B 5JDSA 4WNQA 3G08B 1F02I 3QNYB 4GG6F 1OGAA 4X6EA 3MJ8B 3RI5F 2XA8H 1IGTB 2ZP0T 3IDNB 4W4OC 5ID0B 4FXGA 4Z7VF 2JIXB 1YDPB 4QHLA 2YZ1A 3V7MA 4HUVB 3I9GL 1L9NA 2YPLB 2W0KA 4QF1B 1DTUA 4BH8A 3TZVD 5BV7B 3BD3A 3MBXH 4LNVA 4G7YH 1NBZA 4M3KB 5C0AB 4LK4A 2DAVA 4XCNA 4MD4B 4UINH 3O2VL 5EC2B 3TP4A 3B9EA 4Y5VA 4N0CD 1NQBA 4JG0H 3ZZ1A 3MBXL 35C8H 3JWOL 1GOFA 4CU7A 1MH5A 1XCTB 3WIHA 1U8JA 5JIHA 1DEEA 2VAAA 3PDOB 5IW6B 4OZFB 3EO1A 4N9OB 1HKFA 4OUUB 1B0GB 3LQAL 1DBJH 1PKQA 3QEHA 3CVHL 4RGNC 1CFSB 1MCWM 2EYRB 3HG1E 1M71A 1X4ZA 2YA0A 1FLRH 2IH1A 2WMPA 1JUFA 4P2CG 4KVNH 5CZXC 4LVHC 5IEHA 3RP1A 5JUEL 2CGRL 4I0CC 3ULSA 4WI6A 3QWRA 4YXKL 3KLSA 3FQRB 1TFHA 3BWUC 2MKLC 4BH7A 3MJ7B 1OGTA 4HXBL 4MCYB 4FTVB 5A40E 5GS1C 4KJPD 3ALXA 1YN6A 1CE6B 4OD3H 2AI0L 4PTTA 1K2DB 4CN6A 3DXAE 3EO1B 4NZTL 3CVHH 3BAEH 5HVWA 3AS3A 3B2VL 4UIKL 2Q86A 3QYCA 1G7MB 2JB6B 4CL7A 5K59E 5DJ6B 4YXHH 5JNYB 2UUDH 2CGRH 3VG0H 3MBEB 2Q1EA 3S5LB 3RVVC 1U95A 3QP3A 2C3VB 5D7LE 1KEGL 2FX8L 1TMCB 5EBWA 4XCFH 3OBAA 2P8PA 3QEQA 4R96A 3ZKMD 5JHDB 1BFOB 2ARJQ 3E0GA 3PDDA 4NO0A 3ABZA 3X11A 5FYLH 3UC0L 3KS0J 3QFJE 3FQUB 1KLGA 4FNLL 4G42B 5CHNB 4OV6F 2RGSA 5F88B 1T83A 3T04D 5FHBH 3OZ9L 1PEWA 1CK0H 5TE6H 5IBUG 5IIEB 3ZTNL 1E4KC 2ADJB 5DT1L 5M94B 1NBYB 5CZVH 2HT3C 4Z7QE 4GSDH 1EFXA 1DUYA 1K5NB 2Z8WC 3SDXF 5I1IL 1E4KA 2OJZH 4TUJB 2EDBA 2FGZA 3V4VL 1QSEE 5IFHH 2DWEB 4IHOB 2AK4D 5HYFA 2Q7NA 2VDRH 3UBXI 1UZ6E 2A6JA 1MFNA 5KG9B 1MNUL 4N8PA 1MPAH 3S3JA 3BDBA 2ID5A 1EHNA 4M3JA 4P9HH 3CUPB 1JZ5A 3D39E 3CSYA 5KAQF 4Q6IB 3DIFA 2H6PA 3DURA 4KQ4L 2DWDB 5I8EB 3L1OH 3NCJL 4NQVB 3DSFH 4WGWB 2VLRD 3Q5YA 4FXGB 3GJFK 5GGVH 5LXGL 1SEQH 1YMMD 1NLBL 3X14A 2BMKA 4P2RD 5DD1L 1F4XL 2VUYA 3GK8L 5IV2B 3TESA 5KBNC 1T04A 1FVEA 1Z9MA 1J86A 4N1HB 5FUZL 4DVRH 4MJ6A 3DYOA 3OHXA 1GL4B 3QHZL 3T2OA 1UC6A 4YX2H 4Z78A 5IKCA 3PNWA 3PDGA 3SKJL 1AR1D 2VZSA 4QRUA 5JHLH 1CLCA 1NUNB 3GMNA 3T77B 3PDOA 3U6RA 3ULUC 3LQZB 3NCBB 1JNLH 2APFA 4JZJA 1T66D 1WAAF 5CJXC 5EU6D 2F54B 1MREL 1MH5B 1OAUL 3VWKA 2VLRA 4H26A 4MSWB 2EE6A 3NPSB 3S98A 5E7FA 5C0ND 3UEZA 3ZDYE 4XBPB 1UH4A 1ZAGA 4P2RA 5GJSH 5DURB 3DBXB 3GSWB 1C5DA 4L4TA 4R3SA 1GH7A 2GCYA 4FFZH 2R4SL 2RB8A 4U1JB 5E94A 1B2WH 3H7BB 2DL2A 2G5BA 3LN4B 3UX9B 2Q8AL 1GHFH 4GRWH 4JRYB 2HLFD 1ZLUH 1JPST 1MAKA 1JRHH 3LD8C 5KW9L 3WIFA 2FX7H 3JV6B 4E42B 2MMXA 2QQLH 2V2XA 5IEHB 2ED9A 3Q2CA 4PP1C 3QIBB 1UCBH 4M93C 2XI9A 3MMEA 1B88A 3CU7A 2IWGA 1U95B 5FKPB 3CLFH 3BP6B 5EOQH 5I74C 5ISZA 2J7LA 1N3NA 1X9QA 3P4OB 1QEWB 4FXKB 4NN6C 3MREB 1SVCP 3HAEH 4J23A 4OCWL 4I2XB 4JN1H 4MNHA 4WI9A 4XB8A 4JDTL 4PG2A 1T20A 3S5LA 1VGEL 4LBEA 2PTUA 5DURD 2BNQA 2EE3A 2WWKO 5GRXG 2AJYH 4P5TA 3QPQD 4RMQA 2QL1A 1T5WB 5DJCB 1UKSA 4OZIA 1ED3A 1XMWA 1R3HA 3C9NB 4XNQB 1NMBH 2HG5B 1UB6A 1C12B 1DBBL 4LPVA 3TJHD 1RZJC 4HWEL 3T0EA 2AKRA 4RA0C 4WI7A 4ELKB 2DQTL 2ZOLA 4XC1H 3GUTB 5EORL 4Z5RB 4RGMC 1D3CA 3OKDB 3RKDC 1Z0MA 2P5WD 3G5XA 1NCAH 4KVCL 3KPMA 4PJEA 4Z7UF 1FAIH 5IB5B 3MUZ1 4IRSD 1YQVH 4KDTC 5I18L 3RNKB 5BVPH 4L29A 5E03A 4U1NB 3QQ3A 4KHXL 4X9FA 2NY4D 1PDKA 4PRPA 2SEBA 4S2SB 2IFFH 3P2TA 3FB5A 2NX5D 2ZG1A 2R56H 2JJVA 5DF0A 5F7DB 4KK8C 4JHBA 5KTEH 4UQ3B 4TYUA 1OT2A 1FRGH 1HYSD 3VRJB 2YA1A 4QT5B 1JZ4A 3F7YA 4PGJA 2A0LC 3RWFB 4JFEB 1I9JL 4K9EH 1EMTL 2IQ9L 4JQXC 4I3GA 1HOCB 1JCKA 3EDDA 4PJBE 1QFWI 4P99A 1NMBL 1ZLSL 5B8CA 4MDJA 4K9EC 4O02H 4GKNA 5DD3H 4HXAH 4LPXA 4C58B 1FG2B 4DQOH 1KEML 4U6XA 4GMTH 5KVGH 2O5ZL 4X6BB 2GITA 4OZHE 5F7EH 4P4RA 4KRPC 3VXPB 3JSSA 4XH2A 1HNGA 2GUOA 1B4RA 2FHCA 1KPRA 2W92A 4PJ8A 1NLDH 4MAYA 2CXKA 2ZCHL 5KSBF 1T5XA 2YPVH 1BOGB 1FFRA 4A2LA 2YC1A 3FO0L 5JPNB 1ROWA 3CVHB 4RRPA 4E0RB 1IEHA 2VZ1A 4HBCL 4DN3L 1I9IL 2IGFL 1K8DA 3HNSL 1MY7A 1GIGL 3T65A 1EZVY 5I2IA 3DRQB 1KJ2L 5CJQL 3BKML 3V6BR 4LP4A 5DO2C 4WHDA 4KI5F 5L2KE 2J1KA 3IDXH 3MRDB 4WU5A 4YX2L 4PGBB 4NQSA 2EDQA 5C08A 2C3GA 4LQFH 3BXNA 2XKNA 4D8PB 4H5SA 5CJQH 3FT3A 2A6KB 3S3PA 5J1TC 3GSUB 1I85A 4L9LC 3KPRE 3ULVE 3IXAA 3BPCB 4KU1A 4LBEB 4FQJH 3GI8H 3F6LA 5LCVH 5F7EL 3PWJA 3KXFB 4F7PA 4N0UE 1ODAA 1Q1JL 4WFEE 2CLRA 3I2CL 2PKDA 2R0WH 5DHVB 5C0BB 15C8L 2CUHA 5EUKB 3T2NL 3T0VA 1EO5A 1B6UA 4C56E 3RNQB 2YR3A 4OGAC 4F33B 2X1QA 2B20A 4HHAB 4XNXH 2W60B 4F7MA 3WHXB 5F3BB 3C8KA 4K3JL 4RBPK 5DHVH 5EZIL 4ERSH 4POUB 2D7MA 1BD2A 3B83A 3OPZL 5FOBB 3ZE0E 5C0JA 1A1OA 1KXQE 3QXDA 1NCWL 1DLFL 2A6DB 2ATKB 3T0EB 1JPFB 1BWMA 3W81A 4QRRD 3ZMRA 1UACL 4EXPX 5EZIH 2VH5L 1NDGA 1BMGA 5DQDH 1YECH 4MNQA 3BIAX 4TRPH 1F4WL 4Y4FC 5HGAB 1Q94A 1G9MH 4Q6IC 2HN7B 5TE4H 3R1GH 3CXHK 4Z78B 5IKCB 4YEFA 5F7DA 3ULVD 5DUBA 5E2VH 1YN7A 3C5ZC 1EK3A 5ADOL 2DICA 3MLRL 5DFVD 3AMLA 3B4NA 2XZCL 5JIKA 1MFDL 3RWJB 5IGXL 2Z35B 4KK6C 2FH6A 2ITCB 1UACH 4DCQB 5I1EL 4UDTA 1S5IH 1VPOL 1JTTA 4QRPB 3WD5H 3QJFA 4WU7B 4MNGA 2ORBH 3OX8A 5K9QG 3M17A 1J0KA 3QHFL 2FJGB 5D93C 3IETB 2D9QB 4NKOB 3CFBA 1CGWA 4HJGA 4MXWL 5C0IB 4DW2H 3RX5A 3SO3B 5E99H 5ECJE 3S4SB 3VGBA 2RBLA 3BH9B 2G9HA 1GAFL 2Y5TB 2W9LA 1G7LA 1TJHH 4LVNB 1BQHA 2AS5M 2CIKB 4D9LL 4PJBF 4ZOCA 3UPCA 1PZ5B 2X1OA 2D7TH 1QRNE 1XCTA 1KIQA 1WEJH 3VFMB 1Q9LA 5C9JA 3AM8C 1BIHA 5DEGB 3SDAC 4RWHA 1N2RB 2NXYD 5EOCH 3WFCH 1OGAD 2IBZX 1RJZA 3MRQB 4PGDB 1BVLB 1H3TA 5HD8D 2E9WA 4B7IA 3L9RB 2FATH 1QBBA 2KQMA 3SDAA 3D85A 1RQ5A 3I6LE 3VXUE 5E6ZA 3OKNA 2A6IA 3CVHA 3EKCA 3GJEA 4HJGB 3T0AA 3SO3C 4ENEC 1JHKH 3KYKL 3QHFH 1RZGA 1IT9H 3Q48A 3PWLB 1U8HB 3LEVL 5K9JL 2DLFL 2NXZB 2CDGB 3H9SA 3HI1B 1WAAA 2AABL 3MR9B 1AGBB 1CLZL 4LCYB 2OJEB 4HUMB 1FIEA 5CJOL 2J8UE 3U4AA 4HIHB 2CRYA 3GSOB 3BZ4A 3CFEB 2DJUA 2FJFA 2ZUUA 3T3MF 5MP6H 5IVZA 5IMOB 1HHKA 3MUHL 4G6ML 1CG9B 4CJ1A 3GSWA 4LEOA 1IAOB 4NRYA 4UTBH 3GIVB 3SE9L 1JNHA 5CP7A 3PXJA 4NBXB 1H5BB 3NH7L 4OGYH 4TQEH 4PJXE 1A7OL 2BSSA 1X5HA 1CVRA 3VWJA 1DQQB 4F7MB 1A4KA 3RVUC 4UTBL 4LSSH 4M43L 1CFTB 1F6AA 1QSED 4OLWL 5DJAA 2JJTC 2YD2A 3F65A 5K9KA 4IOFC 2EZ0C 4X7FC 5FOBA 3P9MA 1T2XA 4Q58C 5FV1L 1QR1B 4JFYB 2NXYB 3HUJB 3RY5A 5EBMB 2FEEL 4OZFG 4U1SA 1T7VA 5HHQB 4YK4C 4PRBA 1B6DA 4R97B 3QUYB 3OV6A 3SBWA 4X5XB 5HYJA 5EIIA 2BNQE 3FMGH 1CXIA 4ODVL 4K7PY 3GMMB 4PJHE 2G2RB 3IU3A 2J8UA 2AJYL 2YD9A 4XX1G 3ZYOA 1FVDB 4F57H 3NZ8A 1SY6L 4AIZA 2D7PA 4PY8J 1HEZB 5BXFA 1R3HB 4XNQA 4CVZB 5J3HD 2HTLD 4JDTH 1QSEA 3ALPA 1KN4H 1BLNA 3R8QA 1NCDH 4GRLC 5JHDD 1A7PL 3QUYC 2Y06L 4HS3B 4XP4L 4EDWL 4WFFE 1U2HA 1F97A 1Y0LB 3MRIA 1QBML 4OZGF 1REIA 5T3XE 4P46A 5EO0A 3MLTB 1XCQB 2HRPL 2UVFA 4ODSH 4XNMA 3PL6B 2QQKH 4NQCD 3GMMA 5F7UA 1D6EB 4TSBL 3BWAB 4IOIB 1X44A 1RJYB 1JF6A 3QJHA 3S37H 3IETA 2COQA 4NKOA 2E7HA 2JKXA 1EAJA 1IGTA 3RWEA 4ZNEE 5F9JB 5INDA 5IVXB 1QFHA 1FVEB 2JIXA 1FNHA 4M48L 3H42L 4HX1A 3CDGB 1Q9KA 5FYJU 4U1LB 3SDAB 1NCNA 3HC3H 1O0VA 3VFPA 2BJMH 3B2VH 3ZKSD 2YMXH 3NABL 4LSDA 5DVLA 1B4JH 1PZ5A 4G8GB 3SQBA 5DQJA 5C8JA 2V2WA 3C5ZD 1U58B 5E4EB 1S9WB 1LILA 2OP4H 3GMRB 2NY2D 1FDLL 4M1CC 4QHMA 4FZ8L 1A3RH 5DS8B 3TIDB 3ARUA 1P4LA 4KTDL 4L8DA 1BQLH 3UBXB 4G5ZH 5TF1L 3X13A 4MJ5B 4ERSL 4XP1L 2UYLA 3CXDH 2ADGA 3BISA 1I8IB 4GKSA 4EVNA 5C0JB 1JUFB 3M07A 2E7LC 4WO4C 4G3YH 2AK4E 5CZVL 3KYAA 4XZUA 3IJYB 4Y4HC 5KVEL 5C0GA 3BKYL 1JTPA 4OZFA 2JJSC 3BVNA 1F6AB 5DJAB 4FABL 3MLWL 1S5HA 2ADFH 2X1XR 3KXFD 2CLZB 5GJTH 3PQYA 4JO2H 1VB9A 3TGXA 3FCTB 1PKOA 5ID1A 2R69L 2BHZA 3IS1X 4OIAA 3FO9A 3QNXA 1NGQL 2BNQB 2X1PA 3S9DB 1T0PB 4NN7B 4XPHH 2X4QB 1T4KA 1AO7B 1NMCC 3IDMA 1E27B 2HG5A 1NL0H 4K23H 4YGAB 1IM9B 4X9BA 3WO3B 4U0RB 2FB4L 1KCLA 4FZ8H 3CSGA 5FECB 3IU3B 5LGJB 2FWOB 5SWSA 4J1UB 5GGRB 4YDIL 2FCBA 3KJ4B 2V7HA 1BOYA 5GIRB 4K8RC 1PQZA 2R4RH 3K4DA 3C5SA 3MODL 4WNQB 3AREA 5EU4B 5ILTH 1NAML 4PB9H 2BNQD 1OCWH 4Z7OE 3HLAB 5C3LD 4LAQL 4YDLC 3ARBA 3PHQB 3QCTL 4M5YH 1OD9A 3VXSD 4OI7A 1T7YA 4AK1A 3QRGL 2DLFH 2Z4QA 3V6FB 3C60C 4PUBH 3JV4B 1DANU 3ETBF 3QA3B 4X7CC 5CWSA 2UZIL 4EN3D 3BPNB 5FFLA 4URTB 1RK1A 3KVQA 3OPZH 1HHIA 1TDQA 4X4XA 1WZ1L 5SWSD 4F8QA 4YHMH 4F7CB 1SMOA 2EIZB 5JZ7D 2JB5H 1FZMA 5J56B 1MF2H 1KIRB 1XZ0A 1YMHB 4FXLA 4JM4H 4PB9L 2QSVA 1HOCA 4QOKD 5HGHB 1TJIL 4OGXH 1JWMA 2K3TA 2Z92B 3DSNA 1F4HA 1ZSDA 4EDXA 1KENH 1MCCA 2YD5A 4HIHA 3CH8A 3O11A 5E1HB 4DK6A 1U9KA 2M2DA 3DROA 4G6JL 4BQBA 5FO8B 4PRNB 1KUMA 3I84A 1NAMA 1MLCA 1J0YA 2BZDA 2OMNA 4XMKH 4Z7OF 1NBVL 2DQIL 5CSGA 3HC0B 4GW5A 4Q6IA 4LDEB 1T21A 1PKQB 3PNWB 2BFVH 3LV3A 1CT8A 3UMTA 3VXME 1NAKL 1WSST 1XF5B 4K8RD 4JZJC 4RMRA 5HGHA 1HH6A 3B5HA 2BMKB 3VI3F 3G9VA 3D2UB 3MNZA 1UKQA 2FLRT 1Q0XL 1Q9LB 1IC7H 1QLRA 4U1GB 2ICWB 4HUKB 1G0YR 2QHRL 3OB8A 4DVBB 1P5UA 2E9BA 3C8HA 1DBBH 1TPXB 1XIWC 5IJVA 1IMHC 1MF2L 1M05B 3QI9B 1BX2B 1ADQL 4FG6D 4X98B 5BMFL 5SWQB 3M1BA 4JANB 4JHWL 5F9AC 1S3KL 4ZFOL 4B5EA 4K07A 4TRPL 3U9UA 3IF1A 4AQOA 2OZ4A 4L8CA 2D0HA 1SBBA 5DRWA 2B1AL 4LLVB 2A38A 2MCPL 3HI1A 3KPOB 3K2UH 3MV8D 4JFZL 2Q3ZA 2IMNA 4HK3J 4P2YA 2ADIA 3KJ6H 1EERB 4AIZB 1NFDF 1JVKA 2CRMA 1MUJA 2VC2H 5TJWK 2Y25A 4PG9A 3LEVH 1WWAX 5I1JL 4CU6A 3IFPB 4UT9H 5F88A 1U8NB 1IEBA 4NO0B 3FOMB 1JFQH 5SWQA 4HFUH 5LGJA 2B5IC 2KBGA 4CW1B 3U9UB 5E8EB 5GRUH 1IKNC 3KPPA 4LGSB 4ZQKB 3D2UD 3GMLB 2AVGA 3DJ9A 1AI1H 5DC4B 3AY4C 3H3KA 1NGPH 3TFKC 3WXWH 3CMOH 32C2B 1RIVL 3JZ7A 4Z7UA 3WFEH 5D2NE 1JZ2A 4KK5D 2OI9C 4JFEE 5IBLD 4XVSH 1MWAB 1S7SB 5E2TL 4OB5H 4U7SA 2X89D 2HVKB 1UG9A 3TC9A 5H2BB 5EIIB 3L3KA 3VFSA 2CSPA 2XICA 3KYKH 4E5XA 5CGMA 2VDNL 3CCHA 1S78C 5ETUB 2WBJC 3PABB 5HXMA 3AB0C 5J13C 4YHKH 3GJFH 4R4BB 2FBJL 3FO2B 5EU7C 5C0AD 3SDDD 3G5XB 2W9DH 1QP1A 2A73B 5DFVC 4MNQD 5CGYD 2NY5C 1P4LB 1O5DT 3GBNH 1A6VL 2H1PL 4L8DB 2LV4A 3R06A 2IPKA 1QRND 1BQHB 1EPFA 2FBJH 4GW4B 2NY1B 3FAXA 5CILH 1XH3A 3MRRB 2VR9A 1R3KA 4RISH 3WO4C 4NKDA 3FT2B 2A9MH 3TPUB 4N0CC 3S4SG 4G43A 4X6DA 3FRPA 2C9AA 5A2IH 3F5WB 5D1XB 4IRZH 3VFRB 5EU5B 3HE6C 1NFIB 2E9JA 3O2VH 1RPQA 3QWOB 2Y6SC 3QUZA 3IFLL 3FFDA 5E9DD 3IRPX 2YSSB 1JE6A 4OD1L 3SE3C 4ZUTB 3DUSA 2VQTA 2UWEE 2NY0D 2EDRA 1AIFA 2DKMA 1S5HB 2J8UF 1FFPA 2DQGH 3U4BH 4H20H 5KSBE 1MJJB 1EJ6A 3C2SA 5C0AA 3FQWB 3GGWB 5DK0A 4R7DB 3F7QA 4AH2B 4UDUA 4HX1B 3RGVD 2BDNL 2EH8H 5H94B 2OTPA 4MB5A 1EA9C 1IM9D 1J8HE 3O3EB 4WTWA 2RFXB 2B4CH 4MXVF 1QLEH 1KYOJ 1W0YT 1PX4A 2C4FT 4R90H 2KKQA 4DVBA 3QI9A 3G04B 2QJDA 1YEDA 7FABH 5E9DA 5IJVB 1U3YA 2X9YA 4JDZB 2IPUG 1U2CA 1JNNH 4RAHA 3SDAD 4NDMB 2D0GA 5EPMB 5DMKB 3QWQB 3R8BB 1L0XA 2Z91A 4QY8B 5D1QB 3GO1L 1EGJA 3D1MC 2I26N 1FO0A 4UIKH 2DKUA 3T4AA 2GEEA 4BZYA 5I1LB 4FQQA 1FDLH 3ZT6A 5D7LA 5HHPA 5C09D 2F54D 4FTVA 5LGHL 4CMHC 2EC9U 5FDYA 5JXAL 2Z8RA 2EEAA 3CLEH 5DJDA 3S8WA 4PRHD 4I9WD 3PWJB 5F21B 3EDJA 1I1AA 3IAGC 1A6UH 1H3XA 3CK0H 4M03A 2F8OA 4U1SB 2DS4A 4Q0XL 4PRBB 4EBQL 3U46B 32C2A 3N50A 4HHAA 3MV7A 5IMKA 3SKJH 3MUY1 3CZFB 4JB9H 3FHQA 3V5KA 1LVEA 3AUVA 2ESVA 3CSPA 2XTJE 4QRSB 4GO6B 3MPCA 1JWMB 5DR5H 5I1LA 1RU9H 2IF7A 3P11H 2LTQB 5DD6A 2C1PA 3OXRB 1QPXA 4NCC2 3NOIA 2YUVA 2YD3A 1MOEA 5MEQA 1PSKH 1MWAA 3X3GH 5IBTH 1DP0A 2HFGL 1VFBA 1WWBX 5E8OB 4FFZL 1CK0L 1DL7L 4Y4KB 2IANE 3EZJB 3QXDB 2F53E 4M6NH 1EGJH 1UZ6F 3AREB 3KHOA 4Y4HD 2FL5B 3KJ4C 3LN5A 3PF2A 4YDLB 2DM3A 1RURH 3V4UL 2J12B 4MD4A 5C2UB 1OP5K 3TA3A 1RK0A 5INDB 2OZ4L 1NEZG 3NCCB 4X6BA 1EGJL 4M4PA 3F6IA 4JRXD 5CJOH 3H2WA 4UMGA 4D0DA 3VXOA 2HLAB 1OP3K 1MHPL 1JYWA 4GRWF 4O58L 2VAAB 1BOGA 1JI1A 4OV5A 2P5WE 5FCUL 3ULVF 3BFOA 1PSKL 1QVOA 1VADA 1I7TA 3GHBH 3LKSB 2Z35A 5D7SL 4XBGB 5DRWB 2GJ6D 2MCPH 1IZKA 2MQCA 5T1KA 2EDWA 5D1XA 1A64A 3F12A 5D70H 3V9FA 3D3VE 3BIKA 3WLBB 8FABB 5CCKH 5KS9E 3L1OL 3NCJH 5FO7B 4LKXA 1S9WA 5C9JB 2NMSA 2C4XA 4F2MB 3CFBB 4Z7VA 4PJ5B 2VXVL 2RFXA 2HLAA 1MIML 4KMTL 2A77L 2YEZB 5C08B 4DAGH 1MLCB 4YHYB 2Y5TA 5TE7H 1B9ZA 1NH6A 4XXDA 1A6AA 2NY6C 3GRWA 3EFDL 5D71L 3C5JB 1LE5A 5KSAB 3VXSB 3MUGA 1MWAH 1F2XK 4LRNH 5L8JB 3NA9L 2LTQC 2UYLB 4MX7A 2D31A 5KSAD 2YUWA 1DCLA 3HZYA 2D4FA 4N90E 1BVKB 3QG6A 2QQKL 1WC7A 3RL2B 1DBAH 3P30H 4XMLL 2A6IB 3OKNB 3BRDA 1J1XH 3AXLB 3IDIA 4ZPVA 1TQBB 2YK1H 4H1LH 3TM6A 4JPWL 4LSPL 1N5YL 4PJGA 4X80H 2YN5A 3VDCA 3LS4H 3WNMA 1FO0B 4K8RL 1S7SA 2VOTA 4IM8A 4U3HA 3QQ4A 3JV0A 1I9JH 1A1OB 1EEUA 1QSFA 4CMHB 2R1XB 2B8OT 3OGOE 4J4PA 2A2QT 2PR4H 3CAFA 1IBGH 1Q9WA 5IW1A 1FE8H 1W2KT 5IMKB 1I8KA 1CXKA 2ATKA 1K4DB 5T1DH 3V5KB 2H2SD 4MA1C 5LWYL 2V7HB 4WTZA 3JWOC 1I1AB 5CSBA 2FD6L 1BECA 3TT1L 4Q9CA 3SOBL 3B8SA 1WICA 3K4ZA 4HWBH 2IH3B 4UT9L 1U8NA 3B3IA 5F7HA 1LE9A 3V7AE 2Y4SA 3QUYA 3ZKXB 1HH9B 4P59H 3VXNA 1P7QA 2Z31D 5E8NB 2NX5E 5C2BH 1QSFD 3G5ZB 4XMLH 1XGTB 3JWDH 5DWUH 3QUZB 3VI4F 3WKNA 4KQ3H 1KFAH 1RV6X 5T1MB 4UOW1 3C8DA 1NC4A 4HAGA 1HIMH 3UZVB 4OIIH 3NCEB 3VXRA 4A6YB 3KLDA 4MJIB 2ZG2A 3SGKA 4R8WH 1NEZB 4HDIA 1AXTH 3HG1D 3HPLB 5I18H 3O0RH 1FCCA 2G2RA 1AC0A 1GZQA 3BH9A 3LB6C 4JR9H 2D7NA 4DZ8B 5TDOB 3B5GA 5DLMH 4TSBH 3MLYH 5KS9B 4TUOB 2WUBH 5J6HA 5FB8B 1EHAA 5BQ7A 3SJVA 1AKJA 1ZEAH 5JXEC 4HD9A 3WFHA 4WV1A 2GSGB 4ZFGL 3AS1A 4FQLH 3V5HB 2VE6A 3D6GA 1DUZB 1UA6H 2D7QA 5EZLA 5HPOA 1U8HA 4ZG1A 3MRBA 4MJ4A 3VFOB 5F7MC 1T21B 3RVVD 5EIVA 5GHWH 1G7QB 3K81A 4EUPB 1A3QA 4GKNB 4W68A 4GMTL 5KVGL 4XWGH 4PY8I 3V0WH 3BH8A 3U7WH 1AQKL 1EUTA 4WDIB 1FFNA 3Q6GH 1IAOA 5J1AA 1A6UL 1Q9KB 5A16A 2VSDA 2D9CA 5CJBA 1ACZA 5F44A 4R7NA 3WE6B 3GHEL 1LE5B 5JW4M 1XR9A 3T65B 2BRRH 4PJGB 4RWYL 5DJYB 3MV9B 1S7VA 4NC1E 1N8ZB 2OXHA 4HC1A 1KB9K 4XAKD 1NEUA 2AQ3A 3GK8H 5EBGA 6CGTA 4X6CF 1OAKH 2VJXA 3O8XC 1UM4L 4LASH 2XWBB 2D0FA 4ZODA 5AZEH 4J8RA 1PW3A 2ERJC 1BF2A 5DD0L 3IU4L 3KPQA 1MWAL 1YC7A 1NFKA 2BVTA 2F53B 3QDJE 1KEGH 5AWNL 4HMEA 5DMKA 5EPMA 3JVGC 4ZMAT 1T7XA 2Y07L 5A43C 3HPJA 1P4BL 3OR6A 1FVDA 1UWGL 5IHUL 2EXYC 2FL5A 3LN5B 1UQSA 1N4XL 4YAQA 5LKNA 1ZGLM 1BAFL 2G75B 3LIZL 3FQTA 1PG7L 4MWFA 3ZDYF 2IG2H 4JCLA 4PJHB 1HZHH 1QRNB 4GG6B 2LFGA 5L2JB 5JXAH 4HS3A 2K1MA 2AP2A 1ORSA 5DRZA 1XGTA 4RMWA 3TVMB 1NKRA 3FO9B 5EH1A 3STBA 5BW7C 2E7MA 5TPWL 4S0TD 5TDNA 4YQXL 2ADJA 1R3LA 4BSVB 5EU4A 2VERN 1WCQA 1ACYL 1WLHA 2XN9E 4ZS6C 3TIEA 1S9KC 1Q72L 4J3UA 2Y36H 2Q8BH 1VEPA 4GG6A 1LEIA 4J1UA 1BGXL 1S7TB 5F93C 5IB1A 4L9LB 4U7MA 1U3JA 3T2PA 1VA9A 3ILQD 1DFBH 3BUTA 3L95A 5DRXA 4YBQC 5AD0A 4NKDB 1NJ9A 4PJCA 5ICYA 1U8OA 4XRCB 5BS0D 2XIDA 4KKCD 5MEOB 5EORH 2V2WB 3F7VB 3D69B 1MCQA 3LPWA 1GAFH 1P6FA 3BP7A 2GFBA 3MLVH 4NBZB 1WZ1H 2EO1A 1RUKL 1I9RL 2CMRL 1FYTA 5E1AA 4JPVH 1CTNA 2HA1A 2YRLA 3DHJA 5EG6C 1SJXA 3UTOA 3O0RL 4R7DA 3IDYB 4ZAKB 2MKWA 2W65B 1X7QB 1QRKA 4LDOB 3ULUF 5EZLB 3W82A 5HDQL 1BD2D 2EC8A 4MA8L 1XEDA 4NQXA 5HSFA 2Z31B 3TWCL 4YJZL 3RVWC 4FQIH 2JCCB 3SE8L 3GSNB 1IBGL 5DDHA 3DUUB 2Q7YB 1A47A 1LP9E 2ZNXA 1XR9B 3ELAT 1XAUA 2YPLD 5FAAA 5LAXB 1QLRB 1INQA 4QOKE 4DJMA 2GCYB 4HLJA 1XIWA 3QRFM 2FX7L 5IMMB 3ARZA 4ZAKC 5EA0H 3PUCA 3L3IA