2H2SC

Crystal structure of e148a mutant of clc-ec1 in secn-
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
221
structure length
221
Chain Sequence
VRLLESGGGLVQPGGSLKLSCAASGFDYSRYWMSWVRQAPGKGLKWIGEINPVSSTINYTPSLKDKFIISRDNAKDTLYLQISKVRSEDTALYYCARLYYGYGYWYFDVWGAGTTVTVSSAKTTPPSVYPLAPGSAAAAASMVTLGCLVKGYFPEPVTVTWNSGSLAAGVHTFPAVLQAALYTLSSSVTVPSSSWPSETVTCNVAHPASSTKVDKKIVPRA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CLC Cl transporter
publication title Uncoupling of a CLC Cl(-)/H(+) Exchange Transporter by Polyatomic Anions
pubmed doi rcsb
source organism Escherichia coli
molecule tags Ion transport
total genus 37
structure length 221
sequence length 221
chains with identical sequence E
ec nomenclature
pdb deposition date 2006-05-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF07654 C1-set Immunoglobulin C1-set domain
C PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2h2sC02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2h2sC01
3WFHB 3IDNA 1P7QB 5I8OL 1NC2D 3BHBB 4I5BA 3M8OL 1L7IH 1MH5A 2D03H 2IFFL 4XCEB 1OGAD 1FBIL 1X6LA 2VAAB 4OZGF 5GS0C 1EBPA 3ULUD 1OPGL 5CEXB 1BBJB 4MCYA 5C07E 3WLWD 2X4NB 3VE0B 3RFZC 2DIBA 2VUYA 1P4LA 2X9XA 1YMMD 1QPXA 3TLRA 5D2LE 2XA8L 4LLYB 3D9AH 1U8QB 1E27A 2B4CC 4XMPH 5J3HD 4OD3H 1OQXA 4EN3A 1QLFB 3I3DA 3MNWB 3ARQA 5E00A 1KJVA 2A9MH 4WWKC 1ZHKA 4NC1E 3SKOA 3QUXB 5C0CA 4WY7H 1Q94A 3U46B 3D85A 4DVRL 4C56B 2H1PL 4UQ2B 5DJ8B 1MCBA 2VJXA 2YR3A 4M8QB 5T3ZH 5E5RB 5IHBA 5I1GL 1Z6JT 5C0AE 3DV4B 1YN6A 2R69H 4K3DH 1WGOA 4KAQH 4MX7B 3VWKD 1TPXB 2FJFB 3IU3A 3BMVA 2D7MA 5SX5H 4R90H 2EE2A 2C1PA 3A67H 2OXHA 3EOYG 3W9EB 5GS0D 5F1SA 5KSBF 2HVJA 1DQML 2ADGA 3FAWA 3O8XC 4WV1A 3DVGA 3U4AA 4ZXBC 1LEIB 4QHKJ 1U93A 3B8YA 3UBXA 4FXKA 5JHDA 4YBHA 4U0QB 1ADQA 3T4AA 1MFNA 3QDGD 1L4IA 1OHQA 4HW6A 3W0WA 3BD4A 1F3DH 3TNNA 5INDB 4WWKD 2LU7A 5C0DB 2W0KA 1IGCL 1FSKB 1NMCC 5CEYB 5IB2B 2FWOB 3OGCB 1GGCL 25C8H 4J4PC 1F90H 2AW2A 1AR1D 5E5UB 4ETQA 2OJZH 5I8OH 1ZHLA 2V2XB 1TQBB 4IDJL 4FQQB 3M8OH 2FZ3A 3G5YA 1A3QA 5HY9A 3OAZH 2IFFH 4MXVF 4H0HB 1FBIH 4JRXE 4PP2A 4DW2L 4FQHB 3FFDB 4J3XA 2YD1A 1OPGH 5ICXB 4LVHB 2VH5L 3A6CL 4L8SC 3STZB 4KVNH 3KS0H 1GL4B 3ILPB 1RIVL 3O8XD 2ZUVA 2XA8H 4UT9L 4ZXBD 2ESVD 2Y5TB 1KCSL 1N5YL 5GS1B 2A0LC 5JA8B 5DSCA 3C6SA 2AXFA 1WZ1L 2Q86A 5JIIA 1KNOB 4JN2A 1ACZA 4EBQL 2MHAA 4DVRH 4ZMAT 4XWOC 2H1PH 5T3XD 5M7QA 1G7LA 3V5KA 1S9YB 3CSPA 3AB0B 1V3KA 4K55A 4GQPH 3QUYB 2YWZA 4P2OB 4WTZG 5I1KL 4NGHL 1H0DA 4J4PD 1MQKL 3RDTA 3FRUA 2P5EB 4JPVH 1PKQB 3VD7A 1C7SA 4HCRL 4XPTL 5ITFA 4N0CC 1TTGA 1ZLWK 2VDKH 2DMKA 3QFJD 3GSUA 4TOYL 4WW2F 4BJLA 1JPST 5IM7B 1DQMH 2DI7A 3ARPA 2P7TA 2NPLX 5FHBL 3TO2B 4DKDC 4ZPTA 43C9B 1OARH 2EICA 1RPQA 4YAQB 1TVDA 4LOUC 3SQBA 3P77A 1VGKB 4UNUA 2YPLB 3W2DL 5FK9A 2I07A 4HD9A 4CL7A 2I5YL 3ROOB 3C9NA 2A0LD 3WHXB 3WYRA 2I24N 5D1XC 2EZ0C 5C0CE 1IGCH 5JDJA 1KTRL 4PJ5A 4OKVB 4F57H 1NGYA 4I48A 1KB5B 4KKLC 4XWOD 1F3DJ 2YD4A 3FO0L 4OIAA 4DEPB 1GGCH 1MREL 2F8VA 2JCCF 5TQ2L 1MLBA 1FO0A 4CVZB 4Z5RB 3IAGC 3QISA 4Y8AA 1R5IA 4GMTL 5L8KB 3OKKA 4ZS7H 2LABA 2WINA 3E1F1 3S36H 1ETZB 4Y5VA 2AK4D 4DW2H 3DUUA 4HIIB 4FMKA 4N0CD 4NJ9L 3O3EA 3PWUB 2VH5H 1XGUA 2J6EA 3K2MC 4ODVH 5ACZA 4HC1A 4G3YL 5DQ9B 3SPVB 3BQUC 5KANG 1RIVH 2A74B 4QTHB 1KYOJ 4ENEC 3HR5B 2E27L 2ICCA 4MJ5B 4YDJA 1ZLUK 1KCSH 1N5YH 4LOUD 3QUML 1CU4L 2DL2A 3MR9A 2FIKB 4AEIL 1PYWA 2EC9T 5HHMB 5JHDE 2IF7A 1WZ1H 5MEQB 4XVUC 3W0WE 4NPYB 4AL8L 4M93C 1QFUL 2G5BB 3HC3H 1BQHA 1F4XL 4XGZB 4JFDB 1HCFX 4YDIL 5D93C 3LRSA 1VESA 4IIQC 3CFJB 2EZ0D 5D1XD 4O2FA 1EO8L 3U48A 4NQSB 2XNAB 1G0XA 1CQYA 1C7TA 5BQ7B 4FQXA 2A6IB 3UTQA 4KKLD 2ERJC 4PRBA 1TMCB 3QIBC 3SQOL 5I1KH 1TJHL 1BGXH 2W0PA 3U0WL 1C5DA 2P1YA 1XGRB 3PGDB 3ARVA 4XPTH 2W38A 4MA1C 1D5XA 3D3VB 1CG9A 1JZ4A 1NCNA 1DBJL 3HZKB 2EIBA 3TT3L 3TZVA 2EH8L 3O45A 1BIHA 5FHBH 1FC2D 3NAAL 1S7XA 1OGTA 3BQUD 1FFQA 4ENED 2FJHB 1A9EA 2XPGB 3OR7B 4RGNB 5DUMH 5IB5B 4POUB 1YY8A 4MGXA 3B9KC 1MEXL 4I3RH 2JJSA 4XVUD 1I8KA 4I0PB 3EDDA 4UQ3A 1YMHB 3EYVA 3FO0H 2R1XA 4TSAL 2QKIA 3MRDA 5EA0L 1MREH 1ORSB 2WK2A 1E0OB 1F6LL 4PRHD 4PIRF 1XF3A 1I1RA 1HXYB 3QIBD 1OD7A 4G42B 4JFOA 2CDFB 4LCUA 1F02I 3CFEA 2HTKD 5BV7B 5T1DL 2J2ZA 4B7LA 4NJ9H 5I30L 1G1YA 2LVEA 4PY7A 2OJEA 3GDBA 1J0JA 3L3JA 5ACMA 3C5JB 1NCAL 4G3YH 5F7YC 1J8HB 3FO9B 5ETUB 2A1WL 4UOW0 4P2CG 2E27H 4LLVA 3BMWA 2NY3C 4QRUB 4NZUL 4L4VD 3QUMH 3TA3A 1CU4H 3DX7B 4AL8H 2XY1A 3B9KD 4KMTL 3GMPB 4KKNA 5JXEC 2A6DA 4NQED 1IAIL 1EO8H 4PJ5E 3QH3A 5ANMA 4F15C 3F12A 4OZIA 2CLRB 5ENWB 1NPUA 3ZYZA 3TBVA 3FAXA 4R0LB 4TVPH 3SQOH 4JFFB 4CJ0A 5F7UA 1TJHH 5D6DA 4U1LB 3U0WH 2ENSA 4L3EA 1EHAA 1LQSR 5DQJB 4NDMA 3EBAA 1DP0A 4F7EB 2WP3O 5F96L 3TBYB 4K3JH 5ERWA 3HPLA 1Y6NR 3T0DA 5CMAB 1OAXL 5AG8A 3TT3H 5DK3A 1HH6A 2EH8H 2VR4A 4HS3B 4OM0H 4PJ9C 43CAA 4L3CB 1FYTD 1AH1A 1FVEB 4PV9A 2HWZL 3WBDA 2NY3D 4WO4B 1H8OA 4NQUA 3DUSA 3CDCA 4KRPB 1MEXH 5D1ZC 1F4HA 3BP4B 1JNJA 1K3IA 3L5IA 5JXED 4G8FB 5L9DL 4X6BA 4ZAKA 4G7VL 1QOKA 1IZJA 1U8LA 5EA0H 2VB5A 4MNGA 1F58L 3LD8B 2R2EA 3MXWL 1EEZA 1ZSDB 3S34L 5L2KB 2F53D 4W6XB 5D7IA 2FLRT 1G9NL 4TVPE 1LE9A 1S7VB 1K6QL 4Z7WB 4KWUA 5T1DH 1JV5A 1R0AL 3SE4C 1G7QA 1OT1A 3Q5YA 5K59E 1I1AC 2KL6A 2MQ0A 1I1YB 1WIOA 4U1IB 2A1WH 3QNYA 1G9MC 5BRZB 3TP4A 2CIIA 4PJ9D 5F3HB 4NZUH 2EXYC 3QZWA 2YBRA 3LPFA 4X5WB 3MCKA 4XVJL 3QG7H 3VFNB 1Q0YL 3CFKB 4LP4A 5F88B 3FT3B 3I50L 4CMHB 1A1NA 2JE8A 3MSPA 5GGVH 32C2A 4MZ2A 1ES0B 4U7KA 2WQ8A 1YNTA 4M62H 5BVJB 5D1ZD 3RGVC 5DS8B 2ARWA 1I3RB 2IALB 4KU1A 3H9YA 1YZZA 1TQCC 3WFCL 4HIHA 3KPSB 4NRYA 3QIWC 3TVMB 3VXMA 1I7TB 1B0RA 3RJDA 2J4WL 3NN8A 2VLJA 4M48L 1TVHA 1XGYL 3TIDA 3V8OA 4QRRB 3SJVB 3MRHA 3HLAA 4M03A 3DROB 4PJ8A 2EYSB 3OG4B 3AM8C 2D4FA 4NNPL 4CMMB 2XWBB 5C09B 4HWEL 1I1AD 2VLKA 5CFHA 3ESVF 1FFOB 4LHUA 4Z76A 2HWZH 1ONQB 1QRNB 2EXYD 3IJYB 3RL2B 1FZKA 3UTTA 5FA3A 2CIKB 1I9IL 3HZYA 4R96B 4NM8L 5L9DH 3LN5B 1BD2A 3OXSA 3RGVD 3NPZB 4F58L 5ANME 4OZIE 1F58H 1IT9L 2YWYA 4G9DB 4WHTA 2Z93A 2D3VA 3MXWH 3QIWD 1CFQA 3U79A 3P4NB 4X9BA 3VXQB 1G9NH 4MSWA 4L3EE 3LH2L 1NUFA 4N90E 1CXFA 1UWGH 1FIGH 3L5WB 4HUXA 3C08H 3DETC 4JN1L 3ZZ1A 5EU4B 4HKXA 2Q7NA 3AC0A 1IKFL 3QCTL 4D0CB 3TBTB 3UDWC 3BPNC 4UINL 2GIYA 3T3ME 2R2HA 5KS9B 4XVJH 1OD9A 4LSDA 4H20H 2Y5EA 3O4LD 4JPKL 4NFDA 2WQRA 5MEND 1JF1B 5I8CB 5IW6B 3TN0B 1JL8A 3MOAL 4U1MB 3WFCH 3MYJB 4XVTL 3OKMA 5I18L 4MNGE 3QHTC 3T3MF 1DQDL 1EZVX 1KGCE 4OZFH 4M48H 3QWRA 5CD3B 2ITCB 1XGYH 3VD9A 3R06A 5D7IE 3V5HA 2OTUA 1UB5B 3IJHA 4ODTL 5EU3A 2V2WA 3DVFA 3ZDYF 4ONHB 5HJ3A 1NC4B 3KYOB 3UXFA 2EKSA 2K7QA 4F7TA 4NNPH 3QEQD 1W72A 3DETD 4QRRD 4W81A 1XR8A 1LK2B 4HWEH 3V7AG 4ERSL 3L1OL 4LK4A 3ZHKA 1CFTA 3H6JA 4Y19B 5D7JB 4Y5XC 1PW3A 3AU1B 5D7IF 3LKQA 1BWMA 5IESH 5I1JH 5KSVB 3MBXL 1T1ZB 2R4RL 3PWLB 3DGCR 5KZCD 2PW2B 1QFHA 5DRWA 4GRWB 1I7UB 5BCAA 1CFSB 4N0YL 1EJ6A 2NY1B 2BRQA 2HRLA 1TNNA 3VXME 5JMOC 1BLNB 1D7FA 5DJ0A 3HNTH 2JF1A 2VLJE 4X99B 5IB3A 3LH2H 2BCKB 2B5IB 1RHHA 2V5RA 4APQA 3EDEA 3VFRB 4JN1H 5KN5B 3P9LA 2ARJA 4X7TB 4QHLA 3CPLA 5J6GA 4LSVH 1IKFH 2VLKE 1BVLA 3RKPA 4XNZC 3C5SB 4JFXB 2YXMA 4UINH 1H3GA 2X4OA 2FL5A 2G75B 3HNVH 3S5LG 1HI6A 3MRMA 4JPKH 5FUOL 3UTTE 1UWXH 2V6HA 4XPFL 3UTOA 1N4XL 2NY5C 4OZ4A 1JHLH 1BD2E 2YPKB 5I9QC 1I4FA 3FO1A 1UZ8B 4XVTH 2A6KB 1OM3L 5F3BA 5JUEH 1DQDH 3DLQR 1JGUL 3BVNA 4TSCH 1DR9A 5TDOA 1FFNB 3SDCB 4Z0XA 3K1KC 3V52H 4JG1L 4ODTH 1X5ZA 4YK4C 3DO7B 3ESUF 3NZ8B 2D31B 4JAMB 1JPTH 5F8RC 3V7MA 2IAMA 3VXRB 3S4SG 2L7JA 1QEWA 1II4E 3TPUA 5IHUL 3C8KB 4F9LA 1AGBB 2X4SA 3L1OH 1HYRC 1KXTB 2A6JB 5DVNA 1CDUA 5C0IA 3D1MC 3QFDA 1BMGA 4XXDA 2WV3A 5FKPB 3D0LB 3U1SL 2NY6B 2W9EL 2EIEA 3HFML 3CSYB 4KQ3L 1S7RA 3OBAA 1XF4B 2R4RH 5D96B 2A83A 4D9RD 3QQ9C 4RAUB 1SJXA 3EO9H 5GZOC 3BISA 1EXUB 3M1BB 2MPAH 1W2KT 5MERA 1MHCB 3BJLA 4LNRB 4O02L 3SOBH 4YHLL 1NLDL 2A9NH 3DURA 4X83A 2GTWB 5IFHH 2Q8BL 2VE6A 1NJ9B 2DQUL 2IADA 5IW1A 2H2PC 4C83A 3H9SD 3D39A 3GKZA 2PF6A 3BZFA 4B5EA 1HOCB 5I74B 2J8UB 3NCYP 3GJFH 3VFGL 3MCLH 1EO7A 4WCYH 3LB6C 3TM6A 2QL1A 4UTAL 5FOBA 1QA9A 3ARUA 5MEPB 3GHBL 2C4FT 3MRLB 3ES6A 1OAQL 3OKOA 1IGTB 3NMEA 2WBWB 5FUOH 2G60H 4UNVA 3KYKH 3MRNB 3SDAB 4KKAC 4NQVB 2ADFL 2R1YB 1CFNA 1N4XH 5CZVH 5A3IC 3I9GL 4PJFA 3JWOH 5GZOD 5HHOA 1F8TL 4WI3A 2F19H 1OM3H 4PRPB 2GSGB 1SEBA 3D2UD 2VDOL 1JZ3A 1WLHA 2CMRH 4PRDB 2VKWA 4JG1H 3RZCC 1UXWA 3E6HA 1CDCA 1XH3B 3VRIB 2PCPA 4R2GB 2H2PD 1HDMA 2FLBT 3VH8B 1CF8L 5IHUH 4P5MA 5HVHC 5TGBA 5IVXB 1HH9B 4MNQB 3JV4B 1CT8A 5I73B 3LB6D 4RMTA 1S9XB 2H41A 3U6RA 4YHOL 4UMGA 1J0YA 1NEZB 1IM9A 4PFEA 1PG7W 3QO0B 2W07A 1WCBA 1G9EA 1WFOA 4JFQB 1A6ZB 4MB3A 4WFFE 4ZUTB 4HUWA 4Z7VB 4KKAD 2VO5A 1U92B 2V7NB 2C3GA 1CLOL 5A3ID 3IDXH 4O02H 1FCCA 5FUCE 4YHLH 1U95B 4YIQA 3VGEA 1NLDH 4WEMB 2IPKB 5FIEA 2DQUH 2VOTA 2NW3A 1Y18B 4FQPA 4HS8L 3RX7A 3A6BL 2AGJL 1FNLA 3RZCD 3IT8D 3TO4A 3LQAH 2C3XA 3WCYA 1R5VB 2HAZA 2VZ3A 1U8JA 3B3IA 4UAOC 3OB8A 3UTSB 3ULVE 1C08A 4LGPB 3VFGH 1ZAGA 5MI0B 4UTAH 3ZE0E 2FO1A 3GO1L 1HWGB 1IQDB 4IMLB 5HGGS 3DBXB 4Z6AT 1EGJL 1FG2A 3NIFF 4HKZA 2AEWA 4G6FB 3OZ9L 3RL1A 4C4KT 1MI5A 1PG7X 4RNRA 2YKLL 3H0TA 5GGVY 3IFNL 1BOGA 1F8TH 4Y4FC 3BPOC 3BIKA 2P8MB 4JQVC 1NGWA 3EGSB 1MQ8A 2VDOH 3C8DA 3SBWA 3OQ3B 5TF1L 5E24E 5E2WH 3QUZA 1VFBB 4Z77A 1YQVL 2DF3A 3PWPD 3RVUC 3GSQB 2PR4H 1BREA 4NHUB 5EH1A 2R9HC 3D39E 2X44D 4Z7OF 3DXAE 1CF8H 4OAWA 5DJCA 3RWHB 2VAJA 3WLBA 2ZSVA 4G8GB 4GS7C 3HRPA 5F7WC 3IKCB 3MUY1 3KHOA 4ZD3L 1RK0A 3QI9C 2VIRB 3PG2A 3HC0A 4YHOH 2BNRA 3LDBB 4Y2DC 1KJMB 4JO3L 4IMKC 2MCPL 5C92A 4QNPF 3BWUC 1CLOH 2WWMC 4PJFE 4MQXC 5HHOE 4IRSC 4MJIA 1AHWA 4Y4FD 4HIXL 4I8DA 1JIBA 5F1KC 4XMKL 3IAPA 2DWEA 2YS4A 3CCHB 2HRPL 1TCRB 4HS8H 3DYOA 1OT2A 2BX5A 1INQB 3VW3H 3RVUD 5CZXC 2BOCA 2CRYA 2R9HD 3KPMB 1BIIA 4U1JB 4UUJB 5E2UH 3WIIL 3QIUA 4NRXB 3WFDL 5I17A 4Y7MA 5ICYB 1GOHA 4P46C 1MSPA 2XY2A 3FONB 4JJ5A 1IC7L 1YPZB 1EHLL 1BQUA 1QNZH 3GO1H 3QI9D 3ZT5A 1T3FA 3BKCL 4RMQA 2D2OA 4B7IA 3S8WA 2AJVL 4Y2DD 3FOLA 1EGJH 2XZCL 3OZ9H 4DGYL 2YKLH 1A7QL 1ZVSB 3MV8A 1J10A 3IFNH 3OF6D 5DC0A 5DDHA 3P3YA 2VSCA 2WWMD 4MQXD 4X80L 4YO0A 4IRSD 3N9GL 2E9IA 2VL5A 4NKOA 5TF1H 3ZYJA 3KJ4B 4BQ6A 3GSVA 1NCTA 1T1YB 2V7HB 1A6TB 1C16B 1FNSH 4OGXL 4OFYA 2X7LB 4M6OL 5DC4B 5CZXD 3KXFA 1DVFA 3LHPL 1PQZA 1YDPA 4ZD3H 2HKHH 4G6JL 5I16B 4HS6B 1YEEH 4P46D 1RAMA 3CIQA 2YD6A 4OLUL 3X3FL 4JO3H 2MCPH 3GMRB 3NFSL 1Z2KA 5FA4B 3CK0L 4LKXB 1D5IL 4A2LA 2F74B 1QBBA 1MI5E 4DKAA 2ZUUA 1RZKH 1AJ7L 5J6HB 3GM8A 4CUCA 5MHSD 1ULVA 3BEVB 1NL0H 1LO5B 3QRGL 3S37X 5IFJB 1NFIA 2NX5A 3SE8L 1JFQL 1N64L 3U9UB 1S9WA 3CH8A 1MJJB 3GSOB 2DBJA 2Z91B 5DJXA 1WT5A 2LU3A 5E0QA 4G9FD 4IDLA 2FATL 4L9LC 1CGXA 2EDHA 5GGSA 3T0XA 3WIIH 3S98A 4HDIA 3FFCD 5C07B 1S9VB 2YUWA 1LEGB 3FO2A 4M7LT 4AK1A 5D2LB 2Z9TA 3BKCH 1PJ9A 4L4TB 2BNRE 2C3VB 1MRFH 5DVOA 4H8WL 1YY9C 4DGYH 3GK8H 4TUKL 3ARFA 4G8IA 1A7QH 2RHEA 1GJIA 3WE6A 2QQKL 2UUDK 3EFFB 5MEOB 4X80H 1P2CA 4MJIE 5HPMB 5KSBB 3N9GH 1MFEL 1OTSC 4XNMA 3M45A 1H8SA 4NKIL 4FQLL 3FB7A 4RGOH 5ILTL 3F58L 3OKNA 3BDXA 3WEXA 3VXUB 4OCWL 1ZVHA 2PUQT 2HVKB 4YJZL 1Z9OA 3LKOB 4JZOA 1IBGH 4KROB 1MCFA 4E41B 1O7SA 4K7PH 1GZPA 3GMMA 4E5XA 1QBMH 2HMIC 5I1HL 3P9MA 4D9LL 1XGTA 4J3WA 5ID1B 1MAML 4JM2D 5L7XL 1PFCA 4OLUH 5TE4L 2OTWB 3NFSH 5DJYA 2E9BA 3V4PL 2IANA 4BQ9A 4Q6IA 1YY9D 2DYPA 3JUYA 4GAYA 1S8DB 1E4WH 3PHOB 3MV8E 7FABL 3F65A 1AJ7H 5SWQA 5ICZB 1CI5A 1MRDL 1KJ3H 4D9QD 3VU2A 3QRGH 1OTSD 3RIFK 4GT7A 1BJMA 5I8KL 1NUNB 3SE8H 1A7OL 1JFQH 1BQSA 1HZHL 3ARTA 2X89A 5F7DB 4OGYL 3JVGA 3WDJA 3MLZL 1WBYA 3KLDA 2FATH 2RFXB 1JN6B 4Z7UF 3HAEG 1QSEA 4NO3B 4P4RB 5KSAC 1E6JL 4R6UA 4F8TA 3RI5K 3KXFE 3HG1B 3I75A 1I1FA 2HMID 1KJ2A 5CSGA 4XBGA 2WUCH 2LQRA 2GITA 3FB5A 1WBXB 1I7ZB 4L1HA 3QBTB 1BPVA 1MRCL 4TUKH 4MXWH 4N9OB 5DD6A 4L4TD 4HUVA 3MPCA 4KK5C 3V2AR 3MLXH 2QQKH 1N59B 1U8OB 4TTGA 4WW2B 3FJTA 4W68A 3U7WH 1MFEH 2P46B 4PB0L 2KZWA 5HXMA 4FQLH 1LK3H 4WU7B 5ILTH 1P53A 2B8OT 2DL9A 3FOMB 2PETA 4U1SA 5HYSG 5IG7A 1M71B 2UWEA 3ORJA 4BKLA 2NX5E 3IDNB 4JY4B 5HDOA 2E3VA 1TZHA 1MH5B 1XZ0A 3P0YH 2D7OA 2VISB 1FL3A 1ZGLB 1FNFA 5KSAD 4D9LH 4GW5A 3UMTA 5ESVA 4EIGB 5L7XH 3I02A 3QWQB 4E42A 5A40E 5TE4H 2JCCB 4XCNB 1NMAH 5L6YH 3O9WB 1PSKH 3IRPX 4EN3B 5C2BL 3RWDB 1U8NA 4OCNC 4KRLB 5LG1A 4KI5E 1KJVB 5E9DB 4R97C 3WN5C 4KK5D 3T0VA 4MA3A 5C0RL 2E6PA 3D85B 5FB8A 4WJ5B 1BJ8A 3SDYL 4JLRB 4PJ7A 4PV8A 5SWZA 5J12B 4FZEH 4LP5A 5DLMH 3BGFC 3RU8L 2BFVL 1A7OH 1HZHH 5T5NF 1AGFA 1J5OL 2BERA 4KI5F 4OGYH 1VKXA 4GRLC 5GGTA 3C60B 1T80A 1C1EH 2NW2A 5T3ZD 1JGDA 3MJ9L 1NFDA 1I9EA 4KXZH 5DVLA 1JJUA 3GUTA 1BZ9B 1S7UB 2C1PB 2VWEC 4HUNB 2OL3A 1KJ2H 3D0VA 2AJSH 3WNMA 2K3TA 1KIQB 1W0VA 1IGFL 3RWEB 3K1DA 2XTJC 4D0DA 3OB0K 4LEXH 3SE3A 3D69B 5DHYA 2P24B 1BZ7B 4OD1H 3UBXB 1BWWA 1KIUA 2FB4H 4NZRH 4ZUSA 1MRCH 1TCMA 3T2QA 4P23C 3BIBX 2Q3ZA 3T4AB 1J1OL 2QADC 3BP5B 4DZ8A 2IANE 4B50A 1JGEA 3GSWB 5J1AA 4MJ2A 4ELKB 2PO6B 3AS3A 3MZGB 2DQIL 4PB0H 2MQCA 2ILLA 2C3WA 1U8MA 2GEEA 3QNXB 3B2VL 3C6LC 4NKDB 4PJAF 2HLFC 3BI9X 5FM4A 1KTKE 4GXVL 1B6DA 5IVNA 3V6FA 4YHNB 2FZ3B 3G5YB 3GMLB 5EO0B 3K46A 5HY9B 4GRLD 4JANA 3F7VB 4PJBA 2KQMA 3QDJA 3CLFL 4EDXA 1UM4H 1QSEE 2Y72A 3KDMB 4NC2B 4YE4L 5E99H 4LSUL 3TJHC 5DUBA 4CNIA 3VI4E 2XTJD 1R24A 2D0FA 4NQCB 1R3JA 5C2BH 4UIMA 1DTUA 4F37K 5E8OB 1YEFH 5DRXA 5C0JB 5DSCB 1T03L 4P23D 2Q86B 1CZ8L 2QADD 5C0RH 4Q9QL 2QBWA 3MXVL 2FO4B 2MHAB 3H7LA 2WIMA 1CGWA 1IGML 1G7LB 3AREB 1DSFL 4L4JA 3SDYH 1S7SA 1BVKB 2PW1B 2GY5A 3MYZA 2ZKHL 3RU8H 3C6LD 1MCCA 1QLRB 2UWEE 5FYJL 2HLFD 4KPHL 5BS0A 1HIML 1LNUB 1PZ5A 1CVSC 2EDOA 4YHZL 2BNQD 2DMBA 5DJ6A 1E4KC 1JWUB 2ZOKA 5ABDE 1QTYT 1R3LA 4QT5B 3MV11 1IGFH 4FG6C 5FCSH 2WUBH 3EDJA 3TJHD 1U91A 3IFOB 1WFTA 4ZOCA 5CWSB 2Y36L 1HEZA 3P77B 2P8PA 2D7PA 3ZYOA 4DQOL 2JJUA 1UKQA 4R26L 2I07B 4RISL 4CVUA 1FGNL 5KOMC 5J11B 3OKDB 4F7PB 3C9NB 1P5VA 3V4VL 1D5MB 3G6AA 3LKRB 4ORZC 2A73B 3QHZH 4PJ5B 1WV7T 5FO8B 5CJOL 1Y6MR 2DQIH 1UJ3B 4P9HC 5SWZE 1CR9L 1DQJA 3MRIB 4ZO6A 1V7MH 4GXVH 3BW9A 4ZFFA 1HSAA 3DPBA 2R2BB 1WAAF 1NFDE 3DUUB 4GKZA 1ZT1A 3CLFH 1J12A 5C0BD 3CFBA 1DLHB 2X4RA 4OFPA 3DMMB 3KAAA 1KF9B 2LTQB 4BUGA 1KIPA 1WK0A 4XB7A 3KWWA 4LLUB 4FG6D 1P69B 4YDJB 4I2XA 3VDBA 1WTLA 3JWDH 4HJ0C 4P9MH 2PTVA 4YZFF 5TDPB 1T03H 3HE6A 4X9IA 4ONFL 3QUMB 5F9WB 2AJYL 3MLWL 2EEBA 4Q9QH 1FL5A 3MXVH 5C1MB 3QEHB 3L7EA 4QRSA 3LRSB 1IGMH 2VLLA 1WZMA 3DX8B 3CZFA 4S0SD 3O6ML 4R4BB 2ZKHH 3BWAA 3L5JA 4WFED 5C8JB 2AV1B 4PRBB 3FL7A 1YNLL 1N3NA 1AXTL 3ALWA 3ROLB 5KVEH 4J1UA 1U42A 1HIMH 1C5DB 4YHZH 4YNYA 5C70A 2EIDA 5E03A 2R4SL 3O3UN 4PJBE 1CG9B 1LDPH 3QDJE 1SY6A 3TZVB 2XWJB 3BDBA 3O45B 4TUJA 5D70L 4BH8A 4XTRC 1T83C 5J89A 1MWAL 1A4JB 1SJHA 2W59A 3UTPD 1A9EB 5E1HB 5TH2B 1DN2A 4R26H 4RISH 4JREC 1FGNH 4HJ0D 3KPNA 2VITA 5D1QB 3V4VH 1G7IB 4LCWB 1DN0A 3DV6A 4DWHA 4EI5A 4FNLH 4ODBD 4KMLB 3DSFL 4UQ3B 5L8LB 1MCOL 4Y1AD 3VGGA 5CAYB 1MY5A 3E3QE 3VWJC 1RJZB 4G43A 5FOJA 5FF6A 1KLUB 4YDLC 5BS0E 3WJLA 1GH7A 4LCUB 3PGCB 1VHPA 1MLCB 1ED3A 1P4IL 1XMWA 2OJEB 1AKJD 1UKTA 4PJCA 2CRMA 4K7PY 3KPQA 1U58A 4LLVB 3OXRB 1B2WL 1HSBB 4XTRD 3T0EC 4POYA 3PDDA 3TA3B 5FAAA 3RKDC 5I66A 1QHPA 2B1AL 4KDVA 4ONFH 5E5MB 2ADJB 2AJYH 1EFXD 1EUUA 1GOFA 2B1HH 4G80A 1OW0C 3K7UA 3L95A 3CXHK 3CX5J 2A6DB 5K9KA 4K23L 3OMZA 2HLAB 4P5TA 3MRJB 2BZDA 3F12B 2H32A 3WS6A 1OAYL 3O6MH 3VWJD 3DI2B 1ZLVK 5CHNA 3P73B 3T0BA 1YNLH 1XCQA 3FHQA 3LRHA 5HHVL 4NO0B 2P42B 4NT6A 1TNMA 2R4SH 3K2UH 5DMYA 4HIEB 3VXSA 5CILH 4LHJB 1TDQA 1HH6B 2NY0C 1NC2A 1JE6A 5ELIA 2BY2A 1HHGA 4NN6C 5DD0L 3GKWL 1MWAH 1GPOL 3ARZA 1AQDA 3DVIA 3VMPA 3T0ED 3DX6A 3ZHDA 5DJ2B 3RKDD 1IEHA 3MRPA 2FH8A 6FABH 4LRNH 3LKSA 4OFIA 1F6AB 5E4IA 5DD1H 4JQXC 5D1QD 1MCOH 4KHTL 4P4KA 3ZYIA 1BF8A 1NAML 3TYFA 4MNGB 4I0KA 4ZNEA 3S5LA 2WBJA 4EXKA 3REVA 2YUVA 1A7BA 5D7IB 1JPFB 2HFEA 3MV7A 4A6YL 1LE9B 1JMZA 1X5GA 1P4IH 5IMMB 5HYIA 3B83A 4OV5B 1G7PA 4QYOB 4N0UA 2VQ1B 2AI0L 3BZ4B 4Y4HB 2NY0D 2ORBH 3QNYB 4CJ1A 2EECA 5GS0L 1B2WH 2CLVA 1UACH 5CJXA 3KG5A 5D5MA 5CBEA 2V5TA 4KHXH 1VEOA 1UYWL 2BSRB 2B1AH 1BFVH 3S4SA 3SKNA 3QQ4A 3QXUA 5EU7C 2Q6WA 4ZQKB 4LLMB 4O4YH 5FM5M 2B4CL 1YNTB 4K23H 5D7KE 4JHAL 1OAYH 4XZUB 1WFUA 3GJEA 3QDGA 3S88L 5GISL 3FQXA 1DEEB 1CLYH 1MFCL 1B0RB 4YHYC 2DQTH 3ME0A 5F89A 4CN6A 3VRLF 3VFUA 1TVHB 1CD8A 5DD5L 4OZFB 3MRHB 3L5HA 1FORH 3IDYC 3Q48A 3QDMD 3SKMA 3D25B 5IGXL 1IEBB 4NC0B 3BSZL 4D8PA 1AO7A 4PJCE 4CDHA 1YYML 4HWUA 4P2RD 4CU6A 5DZLA 5DD0H 4P3DA 3ZLQC 5I1EH 3ULUH 4NQTA 1P7QA 3FB6B 3KYNB 1BAFL 3JWNC 3BHBA 3P4OA 1GPOH 1J86A 3PP4H 3C87A 4XCEA 1L6ZA 4XHJC 4U1HB 1Q8MA 4CADA 4KJYB 3RBSA 1M1SA 5CEXA 3O8XA 3V7AE 2OX5A 3HZYB 4XXCC 4ZXBA 5GZNC 3LEYL 2EDDA 4PLKC 2X4NA 3VE0A 2JIXB 1XF1A 2VXTL 1V5JA 1BD2B 3RA7L 1NAMH 4MA8L 4LLYA 2XTLA 1U8QA 1MCIA 5F70A 1VGEL 3AS2A 1Z9MA 1ZV5A 2AERT 1QLFA 2Z93B 3VG9B 3MNWA 1CFQB 1GHFL 4EI6A 1Q1JL 4A6YH 2COQA 3QUXA 4LVOB 3TF7C 2CDGB 3X13A 5DFVC 4C56A 4UQ2A 4NN5B 5DJ8A 1WICA 1W0YT 3VXSE 4J4PA 2NZ9C 1YEDA 1RURH 2XQBL 2AI0H 5I8EB 3RVWC 1D3CA 1ND0A 3CVHL 4RAHA 3QCVL 5GS0H 5ITBH 1OGAE 4MX7A 1B0GA 3QFJA 5BW7C 3CFDA 2FJFA 2R2HB 3ULUE 2C4XA 2CK0H 4XHJD 3W9EA 4HMCA 3LKNA 4YWGL 4BYHA 4DGIH 2B4CH 1YMME 2K7PA 3V4UH 3HB3C 5GZND 3VFSA 5DEZA 4RRPG 1LEIA 4OUOA 4PLKD 1RJCA 1BOYA 1VPOL 4JHAH 4C4KO 3B43A 3S88H 3PP3H 2EDQA 3T04D 3ULUF 4ZNEE 2YD2A 1CLCA 2HYMA 3L3DB 3PGFL 4XPHL 2APFA 4IRZH 3CLEH 1A14L 2OTUB 5EU3B 3UX9B 4POZC 3MV7E 1T5WB 4M5ZL 2X1PA 2F58L 5DFVD 4F7TB 5CEYA 5IB2A 1R3IL 2DJUA 2ZSWB 4N0UE 1YYMH 1CFTB 2NZ9D 2YA2A 3RVWD 3HZVB 3MLVL 1DDHB 1U3HB 2FX7L 4Y5YB 3MUHL 1BAFH 4PJIA 2J12B 5GGRY 4P5KA 1G6RA 3N1QC 5B22A 1M7IB 3R8QA 3QPXL 4FQHA 3BYTA 5IBUB 5ICXA 1QBLL 4PB9H 2VDML 1JHKL 3LEYH 1CS6A 3RA7H 3ILPA 5F9JB 3HB3D 1T7YA 2Y5TA 3QDGE 5T3XH 3NFPA 1MUJA 3ULVL 5IKCA 4Z7QE 3OJVC 2NLJB 1NBQA 3RNKA 5D1XA 4FP8H 3TWCL 1TXKA 4FTVD 3PNWB 4APQB 4POZD 5EZIL 5HI3C 3P9LB 4WGWB 5FGCB 4QHLB 3Q6GL 3ARYA 3TNMB 3OL2A 5J6GB 4ZSOB 3QCVH 3GJFB 2P5EA 4GLRH 4K94L 1ZGLP 3LMJL 1PKQA 4JFYB 4OCYL 2A77L 5EOCL 4TNWF 2X4OB 4U0RC 2FL5B 1ORQA 4X0KA 2APWA 2NY4C 2IQ9L 3OAYK 4HFUL 5IM7A 4YWGH 3BQUA 1F11A 4JPIB 4OT1L 4PY8J 4P57A 3TO2A 4OZ4B 43C9A 5LWYL 1VPOH 4NKMA 4M43H 1A0QL 5F3BB 1VGKA 2YPLA 3NTCL 4YGAB 1EJOH 1RV6X 2MQ3A 2WIIB 3PGFH 4XPHH 2OZ4A 3ROOA 2VXUL 1A14H 5E6IC 2UZIH 4I9WE 4XCCL 3DYMA 2P45B 4QRQA 4M5ZH 5DT1H 4OKVA 3RVVC 2IAMB 4C56E 4PRHA 1S9KC 1KB5A 1BJ1H 3IJSB 3GSNA 4HULB 4HWZB 3TCLB 5HI3D 2X4SB 5D7LD 4CVZA 1F4AA 5EBLB 3MLVH 1YNKL 1G6RH 2FX7H 2NY6C 1DEDA 2WWKT 1QRKA 5C0IB 4N9GB 4XXDB 3QFJE 4JFED 1E6OL 1ETZA 3KPLB 4HIIA 1X5KA 5DZNA 4NZTL 3ARDC 1QBLH 3LEVL 3IF1B 1TZIA 2VDMH 2NY4D 1JHKH 3GMOA 1C12B 1JWSA 4FFWC 5DQ9A 5GGQH 3SPVA 2A74A 1PX4A 4MJ5A 4J8RB 1F4WL 4YEFA 5GSRB 3SCMC 3GIZL 2FIKA 2BJMH 3TWCH 4OI8A 4NPYA 2OR9L 1S3KH 2G5BA 4XGZA 2B20A 3HA0A 3ARSA 3MJ8B 4TTDC 5E6ID 4JFDA 2HFTA 5EZIH 3CFJA 2AJXH 4QHNB 2HH0L 2XNAA 3DXAB 2Y06H 3RVVD 2A6IA 4MA7L 1T20B 3Q6GH 4JEGB 2VLME 4QRPD 1X5LA 3OKYA 3JTSB 3NIDE 3S35L 5FOBB 3QEGL 1CDJA 3LMJH 3PGDA 1XGRA 4PJIE 4X6CF 5J8OA 1QYGL 2A77H 4J2XA 1SHMA 3ES6B 5C3LD 3D3VA 2KZ1B 5DMKA 2IQ9H 1H5BC 1OCWH 4AYFA 4LPUA 3K8KA 4WHCA 3ARDD 3HZKA 5A1AA 3UAJC 5DC9B 3OJ2C 1KV3A 4OT1H 1PBYA 1DFBL 4DFIA 4PJFB 4FFWD 5LWYH 3D87B 4JVUA 3NIGF 5JW3L 1A0QH 2EDXA 2FJHA 2HJKB 4PJIF 3ARWA 3RIAK 3NTCH 2XPGA 4KUCF 4XX1G 4GRMB 3SCMD 3RX8A 1JPGB 2GTZA 2ZOLA 4XBEL 3KR3H 3ARGC 3E6HB 4J3VA 3SDXF 1YMHA 4TTDD 1EUTA 5GIRA 1HDMB 4K9EL 5DURB 4LPYA 5JR1L 4O5LH 5EC1B 1ODAA 5TGBB 4AQOA 4ELMF 4LPWA 4DUWA 1YNKH 2NY2C 1HXYA 2X1XR 2XA3A 4G42A 4LGRB 2CDFA 1RUKL 2P5EE 3U6RB 1PKQE 5FDYA 3WNKA 3V6BR 2O61B 4NZTH 1WCBB 35C8L 2IGFL 3C5JA 4YR6B 1J8HA 3UAJD 1G1CA 2FR4B 1F4WH 2NTFA 4OCRL 4QRUA 4YIQB 1B4JL 3QXTA 2YPLE 5F8QC 3GIZH 1NKOA 3FMGL 1IILE 3DX7A 4JZJC 4QOKD 5D1ZA 5TPWL 4YHPA 1ZLWH 5EU6D 3GMPA 5JIPA 3LEXB 4X4ME 2G5RA 3MBEC 3ARGD 1UVQA 3TO4B 4TYUA 1CE6B 1KCLA 2HH0H 1UH4A 3B3IB 4PRHE 1QFPA 1W0WB 1N2RB 1I3GL 4JFFA 1M7XA 1ZHNB 4RWYH 4AEEA 3HHRB 3S35H 2NY2D 4XC1L 5DQJA 2ICES 1QYGH 1JCKA 1QSFB 4KMQA 2XICA 1L7TL 3TBYA 1RSFA 1I1AA 1A8JH 1LD9A 4BFBD 1G9ML 5CMAA 3RL1B 3I6KA 4RNRB 5KVFL 4YX2L 4HS3A 2Y7QB 1F42A 3H0TB 1DFBH 3VFOB 1BOGB 2RIKA 1WCQA 4L4VE 3WIHA 5F6IB 2I27N 5KTEL 4WO4A 1UM6L 1J0ZA 3R0NA 5LJYH 5HHME 3QUZB 4XBEH 4PJEA 3BP4A 5IWLC 3ZDXE 1JTTA 2IMMA 1SBBA 3PQYB 4PTUA 4JFDE 4G8FA 5FM8A 2DTML 3MBED 4OAWB 4ZPVB 4LIQL 5DURD 5CEZD 1HHIB 1ZSDA 5CLWA 1U8IB 2FH6A 3U83A 3K8MA 1S7VA 2BNRB 3AM8A 3ZDXF 3U30C 5EIQA 4HK3J 4JRYB 3FTGA 2Z4QB 35C8H 3D3VE 2IGFH 1I1YA 5DJAA 1JZ5A 1FYTE 4JKPH 4U1IA 5AYUL 1D9KC 1MHHB 5J7CC 5BRZA 4ZO9A 2YK1H 1EH9A 4OCRH 3O4LA 1B4JH 4RGNE 3FMGH 5I75C 3CFKA 12E8H 3DI3B 3HPJB 5F88A 2A38A 3FT3A 4OCSL 5JHLL 1QQDA 4WI6A 3TH3T 1ES0A 4HFWB 3RY6A 3QEUB 5BVJA 3EZJB 1YEKL 5DS8A 5EZJA 4O51B 4MAYB 2BOCB 1I3RA 2IALA 2XQYG 4RFNB 3GIVB 1BIIB 3KPSA 1I3GH 1LHZA 1B3JA 4XP6L 3TVMA 1I7TA 5HHPB 5I17B 5GS2D 4P3CL 1I85C 4XC1H 4J3UA 3C5ZB 3BPCB 4JJ5B 3FN0L 4QF1B 1DLFL 1A2YB 1A7RL 4QRRA 3H9ZA 1L7TH 4PJDF 1T3FB 3SJVA 1OAZL 3SDDB 5ISZB 5K93A 1G9MH 5T1LD 3ARBB 4CMMA 1UWEL 5KVFH 1U3JA 2CDEA 3WIHH 2GFBA 1UQSA 3MV8B 1J8HE 1FFOA 1S7TA 4Z7UB 3C09C 1D9KD 1NKRA 1RIHH 5KTEH 5FUZH 2MKLC 3D5OF 3ZE2E 2FX8L 2KUTA 1ONQA 1QRNA 3O3AA 3IJYA 3RL2A 4Y16C 5I6XC 1QFWI 1FN4A 2Y25A 5DRNB 2CIKA 4R96A 4YFLF 1XCTB 4JCLA 3LN5A 2QQNL 1C5CL 2DTMH 5FGBC 1ZS8A 5CCKL 1OTTD 2VXSL 3B9DA 1A7PL 4OQTA 4DKEL 3ZE2F 2JJWA 3KXFB 4G9DA 4P2QB 1DVFB 1PQZB 4JFFE 1YDPB 2BVTA 4GUPB 3P4NA 3FT2B 4HBQA 3VXQA 3WMSA 3VFMB 2YUXA 3HAEH 1ZOXA 2ATKB 1PG7L 3QNZA 3B5GA 4AY0A 3OTTA 3V6OC 3L5WA 1LMKA 4JB9H 3UC0L 3TT1H 4JR9H 1UCBL 5HYJD 2GW5A 4Y5XA 2DBLL 4WUKL 2Z8RA 3EFDL 5FV2A 1K8IA 5IB4B 2R8SL 4D0CA 4EJ1C 3TBTA 1RZ7L 5IBTL 2OBGA 2OQJB 3IETB 1EEQA 4QWWC 4MD0A 5KS9A 3G6JA 2J5LB 3VXTB 1NAKL 3VFVB 4OCSH 5JHLH 1AY1L 4Y16D 4J3OC 3CC5B 2Z92B 4PJEE 1Z9LA 1A3LL 5GRUL 1YEKH 5IW6A 3TN0A 1NBVL 1KACB 4OJFH 4YC2B 5EN2A 1X9QA 4PJXF 3VFWB 1CL7I 4XP6H 3LRGA 1HE7A 4MAYD 4XVSL 1U0QA 2O5YL 5CD3A 2X70B 2GJZB 2ITCA 5SWSD 3FO2B 3TBSB 1DLFH 1A7RH 4HJJL 2QHLA 2FEEI 4U3CA 1OAZH 2IH1A 4ZUWB 3KYOA 1KYOK 4YBLC 4WTWA 1UCTA 2VC2H 4ODHL 1LK2A 4QXUH 4RMUA 1DUYB 3BPLB 2KPNA 5DXWA 4ODSL 4Y19A 3ARBD 5D7JA 4LHQB 5BRZE 4AM0B 1P2CB 1FPTL 3O4LE 3SGKC 1YQ2A 3FB7B 4QWWD 1VEMA 1MJ8L 1YEJL 3UEZA 5KSVA 2W0FB 2Q8AH 4XNXH 1MY7A 4LSQL 3PWLA 1ITBB 3MV9B 1N0XH 1WEJL 2OCFD 5CCKH 1I7UA 1JNHA 4X7EC 5BZWB 1A7PH 1TZGL 4DKEH 3GMMB 4GW4B 3KPSE 2GAZB 4RIRB 5FYJU 3WKML 3E2HC 1BLNA 1ZTXH 3IXAA 2LVCA 1J0HA 4QXGH 4X99A 1Z0MA 5C6PB 3CU1A 1T7WA 4QRRE 4PJAB 3SJVE 4Q9RL 3UC0H 1IJ9A 2PYED 1ZA3A 3QULA 5DJYB 5KN5A 2XWTA 3STLB 2IG2H 4ZO7A 2D4DA 2DYPB 1EDQA 4PS4L 4WUKH 1HXMB 4H8WC 2R8SH 5EUOF 4JFXA 4P0DA 1RZ7H 3B8SA 5I0ZA 3U7YL 3CX2A 3OAUL 5C0AD 1QRNE 3MACL 4GBXC 1NAKH 1G7HA 4V1DD 1AY1H 1FNEB 3T77A 5IJVB 3BD3A 4FQJH 1MCDA 1SJEB 1NBVH 4X9GA 1QSEB 2A6KA 5E2VH 1NBZB 4J3TA 3T3PE 3WNPA 4S10A 4PP1C 2O5YH 3RWIB 2X9WA 1ACYH 1YC7A 1KJ2B 3RTQB 3WJJC 3SDCA 3GGWA 3BN3B 2BSSB 4HJJH 1CDBA 3DO7A 2GITB 5IROC 3FB5B 3KPRD 1IFHL 4JAMA 2RBLA 2ID5A 5EBMB 3VXRA 5DD6B 2Q7YB 4ODHH 3DO3A 5HHXH 1AGBA 1I9JL 1KN4L 2DQEL 2QSQA 2VZOA 5F21B 2YRLA 4ZODA 3S37L 2FHBA 4S1RL 4CU7A 1QFWM 1X5HA 5FKPA 1FPTH 2PTUA 3D0LA 5HGHB 5KS9E 1HHJB 3G6JE 5IG7B 1YEJH 2NY5H 3CSYA 4HK0B 4KVCH 4GBXD 1XF4A 5IMLB 4JRXD 4RAUA 4BK4A 2XFXB 2BVQB 3M1BA 5ALCL 3S3PA 4YXKH 4LNRA 1I7RB 1TZGH 4XPAH 2GTWA 1RVFL 4YQXL 1YA5A 3RZCA 3G6JF 4AIOA 4PP1D 5DWUL 1NJ9A 2W9LA 2CO6B 4RGMC 4PGJA 1KEML 5F7HA 2J88H 4Z0BL 5B8CA 1TETH 1HOCA 4RX4D 1IZKA 2IBZY 4FXGB 2J8UA 1AIFB 2N1KA 4PS4H 1CXEA 4LU5L 4MA3B 5F7FA 4Y19E 5GRWA 5FB8B 3ARXA 5MEPA 5F7NC 1NCWH 5F9OL 1QG3A 3U7YH 3OAUH 3MRLA 2VR5A 5SWZB 3NPSC 4CAGA 4RFEA 1RMFL 4H1LG 4PGCB 1IGIL 3O11B 2DQCL 3MRNA 1AGFB 2FIRT 1OY3B 1VDGA 1B4RA 5DK0A 4NQVA 3SO3B 5I15L 2NW2B 1GAFL 5CP3A 4M6MH 1UG9A 3GB7A 4GRWE 2GT9B 4PRPA 2GSGA 1XIWC 3EDKA 4BUHA 4WV1C 1O5DT 2ZUQB 4MDIB 4M3JA 1EEYB 4N8VG 4XRCA 1CIDA 4FQ1L 1XH3A 1IFHH 2SEBB 5GGRB 3B5TA 3LV3A 3O2DA 1SEQL 4BH7A 4NQXB 1RIUL 3WIFB 3VH8A 1RZFL 5I1AA 3BUYB 5DMGC 5F72S 4DZ8B 1I9JH 5KBNC 5C0CD 5IVXA 1HH9A 1JGEB 4Z95L 2LE9A 5J1AB 3FQNB 4MNQA 3JV4A 1CGSL 1MJUL 1X44A 1S9XA 4S1RH 3JXAA 4HSQA 1U8MB 1NEZA 2VR9A 1GZQB 3MFFB 3T0AA 4OLVH 2R56L 5LQBL 2BVPB 3GRWL 1V7NL 4JFQA 3BAEL 1O7VA 1A6ZA 1OF2A 1U8KB 4Z7VA 1UC6A 1U92A 2V7NA 4L8DA 4JANB 5C9JA 4RFOL 4PJBB 4RSVA 4BFIB 1U95A 4EDXB 2BHYA 4FFZH 1XIWD 1RVFH 4YQXH 3QHFL 4JHZA 2IPKA 4U31A 3U4BH 5DWUH 1Y18A 5DUBB 3L9RB 3VGAC 1R24B 1UZ6F 4Z0BH 1NUDA 5JHDD 1R5VA 1AR2A 5HDBF 3W0WD 5J13C 4HUMB 4J6RL 4M1GL 4AQ1B 4HAFA 3UTSA 3VXRE 5DMGD 1A6AB 3HI6H 1RK1B 3UPRB 2ZCHL 5B38G 3RHWF 1S7SB 4IMKA 3BT2L 1IQDA 3GSXB 4IMLA 2OMBA 1RMFH 3RDTC 1IGIH 3OF6A 4H25A 2DDQH 4GO6B 1GAFH 4HPYL 4CU8A 1FAKT 5DJ6B 1RUQL 3EGSA 2ZOKB 2E7HA 3PJSB 5FV1L 5E7BA 1RZJL 3GBML 5MP6H 2NR6C 4KJWC 1SEQH 1NDMA 4JFHD 1UM5L 3RX5A 1RZFH 3V0WL 5BMFH 4XAKD 3RWHA 2YHGA 2J8UE 4P46A 3G6AB 4U3XA 3IKCA 4ESKA 1KCKA 3WL9B 4JRWA 2VIRA 1N26A 4UT7L 5HBBA 3MOBL 4GKNB 1KJMA 3WUWG 2DOCA 2R56H 1DQJB 1DUZB 5LQBH 1LEKA 3RDTD 3GRWH 3BW9B 1SY6L 5B39G 4ZFFB 4Y5VC 1ZT4B 4NFBA 2F8OA 2WBKA 3G5VA 4IJ3B 3OV6A 5B21A 3B9VA 5KW9L 4RA0C 2RCSL 4GKZB 1BM3L 1ZT1B 3O6FB 2Z31B 1UEMA 4PRPE 2X4RB 2DS4A 4WI7A 3QHFH 1P4BL 2EEAA 4HMDA 2VKXA 4I18B 5AZ2H 2ZG1A 4QY8B 1LO3H 2NR6D 2UVFA 4KJWD 1G7JB 5EORL 5C08B 4M4PA 4URTB 3GMNA 2MKWA 4U1JA 4H5SA 2RAMA 1B90A 1HQRA 4UUJA 5IVXE 3PL6B 3PWJA 4NRXA 5ICYA 4MNQE 4FQXC 2FGZA 2ZCHH 5DMIH 4QRSB 2P44B 1IC1A 3FONA 2NNAB 4C54A 4PYGA 1BP3B 4KGJA 2VLLB 3BT2H 2X4PB 3BWAB 5JW4R 1JPSL 3W5NA 2DLGA 5C0GB 1Z3GL 1U6AL 1ZVSA 2OI9B 5DVMA 1JNNH 4Z7VE 3B9EA 4YNYB 4WUUB 1J87A 5FYJD 4C57C 2J3SA 2YD9A 4YFDB 3GBMH 3MUGA 5CIPH 4BH8B 3DIFB 4MWFA 1MIEL 1MHPL 1BQLH 3CMOH 4HWNA 2V7HA 4TPRL 5JW5A 1MWAB 1C16A 2JJSC 3FT4B 3V0WH 2X7LA 1IGYA 5K33A 3UTSE 4JM2A 1OAKH 2BP3A 2D7TL 4K8RL 2P48B 1DANU 4LSRL 3KPOA 5H35A 3GBNL 1K9TA 1A02N 4FQXD 1P7HL 4UT7H 1QVOB 2GJ6D 2VXVL 3NABL 3RQ3A 3GMRA 5FYLE 5FA4A 2F74A 1JP5A 3MA7B 4Y4KB 3UP1A 4NQDD 5K9OB 5KW9H 4OZGA 2RCSH 4RRPA 4BSVB 1BM3H 1ED3B 3D6GA 4OM1L 5LAXB 4K2UH 2CGRH 5EWIL 2ZCLH 3TA3C 1MJJA 3GSOA 3UBXI 2Z91A 5EORH 2FX9L 2X1QA 3UZVB 5DJZA 4HXAL 3R4DA 2VXQH 5C07A 4GKSB 1WWBX 1IRAY 1S9VA 2C3HA 3ZSTA 4Y89A 1CFVH 4XWGL 4OGZA 5D6DC 4L4TA 5E8DL 2C3VA 2OXGA 1JPSH 1NBYB 1XCQB 2IQAB 2QSVA 5MHSE 4AJ0A 5F7KC 3EFFA 4K3EH 4NOBA 5JQ6L 5KSBA 3OHXB 3VXSB 1SM3H 3RVTC 1PD6A 1NC2B 4YHMH 1MIEH 3VXUA 1OGAB 4G9FE 2N4IA 2DICA 2HVKA 3LS4L 4WTXA 5CP7B 2AK1L 5LGJB 2WWKO 3CFCH 1LE5A 4E41A 5SX4H 1M4KA 3MRPB 2BNUB 1AD0B 1YMMB 3LKSB 4ZAKC 3GBNH 2ENYA 3DYPA 5B3JE 2M1KA 2ZNXA 3MLYL 1LO4L 2VXVH 4HPOL 3RVXC 2EH7L 4ZDHB 4L8CB 3NABH 2OTWA 3S5LB 1NUGA 1UWXK 4N0FB 3REVB 5DQDL 4L3ED 3IU4L 2HFEB 2EXWC 3QJHB 1HNGA 4TQEL 5ICZA 5B3JF 4A6YB 1T0MB 4MD5B 1IQWL 4KK8D 3H3PL 3IKKA 5EWIH 3EKCA 3RVTD 3VWKB 3N1MC 3T0WA 4FRWA 1GGIH 5F7DA 1CVRA 4HWBL 2FX9H 2V17L 3CFIC 3PUCA 3BRDA 1JBJA 2RFXA 3WDHA 3A6OA 1MCHA 4NO3A 4OB5L 3S4SB 4HXAH 1IL1A 5KOVC 3CSGA 1K4CB 3EJYC 3HG1A 2R39A 4ZAKD 1J0KA 3DVNB 1T0PB 1YC8A 4XWGH 4HJGB 4RMSA 5E8DH 1WBXA 1I7ZA 3X12B 1LDSA 2AVGA 3RVXD 4WWKB 3FQXB 1JTOA 5F89B 4H26B 4PJ8C 3PABB 1N59A 4ZNCD 5JA9A 1U8OA 8CGTA 5T5FL 2EXWD 3G5ZA 3EIFA 4OZGE 3DJ9A 4YPGB 5JQ6H 2X4QB 4XCFH 2L7UA 1JI2A 3SKMB 3O6LL 2VQUA 4W4NA 3RAJH 1M71A 5JQHC 3MGAA 1LWRA 1J11A 4JY4A 1RUPL 5CJQL 4EOWL 3P4OB 2YN5A 2AABH 1KULA 2W65B 4QKXB 1MNUL 1DBML 3LS4H 4AEHL 2AK1H 5HVFB 4CADB 2VISA 5KAQG 2W60B 1ZGLA 4HMEA 4OTXH 1A6VL 3O8XB 5DUPH 4ZXBB 4IOIB 2ESVB 1K3ZA 3MLYH 1NGQL 4HBCH 1L9MA 1WWWX 1LO4H 3QRFM 3P2TA 1OP3K 4HPOH 2JCCA 2EH7H 4XCNA 3O9WA 4L4TE 4ODWB 1T21A 3RWDA 2VLJD 4I3SL 5E9DA 2R2CA 4I13B 1A6UH 4EI6B 4PJ8D 1NMCB 3X13B 4WJ5A 1IQWH 3ECBA 4PJGF 5D7SL 4JLRA 5KSBE 4H88L 2VLKD 1YEDB 2G9HB 4LHUD 4O2EB 4ODUA 1ZEAL 1ND0B 2XZQL 2BRRL 1A5FL 4PGZA 3VXUE 5CJ8A 1B0GB 1WSST 3QFJB 3C60A 3IDGB 3HC4L 3CFDB 4M61A 4HWBH 5FYKE 3BE1H 2GYSA 3UTTD 1OSPL 4L8SB 1BZ9A 1S7UA 4EVNB 4OB5H 2EDTA 4E41E 4GQ9H 2QEJA 3LKNB 2ZUXA 4KK6C 1KIQA 4WU5A 5HVWA 5JOEA 2YC1B 3CXDL 3RWEA 3VFSB 5FGRA 3FB8B 1AQKL 1IEAB 3D69A 2P24A 1R3KB 4DUVA 4DAGL 1BZ7A 4I77L 2R0KL 2F54D 1DL7L 3BP5A 4ZS6C 3GSWA 3V5DB 4LVNC 4KRNA 4MXVE 5GJTH 5T5FH 3JTTA 4ELKA 3QJFB 5E1AB 2PO6A 5IJKA 1H15A 4XC3L 4NP4L 3NCBB 4PJHF 3QNXA 4NKDA 3VXNA 5T3ZE 4O2CB 2AK4B 4PJIB 5CJQH 4EOWH 4YHNA 2AEPL 3GMLA 5EO0A 5C0BA 4P5KB 1G6RB 2DLFL 2F5BL 3MO1B 3F7VA 1NGZB 3H3KA 5T5NG 3KYMB 2VZUA 3KDMA 1A6VH 2KDGA 3HG1E 4KK6D 1NGQH 3CVIL 4HGWA 5H8DA 3W39B 4NQCA 3BH8A 4HEPG 3NFPB 1HYSC 2CUIA 5E8OA 1MUJB 5C0JA 2LV4A 4DKFL 4I3SH 5IKCB 3LVEA 4U49A 3V8CA 3RNKB 5D1XB 2OK0L 4L9DA 4ZS6D 1PZUB 4P9HL 2FO4A 4NRZA 3AREA 5D7SH 1BVKA 1F2XK 2PW1A 4H88H 2H26A 2BY3A 3QWOA 5I1GH 1ZEAH 1QLRA 1A5FH 3LQZA 1IAOB 1LNUA 3C2SA 4XBPB 1CBVL 3HUJF 3TH4T 1FCGA 1PAMA 1ORQB 4X0KB 1JWUA 5C0EB 3NCMA 4QT5A 4ORGA 3BQUB 3CXDH 5FUCC 4F33B 5EU5A 1F11B 2I25N 5HVGB 3EYOB 4P57B 3NCEB 1AI1L 3IFOA 4NKMB 4DAGH 5CWSA 1P6FA 3T2NL 1OWWA 1T5XB 2JCCE 4I77H 4X7CC 2R0KH 4JGUA 3HNSL 3G5XB 1DL7H 4JHWL 4M93B 1HYSD 3OKDA 4F7PA 1KN2L 1D6EB 4Y1AA 5E9DE 4Z7NF 5D93B 4IIQB 1D5MA 3LKRA 4QRQB 1N0LA 2A73A 3ULVC 4F9LC 5FO8A 3FQRA 1FC1A 2ERJB 4PRHB 4XC3H 4ZO8A 3GSNB 4NP4H 3MX0A 3QIBB 1UJ3A 4ZG1A 1NGPL 3MRIA 4JO2L 3MC0A 3RIFF 1PX3A 5AWNL 2X9YA 5F6HJ 4IDJH 4MA1B 4LCYB 2H9GB 2DLFH 1A7NL 3VXPB 4NWTL 2R2BA 1AKJA 1RJLB 5HHQB 4K94C 4KUCD 1DLHA 3A6CH 4WFFD 1TZIB 3DMMA 3WO3B 1CGVA 3GMOB 1JWSB 3RI5F 3VDAA 3Q2CA 1IAKB 4L4VB 4LLUA 3CVIH 5A16A 2BHUA 5K9JL 4UT9H 4X4XB 2OS7A 4OFKA 1EFXA 3KS0J 1FZJA 1LO0L 3B9KB 5TDPA 4DKFH 4NQEB 1N6QL 3QUMA 4EBQH 1JGVL 3BP7B 4P9HH 3QEHA 4IOSD 2NYYC 3ULVD 2APTA 3DX8A 3QAZC 5BV7L 3EAKA 1R3HB 4R4BA 3BUTA 5C8JA 2IPUG 3OB0H 2AV1A 4NGHH 1UJTA 4WI9A 3ROLA 1MQKH 4PBXA 5I71C 5GXBB 4U2ZA 5JNYB 4HCRH 3U82B 5C0BE 1H3UA 3THML 3GM0A 1NANH 4TOYH 5DMKB 5CJBA 2APVA 2EYTA 3CDFA 1FYTB 5GQBA 2XWJA 4PRNB 2EYRB 2NY3B 1AI1H 1T6WA 3T0EA 1A4JA 1EO5A 4X6DF 3T2NH 4F2MA 3W2DH 4NQCE 4R3SA 2VDNL 4YHKL 5TH2A 3HNSH 4JHWH 2I5YH 3UZEA 2XG4A 4JQIL 5D1QA 2GTZB 1G7IA 2ZOLB 3IXTB 4LCWA 4PJDB 3D39D 1NCUA 4F15B 2Z8VC 3TJEL 5GIRB 4JM4L 2NYYD 5EO1B 1K8DB 4W6WB 1RJZA 2F53B 1CICC 2XG5A 3G6DL 4X8JA 1NGPH 5TQ2H 4JO2H 4F9PA 2E7BA 1KLUA 1NMBL 4GMTH 4GFTB 3OR6B 3QYCA 2YMXL 4PGEB 4RMVA 2WANA 1A7NH 2OYPA 3FQUB 4NWTH 3PGCA 4YH6A 1UH3A 4HH9B 1EEUA 1MLCA 4X6FB 4YDKL 4TUOA 3MA9L 4WI5A 4PJ9B 2XV6B 4OUUA 5HHOD 3CAFA 4X8XA 3LZFL 3OXRA 1HSBA 2NTFB 1T1XB 1UENA 4LL9A 1LO0H 2ED9A 5DYOB 4AEIH 3RWCB 2FECL 5D1ZB 5E5MA 1N6QH 4YHPB 2ADJA 1QFUH 5IR1A 1F4XH 2DI8A 4Y1AE 1OB1A 1JGVH 4N1EA 4HUKB 5H94B 2E5EA 4N0RA 4YDIH 4KKCC 3JV0A 1UVQB 2HLAA 1BZQK 3MRJA 5BV7H 3SHSA 3P73A 2EDFA 3KJ6L 1CICD 1FQ9C 4K9EC 5GSVB 4PRID 3H7BB 1L9NA 1IM9D 4NO0A 5HYQA 4ZTPL 2HA1A 4RBPK 4FA8A 1I1AB 1LD9B 4HIEA 1DBJH 5CSZB 4PGDA 4KY1L 3I6KB 3QQNA 4ZOEA 4M7ZC 3NAAH 3SBWC 5JW4M 2V9TA 1IGJA 3X17A 4PJXB 3I6LE 2FJGA 2VDNH 1CK0L 5D2NA 4EXPX 5INCA 5DJ2A 4F37F 4JQIH 4MS8C 4G8EB 2HKFL 2VDLL 3WO4C 4M6AA 4PJEB 3RGVB 1F6AA 5EBWB 4XP9L 3TJEH 4PTUB 5F9AC 1TQCB 3W9DB 4KKCD 2CKBL 4TSAH 4JM4H 3QIWB 4C59B 1RZIA 1CFBA 3G08A 1A64A 1FDLL 5HHNA 3T65B 3VI3F 4B53A 1FAIL 4FQIL 1O0VA 5EO9B 3O2VL 1JPFA 2XN9D 3O2WL 3T4YB 1INEL 1BQHG 1K85A 4TN9A 3DARA 3FTGB 3HAEB 5IMMA 4LFHD 5I30H 1MI5D 2J7LA 4OV5A 4QYOA 5DJAB 1NCAH 1OP5K 3QP3A 2VQ1A 4WEBL 1AHWC 3BZ4A 4Y4HA 1FV1B 3VD3A 3LZFH 4NBXB 3T0EE 1VADB 3O4LB 4UV7L 1FLTX 5MENB 2BSRA 4L5FL 2IWGA 1QQDB 4KMTH 4MS8D 1LP9F 4MCZB 4LLMA 1AGCB 4LCWE 4ZQKA 1IAIH 1MFAL 5EZJB 4NN7C 3QIUC 1MIML 4XZUA 1YUHA 4HUUA 3O3BB 3KJ6H 5HYSB 1DEEA 3IDIB 4KQ4L 3N1GC 3AS0A 4OZFA 2VLRD 3QEQB 5F96H 5IW3A 1R5WB 5F1NA 3K4AA 4KY1H 4OLZL 1OAXH 3D25A 3MNVA 1IEBA 3SEPA 2CDEB 3BYYA 2GFBB 4XT1C 1UQSB 1S7TB 4MJID 3BPNB 2XZAL 2YA1A 3FB6A 3KYNA 4B41A 2ITDA 5JOFA 4HF5L 2R0ZL 4WHDA 1CK0H 3O3AB 1U3YA 3MGTB 4U1HA 3DWTA 5KZCB 2HKFH 4KJYA 1FN4B 2JB6A 2N56A 3BOVA 1V8HA 4XP9H 2JIXA 1QHOA 3O6KL 4QTIL 1X4YA 2CKBH 1ZS8B 4G7VH 4U1NB 4L29A 3QIUD 1SBSL 1FDLH 2QSTA 1FVDB 2C26A 3EYUL 5I19L 5LGHL 3S34H 4MJ6B 4JDTL 2V5MA 1A3RL 1MELA 4BZ1L 1KSRA 3O2WH 3MLTB 3QDME 1K6QH 1INEH 3QNZB 3QXAB 5HGBA 1R0AH 2CDGA 1T22B 1PY4A 4UU9A 1I8IA 1YEGL 1J9CT 1RZGB 2FGWL 4Y5XB 3QDHA 5I8EA 3HRZA 1K8IB 4Z7WF 4PPTA 4CDGC 4OF0A 2DLIA 3MODL 4OSUL 4MD0B 4UV7H 2X2YA 3G6JB 1Q0YH 4L5FH 5JIKA 5D2NE 2X1OA 3I50H 2VNCA 3IDJA 1UXSB 1JWMB 1WT5C 5EU7E 5HGAB 1OL0A 1RU9L 3KPTA 3ZDYE 4YC2C 1MFAH 5E4EC 3WFBL 1MIMH 2ZNWA 4U6VL 1UA6L 2LAGB 3ZTJG 5EN2B 2VDQL 1H3WM 2HJFB 2J4WH 3L3DA 4KQ4H 1M05B 3VFPA 4J12A 3SGEH 1QP1A 3PWVB 1T5WA 5LBSL 2IH1B 3ARFC 5D7LA 4KTYA 4OLZH 2V5SA 1FIEA 1N5AA 2ZSWA 4XNZB 3MRBB 2OP4L 5BJTB 1F97A 3HZVA 2XZAH 1DDHA 3O3DB 1U3HA 4Y5YA 1FH5L 1WIPA 4HF5H 4M1CC 2YZ8A 3GHEL 1TLKA 2R0ZH 1OP9A 1M7IA 2NX5D 3QXWA 4PREB 4LCCC 5JDSB 1WZKA 1I9IH 3ZKXC 4NM8H 5I9QB 1F5WA 4QTIH 3RJQB 2BSTB 3O6KH 5F9JA 4H1LH 4F58H 5FECB 1KTDB 1JNHB 1RZ8B 1SBSH 1IT9H 3EYUH 3QZWG 3F7PC 5I19H 4KV5F 1RI8A 4BFEA 3IXAB 3H9SB 4JDTH 2NLJA 4YK4B 1ZLSL 4BZ1H 1ZXQA 5F93C 2VN4A 1X5IA 3PNWA 4Q6IC 2ED7A 2UY6A 4MXQC 1ZA3B 3QULB 1YEGH 3ARFD 2XWTB 2FGWH 3OKEB 1KCUL 3BKML 3MFGB 3TNMA 4W4OA 4ZSOA 1CIUA 3QCTH 3GJFA 3MQIA 2ZG2A 4LVEA 3MODH 5E56A 4OSUH 4JFYA 1YN7B 1UEYA 4M1CD 4QRTB 2QQLL 2VYRE 1G7HB 4Q97A 3VGHA 3JVGC 3T77B 5KG9B 4NYLB 2VSDA 4JPIA 4M7LL 1QFWL 2G2RB 1Q9WA 4UI2A 3ZMRA 3D2UB 4LHUG 3MOAH 1UA6H 2P5WD 3SCMA 4RCAA 5I18H 4WFHD 4BQ8A 1B88A 3IRZA 1CYGA 2BVOB 2WIIA 3D18B 4FOMA 4Q0XL 5F7LB 5HI5C 3GGWB 5LBSH 4K7FB 3SGJA 2IAND 3IJSA 3EJJX 4HWZA 3TCLA 3CZJA 4MXQD 4M1DL 5IEHA 1Z5LB 2OP4H 4ERSH 2MMXA 5EBLA 5D8JL 5BVPL 3MGOA 1FH5H 3GI9L 2UYLB 2X41A 1Q9OA 4N9GA 3CX5K 1OQOA 4NZJA 2NXYC 4LLWB 2X4TA 3KPLA 5EIVA 3MBXH 2X89D 3IF1A 2WW8A 3BZEB 4BQCA 1C12A 4X4YA 1KLGB 3UYOD 3BXNB 4J8RA 3VGFA 1FNHA 4GG6F 4N0YH 3X11A 2R23B 4PTTB 5GSRA 5HDQL 3BX7C 1X5FA 2VMFA 3RZCB 1ZLSH 3ARGA 2GSIA 1CL7L 3MJ8A 5HI5D 4Z18A 5B8CB 4R8WL 3MRFB 1OLLA 4QHNA 5HVHB 3DXAA 5D7LE 3RUGF 1KCUH 2FEEL 1T20A 2B0SL 3W82A 2X5PA 1D5BB 3JTSA 3BGMA 1KENL 1T7ZA 1T89C 2GI7A 1DQQA 2NXYD 3M07A 4RFEB 4MMXC 5DI8A 5GRZA 2NY7L 1JHTB 3ZKSD 3PHSA 4XPFH 1AD9A 1U36A 3N85L 4Q9CA 5DK0B 2BMKA 2CR3A 2H2SC 4X6EB 1BFTA 3QQ9D 3GB7B 1FNGB 2HJKA 4IS6B 2P4AB 1JGUH 3SE3C 2CK2A 1FFPA 5E8PA 3PWPB 4LSPL 4GRMA 4OCXL 1JPGA 5J56B 4NWUL 4XRCB 2D0HA 4GSDL 1A1MB 3ZTNL 2DQDL 3REWB 3LV3B 5CEZL 4BH7B 4QRPE 3LKPB 3U36B 4IHOB 4YFEA 4OI9A 4ZFOL 4M1DH 5EC1A 5I1AB 2EC9U 4K7PX 5FGCE 4FQ2L 1BHGA 3VJ6B 4ZSOE 5GJSL 1ZHBB 2NXZC 5GPRA 5D8JH 4JFPA 5BVPH 3LIZL 3GI9H 3HE7C 3U1SH 4AENA 2W9EH 5A2KH 3HFMH 2O61A 1T2XA 4KQ3H 1BX2B 5DEGB 4O9HL 2HTLC 1RUAL 3KLAB 1EAJA 4Y4FB 3BPOB 4YR6A 3X14A 1OF2B 4M9OA 3DNKA 4L8DB 2H2SD 2ICWA 5C9JB 2FR4A 1WBZA 1J0IA 5JZ7C 5HDQH 1U2HA 2Q8BH 5J57B 2EDJA 2DD8L 1KB9K 1NH6A 3QG6B 4P59L 4R7DB 4JO4L 3LEXA 3VCLA 3OAYH 4CVXB 1CE6A 3MRRA 4IRJC 3NIFE 1JF5A 2B0SH 3H9HB 4GS7B 3AXLA 1J1XL 1W0WA 1N2RA 2C1OA 4PD4J 1ZHNA 3DSNA 3E3QC 1Q0XL 3QI9B 3RPIB 1P1ZB 5L0QC 2BY1A 1KENH 1X5AA 2NXZD 2JB5L 3GHBH 4Y2DB 5EOQL 1IVLA 1QSFA 3HE7D 3HZMA 1OAQH 2KQNA 4H25B 4LLDB 2NY7H 1H8NA 4XP1L 4QO1A 2ADFH 2HTLD 1IARB 2Y7QA 1EGJA 3VFOA 3I9GH 4IRSB 2DIAA 1NSNL 5GS3A 3QDJD 4Z7OE 4RDQG 2ZUSA 2O5XL 2HFFB 1Q38A 5JZ7D 4LSPH 1SYSB 4OZHE 3L3GB 4NWUH 4R7NB 4F7MB 5FCUL 2DQDH 3PQYA 5CIPB 4BFGA 3V79C 5CEZH 4Q2ZB 1NDMB 4XPBL 3RWGB 2K1MA 1ZA6B 4IRJD 5F1IA 4ZPVA 4FQ2H 4YDVA 4P46B 2DKSA 4QNPE 1T4KB 3IS0X 5GJSH 5HPOA 1HHIA 1U8IA 5M94B 4OZHF 1JF6A 4JRYA 2Z4QA 2RB8A 1LEKB 5BS0D 1X7QB 1RFDL 3G5VB 1MHHA 1FHGA 4KXZI 1YJDC 4Y16A 5HSFA 3W5MA 3FRPG 3HPJA 4PLNC 4MD4A 1C5BL 3EOBB 5CLTA 4G9FB 4P59H 5JORB 1YEHL 5EFIB 3JSSA 3A6BH 4JO4H 4HFWA 2AGJH 3QEUA 1SYVB 5FGBA 5GS2H 3HE6C 4O51A 3L3HB 4MAYA 1RZJC 3GMNB 4F3FA 3FFCB 2XXMB 4XPGL 4S1QL 3EOAA 3GIVA 1IM3A 4H5SB 5SWSA 3MROB 1HQRB 1PDKA 1Q0XH 3PWJB 5HHPA 4S0TD 5KANI 1KCRL 3RY5A 3SGDH 3C5ZA 1DZBA 3FQTB 2JB5H 1JRHI 3BPCA 3Q5OA 3QXVA 1A2YA 2VQTA 4QF1A 5EOQH 5IIEB 3LPGA 5ISZA 1KT2B 3SDDA 4F7CB 3DRTB 3ARBA 5E8EB 2RQ8A 2EO1A 3BJ91 1HHHB 4UDUA 3U2SA 1NSNH 4Z7UA 1MCNA 3AY4C 1R6VA 3AAZB 1NLBL 4WIQA 1URLA 1FRGL 4KKBC 3P4MB 3MUGB 1XEDA 3MUZ1 4MWFB 5DRNA 1YQVH 3HKFA 4HG4K 1JK8A 5DTFB 4XH2B 4L9LB 5JW5B 1LO2L 1XCTA 2E7LA 3HE6D 1NGXB 4KUZL 4MQTB 4EI5C 4EUPG 4JO1L 4U1KA 4UB0L 1S78C 1IGYB 1EIBA 4W70A 4JM2B 4P2QA 1VFAA 4GUPA 3KPOB 3FT2A 5H35B 1KBGL 4HLZG 3WSQL 2PYEA 3VFMA 4XI5C 1A9BB 2ATKA 1QSFE 3JV6B 2XIDA 2E9JA 4RAVB 3WJLC 4EDWL 2F15A 3SE9L 4PBVC 2ATPB 4NUGL 1RFDH 1ZANL 2PYFB 5IB4A 4OZGB 2PXYC 1IC4L 2OQJA 3IETA 1FZOA 4HIXH 4V1DA 2ICWJ 3QSKB 5FHAL 3RIAF 1L7IL 4XMKH 3VXTA 2DWDA 3VFVA 2HRPH 1C5BH 4KKBD 4I1NB 1H3PL 3CC5A 3MJ7B 2Z92A 5E08L 4NIKB 4UT6L 1JYNA 4LFHG 3PQYE 1ZT7A 4XPGH 4Q6YA 4S1QH 2ZUTA 3KLHC 5DJZB 4EI5D 3VFWA 1S78D 3D9AL 4P5TC 5D7KD 3WFDH 1KCRH 4EKXA 4OD3L 3WS6C 3KPRA 2X70A 2GJZA 2W0LA 1EHLH 1IC7H 3TBSA 2IFGA 2EKJA 2A9ML 5I0DA 3VD5A 4K8RC 2YSSA 3OJMB 4XI5D 2EDNA 4ZUWA 5HYJE 2AJVH 4JRYE 2XZCH 2E6JA 2WNGA 1BECA 2GUOA 1YPZF 5CBAB 1T04B 1DUYA 4DZBA 2BOBB 5FO9B 2GHWB 2JJTC 4AM0A 3HS0B 1NLBH 2PXYD 3MMEB 1GC1C 1FRGH 2DJSA 3CGTA 4R90L 2W0FA 3A67L 3KHQA 3DGGB 3TIEB 1LO2H 3MV9A 1ZWIA 3HMXL 5KSAB 4KUZH 4OGXH 5SV4A 4CN4A 4M6OH 3K4DA 4UB0H 2CR6A 5BZWA 1LE5B 1JZ6A 2N7AA 2IC2A 4GW4A 5SWSE 3LHPH 1K2DB 3WJJA 3RWJB 2GAZA 3KLHD 4P4KC 4RIRA 4WTZA 1KBGH 4G6JH 4P5TD 4UBDC 5KJRL 2C5DC 2WBJC 4H0GA 3X3FH 4PJAA 5ISZE 4K8RD 1CGTA 2CSPA 3CK0H 1D5IH 2BC4B 3STLA 4EDWH 4ZUVA 3TYGL 4ZFZA 3SE9H 4K71C 1A47A 1KPRA 1ZANH 1HXMA 1P7KB 4Z7UE 2NMSA 1F90L 2OJZL 4KTDL 4FABL 2GQHA 5FHAH 3S6CA 3CH1A 5CJXC 1PKOA 3NBNA 1FNEA 5KAQF 1H3PH 5IJVA 1N64H 5E08H 4UT6H 4IEFB 5A2JH 2DQFA 1SJEA 1SJVA 3EO1B 3CMGA 3KPPA 5ADPL 4KVNL 1CDHA 2HP4A 3N06B 4NNXB 5DFTA 4NKQB 3IGAB 2YPVL 1IL1B 1NBZA 1JUFB 3O4OC 2JJVA 3HCVA 2C7UA 4P2QE 2CXGA 3RWIA 1Y0LA 4I4WA 3RTQA 5JXAL 4P4KD 5C6WH 2BSSA 2PYEE 2Q3AA 4UBDD 2WBJD 4H8WH 4XNUL 3IAQA 4R97B 5EBMA 4E0RB 3WN5B 2Q7YA 1P9MC 3MV7D 3HUJB 3SO5A 5D2LF 4U1GC 1AR1C 2H3NA 3G5ZB 3UJJL 4RMRA 4V1DE 4NKIH 4JPVL 5HGHA 3BGFB 4Z8FL 3F58H 1HHJA 4X5LA 3Q5TA 2CQVA 4GG8B 4HK0A 1U2CA 2VDKL 3KNBB 4GRLB 4OCWH 1B6UA 5IMLA 3T2PA 3DHJA 2XFXA 1V3LA 2BVQA 3BH9A 3HMXH 1XIWA 2GKIA 1I7RA 3K80A 1OARL 2BY0A 5GHWL 3GSRB 2XTJB 3H42L 5I1HH 1ADQL 4LLQA 1MAMH 5DD3L 2E7CA 3KPRE 2CD0A 5KJRH 1CD9B 5FM5O 1HWHB 3HN3A 4P23B 1KIRB 2QADB 5I1IL 1T21B 1GYAA 3HI1B 3QUXC 4L8BB 3TYGH 3V4PH 4F57L 4FXGA 1AIFA 3VMOA 4BZ2L 2YZ1A 1WAAA 7FABH 5KSUA 4KTDH 1CWVA 1MRDH 3ECBB 5F7MC 4FABH 3C6LB 3FN9A 3OJDB 1AO7D 5H2BB 2M2DA 5DJDB 4ZS7L 1AP2B 4PGCA 4P99A 1I8LC 4ODUB 3S36L 1TPXC 3O11A 1P7QD 5I8KH 1YYLL 2BNQB 4LPVA 2D7QA 3CD4A 4RQQB 4M61B 3MLZH 3OSKA 4ODVL 5ADPH 3MV9E 1FJ1B 2R1WB 1IKNC 2GT9A 3MJ9A 2YPVH 1E6JH 1U9KA 3NA4A 4WU5B 4MDIA 5JXAH 1TJGL 1D6VL 1EEYA 4K07A 1L0YA 2SEBA 5GGRA 2PN5A 4LAQL 3HC3L 4NQXA 4NUJB 4PJAE 4XNUH 4OF5A 3WIFA 3ILQC 1E4XL 4I9WD 3BUYA 4YPJA 4RZCB 4LBEB 3QUXD 1FSKC 5EB9A 1X4ZA 3FQNA 4C56D 3JTTB 3UJJH 1BGXL 3W81A 1H15B 4Z8FH 4MNHB 1GZQA 4LF3B 1TQBC 3MFFA 2KH2B 1CD1A 2BVPA 3VXNB 4BSJA 3QR2A 4X6DB 3RPKA 1KPVA 1U8KA 5C0BB 3S97C 4LVHC 2C4FU 1YECL 4BFIA 3GMQA 5T1KB 5GHWH 2DKMA 1VA9A 3H42H 1ADQH 5LVEA 2QSCL 5DD3H 5DUML 1T0NA 1QD0A 3L9RA 4N1CA 4N68A 4HGWB 4OGAC 3O41B 4WGVB 2DM2A 5GS1C 3BH8B 4I3RL 4NNYA 2HG5B 3T8XB 1EV2E 5I1IH 3R0MA 3EZ8A 4NO2B 4GMSL 2X40A 1GXEA 3ILQD 4BZ2H 1G6VK 5FXCH 1FO0L 1A6AA 5ESAA 1RK1A 5L2JA 1L0XA 3UPRA 2FDBP 3AB0C 5E6ZA 4NRZB 3QUYC 2VLMD 3WHE1 4P2OC 2H26B 3GSXA 2Q76B 3MRGB 4BSWA 3QWOB 1YYLH 2J6EL 2X05A 2BFVH 3LQZB 5BOZG 2Q1EA 1J5OH 3K81A 4HC1L 1QBAA 3MJ9H 2JTDA 1TTUA 4QXTB 2AEQL 3PJSA 2ZUWA 3T08A 1KPUA 4ORGB 2IMNA 1QFOA 5EU5B 3WS3A 1TJGH 1D6VH 5J9PB 4JCMA 4OGAD 4LAQH 1E4XH 4HKBB 3VA2C 1ZKAA 3MLUL 1J1OH 1GIGL 3CJJA 4Y1AB 2GJ6A 5CINL 1WAAE 2GY7B 2JLLA 4TVPL 4DEPC 3F5WB 5BXFB 3WL9A 3FQRB 4U33A 2HTKC 3QUYD 4U6TA 3B2VH 4GKNA 4P2OD 1DUZA 4NQDA 2P5ED 4K3JL 1ZE3C 1D5ZA 1ZT4A 4TNVK 1CLZL 3JBG7 4YZFE 1AKJB 2YEZA 4OM0L 1YECH 3O6FA 2Z31A 4TSBL 5AAMA 4UZGA 1W8OA 4PY8I 4YE4H 2QSCH 3O0RL 4LSUH 4PG9B 3G9AB 5T1KD 4ALAL 4I18A 1MPAL 3S96B 4JFHE 5A16B 1FL6B 2YPLD 4QY8A 1E28A 1AGDB 4JREB 4JZNA 1EFXB 1G7JA 4XAKE 5C08A 1FZJB 4HHAB 2CUMA 1KTLB 4GMSH 1ZMYA 1CZ8H 1FO0H 5BO1L 3PL6A 1DQLL 2OLDA 3VWJB 2NNAA 4XCYA 1DSFH 2V5YA 3MRKA 2X4PA 3FQWB 2J6EH 4YDLB 5FYJH 5FKAB 4HC1H 4KPHH 4NO5B 5C0GA 1HKLL 2AQ1A 4WUUA 1MCJA 2AEQH 1LP9B 3EYFA 2EYTB 1BBDL 5C6TL 3QG7L 3DIFA 4RGNC 3T0EB 2Y36H 5GGVL 4FFVC 4F2MB 5EULV 4R3SB 1MWAA 4DQOH 5HHMD 4M62L 3FT4A 3MLUH 1GIGH 4I0PC 5I1LA 4QLRA 4IBLT 5SV3A 4JFDD 5CINH 2VDRL 3H2WA 3E6FB 5CJOH 5HGDB 2GCYB 2VDPL 1QVOA 4X8JB 1EK3A 1CR9H 3VGBA 4UNTA 5BV7C 3MA7A 3RBGA 1CLZH 4Y4KA 4GLRI 5FYJE 3IYLW 5K9OA 3D3VD 1J8KA 1WISA 4BSVA 1RUML 4TSBH 3B9AA 2NY0B 2Z8WC 4TUOB 5LAXA 3O0RH 4NN6B 5JW4N 2Z0BA 4ALAH 4OUUB 1MPAH 3I6GB 5DK2B 1N7ML 4P3WA 2Z8SA 4RGND 4YBQC 4MMZC 3EDFA 2I26N 3EUUA 4FFVD 2IH3B 2CO7B 5BZDB 1FNAA 3S3SA 5TE7L 4I0PD 3MLWH 5BO1H 5IR1B 1OB1B 3VGDA 4GKSA 1DQLH 1OAUL 2GJ6E 3ZT7A 4R0LC 3O81A 3SY0B 3PXHA 15C8L 2A2QT 2VN7A 1UWGL 1NBYA 1AXTH 2DM3A 1FIGL 2IQAA 4NQDE 3C08L 1WTGT 1XGPA 2AXGB 3MRQB 1X3DA 3QDMB 2NCMA 3AS1A 1HKLH 1AGEA 5HYQB 3QQ3A 1G0DA 2EIZB 3OHXA 1NDGA 2P8LA 2XXCB 4P2RB 4PGDB 3T1FB 1J8HD 3KGRA 1BBDH 4NSKB 2ZUYA 5C6TH 5DR5L 5D70H 5I1DB 4OKDA 4DGVL 1OGAA 4H20L 4WO4C 1IGJB 4LRIA 5K59F 5EG6C 2FJGB 4KRPC 5EZOL 4YBQD 5C08E 5CP7A 5D2NB 5LGJA 5INCB 4JPWL 3OKLB 4M8VA 4V2CB 2BNUA 1AD0A 1YMMA 3WKNA 2VDRH 3PV6B