2H2SD

Crystal structure of e148a mutant of clc-ec1 in secn-
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
211
structure length
211
Chain Sequence
b'DIVLTQSPAIMSAAPGDKVTMTCSASSSVSYIHWYQQKSGTSPKRWIYDTSKLTSGVPVRFSGSGSGTSYSLTINTMEAEDAATYYCQQWSSHPQTFGGGTKLEILRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CLC Cl transporter
molecule tags Ion transport
source organism Escherichia coli
publication title Uncoupling of a CLC Cl(-)/H(+) Exchange Transporter by Polyatomic Anions
pubmed doi rcsb
total genus 48
structure length 211
sequence length 211
chains with identical sequence F
ec nomenclature
pdb deposition date 2006-05-19
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2h2sD02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2h2sD01
2Y72A 2Y25A 2K1MA 2ZJSH 3MRBB 3MRMA 1T89A 2IBZY 3VI4F 3LQZB 1A47A 2VDRL 1ITBB 2B39A 3FB8A 5AG9A 1GGCL 5SX4H 5LBSH 2C1OA 3LEXB 4EQ3A 2YS4A 4JY5L 4HGMA 5JOFA 4QHKI 4QNPF 4PJ5B 1NGYB 1IAIM 4MX7B 3IB4A 3IDMA 4WY7L 1IM9B 1SQ2N 1MCNA 5I1GL 1R3KA 5HGDB 1IC1A 4OLZL 4P49A 4PJEF 1HH6A 3ZE1E 3L3HB 5DFTA 4PTTA 2EDYA 2MCG1 1OQXA 4OF7A 1WZ1L 3ZLQC 5CJ8A 3OAZK 4ZNCD 1AC6A 3KS0H 3K4ZA 3DVGA 5FDWB 3QHTC 1FNFA 4P4KB 4G6KL 4G5ZH 4WU7A 1EGJL 3TZVD 5ESQB 4HK0A 2EIZA 4G80B 1MPAL 3KJ4B 5T1MB 4Z7UE 2AV7B 2C9AA 4BQ6A 4PRHE 2FECI 5KOMC 3GBNL 4H88L 1U42A 4POYA 3TFKC 3H7BA 5B39A 3NBNA 1WWCA 5DFVC 35C8H 1B2WH 3IRZA 1ERNA 4E5XB 4ZFGH 3UPCA 5GQBA 5E5MA 4HG4K 5H37H 4M8QA 1ZA3A 1P4BL 2EO9A 3SY0B 2UWEF 1L6ZA 5C2BH 3IFLH 3TN0A 4JRXE 4NHUB 1S9VA 2A6JA 3ARPA 1NGQH 1KYOJ 4F8TA 4XP5H 2NX5D 3IU4H 1YC8A 3N9GH 1DQJA 5I76B 5HYSA 3ES6B 1KTKE 1G7JA 1QQDA 2XV6B 1LK3H 5JOPE 1I1AC 3ZHDA 1UZ6E 4K3DH 3JXAA 3Q0HA 1GZPB 5E8EB 2HMID 2R1WB 3WJJA 1T0MB 1F6LL 3VRJB 4I0PA 5MEQB 3GI8H 3W0WD 2P46B 3OAUL 3FB7A 3VCLA 3BD3A 4ZUTB 1JFQH 4JKKA 4NUJA 3BN9D 4IDJL 5HHOB 4LEOB 3GHEH 3TH4T 3PHQB 4P2OD 5IOPA 2NQCA 5IB1B 5EOCH 2J5LC 3MOAH 3GRWA 4ZUVB 3SPVA 1QSEE 4LSQH 5HSFA 3LH2H 5DZOA 2A83A 3MV8B 5K33A 3HR5B 4TUOA 4NRZA 1Q9WA 3BIKA 4OJFH 1OP3H 3U7AA 4UTBH 3CZJA 3MMEA 3GJFA 2EIBA 3CFEB 2NW3A 1ETZA 5D8JL 3QSKB 1ND0B 1X5FA 3UP1A 1VFAA 1VEOA 2NW2A 5HD8C 1MVUB 4Q9BA 4G8GA 1HOCB 3TVMD 3KPMB 3NTCL 2ARJA 2R1YB 1IGYA 3W81A 3T8XA 3RWDB 5LGHH 4ZXBD 2J5LB 3DV6B 3CMOL 3F6LA 1NL0H 3S96A 3QJHB 1G9MH 4NQEB 2ATKA 4H20L 4C55A 5L0QB 2N7AA 4M1DH 4UMGA 3VH8G 1AIFA 1QNZH 3WN5A 5J56B 1A21A 3I6LD 1BFSA 2YD4A 4QO1A 5JR1H 1G7JB 1QQDB 5F88A 3QUZA 3NCFB 4TNVK 2V9TA 5C8JA 2XA3A 3JTTA 1QFOA 3O8XD 3I3EA 2A9NL 1N0LA 4KXZI 2HTKD 2CKBH 4MCZB 1AD9B 4ZS7L 4KJPD 1OP5H 3V0VA 3V4PL 2ZOLB 4MJ6B 3WFZA 5BVPL 1NKOA 1A6UH 1QYGH 2FO4A 1F8TL 3QDMA 3T0ED 3I6LE 1CN4A 1F3RB 2Z93B 2GK2A 3WS3A 1SVZA 1YMHA 3QFDB 2BY2A 4YXKL 1D6VH 2EH7H 2D7NA 2V2WB 3NAAH 4I5BA 5EUOF 1ORSA 3OSKA 1N26A 3MJ9H 1XGRB 5GGVH 3RWHB 1NAMA 1CXLA 3QHZL 5AZEH 2FSEB 2VDLH 4S1QH 5I0ZA 3VWJA 4YFEA 1H8NA 2EDLA 4K7PH 5JHDD 1RVFH 3SE9H 1PFCA 1TETL 1T1ZA 1EZVY 3GBML 3P4NB 4OFYD 4QHMA 5EZJB 1FYTB 1VSCA 4Z7UB 2XKNB 3GEWB 4M7ZB 4XVTL 4F15C 3W5MA 5DVMA 1INDH 5FCUH 4L9LB 3DNKA 4XNQA 5K9QG 3MOBH 1I3UA 4HCRL 4JFQA 4JDZA 2FRGP 2XZQL 3MRKA 3TBYA 4ZD3L 5CEZH 5GS2H 2X1PA 3V0AC 1MSPA 3IETA 5ANME 2MMXA 3KYMB 4HH8A 5IHUH 3QCTL 2X10A 2VZUA 4YHPB 4BZ1L 5L8JB 2HWZH 4GKZB 1BVLA 4WI4A 5J12B 3SDDB 4PRPD 2DMBA 4RGNB 5E8PA 1VESA 4JPIA 3QO1B 4G9DB 4XPBL 3LS5L 5DMGC 3VG0L 1E6JH 3GSNL 4ZOAA 4OZ4B 5E8DL 3VXUD 4OCWL 3HAEG 4Q6IB 3WMSA 2YK1H 1GC1L 4DOHE 5ADOL 3LSOB 5TE6H 3L5IA 1NC4B 4XBPA 2MCPL 4DK3A 2WMPA 3S35H 5CHNB 4LLQA 1RHHA 1NC4D 1T3FB 1D9KA 4PR5B 5TDPB 2IAMC 1E4WL 5ITFB 1IL1A 4Y5XC 5D4QA 2V2TB 3AS2A 4HJGB 1V3LA 3G6DH 3NZHL 1PX3A 4RQQB 4AENA 1Q0YL 3KWWA 2H1PL 4MXWL 1FE8L 3AS1A 3WHXB 3UX9B 4Y16B 3CK0L 2FYYA 5B3JF 1SJHA 3SDDD 1OAXH 3GSNB 5KSBA 3UJIL 3SDXE 3QUML 4KC3B 1QSEB 3ULVH 3WN5B 3NCYP 3J8F7 1PG7W 1OT1A 3CVHL 1FC1A 4MGXA 1JZ5A 1CD9B 1N6VA 1ORQB 4I0PC 2UZIH 5EIQA 5KSBB 3QEQA 2BMKA 3MLSL 5B8CC 1MVFA 2V5YA 1AY1L 3WHE1 2RR3A 2YBRB 2D4DA 4WUUE 5EN2A 1SY6A 4ONFH 4HWUA 2V17L 3GRWH 4MWFB 1XCQA 3PV6A 1FYTD 1DQQB 1RI8A 4KQ4L 1IAIL 2VDPL 3RZCA 1ONQA 2EDQA 5CGMA 5C1MB 5HHQB 5I1DA 3MRNB 1I9JL 1A7BA 2E27H 1DN2A 3V79C 4HH9A 1CE1L 3KPRD 4P9HL 4HS8L 1AKJD 1T4KB 3FQUA 1U41A 1YECL 3UZVB 1HHHA 5HHVH 4JFPA 4Z76B 3TVMA 3VFRB 3MCKB 2CLVB 5CZKA 4E0RB 4JFHE 4IOFD 4GJTB 1QBML 1FG2B 4GMSH 3O6FC 4NCC2 4PJEA 4R4FH 3CFDB 1DBJL 1P4LB 1X5AA 4XRCA 3I50L 3TBTB 4MAYC 4NQSA 3F7PC 3O8XB 4L8CB 1QBMH 4KMLB 4KKNA 2AJ3A 5FO7B 3FQWB 2AJZA 3O3DB 5KVEH 5E1HB 4ACPA 2OTWB 3MRHB 4KKCC 4JFFE 2W9DL 1S5HB 4L4TB 4AENB 5TH2B 5CEXA 2IQAB 4QRRA 4JN2A 5CJXA 4OV6F 2Q76A 4NUGL 3DVFA 4EUPB 4Z78B 2AJZB 2X40A 3O3DA 1CFNB 5GRVL 1F58L 4PV9B 4F2MB 1B4RA 3DO3A 3QUXC 4N9GB 4M93C 2E27L 1OT2A 4OZ4A 5IP4A 2FH6A 4OCRL 3HPLA 3TCLA 5JXEC 3ZMRA 4MHHI 1G7IA 4PV8B 2HLAA 4XP6L 2ICES 2ADFL 3TVMB 3VFRA 3QI9C 4JY6A 1FHGA 4UUJA 1EFXA 2DL9A 4IEFB 5I2IA 2FO4B 1A22B 3JSSA 2E7LC 2HLAB 4OCYH 4EQ2A 2OZ4H 3UDWA 2I24N 1C12B 1NUGA 2GK0B 4DFHA 4Z7OF 5J1AB 2HFGL 4X6CE 1LO3L 3IDJB 3IRPX 5HI4C 5E7BA 4Y88A 1RURL 2FO1A 1U8JB 2YD3A 5I8EB 1JGDA 4K07A 2E3VA 2CKBB 2VXSH 2DF3A 3MV8D 3IS1X 3QUMH 2ITDB 1CLYH 4FZ8L 3QUZC 5C0FA 4HC1L 4EEEA 2I60L 4XMLL 4MXWH 4LDLB 3PIQB 1UM5H 3KLHC 1JUFA 2G75B 4Y1AA 3UPRA 1FP5A 4TOYH 1UM5L 2ITDA 4X4ZA 1J0IA 2AK4A 5BCAA 3FB5A 1KT2A 1C16B 3BZ4A 5ICXA 3X12A 1P1ZB 1TVBB 3WNLA 4Y16D 1FG9C 1WWAX 3TP4A 1QFWH 5ADOH 5DZLA 1R5VA 5CJ5A 2ENSA 4NBZB 5HYJE 1YEDB 2Y5EA 4KTDH 4FQXB 5D1XC 1FVEA 1AGFB 1INEL 1NBVH 1HYSC 2DI8A 4OSUL 4U1IA 2F5AL 4ERSL 2KZWA 1PW3A 1XGQA 4EXKA 1DL7H 3EOAB 3DROA 3RX7A 4WIQA 1FH5H 3F5WB 4P23D 1S7SB 5E2WH 1FL5B 3SO3B 1PG7H 4JVUA 1A7PL 2ADFH 3ZKXB 4D0CB 3PWVA 2F19H 1DUYA 4K7PX 2FIRT 4PGDA 1N59B 5E2UH 4M5ZL 2BHYA 1P4IH 3K3QA 4Z77B 4LCWB 4JM4H 5F7EL 3NFPA 2DLEA 3FONB 4LHUG 4XNUH 5KS9F 4NUJB 1CFSB 4LIQL 5HHOA 1C16A 3EJZD 3QCUL 4GMTL 4JFXA 5F9DC 2V5RA 4UIKL 2DQJH 3U9UA 4WV1A 2AAVA 2XWJB 2BFVH 1E4KC 2C3WA 5F1OB 5J8OA 1OY3B 3HA0A 5IF0A 2VISB 2IQ9H 5L88L 3IDXL 4NZRL 4HMCA 1A4JA 3BO8B 3QG7L 1UB6B 1RZKH 5IJVB 1TCMA 3BQUD 5DR5L 1FRGL 3DMMB 4HAFA 1UZ6F 1KIPA 4MZ3A 1KN4H 4U3XA 3DMMD 5FGRA 4QT5A 4P2RE 3FFCA 12E8L 3ELAT 1NGYA 4WJ5B 2YD1A 4MAUH 4WHDA 4M6OL 4XP1H 5D1ZC 2R4RH 1ZLSL 1KJ2L 3VD3A 1FQ9C 1EVTC 1OOAA 1RD6A 2ZPKL 5FUZH 5C0BB 1JTPA 4KVCH 1HI6A 3E3QC 1ZHLB 3QXAB 4WV1B 4HFUL 2AXFB 3B3IB 1QHOA 2R2HB 5ESVB 1JRHI 5J6GB 2J6EH 1MUJB 2EIZB 1MY5A 4WW1A 4U1NA 4KRPD 3TNNB 3N1GC 1JZ4A 1VFUA 3L5HA 1CF8H 3RTQC 3VFSA 3PIQA 3FONA 3CMOH 2FATH 2YN5A 4NQTA 3SKMA 5A43C 1K5NA 1OB1A 5E5UB 4F3FA 3HFML 3GSUB 4LASL 3NTCH 4XX1E 4KKAD 3KLHD 3O3BA 3QO0A 2D4FA 2F8VA 3UJTL 1MHCA 4L4TE 4S11A 1BD2E 2EO1A 3GI9L 2P8MB 1EHNA 4L1HA 3REVB 1R3HA 1MRDH 2WINA 2EXYC 1WK0A 4FQCH 1GC1C 2Q8AH 1CFTB 4ZXBB 2FH8A 2ED8A 5BRZA 4IRSD 1UEYA 3RVUD 5EU7E 3RDTA 4UOJA 1IAKB 5T33H 1YY8B 3HS0B 2MHAA 3UTZB 4PJ5A 4KTEL 2AXGA 2NY4C 4XMKL 3SCMA 4J8RA 3C9NB 4NHCL 3HRZA 4OGYL 2EKSB 3WFHA 2EH8H 3QQ4A 4HWBA 3SJVB 3VRIA 2F8XC 3C6LD 1RK1A 3KPRE 2Q7YB 5KSVB 1C5DA 1U8OB 2AP2A 4NHCH 5GRUH 1NUDA 1NGWB 4KTEH 3VXQB 5F7UA 5K9KA 2HT2C 4XAWL 2VZ3A 5T33L 2Y5TA 5E4EC 3TV3L 1X4XA 2H2PD 3C08H 5C0IB 4X4XB 3MNWA 4OCLC 3QCTH 3X14B 2HH0L 4ZNEA 4P2OB 4FQCL 4QY8A 1MUJA 2APFA 4K3DL 4BQ9A 1SM3H 4PRPE 4Y2DB 5FA3B 2LTQC 3S96B 4HLZG 4ZD3H 5CEZL 2FECL 3GI9H 5BV7C 1FORH 4D9RE 5J1TC 4GW1B 1C1EH 2A9ML 1S9XA 3D0VB 3BKJL 3MRPA 3BRDA 3T0EA 4ZSOA 4BKLB 3JZ7A 5CP7B 3D0LA 1U8LA 2DBJA 1KLGA 3MR9A 3MYZA 3K2UL 1N2RB 3FB7B 4XWOC 3VCLB 2QTEA 2VWEC 5FOJA 1P4BH 2NY6B 4ZDHA 4HF5L 4QT5B 4MMXC 1BAFH 1H3PL 3TBSA 1CFTA 4ZXBA 4EIZC 5F8RC 1LO4L 3V7AE 4ZS6C 4OCSH 1CICD 1FLRL 3BPLB 3S97C 1KNOA 3DV4A 1YYMH 2X9YA 4X8JB 1LEKA 3TPKA 4RMSA 3BZEB 4X4MA 1UYWH 4O2CB 3NIFE 5JW5B 4UINL 1MFDH 4FQ1L 2QSTA 3EFDL 1KYOK 3QI9D 3WUWB 3VMOA 4ZTOL 1FSKB 3Q48A 5CEZE 1HZHL 2VL4A 5EBWB 1UWGL 2D7QA 2P42B 1NDMA 1Z5LB 2VKWA 3MV11 3EFDH 4UINH 4YR6B 4QRTA 1O7SA 2GJ6E 1RJLB 5EUOE 5JDSA 2XWBB 2QADB 4DKDC 3NA4A 3V6ZB 5TQ0H 3S34L 1GYAA 3KDMB 1RZIA 5CSZB 2R2CA 4EVNA 4KTYA 1NBYB 1LO4H 1AKJB 4L9LA 3IJYA 2BFVL 4HEPG 1HHJA 1VB9A 1G7HA 2XKSA 3MGTA 4XVSL 2DQGL 5JLZA 2X4OA 3MV7A 2ADGA 3PG2A 5IBLD 1QLFA 5IM7B 5J12C 4DGVH 3BIKB 5J13B 3TIEB 1MLCA 4UIMB 1CDGA 5CMAA 3RY5A 4CVWA 2XQBH 2BCKA 2P5EA 1KSRA 1OSPH 1ETZB 2VAJA 3R8BB 1TVHA 1CR9L 3VFPA 5E8OA 1FIGH 2HVKB 2NY3B 3Q6FB 2Y07L 4ODHL 5LCVH 1OGAD 4U6TA 1X5GA 5GRYA 3MRQB 2OSLB 4HQQH 3W9DA 4OJFL 5F96L 1N5YL 2APVA 3JV0A 1O5DT 2H26A 5IT2H 2GFBB 1VFBA 3GNML 1XFPA 5EC2B 2PXYA 3EAKA 3QQ9D 1OCWL 5SX5H 3GJFK 2BSRA 1EDQA 5I17B 3ARBC 1HHJB 5J13C 2X4PB 3DRTA 2EH8L 3CLEL 2NY0C 5T3ZH 5IHLB 3MLTA 4GRLB 1U6AH 1UB5B 1IVLA 1PEWA 2V5SA 4XNYH 1OAKH 3GI8L 4LHUD 4OLXL 3GK8L 4JPKL 3KJ6H 1C5CH 1B9ZA 4BFBD 3WFBL 5TE7L 4TTDC 1TQCB 4PY8J 4RGND 4JFZL 4ZUUB 2HVKA 1Z9LA 4JB9L 1ORSB 1RULL 2BDNH 5FF6B 2JCCB 3MUGB 2NW2B 4PJ8A 3I9GH 3OZ9H 4UB0H 2BCKB 1GHFL 4RAUB 1JPTL 4J6RL 1IAMA 5DHXB 3QBTB 5CILH 5KTEL 2H8PA 4NSKA 5IB3A 5I1AB 4POZC 4UV7H 1HCFX 3LRGA 3U4EA 5CINH 3B9KC 3IDGB 2CDFB 2WAHA 3O45A 3EKCA 2GSIB 1PZ5B 3D3VD 3U30C 4U1HB 5D6CA 4XCNB 5EU3A 1ZVHA 4D0BA 5KS9E 4LQFL 1KGCE 3BPNB 3V9FA 5LKNA 2PO6D 1ZSDB 5JHDB 3NFNA 3QDGD 4S1SL 3LPFA 3DSFL 2EDTA 5CIPB 5KSAA 1MFCL 5DC0A 4NGHH 3FO9A 1JWMB 3T8XB 5C0EB 5C7XH 1GXEA 3QT2A 3I50H 4PJDF 4WFGE 4QRUA 3I84A 5C09E 1RUPL 1YUHB 3SKNB 5DWUH 3MBXL 4F2MA 5FECB 4MQSB 5I1GH 3F5WA 4APQA 2PNDA 4JG1H 4YQXL 4G6AD 4LMQE 2KBGA 3Q2CA 4PGCA 1B0RA 2N7BA 2QQLL 4LSDA 3EW3B 4MNGB 5EU6E 4JDVA 2ARWA 1FZJA 3ESVF 3RUGF 3L5WB 4P9HH 4XNUL 1GGCH 2FJFB 1EHXA 4QRRD 4M7LL 4KROB 3CIQA 1K6QL 5GZOD 1IFHH 1KFAH 3P30H 3C60C 3FN9A 3LKOA 1P4LA 2CRZA 1ZLVH 3TNMB 1ZWIA 4LPCA 3RVTC 2YWZA 1NEZB 3B6SA 3VXRE 1PKQE 3TA3A 2J8UE 3VGFA 1I3VA 5DJDA 4LBEA 5D6CB 4KJYB 4ZUSA 5ISZA 4F9LA 2GJ6B 4O2EB 2ZUUA 3IDGA 2NY4D 4X80L 2F74B 3KG5A 1GIGL 4NO0D 4HS3B 1CDYA 4XCCL 3F8UB 1FLTX 4HK3N 3NVQA 5IEHA 2BSSB 2OL3H 1K85A 3N06B 5KSUA 4E41D 1EGJA 1KNOB 1LK2A 1KG0A 3WE6B 5I19L 5TF1H 5DQDL 3HI5L 1KUMA 3DUUA 3S5LA 2ENYA 1C7TA 3FT2B 3MV8E 1Q0YH 1WLHA 4TNWF 2MKWA 4NQVA 4HWEL 4ODUA 1R5IA 3DYOA 1K9TA 2V6HA 3MJ6A 4XMLH 4H8WH 2F8OA 2VXTH 3KYMA 1R3JA 3LZFH 1TMCB 4NQEE 2NY4B 4U05A 2VITB 1FSKC 3RGHA 5LVEA 5HHOD 3QIBC 1MFAH 2FLRT 3VFPB 4OQTA 2GJ6D 4LVOC 2C1PB 4QGTA 1KF9B 2DLIA 3BZFB 4OIIH 1W0WA 3W0WB 1BQSA 2LAGB 2IG2L 2G9HA 2KQNA 2BC4A 4YJZL 1H15A 1LILA 1RQ5A 1SJVA 5HGBB 1U3HA 4QRRB 5EUKA 5TDPA 3GMOA 4AM0B 5F9OL 3LIZL 3TO4A 5FAAA 4AT6B 2P1YA 1IKFH 1MAMH 4M5YL 4NP4L 3HZMA 4WW2A 4Y7MA 3DARA 2RCSL 1QSFE 4LPTA 3SEPA 2NXYB 4PJHE 1VA9A 5I0DA 4PJCE 15C8L 3QRFM 2QL1A 5D2NA 1RJZB 4EDXA 2XTJE 3F65A 4IBLT 2PW1B 5CD3A 3ZDYE 1J0JA 4PRDB 1NAML 2YN3A 3ETBF 4NUGH 3HZYA 1PSKH 3MBEC 1E27A 4K8RC 1P2CB 2MFNA 3DUUB 2Z8SA 2AEIT 2YXFA 3U1SL 3X13A 4XP9L 5BOPA 1OGTB 4QOKD 1HKLH 3E8UH 2HYMA 4ZUUA 2HTLD 1RMFH 1A14H 4JANB 4JRXD 2FR4A 5DRWB 1DBJH 4KQ3H 4M48H 4QKXB 4LP5A 4FFVD 5IVZA 4GAYA 2BXYA 3TESA 3E3QE 3G6JB 4CL7A 5CSBA 4AEHH 2DN7A 2M2DA 3UBXB 4PPTA 1Q0XH 3ECBA 3A6BH 3RVUC 4WTWA 3ULVF 4YGAB 4GRLA 3DVGB 3MLTB 5EO9B 3ZDYF 4Z8FL 3MRHA 5T3XE 4IHOA 4ZS7H 2FEEL 2BNQB 3FRUA 2AXFA 1PBYA 2CR6A 2R1XA 1XF5A 1YA5A 4PB9H 3ECBB 2GEEA 1AJ7L 3LHPL 1BBJB 4LIQE 4Q7DA 5DQ9A 1YQVL 4XRCB 2BJML 5GGSA 5K59E 4JFEA 4X4YB 3TO2A 3VE0B 1IM9D 4N8VA 3IXAB 4QRSA 1GAFH 3CMGA 1RZGB 4JGJA 4QXUL 1A3RL 2PYFB 4OGXH 4ELKA 3D25A 3KLAA 4QXTA 1BD2A 3I85A 5FO9A 3BMVA 2CIKA 3PNWA 3KPNB 3EGSA 1I8IB 3L95B 4JZJA 5L9DH 3OJMB 5LGHL 2DKSA 3KLAB 5I6XC 4YGVB 3OHXB 1YN6A 4LLYA 3STLB 1P9MA 5A2FA 2XPGB 4PJIA 4YDVB 4DGYL 5JZ7C 4OZFG 4JY4B 5T3XD 1VGKA 3A0OA 3G5VA 3VFOB 5IV2B 3TNNA 3WUZA 5MI0B 2YSSB 1KPUA 1ES0A 4JCLA 1PSKL 1QA9A 3IFOB 5EULV 1OGAE 3LN4A 2A0LD 4Z7NE 4KK5D 4Y2DC 1R3HB 4MDIB 3TBYB 2FB4H 1L0QA 1QR1A 4YHYC 4CU8A 5EOCL 5IVZB 2A74A 4NZDA 2CRMA 2E6PA 1G7LA 3QDHA 4DFIA 4ZPVB 1MCDA 1OQOA 3CPLB 4RRPA 4FQQA 1FN4A 4J3WA 5C09A 3ZSTA 2WBJD 5GZOC 2XZZA 3KPOA 3KR3H 1WZMA 2EXWD 5DVKA 1CIUA 2VLKB 5H2BA 4HWZB 5HGAB 4JDTL 1HSAA 1Y0LB 4PJ9B 4L5FL 4JQIH 1W0YT 1BF8A 1T7YA 1NANH 3UAJD 4U1LB 4NNPH 5T1KD 4RNRA 5BV7H 3OKMB 2HT3C 2Y23A 3O6FA 3VH8A 4XP5L 3SOBH 2V5TA 3U2SB 4XPAH 3SE4A 2R0ZL 1P1ZA 1SJEA 1INDL 4JFDE 5KN5A 4QY8B 2QADD 2WIMA 4PJBF 4YFDB 2ZSWB 2EICA 3R1GL 5D1QC 4H8WC 4P4KA 3T0AA 1HYSD 4K7PL 2ZUXA 2CK2A 1BQHG 1Q9LB 2YA2A 3HZVB 5E2TL 1N3NA 3QG6B 4NC1C 4KWUA 3GBNH 4H88H 1HNGA 4YHOH 2AK1H 2VDNL 1DE4A 1FL5A 2FIKB 4XC3L 1CZ8H 4RSVA 3BPOB 4YXLH 1IKNC 1OF2B 2Y5TB 1J9CT 1U3HC 3NCJH 3ULUH 1F8TH 3O2WL 4EUPG 4JR9H 4XPTL 3PDDA 3CFKA 4ODWA 3B9KD 4BA8A 3ZE2F 3OBAA 4Z7OE 5ICZA 1AGFA 1WUNT 1KTDA 3WFEL 4PLKC 4U6VL 2SEBA 4ISVB 5HI4D 1H8OA 5JR1L 2VE6A 4A6YA 5I18H 4LKCA 2PW2B 4NOBA 4QRPD 1AGCA 1WTLA 5CMAB 3TN0D 1RFDL 4NWTH 4QEGA 3Q1SH 2P5ED 5SWSE 2VXUH 3DX8B 4R6UA 3P73B 4AIOA 4PLJC 4ZPTA 5I1CL 5FM5O 1NL0L 4YC2B 2C4FT 4NWUL 4YHIB 1U8IB 1QFWM 3G5XB 4J23A 1TZGL 1Q9KA 4HBCL 4JG1L 3CDCA 3O8XA 5D1XB 3RKDD 3MBED 4BFGA 3QNXB 1ZSDA 3AY4A 3ARFD 1CFSA 4MNQB 4YBLC 4HKXA 1A8JH 5EC2A 2H32A 3VRLE 3GMLB 4GRLC 5D1XA 1JTOA 3IFNH 5EOTB 5FA4A 3MV9E 1LDPL 4R97C 4UTBL 5C7XL 1XGTB 2VYRE 4G6MH 4PJCA 1LE5A 5E6IC 4Z95H 3SJVD 3UTTB 4Z7VA 1S7TB 5FYKL 3A67H 5IEKA 1HI6B 3EO1A 4WFED 3RVVC 4I4WA 3UYOD 1F2QA 2ICCA 2YD6A 4AIZB 4LPVA 4NNYA 4YBQD 2VQUA 3CD4A 3D85B 4JEGB 2Q3AA 3MOAL 1CK0H 4V1DE 1CDJA 3UPAA 5BZWB 4G7YL 2IJ0C 5KVFL 2H6PB 1QACA 1OD9A 1DBML 4ONHB 1YEHH 4HJ0D 4UU9B 4M7KL 1TXKA 5D7JB 1J5OH 1IEAA 4FNLL 5GHWH 4HIHB 4NKOB 2VDKL 1A1OB 2YPLB 4NO5A 2H32B 1GHFH 3ZT5A 4IIQA 3TIDA 3P0GB 1JNNL 5JIHA 4HIEB 3IJHB 4KRPB 2BDNL 3ZYZA 1JYXA 1HHKB 5FV1L 3BWAA 1TLKA 3OG6B 3QUZB 1URLA 1TITA 2VDKH 3MACL 5A40E 1MCWM 1OB1B 2XWTA 4FNLH 1QD0A 2LAAA 5BW7C 4JKMA 2OQJB 1G1CA 4YX2L 3RL2A 5DK3A 1KXTB 2K3TA 1WWWX 5D1ZB 4ETQB 4LCWA 4G9FD 1YEHL 3MFGB 1D5XA 4AEIL 1DBMH 1NFKA 1EPFA 4KK8C 3T3PE 3FT3B 3DWTA 1UACL 5DD6A 3QUYC 2J4WH 3VI3E 3UTQA 1Q9OB 3UO1H 2Z31D 5T3ZE 1KB5A 2VXVL 5JPNB 1GJIA 2GI7A 2NXYC 3OF6A 4LLAA 5EB9A 1MCWW 4F58L 4JJ5A 5D9SB 5FYKU 1B4JH 4LLMA 3IDMB 4N0CC 3PP3H 3HE6C 2HG5B 4BJLA 3A6CH 1J1OH 2Q1EA 1KB5L 5MENE 1FFPA 1S9WA 3GZKA 1U8LB 3GFUA 1KULA 2DLFL 5B4MD 1LDPH 1XGUB 1HN1A 1AD9A 4NQDD 1A6ZA 4J3VA 4PJDE 2X09A 4NRYB 2ZCHH 4R4BB 4QHKJ 4Y2DA 5KG9A 1CXKA 1A0QH 1EO8L 4N8PA 1U8PB 2ZUQB 1YMMB 1DUZB 1U92B 4MD5A 2AJSL 4M6NH 3K46A 4HK0B 5IFJA 1AHWA 2AABL 5T5NG 2FD6L 2ZSWA 3CSGA 1J8HE 3O2DL 5FDWA 4N5ED 3O2DH 1ZHNA 4JY5H 2CGRH 3BXNB 1MCRA 2W38A 1EA9C 4P23B 2BNQE 1F6FB 3VXUE 3E2HC 5ECJE 2W0FA 1AGEA 3L3OB 4XGZA 5DMJB 2LU3A 3DX7A 4L29A 1EO8H 4R7DA 5D7IE 4RNRB 3N85H 1FBIL 9CGTA 1I8LA 5C07E 1XF4A 4WU5A 4FQXD 4JDVB 4TYUA 5A16A 3MMEB 4JY6B 1S7RB 1NGPH 4N5UA 4FXKA 5CJQH 2AJYH 2A0LC 2ZNWA 1HNFA 3VXTA 2V2XB 4Z0BH 4OZIB 3TJEL 1WBYA 3MV8A 5I15L 5CEYA 1CQKA 5A16B 4TUOB 2I25N 4IRSC 4F58H 5EU4B 4HMDA 3P0VH 4HLJA 2EXYD 3VW3L 4OIBA 5FDYA 5IBUG 5HDBF 1ZGLM 5LGJA 4MXQD 3VXSD 3CDGA 4LVNC 2R1XB 4YR6A 1I7UB 3IVKA 1EAJA 1I7TA 3SDCB 1MRCH 2GJ6A 4BUGA 5F7HA 4YHIA 3O8XC 3SE8H 1JUFB 1KENL 2G75A 4YHLL 4YX2H 3SKJL 1NBQA 2NTFB 1OSZA 1AHWB 3F6IA 1JK8A 4M00A 1KJMB 3ILQC 5ACZA 4KZEL 3HZKB 2O26U 1X7QA 3KPSE 1NFDE 2EDNA 2QQQA 3MV7E 3DETC 2CD0A 4ODVH 4NNPL 2Y06L 1MF2H 5ERWB 3IU3B 3P2TA 1F4XL 1BJMA 5E1AA 2MJWA 4TUKH 4DW2L 1QSFA 1R6VA 4DZBB 3QO1A 2B4CC 2X4QA 1B0RB 1MREL 1MWAA 1GPOH 1YEGH 2B4CL 5C0AA 5IIEA 1R5IB 3HI6H 1D9KD 1TTUA 3T2QA 2PW1A 4HLZH 4OT1L 5CD3B 4HUKB 5F88B 2XY1A 3HB3D 4R7DB 4PJAB 3LMJL 2DTSA 2HKFH 3HG1A 3C2SA 1QLEH 1TCRA 2PKDA 5F9AC 1T1XA 3UTOA 4QHNB 4B7IA 1JJUA 4K9EL 3MRDA 1T66D 4P2OA 3T2OA 4K2UH 2GIYA 2HT2D 4FP8L 1RHFA 2D9CA 5C0CA 1KELH 3CPLA 1FO0B 2AJVL 1LD9B 4FQ2L 5EU3B 1NCCL 3QEUA 4WNQA 5FHAH 1ZGLA 3DRQA 3PHOA 1EERB 3GJEB 3MA9H 3IJSA 4HPYL 4Z7UA 5HGDA 4V1DA 3KJ4C 1CG9A 3W9EA 4YHKH 4NWUH 2D7TH 4PB0H 4HHAA 8FABB 2Z31A 4N8CH 2H9GA 1FNHA 2JJSA 3CH8A 3ARGD 4JCMA 3U2SA 4HFWB 3RP1A 3PGDA 4DZBA 1GL4B 4R90H 2XG5A 3PV7A 4GW5A 4BFEA 3MRKB 3I02A 3KPLB 1QEWB 3PDOA 3V5HB 3MLPA 3JUYA 5LXGL 1KJ2H 4PGEA 1CXIA 5E9DD 1BFOA 2O5YH 4YAQA 4U1SB 5I8KH 3WIHH 4MAUL 4IS6B 5DEGA 1N3NB 1A4KA 4MJIA 1EO5A 3EYSL 3L3DB 4Q9QH 12E8H 3QPQC 5JNYA 4XXDB 2ADJB 2AQ3A 3A6BL 2G2RA 4LCIL 1UVQB 2NNAB 4OLWH 2V7HB 1OAYL 1N6UA 5HHPB 4L8CA 4LVHC 4V1DD 1RZKL 3Q3GA 2AK1L 1CL7H 4X6DB 4Y1AD 4HIIB 3TBWB 4CGTA 4UNVA 4OKDA 1FCCA 4O2FB 5HYQB 1S8DB 1CCZA 3VXUB 1HILB 3HC3H 3Q6GL 4MS8C 1PKOA 3OXRB 4G43B 4J1UA 4PRNB 5GXBB 2IBZX 3KPNA 3U79A 2ESVB 5F3BA 2R4SL 3QFJB 1NC2A 4PY7B 3FCTB 3CXDL 4OBSA 4APQB 1RHHB 1EFQA 4XPAL 3E6FA 5KSUB 3OHXA 1LO2H 2IH1B 3VXRD 3GB7A 2XRAL 1OWRM 4AQOA 3OR7A 4ZAKA 2XTLA 2YWYA 4PY7A 1XIWD 2PYEA 5J3HC 5CSGA 3CH1B 5EU6A 1J7VR 5IB1A 1RIUH 4MCZA 4JDTH 3QUXD 4X7DC 3QDJA 4O2EA 4YFLF 3VFTB 4PUBL 5FUOL 4YBHA 3K2MC 4BZYA 3V5KB 3TBTA 4FABH 4HT1L 3G5ZB 3QJFB 2IG2H 2YPLE 3BP6B 2R0LL 5A2IH 1HCVA 1IGIL 4PJGB 1BBJA 4C56E 2VLLA 2D7PA 3PHOB 2E7CA 4FFWC 3M17A 4P23C 1F00I 4WFFD 5L0QC 4NPYA 4I3RL 3QZWA 1AO7B 1PZ5A 4F33A 2P49B 1L9MA 3QRGH 3O6FD 2V9RA 4ENED 5C07A 4LNVA 2WUCL 1UA6H 3HC3L 3KPMA 3S3PA 4Y4FC 3T3PF 2CIKB 4GXUM 4ODSL 3EYFA 4NNXA 2CLZA 1U8MB 1E27B 3Q5TA 4ZAKD 1HHIA 2YPVH 5IKCA 2HAZA 4NZTH 4LP4A 3S37L 5FCSH 4RX4D 2CH8A 4RAUA 3PL6C 1MCJA 1G7MA 5CCKH 1VERA 2P47B 3D9AH 2FHFA 4U3CA 3SDXF 5B39G 1HYRC 4J1UB 1J86A 2EYRB 1X5LA 5EBMB 1BVLB 4EN3C 5I1EL 1DQMH 5CZXD 4O9HH 5GZNC 5TFSH 4DTGH 1OARH 1S9YA 4DCQA 3O3EA 1NEUA 2EKJA 2G60H 2CMRL 5DZNA 4XP6H 2FX8H 6FABH 4FQIH 1BHGA 5E4EB 4MJ5B 1MIEH 4XNQB 2XTJD 3J7HA 3QCVL 4UV4L 4HUWA 2ZZUT 1ZS8B 2ADIA 3LEYL 1R24A 1RZIB 2DM3A 4UT6L 3MJ9A 4KRMB 3MUZ1 3IDJA 1P7QB 3MJ8B 4N1CA 1J0ZA 1HEZB 1UM4H 1OTUC 5EU5A 4PRID 4Y5VC 1NMBH 3RVTD 3HZYB 1E4XH 4OLEA 1RUMH 4A6YB 4KJWD 4PJHA 4A6YL 3MJ7A 1D5BB 3DVNA 5D9SA 1A3LH 3CLFL 1SEQL 3MA9L 1IQDB 5GJTL 5F7NC 2YC1A 3F12A 4JPIB 1VGEH 3LKSA 1EBPA 3LN9A 5JXAH 5J11B 2YD8A 5C3LD 5CUSH 2IAMB 3MBEA 3GM0A 4PJAE 3CJJA 5M94B 4MCYA 3JWOL 1RIHL 1JMXA 1NMAL 4F7MA 1CTNA 3C6LA 3L95A 1QFPA 2I27N 3RVXD 2KDGA 3RWGB 4NJAL 1YECH 2DQHL 4W4NA 3JWDL 4LL9A 3TH2T 2XICA 1KEGL 2Z35A 4NO3B 1BD2B 3DTXA 1JZ2A 1T89C 1YQ2A 4DN4L 5L6YH 4UT9L 3WO4C 4JRYA 2OCFD 4JN1H 1I1AB 4ORGA 3HCVA 1IAIH 2VDPH 5DUML 4G8EA 4UDTA 3VFUB 3AU1B 1P7QD 3PWPB 2DDQH 4UV7L 4GBXD 2QKIA 4S2SB 4Q58C 2EZ0C 4JFEE 4JY4A 4R4NC 5CILL 5KTEH 4J6RH 3G5VB 2Z31C 2O5ZL 4OCXH 2UZIL 2G5RA 4M1GL 2HFTA 2GW5A 5DRXB 3T0DA 4MCYB 1KCUL 4UAOC 4U6YB 3X17A 3RIFF 1MOEA 4YK4C 2VE6B 3H0TB 2GYSA 1QEWA 5TE7H 1OAXL 4PLOB 5EOCJ 1V7NL 2WWMC 3LKQA 2Q8BH 7FABH 3CCHB 1UKTA 3O9WB 2O5XL 4IMLA 4HUXB 4TUJB 5EU7C 2KPNA 4LCUB 1B0GA 3BKMH 3GMNB 5I1JH 1DQDH 1AR1C 5AYQA 2X44D 5EU6D 5T3ZL 3QXWA 3S35L 1KCSH 2H2SD 2H45A 3U7YH 5IFAL 2FZ3A 4HKZA 1FAIH 2R23A 4PRBA 5T1DH 2A1WH 1CLOL 3Q3GB 3FTGA 1QO3B 4B7LA 3OB0H 4G3YL 4QXWA 1ZS8A 2ADIB 2NY1C 3MA7A 3PQYD 1OCWH 2MQCA 2X1WL 3H2WA 3MYJA 3OKEA 3GMRA 1SYSB 2E6JA 5CP3A 3PF2A 4KZDH 3ZL4H 2HWZL 4JN2B 4BZ1H 5LCVL 2Y07H 2PCPA 5FUCE 2HT4C 3DYPA 5C0NC 5GS0D 1FBIH 2DQUH 4P2CG 4KXZH 2BOBA 2RGSA 4RMRA 1RZ8A 2HFFA 1I7ZB 2VDMH 3D48R 1P7HL 2BERA 1G0XA 1ZHLA 1K6QH 2A6IA 4HBQA 2IADB 5FIEA 1NGZA 5SWSB 1VADA 4OUOA 2VLRD 4OZFA 3TBSB 1QUNA 3QUXB 1OWWA 2EIDA 3B8YA 4KMTH 4BSWA 2CGRL 3QWOB 5E5MB 4L3ED 1EFXB 4WTZA 4RIRA 5DS8A 4Z7NF 4F7TA 3S35X 1I9IL 3RY6C 3V8CA 5GSVA 3MNVA 1LE9B 5GJSH 2AJSH 4M6NL 5IROA 1I3RA 4S1QL 5DWUL 4K94L 5CGTA 1P7KB 4FFZL 2P8MA 5MERB 4X6CA 2EYTA 2YA0A 4NQXA 4GRMB 4DKAA 4P3WA 2CPCA 3BAEL 2AJUL 3WLBB 4H25B 4IHOB 4JJHA 5KAQF 3HZVA 4FXGB 2PCPB 3EOTH 4ELME 4KV5F 1KB5H 1UKSA 4RFOH 3SCMC 4HSQA 2AGJH 3VFSB 4K3EL 1CFVL 3QR2A 5HY9B 1WIOA 1A5FL 2IANB 3MLRH 5IV2A 3VXPA 5L2JA 2AK4E 5ISZD 1WIPA 1JV5B 3L3HA 3DO7A 4HKXB 3WL9A 3VWKA 4R0LC 2SEBB 1NMCB 1VENA 4S0SD 5IR1B 4D9LL 1HHGB 2FX7H 3SE4C 5DS8B 5BMFH 1X6LA 3PWUA 1IJ9A 2PR4H 5MP6L 3W11C 3PWJB 4X7CC 3P73A 3MLZL 4OZFB 1MCPH 3EYUL 3F7QA 4EN3A 1WFTA 4KRPC 4U1MB 3TLRA 3OZ9L 4UB0L 3T4AB 3CX5J 3SGEI 3F7YB 4NQCD 1BX2A 1R5WA 3M1BA 1EUTA 3FFCD 1JNNH 3SKOB 5DRZB 1IARB 5GGVY 1TZHB 1T1YB 3MLVH 3QZWG 4P3DA 1SEBA 2VABB 4LKXB 1OSZB 3T2NL 4RAVA 3QDME 4M7KH 5HHMB 1F3JA 1I4FA 5ILTH 3MYJB 4ZXBC 4OFIA 4W6XB 3HUJB 5CIPA 1T22B 1ZEAH 5KVMC 4GAGL 1MQKH 1MFBH 4YDLB 5ADPL 1UWXK 3GMLA 5DO2D 4ZSOB 3VDCA 2EEDA 1GGBL 5E6ID 4HIEA 4FTVA 2F58L 1NH6A 1PYWA 5DFWH 5C0CE 3GO1L 4KH2A 5EZIL 3GHEL 2EXWC 4MYWB 1MFBL 3H9SB 3MFFA 4OKVB 2YEZB 3FCTA 1JFQL 2YMXH 1NLBL 1F90L 2X4QB 4PGCB 1EMTH 4FXKB 3HI1A 2PO6C 4WDIB 3U4AA 3UXFA 3T04D 1PLGH 1FO0L 2A6DA 1U3ZA 3H9SA 3MFFB 1MRFH 4NBXB 5KN5B 4HHAB 1A6VL 4OTXH 3CAFA 3HZKA 2X4TB 2BVYA 5I66A 5CSZA 4ZUVA 4EVNB 3D18B 4PREA 3HN3A 4IOIB 1QRNA 1NGQL 1TDQA 5JUEL 4D3CH 3IFLL 2FATL 5EORL 1YNLH 3RDTB 1CLZL 4JAMA 3KNBA 4LBEB 1LD9A 2X1QA 5E6IA 1I7TB 2B1HH 3AU1A 4IIQC 5DJXA 2R0WH 2X4NB 3NA9L 5I8CB 5DHYA 4JQVA 4LVHB 3VFNB 1CGSL 1S5IL 2VLMD 4Y19A 4KHXL 5FO8B 4KVCL 1MVUA 4B41A 3WJLC 2B20A 1VKXA 4U6VH 1OAQL 3ARDD 3QH3B 4GKSB 2DRUA 4TTGA 1BIIA 4LSSL 3K8MA 4OZIF 3RZCC 2QBWA 1RUKL 3LKQB 3NCYS 4NRZB 3EUUA 3PWJA 5I16B 3B3IA 5J6GA 4NQVB 2FNBA 4LPUA 4HC1A 2OK0H 3ZE2E 2YR3A 2CXGA 4YXLL 4PRIE 2GJZA 3ZKMD 1PKQB 2OTUA 4WENB 4L8SC 4Z9KB 3INUH 4YDJA 2A6IB 5AEAA 43C9A 5CD5D 3HC0B 4LEOA 2BVTA 3RVXC 3ARED 3GSRA 4RCAA 1MFEH 2BNRB 3BEWA 4I0CC 4MQXC 3W39B 1BAFL 1H3PH 3VFGL 5F93C 4EI5B 3O3AB 1XCQB 2HJKB 1KIRB 4KMQA 4LIQH 3HR5A 5EORH 1R24B 3STZB 2GUOA 5JUEH 4I18A 3U0TB 3QIWC 2RJMA 5C07D 2XOTA 1BBDH 4WO4B 1JZ3A 3QAZB 5HHXL 3RKDC 5ELIA 4OTXL 1AQDB 3RKPA 1SM3L 2EKSA 2VERN 5LWYH 5I30L 3TO4D 2NY6C 3MLYH 1JL8A 3LKPB 3T0EE 2APXA 1KTLB 2HH0H 3FFDB 1IM3B 1K4DB 1T83C 5T1KA 4X5LA 3TV3H 1NDMB 2HJFA 3VWKD 1A1NA 1F97A 2YMXL 4WFHD 4DKFH 1RUAL 3UTPD 3N0PB 1IBGH 1GZPA 2RHEA 3DXAB 3VWKC 1CD1A 4MZ2A 1NBVL 4NQDB 3MQIA 2X89A 1FNSL 4OF6A 5DGQA 3NCCB 3S36H 1CIDA 2OJEA 2HMIC 4KAQL 2HN7B 2Z0BA 3PDOB 3V5HA 3QDMD 3NMEA 4JFFA 2P7TA 3LKNA 4YDKH 3QDMB 1U8KB 3RHWF 1HIML 1OTTD 1IGTA 4RWYL 4EUPA 2ADGB 5D93B 1YMME 1QLFB 5DTFB 3DXAD 5DD0L 3MREB 2O5XH 5KJRL 2DM7A 2A83B 3TPUA 2BVQB 25C8L 3QIBD 4WI2A 4HUVB 3I6KB 3IF1A 4JO4L 1TJIH 3L3IA 2XYCA 4AL8L 4HXBH 3O2VL 4K9EC 5JDSB 5HHME 4MQXD 3VXNA 4XI5C 4APQC 3VXMA 1CBVH 1JNJA 2IBBA 3TFKD 2AK4B 1NLDH 4MD0B 4QCIA 4WO4A 5L9DL 3RWFA 2OSLA 5TPWH 4YNYA 4X0KB 3QUZD 3RJQB 5AZ2H 1NSNL 2DDQL 1CE6A 1HWGB 3H9HB 1G7MB 3C60A 3UZQA 5FB8A 1VFOA 5ITFA 2XNAB 3T2PA 2XN9A 1T1ZB 5GGSY 3D6GA 3DURA 5E1AB 1VACA 2E7HA 1OLZA 4U1GC 1AE6L 1ITCA 1F4HA 4GG6F 2ORBH 5C6TL 4EZMA 4FFVC 3BESR 4Q6IA 4UT9H 3AREB 1SMOA 5HPMA 3DXAA 1FVDB 1CD1B 2LFGA 4Y1AE 2W0FB 2HTLC 3NIFF 3JWDH 5DA4A 4HUNB 4RFOL 4RAHA 3UTSB 4XCYA 2COQA 4MA3A 3RX8A 5MHSE 3LEVH 4GQ9L 1ADQH 4TSCH 4WRLA 1KCVL 3KYKL 2EDJA 1IEBB 3FQNB 1R3LB 2W07A 3SBWA 1T66C 1R5VB 4ODTL 4ZFFA 5BS0B 4L3CA 4IRJB 3LQZA 3WKMH 5JXAL 1U8NB 2P43B 5GJTH 3DRQB 3BH9A 3WNKA 4WV1C 1ADQL 4TSCL 2DYPD 2ICEA 2IALB 4CVZB 4JFED 5IB4B 1HQRA 1E4XL 5JNYB 4RZCB 3PWNB 5IFHL 4PP2A 2KQMA 3O11B 1GGUA 2X9XA 3G6AB 1J05B 3IDNA 3BPOC 3EJYC 4WHTB 5E00A 1BFTA 1T3FA 4MNQD 4WFGD 1OTSC 5LQBH 3RWCA 5HDOA 2V7NA 4KMTL 2PO6A 1DEEB 4OUUB 3MBEB 2N1KA 1RZ7H 1XF4B 2WANA 3L3KA 3LEYH 3ZDZE 4JREC 4MD4A 4QTHB 3VXSE 1YEFL 1S7UB 1W8NA 5K9JL 2ARJB 4GW5B 3QEGH 3FOMA 1NCAH 1F4WL 4KQ4H 3RGVD 3UTSA 5K59F 3RWEA 3B9DA 1G9MC 4HFWA 1A6PA 3MTRA 2Z93A 1HILA 1JF5A 2D03H 2W92A 1A2YB 1P69B 1B6DA 1D3CA 3BSZH 4MVBC 1ZLVK 1FVDA 1E4KA 4OSUH 3P0YL 3RA7H 2WK2A 5T3XH 1I8MB 2GHWB 5EFIB 1FJ1B 2HJLB 1CBVL 4K71B 5GGUA 4AQ1B 4KTDL 4ONOA 4O4YL 3ARTA 1J11A 4XCNA 1FAIL 2W59A 4Q6YA 5F97E 3S4SG 2EYSA 1J05A 2VQ1A 3IDNB 5E00B 3WJLA 2YRZA 1FJ1A 1FYTA 4YH6A 3OGCA 3OKKB 1T5WA 5KJRH 3P40A 3VXOB 5I1JL 5F1IA 4BH8A 2XWTB 4YNYB 5D7LA 3B9AA 2OLDA 5SX4I 2EC8A 3ULUF 3CUPB 3CX5K 2XFXB 1V05A 1F2XK 1JTTA 2DJ4A 2VLJA 5M95B 4KAQH 3WIIL 5C0BA 3LKOB 3KGRA 4KUCD 1L7IL 4OCWH 5E8DH 4E0RA 4KI5D 5JDJA 4YWGH 4M1CC 1YY8A 3HS0A 2HFGH 3F62A 3IDYB 5LAXB 2VXQH 5DA0B 3OJDA 4OCXL 4CJ0A 3WJJC 3E2HB 4LGSB 2X89D 3NACL 1CICA 1YPZB 4OZGF 3UJJL 4NDMB 1Q1JH 2DQTH 2IEPA 5L8KB 4DGIH 5FM5M 4K55A 1HDMA 4X5WA 1DFBH 2WQRA 1FFPB 4WEBL 3D25B 5JORA 32C2B 4N8VB 4OCRH 3T0XA 3MOBL 4U1KB 1YEDA 2ZUVA 4TQEL 3SPVB 2K9UA 2OP4L 4NO0A 3GSXB 5IWLA 3JTSB 4CW1A 1KTDB 1IGJB 1ZHKA 2N4IA 3G6JF 4Y5YB 3IS0X 2WBJB 1FFNA 5F9JB 1XF5B 3RIFK 2B0SH 1JHTB 3PP3K 3QQ3B 2JB6B 4OZHA 1KTLA 1ZXQA 4HUUA 2FWOA 4J2XA 1XZ0B 4L4VD 4L1DA 4YQXH 4N0FB 1T5WB 1A4KB 4LCYB 4L3EE 1YN7A 2JKXA 3LPGA 4PJ7E 5HYSG 1RUPH 5J6HA 4NJ9L 1DBKH 5F1KC 3OMZA 3DBXA 2EDDA 1IGFH 4ORZC 4Z7WA 2A6DB 4XHJD 4HGKC 3O4LE 2JLLA 4JZJB 4LSRH 1HH6B 5EG6C 5EA0L 3T4YA 2V2TA 1RK0B 4K7FB 3PV6B 3PGDB 2VAAB 1NMBL 1B6UA 4ZNEE 2L0DA 4LLUB 5DURD 5EBMA 3T3ME 4ZQKA 5F7YC 4LKCB 5BS0E 1E4XI 1LE5B 4O2FA 3QUMB 5AAMA 1OAQH 3WD5H 1A6WL 4CRPA 2ORBL 5FK9B 4L4VB 4FQQB 4LAQL 3T0EC 5GS1B 1G9EA 4KK9C 2AV7A 3JWDC 5C0JA 2R0WL 3NA9H 1FV1B 3MUY1 5HHPA 3GRWL 1LO5B 5DI8B 5GS3A 5H94B 4MJ6A 1I7UA 3IVKB 4TTDD 4FFYL 4UNTA 4PJGF 4R2GB 4YDLC 5I8OH 5KVDH 2ZSVA 1HINH 1FV1A 4M02A 3ROOA 3FOLB 4X4ME 3D39B 4GRMA 4AEEA 4YDIH 1IGCH 4KHTH 3RWHA 1N8ZB 4GLRI 3CX2A 5IVXA 5JMOC 4BELD 1UWXH 3K1KC 2VITA 3P9LA 3FB6A 3WFBH 1J8HD 2JF1A 4E42A 4NYLA 1RUQL 4FXLA 1I3GL 3PQYE 3OKYA 4NKQB 3RVVD 2VUYA 1YEIL 2R15A 4MVBD 43C9B 5F70A 1C08A 4K9EH 3TCLB 2VKXA 5T5FL 4Y8AA 2MCPH 2R2EA 1LNUA 3DMMA 3VWKB 1KJ3H 5B8CB 4U1LA 3BN3B 3GO1H 3ZKSD 2BVOA 1OPGH 3RGVC 1YJDL 3FB5B 1JPFA 1U93B 1HHIB 4P2QA 5IKCB 1KC5H 4OGZA 4OT1H 4M03A 2R29H 1WEJL 1Q9LA 4CAGA 1NFIB 1CFBA 5ICZB 4PJFA 4G42B 3PWNA 2NXYD 1SYSA 3LB6D 3HUJA 4LQ1A 4Y5VA 3BOVA 1J0HA 1EHLL 3EYOA 4NPYB 2H2SC 1LK3L 4PYGA 3CSYA 1OF2A 2Y4SA 3N1QC 4N0UA 5T1LA 3N9GL 3EHBD 3VWJC 3WIFB 1AR1D 4QRQB 1EEZA 5DQ9B 1QO3A 5GGSB 3RNKA 2DWEB 1HWHB 3REWB 2HRPH 4J8RB 5CS7A 5C2BL 1DUYB 1X4YA 4X9FA 3T0VA 5DJ8A 2WWMD 2A73B 3LS4H 3RGVB 4EBQH 2EE9A 3B4NA 3OKLA 1DLFL 3KYNA 1QP1A 3VFGH 3IT8D 3Q6GH 4PD4K 5I6XB 3HI1B 5EOQH 2AKRA 1X5KA 1G9NH 2C7UA 3QHZH 1MCFA 4P2QB 5AZEL 5BZWA 5BRZD 1I7ZA 3M8OH 5K9QI 5DUPL 4YO0B 4C58B 4P46B 5FOBB 3MRFA 4JM2D 3JVGC 1Z3GH 3KLSA 3ARGA 4F3FB 1AGEB 3L3OA 2XTJC 2LVCA 4K3EH 2NY0B 2YBRA 1AGDB 1HZHH 4G5ZL 1T20A 5BXFB 5BVPH 1RUKH 5CJQL 3L5JA 4OD1L 4UNUA 4IRJD 2XT1B 4E5XA 5GZND 3WIHL 1ADQA 1T21A 1UG9A 1TQBB 2OBGA 3BHBB 5IB2B 1D6EA 1ZVYA 4IOIA 4KI1A 3F7VA 3RHWK 4LSVH 2Q86A 4D8PB 2IMMA 5IW1B 4BQ8A 4R90L 4M1DL 1YN6B 4N1EA 1WZKA 1T4KA 1D6EB 3RBSA 4HF5H 3OXSB 3MV9D 2B1HL 5GIRA 4MXVE 4NN6B 5HYEA 2VLME 5D2LF 3HPJB 3QXDB 2VH5H 3MRRB 1VHPA 5KS9A 4YZFE 2OS7A 3T4AA 5B8CA 1P7KA 2VZSA 5E24E 1A6VH 1IGMH 1JNLH 3K7UA 1MRFL 1EH9A 1NCTA 1LO0L 5KS9B 1YMHB 3QFDA 3N1FC 4UT7H 2J88L 5K93A 5IMMA 2FBJH 5JHDE 2LTQB 1WBZB 4CDHA 4HIXL 3TIEA 4U7MA 3MRJA 1QSFB 5FYKE 1FCGA 2CDEA 4WTXA 4ORGB 3D2UB 1GGIL 2WIIA 2X4OB 3MV7B 5ITBL 5JMRA 4WI7A 4KRNA 4QWWC 5I71C 1G0DA 1JRHL 5C92A 1HHKA 3C2AL 1JNHA 3BYTA 3D2UA 3F7YA 5D7KD 2NTFA 4GAGH 4XVUD 1JMZA 1SMAA 1G9NC 3ARFA 1RJLA 4LVEA 1T22A 1DJSA 2Y6SD 4KKBD 2PYED 2Q6WB 4RA0C 4RAVB 4FN0A 3ARVA 3S9DB 3IDIB 3BDBA 4IRSA 3S5LB 3DPBA 1MCBA 4NM4H 1PKQA 2OTUB 3GHBH 3SGDH 3TJHC 5BVJA 3IU4L 2VRAA 4LASH 5ISZE 1XIWB 4PTUA 1IRAY 3LQAL 1VACB 2GTZA 3HRPA 4OZFH 1IM3A 1K4DA 2PXYD 3IDYC 4DVBB 3MGOA 3VXRB 1WCBA 4RX4A 3G9VA 4L8DA 5GIRB 3UPRB 4HUMB 2VNCA 1QPPA 2NZIA 3MROA 1U2CA 4Q2ZA 1NGZB 2CLRA 2JJTA 5SWSA 1QSVA 2HRLA 2VZVA 3SQOH 4DAGL 2YKLL 3F58H 4Z7WF 4MDJA 2HT3D 4AEFA 2J8HA 3LOWA 1FGVL 5D72L 2FCBA 1MCOL 4X7TA 1BWWA 1N0XH 5F21B 3ZDZF 4KJQC 4BH7A 4DUVA 1CK0L 3F7VB 1ZLSH 3VXNB 2VC2H 4MNQA 2DIBA 4MHHG 3AXLA 1PD6A 5HGHB 2DQDH 3D69B 3WDJA 4FMFA 1JGEA 2KH2B 1GZQB 5J7CC 1NCBH 4NJAH 4ZUSB 4JPVH 4OZHF 5L7XH 4CN6A 5I1IL 1RIHH 5BZDA 4J4PA 5JPMA 3DI2B 3AB0C 2XXCB 5IMOB 5DR5H 4I5BB 5I1AA 4L4JA 1JGUH 1VGEL 5I76A 3W0WA 3CLFH 3O45B 4RA3A 1UQSB 2BVOB 1PY4A 2JCCA 4NZJA 2CLRB 2DTMH 2AJXL 1OGAB 2KKQA 4G8FB 1I9IH 4P2QE 2ZCLH 1M71B 5SWZB 3TO4C 3OAYH 3DUHA 5GRWA 4IJ3B 5HYQA 3KHQA 4G8IA 4PJFE 1RFDH 3SHSA 1KBGH 4PG9A 3O81A 3HUJE 1ZT4B 3QCVH 4KUZL 3D0VA 4UV4H 3KLDA 4Y19B 1OAUH 3OKDA 1HSBA 1N5AA 4N0UB 4FQIL 4HG4J 3UROR 3WFEH 3WEXA 4X7TB 4DTGL 3DHMA 3DVIA 3NFSH 5H35B 2DLFH 4OD1H 2AEPL 3OKNB 1QSZA 4KZDL 1AH1A 1U2HA 4JR9L 4XXCA 3BVNA 4P3DB 3G9AB 2E7BA 4D0BB 3TCXA 2H8PB 5DJZA 1VFAB 5DRWA 2VDNH 4XC3H 2A1WL 3LSOA 3BD5A 5JQHC 3B6SB 4U6YA 3U7YL 4IIQB 3EFFA 4LLVA 2ESVA 1A7QL 5DQJA 3QUYB 5C0BE 4OF8A 1JN6A 5C71A 4G8IB 1KGCD 1FFOA 2A6KB 3RZCD 1A1NB 1M7XA 1T7VA 5CEZD 1P9MC 2ICWB 2CRYA 3MUHL 4YHMH 2Q8BL 5IG7B 7FABL 3QEQB 3LKPA 4HPOH 1JN6B 1UZ8A 4F7EB 4X4YA 2BRQA 1GOFA 4O00A 1CICB 1YPZA 2R0ZH 2DBLL 2HRPL 4WI3A 1YNKH 2HKHH 3PWPD 5HJ3A 4XVUC 4ELMF 4JGMA 4X99B 4XVJL 5FKAB 3WXWL 3ARRA 3O6LL 4MLIA 1UVQA 2NNAA 4BM7A 3WHXA 3STZA 2VDQH 2ZSVB 4ZO8A 5DJ2B 2GITA 4MA7L 3IGAA 4X0KA 1BJ8A 1MCQA 2X4RA 2ITCA 3WEXB 4NQCB 5DUMH 5BQ7B 4PJIE 2WQ8A 4L8BB 3OKDB 2DQEH 1KJ3L 2H32H 4HUVA 1F4YL 4PJ7A 3RVWD 4CVXB 2EDXA 3B5HA 32C2A 1Q8MA 3KWWB 2E9JA 1J1PL 3K4AA 1RU9H 3A67L 4TN9A 3NCEB 3EFFB 3CFCL 3I75A 3U82B 4G6ML 2F54A 2ZCKH 2BSTA 3GIVA 3C5SA 4I8DA 3TT1L 2APWA 4Y4HD 4I2XB 4NC1E 4AY0A 1KB9K 5H37G 4YEFA 5CGYC 1KEML 5KVDL 5I8OL 3VFNA 2E9IA 4JRWA 5D6DA 3HG1D 5I1CH 1IMHC 2YSSA 5FKAA 1UM6L 1RZJL 2R69H 4HS8H 5GRJL 4M4PA 2QLVB 3G04A 2EDRA 3X3GL 1GAFL 1VPOL 1R0AL 1KIUA 3H9ZA 1DSFL 2QHLA 4QYOA 4GAYB 1QKZH 4H5SA 1YQVH 4ZOBA 4CN1A 3EBAA 4KJPC 4YHZL 2R2BA 5D5MA 3ABZA 1Z0MA 2BSTB 2FL5A 1KPVA 1LGVA 4HJGA 1A9EB 3CCHA 4OZGB 4OD2B 3ULUE 4HUXA 1XCTB 5D1QA 5F7LB 3CFJA 3WHE0 1RV6X 4YHKL 1WF5A 2UY7A 3CVIL 1D5IH 3MCG1 5HPOA 4F80A 4ZAKB 1EJOH 2PW2A 3MZTA 4ZYKB 5D2NB 3DXAE 4HPYH 2ERJC 4NQDE 3V5DB 4M48L 3VA2C 3ZDXE 3SE3A 3U36B 4HZLA 4LK4A 3O6FB 5LGKA 3PWPE 3OKOA 3D3VA 2EC9U 3HG1E 4F7CB 2B5IB 4MD4B 4XBEH 1FE8H 4XP9H 3U1SH 1W0VB 3BRGC 3QQ9C 1UA6L 1JGEB 1I8KB 4NNXB 5JHLL 2I9LA 5F1IB 5JW3L 1IILE 3T65A 1U91B 4R4ND 5DMKB 4OM0H 3ZYIA 1O0VA 4XTRD 5T3ZD 1B88A 1BVKB 1J0YA 1TIUA 2IALA 4LF3B 1NCWL 3D39A 3OB8A 2F53A 1U8JA 3QNZB 4DZ8B 1LEIA 1YPZF 1HXMB 2R0LH 5DK0A 5JA9A 3C87A 4MJ4A 5DVNA 3PP4H 5DD1H 4JQIL 3L9RB 1EAPA 2CSPA 1XGQB 1T7ZA 1DFBL 4Y2OA 4E41A 2YRLA 3MCKA 4N0RA 4NIKB 2YPLD 3KR3L 4Z5RA 5SWQB 3AUVA 3FO1B 3HMXA 1S78C 3T77A 1F4XH 2IAMA 3OKOB 4BK4A 2OX5A 3AY4C 4HGWB 4OI8A 2R2EB 4L9LC 1BZ7A 3UTSE 1WBXA 3BP4A 3MV9A 4X5XA 1L7IH 2OR9H 3OR6A 3CSPA 3KXFE 3TWCH 4AT6A 4DN3L 2R4SH 5IBTH 4NYLB 4C4KT 4Y1AB 3DGGA 1V3KA 1OP9A 1XCTA 5ESQA 5EO0B 3P4MB 4PJCF 4JVPA 4MWFA 3UTTE 1JI2A 4M1CD 4N90E 2NY1D 1N4XH 1MI5E 1ZMYA 2FJGA 3ULUD 3O6KH 1RY7B 2JB5L 4XB7A 2HVJB 2J1KA 3BPLC 1DQLL 1MEXH 4JZNB 1IGJA 3RNKB 2ICWI 4X6DA 3MJGX 3BH8B 1JP5A 5DUBA 3CDYA 4OLWL 4Q0XL 1JHTA 4OQTL 1KOAA 1A1MA 2IAMD 2AJYL 1IEAB 4PLKD 1RIVL 1S7SA 1FFOB 1WWBX 4OI7A 1IQWH 4LLUA 4XPFH 3BX7C 1N64H 2YA1A 1MH5B 1I1RA 5EWIH 3QDJD 3AREA 4HWBH 1AXSA 1S7VB 4OGXL 3RL1A 2QV2A 1ZTXL 4MB4A 5HYSB 4O58H 4RFNC 1MWAH 4LPYA 4NKMB 3U0WH 4N9GA 1K3ZA 4P46A 1R5WB 5FOBA 1A02N 2IH1A 3TVMC 2X5PA 1KBGL 1EJ6A 1IEHA 2YD5A 3D87B 3MLWH 4KRLB 2P8PB 1BZ7B 1DQQA 4GBXC 3QIUD 3IDUA 4R2GC 3MCLH 1XGYH 1EEQA 3FO9B 3WLWC 3U0PA 4Z8FH 4PB0L 4WUUB 1KT2B 4X7SH 5D71L 4ELKB 1T04B 4PP1D 2Q86B 4D8PA 3P4OB 3BH9B 5AG8A 4GO6B 3VD7A 5C08A 3D69A 1FNEB 5CJXC 5DUBB 1WGOA 5INDB 4KQ3L 3H7LA 3GSWA 3WBDA 1A14L 4NQCE 1S7XB 2CLVA 3PGCB 4L4TD 3VJ6B 1GGTA 1TNMA 3GMQB 3FO0H 5BO1H 4LVOB 3A6CL 3DROB 1L7TH 3CH1A 3OAZH 1F3DJ 1NCBL 2VQ1B 3ROLA 4HKJA 3VGEA 1WAAE 2PF6A 1D9KB 4MNGE 3EDFA 4LSQL 4GAJL 3BW9A 4OLYL 4Z7WE 4M62L 1U8OA 1KTRL 4PJDB 3NH7H 4ISVA 4OZGE 4QRRE 1T5XA 3BP4B 4PRPA 4OFPA 1MH5A 2V2XA 3D18A 1A7NL 2CJUL 1AXSB 1S7VA 2NX5E 3ZKNC 3B2UC 2M8XA 3RI5K 1NCDH 3QIBA 5C08D 5ICYB 2LVEA 4LDEB 2JTDA 5CLTA 3HTLX 3QEHB 4FG6D 2BOCB 5GGQL 1EVUA 4LLWA 1CGUA 3MR9B 1KN2L 2FHBA 1KJVA 3CGTA 1UXWB 2VLKD 3DX7B 4X83A 4B53A 3BHBA 1LK2B 3ARZA 3SDCD 2VZ1A 3JTTB 1WT5A 2IANE 5EIIA 5D2LE 2DBLH 1U8PA 4JFZH 2WBKA 4AL8H 2OR8A 1DZBA 2UVEA 3K8KA 1QFWI 4YHML 1EO7A 1J5OL 3FHAA 5DD0H 2VDOH 4R96B 1MJ7H 4V2BA 3T65B 4X7EC 3P9MA 4TNVF 5HI5C 4UILH 1CDHA 2WBJA 2X42A 5IVXE 3QPQD 4I3GA 4YDKL 1RK1B 4X6CB 3IJHA 2C1PA 1XGRA 3S36L 1INQA 2AVGA 1VFMA 3U36A 4R9HA 5IG7A 1P6FA 2I07A 4L4VE 3BZ4B 3SDYH 4X80H 5IT2L 4LVNB 4JREB 3QWOA 2FBJL 2ZOLA 1QG3A 2W0PA 3GMMB 1EEUA 3VXTB 4WI6A 3MJ8A 3MLYL 1RJYB 4ODHH 4H0HB 1YC7A 4R0LA 4F7PA 1Q9OA 1H9VA 3AGVA 1DCLA 4S1DD 4OFYA 3OAYK 1GSMA 3BN9C 4WCYH 1OAUL 5ANMA 4I2XE 3NZ8B 4HX1A 3GSWB 3D39E 1G84A 4AK1A 4EXPX 4HBCH 1G7PB 4J3OC 5IF0B 4D9QE 4S1DC 1NFDB 3KPSB 1YMMD 5C0CB 4N0FA 3ZDXF 4QRTB 5IB4A 3QPXL 3R06B 1KJ2B 3SJVE 2ZCLL 3ARDA 2QQKL 2BNRA 3BEWB 3KPQA 3BWAB 1YDPA 4BUHA 2HG5A 2I9TB 3MV01 1U8HA 2AJXH 2WLYA 4Y4KA 3NIGE 3QQ4B 2F9BT 5I18L 4U0RC 3FT4B 5D96C 1MCKA 1TZHA 1ZT1B 3C6SA 4LLQB 2ZCHL 2FJFA 1NFDF 4JZJC 4OFVA 4DVRL 2L7JA 5JW4R 1RJYA 4MS8D 4LRIA 4U7KA 2DM2A 4CMHC 5E7FA 1UWGH 1IGTB 1G7QB 3O9WA 5C9JA 5HVWA 4JFOB 4GG6E 1MFDL 4FQ1H 4PBWD 3SKNA 2DQDL 3SGEH 1W72H 4WNQB 3UTTA 3QO0B 5D1ZD 4Y89A 2CK0L 2VC2L 3QIUA 5GRXG 3ZKMC 3EYVA 5D2NC 3WKNA 2D0FA 3ZO0A 3IXAA 5GS1C 3T0EB 3UO1L 4C54A 3VFVA 2JJVA 1VADB 1U58A 3FFCE 3PHQA 1TVBA 2NR6C 4AEIH 3CC5B 4UTAH 3B2VL 5CINL 1AGBB 5DJZB 4OD3L 3X3FH 4BH8B 3CZFB 3T3MF 1Z9MA 3BQUC 5C70A 5DHVB 4Y4HA 1U58B 3ORJA 4AG4L 1T2XA 3BVNB 1BQLL 4PJXF 4ONHA 1JPTH 4XWGL 3W11D 1EHAA 2YD9A 3PGFH 4K23L 1AGCB 3TPUB 3T1FB 5D93C 1NAMB 3CFEA 4M3KB 1JHLL 1MJUH 1S9VB 2A6JB 2I5YH 2LU7A 3WFHB 1NGXB 1DDHA 5TQ2L 5KVGH 3GGWA 4I4WB 4IRZH 2H26B 1OAKL 1AXTL 1WCBB 3HMWL 2JE8A 2EECA 1G6RL 2NXZB 1UCBL 5KVFH 1BVZA 4DWHA 1FDLH 5BVJB 1JYWA 4CBPA 2XA8L 3MRPB 5E08L 2F54E 1T0NA 2FB4L 3SGKC 1I85C 1GGBH 4G80A 5C0RH 4XH2B 2WLZA 5T1MA 2D31B 2ITCB 1MQKL 1Q72L 4NQCA 5FKPB 3RQ3A 3GNMH 3VGDA 2GUOB 5F96H 3ARFB 1N5YH 1MHHB 4GRWH 4PP2B 4HZAA 5D1XD 2ZNXA 5D2LB 3V4VH 4XMPH 1LP9A 3IFNL 4RWHA 3QZWB 1M7IA 1FGNL 4WFEE 3VWJB 4DGYH 3BISA 3E6HB 3DV6A 4S1RL 4TULH 1O7VA 1IGCL 4G6AC 4QOKE 1ZV5A 1T2JA 1OGTA 1IEBA 3FQNA 4Y4FA 3TN0B 3MLUL 1T21B 4QRPB 3WFDH 3DECA 3MLZH 3ARQA 1QBLH 2GT9B 4KROD 3ZTJH 2A6KA 2G5BB 3C8KA 1M71A 2NX5B 5JQ6H 5HPMB 3K74B 2ZKHH 2BRRL 4C56A 4XPHL 3QISA 4X9IA 3EO0A 4ZO6A 2MWCA 2XZAH 3QULB 2ZPKH 5FUZL 1H3TA 2GJJA 2O61B 3U30B 4P23A 2V7NB 4MA1C 2Z8WC 3LHPH 5DT1H 4PB9L 4XP1L 1KPRB 1T83A 4H1LB 1OW0A 4JKPL 4NQDA 5F1NA 1WFOA 5D2LA 3ZE1F 3SBWC 4QHUA 2F74A 3D3VE 4WWKC 3H3PL 1A7RH 3CZFA 4P59L 3EOTL 1KN4L 2N56A 3WSQL 2D31A 3BT2H 4UZGA 2CDGA 4EOWH 2QQNL 4TSBH 4P99A 1II4E 4C57C 1DBKL 5D7LD 3L7EA 4LEXH 5DUPH 1U91A 5DMKA 4J7RA 4LHUA 2DQCL 1HKLL 3E8UL 3NIDF 4PJAF 3ES6A 1YY9C 4MSWA 4XCEA 4P3CH 4JAMB 3BEVB 4ZOCA 3O4LD 4RGNC 4I3SL 5FYJL 4Y4KC 3FOMB 5IBTL 4LPXA 4PJ9D 1N6QL 4ZFZB 2W91A 3LKNB 4WU5B 5HHQA 4M5ZH 4G9FB 4PJ5D 3C60B 4BSJA 4N1HB 1JK8B 1BJ1J 1AIFB 4FTVB 1WICA 1XR9A 1EHLH 1A9EA 1CXFA 3O9WC 5TDNA 1FH5L 3HZMB 1FZMA 4JO3H 4WEMB 1BOGB 3ARXA 4MMZC 4GOSA 3KXFA 5F9WB 3T09A 1RJCA 1KJ2A 4XAWH 4ZFOL 2R29L 1U8NA 3W9EB 4KUCF 4LHUB 4PG2A 2FJHA 5GRVK 2KZ1B 3HCVB 4KGLA 3L3IB 2BC4B 5C0ND 1PEZA 4L8BA 4GRLD 2B1AL 4OGYH 4MDJB 3FQXB 4OM0L 4Y16A 4P2RA 4XMKH 4JHZA 5JW4Q 5IW3A 1J87A 2YPKB 1H8SA 5CHNA 3MRGB 4XBEL 1JPGB 1PVHA 3MXWL 2C3VB 4HC1H 1XIWA 2FR4B 2EDBA 4L3AA 4GG6A 2VXSL 4KHTL 3WDHA 3UJTH 3LKSB 4KK8D 4GW4B 4XCCH 3WYRA 1YZZA 3MNZA 4DEPC 4HK3J 3IKCA 2QKIB 4M7JL 4OIAA 1H0DB 3EYFB 3S36X 3RNQB 5HDQH 2B2XH 3PDGA 3AMLA 4LARH 3IETB 3I2CL 3W2DH 2J6EL 5E6YA 4Y5XB 1S5HA 4L4TA 3U9PL 1QFUH 3ARBD 1A3RH 1CFQB 3OXRA 1XF3A 3G6JA 1TQCC 4M8VA 4LAQH 4PGBA 2X70B 3O4LB 1RZGA 4HXAH 5C08E 1AJ7H 2ZP0T 5EC1A 2VLLB 3WD5L 2D9QB 1Q38A 3RUGA 1C12A 1NKRA 1RZJC 5EO0A 1ZT4A 4HJ0C 5I75B 3THMH 2NY2C 1JGLL 1S9WB 3RU8H 5EDXA 2RAMA 1UWEH 1FZJB 1MNUH 1MHPH 1GRWA 5E94A 4I9WE 1CGXA 3C5JA 4AEHL 2EYRA 5TDOB 1WISA 1NAKH 1K8IA 1YEJL 2R23B 1FRGH 1JWUA 4HGWA 1OGAA 3QI9B 1XGPA 4YBQC 1VDGA 5ENWB 4QTHA 2IQ9L 5L88H 4U1JB 4N0YL 4RIRB 4PJHF 4YEEA 2ZCKL 3SGKA 1A1MB 4GQ9H 4XBGB 1CFNA 1AHWC 3PHSA 4D9QD 4ZFOA 4HEME 1T7WA 4OZGA 1UC6A 1WJ3A 2FEEI 2EC9T 5BV7B 3WCYA 2NX5A 3THML 1UM4L 1F13A 4WGVB 1PAMA 1YUHA 2DOCA 2DYPA 5FYLH 15C8H 2BOBB 5ALCL 4Z18A 4H1LG 1CE1H 1S7XA 3BGAA 2WNGA 1UCTA 5C6TH 1G7LB 1F45A 1H3XA 1TNNA 5CP7A 1MIEL 1AI1L 5A3IC 5IGXL 5CJOH 1UXWA 1IAOA 5I1HL 2G60L 3U9PH 1YDPB 1KCRL 3I2CH 1NQBA 1JE6A 2EIEA 3QHFL 2B2XL 2IANA 5SV3A 3B8SA 5TFSL 4ONFL 1WFUA 3NACH 4OCMC 1BQHA 2F5AH 4H0IA 5FGBA 3C09C 1NLDL 3NFPB 1H3VA 3ARBB 4NSKB 5DD5H 2CKNA 5IB3B 1CYGA 1UJTA 2XPGA 4PJIB 4XBGA 2X4SB 4ZYKA 5MEOB 1OM3H 3O2VH 4NKMA 3QULA 5DF0A 4UQ3A 2CDFA 2O61A 4X6BA 2VLKA 4MJ2A 5H2BB 25C8H 3OV6A 4NZTL 3CK0H 3KJ6L 3QFJA 1UZ8B 2YD2A 4JM2A 4X98B 5DK0B 1K3IA 4X9HA 4RWYH 4PFEA 3DIFB 4P5KA 5JXEA 4XPGH 1A7QH 3RGVA 1G7IB 4PV8A 3QI9A 5D7SL 3TO2B 3VE0A 1A9BA 1OM3L 4O4YH 1TZIA 2ZUYA 1FNSH 4MB3A 5L8LB 4NRXA 4PYHA 1E6JL 4RRPG 4XPBH 5DD5L 3U6RB 3GKZA 4Y5VB 5T3XL 1D5MB 1MLBA 4BZ2L 4WTZG 3QNYB 2AEPH 4P48A 3UBXA 5EZLA 2D0GA 3QHFH 4Z7QE 1H5BC 1JPSH 1LO5A 5DI8A 5H94A 2G9HB 4RFEB 3P3YA 2XZQH 3X11A 2BNRE 1CR9H 3UAJC 1YEFH 2A77H 4NM8L 4DCQB 2GK0A 4WDIA 4OB5L 3CSBA 5HHNB 1R3KB 1BF2A 1B90A 4DGVL 4F57L 1TJHL 2J7LA 1FL3B 5KZCD 3GBMH 2VTFA 3MRGA 5SWZA 4XVSH 1RVFL 4FTVE 2OXGA 5TJWK 5J4MA 5KVEL 2AW2A 3D5OF 3BP7A 1GVIA 3EJZC 4WW2F 1AFVL 5D2NE 5TQ0L 1D5ZA 4PG2C 1JGUL 5JW4M 3BGFC 3QDGB 3VFMB 3WV0A 2VOTA 3BIAX 3L7FA 2PO6B 1RZKC 1WC7B 1D6VL 3AS0A 3MRLA 4MA1B 5J9PA 1PZUB 1HK6A 4AIZA 3O3BB 4NN6C 2ILLA 3LEVL 1PQZB 2BVPA 4KPHH 3U83A 1JF1B 2VABA 4NGHL 4P59H 5DSCB 4AZ8A 1MFCH 2APBA 1A6UL 4EI6B 4LSUL 3H9SE 3OKEB 4NN7C 5HHVL 5DFVD 5E2JA 3DSFH 1KPUB 4JRXB 2CKBL 4LSSH 3HNTL 4JKPH 4CU6A 2UZXB 3CC5A 2Q20A 2R2HA 3V6FA 3RWDA 3QAZC 3V6BR 4NRXB 2DICA 1I9JH 4QTIH 1N0XL 1FYHB 4OCSL 3ZTJG 3IAPA 4LCWD 3K1DA 4WVRA 4AMKL 1U36A 1EIBA 5IHBA 4PGDB 3T0BA 2RFXA 3MLXH 4JFOA 4PS4L 1HHHB 3MNZB 2C7UB 2V17H 2ZUSA 5AZ2L 4ODXB 4WHCA 4KKBC 1CLZH 1I75A 5B38A 4ZAKC 4NKIL 2BZDA 1I9RL 5DEFA 3WFDL 3I9GL 1BM3H 5C0DB 1JV5A 4B5EA 4R3SB 4X7FC 4RDQG 1JZ8A 3U4BL 4E9LA 4NM4L 4W4OA 2OZ4A 1Y6KR 4TULL 5EUKB 4Q9CA 5HXMA 3LQMA 5B3JE 3KPPA 1FGNH 3UJIH 4IMKC 1FPTH 1C5CL 5JLZB 3OKLB 3GK8H 2ZUQC 1SYVB 3QDAA 3BUYB 5JIKA 4OZHB 4H1LH 5EBWA 1E4WH 4YUEL 4ESKA 3EHBC 3VWJD 3REWA 4WWID 1AQDA 1YNTA 2BVUA 2B1AH 5K9KB 3NIGF 3PJSB 4TVPD 2YK1L 4NT6B 4L3EA 3DOSA 5GSVB 1LE9A 1CLCA 1T1WB 3KPTA 1LWRA 3LRHA 4YXHH 5J3HD 2Z91A 1CI5A 4QXGL 4U6XA 1F5WA 1UCBH 2XKNA 1WAAA 4ZFZA 3ET9F 5IHZB 4MNGA 1KXVC 3UBXG 4G8FA 1AXTH 1GPOL 2GFBA 1A1OA 4XNZC 4IRZL 2MQ3A 2BOCA 5FUCC 5IUSA 4PTUB 2RFXB 1MJUL 5F7KC 4LLMB 1EEYB 3DGCR 2GY5A 4OM1L 1BM3L 3BDXA 5HVFB 2YUXA 4NKIH 2NY5L 1BQLH 3EYUH 1PX4A 3IXTA 4NZUL 4AG4H 3CFKB 1ZHNB 4ODWB 2VWEE 2X6MA 4YHLH 3BXNA 1CF8L 4I3SH 3SKMB 1F3JB 1I4FB 2YUWA 4JFHD 2PR4L 5MP6H 3MLXL 4PS4H 3NN8B 2HA1A 4GSDL 3L3GA 4HS6B 5D96B 1DUZA 2P4AB 2UYLA 3AS3A 4LEXL 3FOLA 1JPFB 1FZKA 1FIEA 5I8EA 2ZUTA 4TSBL 3L3GB 4RGOH 2QQNH 1W72L 3MLRL 1YEKH 2W65A 3HAEH 3WSQH 5KSBF 3TJEH 5CAYB 4LSUH 3H3PH 1EGJH 1NANI 1W2KT 2AXGB 4G6KH 4MX7A 1QHPA 4NQEA 1BFOB 4YAQB 4AJ0A 5EBGA 1OHQA 1VGKB 1FL6A 4AYFA 4RGOL 4POZD 4WUUD 3BAEH 1M4KA 3RPKA 5IK3A 3QG7H 4LGRB 5EUOB 2M26A 3N85L 3QIUB 1CVRA 3M8OL 2I9TA 4OLZH 1CDIA 1WT5C 1G9NL 4XPHH 3VGAB 1EV2E 4GSDH 5FA3A 2VSCA 2ZKHL 1XMWA 4M9OA 4PJBE 5EU5B 5F6HJ 5FYJD 2OXHA 4EBQL 3IU3A 1YNLL 2VZOA 5I1KL 4J4PC 3NZ8A 1UH2A 1FZKB 2WWKO 5F7EH 3WLBA 3MLUH 3PGCA 2P24B 4IOFC 1LVEA 4Q9RH 3HNVL 2Q7YA 5KSVA 3CFIC 4QRQA 2I26N 5D8JH 1BEYL 2FJHB 5DHYB 3Q5OA 4XXCC 5C0CD 3T1WA 3KPSD 1JVKA 2DQFA 2W9EL 1QSED 1I1FA 2NTSP 3IAGC 5AAWA 1EMTL 2VLRE 5D7JA 5E0QA 1NLBH 1WBYB 4QHNA 2OI9C 3VD5A 4WEUD 5T5NF 1WTGT 3Q6FA 2NY1B 1P6AB 2E8YA 4EI5A 5SWZE 1LQSR 1JWSB 3NCMA 3RAJH 1JPGA 1X7QB 4QRUB 4X6FA 5C0AB 5IIEB 4DEPB 4IDJH 5ADPH 1NC2B 3O0RL 4TOYL 4RMUA 5E8PB 2JK5B 1OP3K 5ILTL 4U0RB 1TQBC 2I60H 2C4FU 3IJYB 5DJ8B 4HKBB 2Q8AL 1JGVH 1DANT 1CLYL 3V6ZA 3HMXH 1DVFA 4P57B 2OI9B 3KDMA 3OGCB 3OKKA 1G6RA 4U49A 4YDIL 5E6ZA 3AFLA 5CKAA 5FV2A 1LO3H 3OL2A 5DHVA 1K8DB 4QHLA 2QR0B 2NY3D 1KCLA 2FYYB 1FO0A 4FTVD 4LU5L 1MJJB 1FFRA 4FFYH 3K80A 4ALAH 1Z2KA 4JO1L 5CBEA 2HP4A 1JBJA 2FEDC 4ZO9A 4U1SA 3VGBA 4MJIE 1NUFA 5I1HH 4HFUH 5FKPA 5IMKA 3AVEA 1A7NH 2CJUH 1WQVT 3SO3C 5CJOL 1B2WL 4O02L 3ULSB 2I07B 4HV8A 4I77L 3NH7L 4HAGA 1P5VA 4R3SA 5FHBH 1FYTE 3GKWL 1UJ3A 3WO3B 2R4RL 2CK0H 3BWUC 5FYLL 4O5LH 4M6OH 3GMMA 3BQUB 1K8IB 4W4OC 5D7LE 4GKNB 1NJ9B 3MO1B 1OAZH 2GT9A 3MGTB 4UDUB 5I74C 2BY1A 5IJKA 5BO1L 2IMNA 4UBDC 3GUTB 4KI5F 2W9DH 1BFVH 1FC2D 4KPHL 4QRPA 3TYGL 2VLJE 3BQUA 3VXMD 5SX5K 4PJ8C 4W68A 5JHDA 1KLUA 2JJUA 4PJ7F 3FQTA 3OB0K 1WZ1H 4GQPH 2IQAA 5CUSL 2AI0H 3WS6A 2PTUA 3EOBB 1KLFA 4NZRH 2FX9H 1CD0A 5C8JB 3VG9C 4JHWH 4HKBA 4M6ML 5MENA 3BJ91 4NKDA 2ADJA 2J8OA 1LP9B 4RGMC 2VL5B 3MZGB 2DQJL 2Z92A 3L3DA 3RU8L 3VXQA 2HT4D 1XGYL 3PXJA 1KPRA 4MAYA 1I8LC 3RY6A 4QHLB 2AQ2A 5FM4A 3Q1SL 3P11L 3MLWL 4Z7VF 4F9PA 4P5TD 3DV4B 3V52L 1DEDA 5D5MF 3BE1H 3HG1B 1MAJA 3WO4B 4PJEB 1TCRB 4N0CD 3U0WL 4OGAD 1M6OB 4NBYB 4P0DA 3HNSL 2ED9A 4CNIB 2YPLA 5GISL 4HWBL 4BYHA 2OR7A 3W2DL 4HMEA 5E2WL 1ZHBB 2XN9D 1GOGA 4ZSOE 5HDQL 1CWVA 4PV9A 3DURB 5I1EH 4HIJB 5E8NA 1Y6NR 1X5JA 4KK6C 4Q0XH 2EEBA 1MCHA 1NGXA 4M4RA 4P4RA 4YZFF 4NC2B 3TH3T 2Z8VC 1ULVA 1ZGLB 1WV7T 1BZ9A 1VKXB 5E03A 1DN0A 1F11A 5EBLB 2X70A 5IR1A 5J89A 2JB5H 3VMNA 3SCMD 1BQHB 4P5MB 1N4XL 2ICEB 1I1CA 3LRSA 3MRDB 1MJ7L 2VDOL 3QQ3A 2W0KA 3QWQB 4JFPB 2RQ8A 1V7NH 1FZMB 3QXAA 1NEZA 3FO2A 5LGJB 4IDLA 1S7QA 3UCRA 5C0FB 3HC4H 1BREA <