2H2SD

Crystal structure of e148a mutant of clc-ec1 in secn-
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
211
structure length
211
Chain Sequence
b'DIVLTQSPAIMSAAPGDKVTMTCSASSSVSYIHWYQQKSGTSPKRWIYDTSKLTSGVPVRFSGSGSGTSYSLTINTMEAEDAATYYCQQWSSHPQTFGGGTKLEILRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Uncoupling of a CLC Cl(-)/H(+) Exchange Transporter by Polyatomic Anions
pubmed doi rcsb
molecule keywords CLC Cl transporter
source organism Escherichia coli
molecule tags Ion transport
total genus 48
structure length 211
sequence length 211
chains with identical sequence F
ec nomenclature
pdb deposition date 2006-05-19
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2h2sD02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2h2sD01
3BO8A 4LLQA 4QXTB 3L3JB 5KSBB 1MRCL 3CFBA 3S6CA 5DJCA 3FQXB 3ARFA 1X5LA 1LO0L 2W1NA 4JR9L 4KK9C 4NFCA 4JY5H 1A3LL 1IKNC 3U7AA 3H0TB 4HKZA 1MCKA 2K3TA 5CILH 5GGSB 4PB9H 5IHLB 1GJIA 1ZHKA 4PBXA 3NIFF 1G7LB 3O9WA 3ULUF 1FLTX 1I85A 5KVEH 5HHNB 1GGUA 5IMKA 3W0WB 1CGTA 4NUJB 3WXVH 4H5SB 2BCKA 1UVQB 5DA0B 2BP3A 4LQFH 3KXFE 4G42A 4PY7B 2CK0H 4YJZL 3C60C 2RGSA 2EDQA 1RIVL 3WO4B 1NL0L 3T77A 4ZPVA 3BEWB 5FDWA 3B9KD 1GOFA 4LRNH 4QRSA 4U6XA 3UC0L 4LPVA 2LAGB 3OAYK 4W70A 5F7EH 4PRAB 1S9KC 4WU5B 4L4TB 3KPMB 3T0EE 1UACH 1JWUB 1ZHBB 5DXWA 1LEGB 4JM2B 4HMEA 5CD3A 4G6JH 3NPZB 3S4SB 1DQDL 2VR5A 3R8BB 1A7QH 5DVLA 4LCIL 4N8VG 3O8XD 2RCSH 3NCJH 1ZLVK 2FL5A 1JTOA 2HH0L 5TDOA 5D7KE 4Q9CA 5DD6B 3K1KC 1J10A 4LIQE 2EEBA 1OGAD 1ZT4A 2UZXB 4JQIH 3U6RB 4RGOL 4NBZB 4Z7QE 4POZD 2F54D 4QOKE 3I3DA 1MWAA 1RZKH 2VDQH 3ZTNL 4U1MB 4XP9L 1TCMA 3B83A 4Z7VF 1NCBH 5K93A 4JM2C 5LXGH 4ODXB 3PWPA 2H1PH 5DLML 5JHLH 5KS9A 1KTLA 1MWAH 2HJFB 3R4DA 1N4XH 1SJHA 5FO9B 3KAAA 3RGVD 5FFLA 4ONHB 3FKUS 4LU5H 4K94H 3LKRB 3L5XL 5EO1A 3FZUD 2C1OB 2NY5H 4LCUA 1KJMB 4PV9A 3EYVA 3HNVL 5FA4B 1H3UA 3GKZA 1P53A 2X1QA 5DVNA 1N6UA 5EU6A 1C08B 1UH3A 1PY9A 2LU7A 2F5BL 3RGHA 5A3IC 4PG9A 1A4JB 2EO9A 1JNHA 3K8LA 5C0IA 1XF1A 5CINL 4X7SL 4YGAB 3SJVD 4U1NA 3C5JB 3LQAL 4IS6B 5B3JE 1JZ8A 2W91A 3SY0A 4L3CA 5DJ6B 4O9HL 3F8UB 3IF1A 5HGDB 1HHHA 4GSDH 3ZKSD 4DOHB 4PLJD 1QBBA 2DQHH 1BEYL 3SQOL 5E7FA 4XHJC 1YYLL 1F90L 4CVUA 2CRIA 5BQ7A 1QR4A 2VXTH 1PKQE 5MHSE 4K9EH 2WK2A 3O8XC 4P23D 2AK4A 4TNVF 5ESVA 4EN3A 5GGQL 3OGCA 3RVTC 3VH8G 4BFIA 1SJEA 4PR5A 1RHFA 2HMID 3ULUL 2JJVA 1TZHB 2VXQL 1A6WL 5D71L 4GG6E 1TPXB 3DNKA 4U2YA 1MIMH 5ICZA 1H8NA 4ODSL 2APVA 3HZMB 2LABA 4ENED 3G5YA 3QEUB 1NGXA 4J3OC 5IEHA 4HLZH 2V2WB 4NO3A 1FSKB 1V3KA 1MCPL 1T80A 4NQCA 3VMPA 1D9KA 4JAMA 2MWCA 2ZWLT 3HPLB 5IQ7L 4KTDH 1U2HA 4LFHG 4FQHA 4IDJH 3O11B 4FTVA 4H25B 1DANT 1K8IA 4RZCA 4J6RH 2XZCH 1BFOB 2A6KB 3R0NA 4H0IA 4QRPB 3SGJA 1OHQA 4IIQA 4K3DL 2P8PA 4KQ4H 1LVEA 4DN4H 2XN9E 1F4WH 2EYSA 2W0KA 1IRAY 1TPXC 4U6TA 3S34L 3HFML 3QWRD 4IMKA 5GGVY 4BK4A 5IB1B 3QWQB 5C86A 5DEGA 5KAQF 1IGCL 5H94A 4NQEB 1MHPL 5C0RH 5HI4C 4OQTA 2YD3A 3MUJA 4HKXB 3TVMD 1LWRA 3X12A 2M2DA 5K9JH 1GOGA 3B9AA 4TN9A 4M7KH 1CD1A 5FKAB 2BOCB 5GISH 1JI1A 4HZLB 5C6WH 2GITA 1IGTA 4OQTH 1EH9A 1G0XA 5I30H 4C56A 4KHXH 5DJZB 4UT7H 5JPNB 2C3VA 3ARPA 3JUZA 1K4CA 4GAFB 2C3HA 1ZSDB 3GSWA 4F3FA 5I75B 2EDEA 2CKBL 4FFVC 1D5ZA 2CMRH 4X5XB 4OBRA 2DYPA 5E4EB 1JVKA 3RDTD 3TN0A 5AUMB 5I1IH 4KQ3L 1U8MB 5E8DL 4R26L 3CZFB 4UILL 3MRNB 3T2OA 4IOIB 4XNXL 1QKZL 2DF3A 3GJFB 3PJSA 5J6GB 1QFHA 5J9PA 1U92B 4ZTPH 12E8H 2FJGA 2VAAA 4UTBL 2YC1A 2HVKA 5F89B 3VCLA 2HT2D 4YFLF 3F6LA 5GRJH 4DCQB 2A74A 3QRGH 4U3HA 3UBXG 5I75C 2O5YH 1CLOH 3T0DA 5T1DL 4JHAH 1CICB 1U8QA 1XF5A 5E4EC 4TPRL 2V5SA 5IVXF 5DK2A 5JR1L 4TSAL 1NBVH 5DZNA 3HZKB 2XNAA 4D9LL 1EHAA 2NW3B 4GRWF 4UBDD 1VSCA 5SV3A 1Q1JH 4KTEH 4PGJA 3EO9L 3V0AC 2E8YA 4YHMH 4P9HL 3SDDB 2R8SL 2ATPB 2I07A 4JPVH 1A1OA 3GSUB 1F42A 2V9RA 1ZLUK 2B4CH 5TE7L 3RIFF 1I9JH 1QFOA 5F93C 2A6IB 3FFCD 2GK0A 4MWFA 1R3HA 4H8WL 5J3HD 4L3EB 1CICC 4JO3H 5DUMH 3CFDB 1HINL 2VZTA 3FOMA 3A6OA 2BVQB 5ETUA 2NY3B 3QEHB 1WTLA 2Z0BA 2BSSA 3UP1A 4D0DB 1FL5B 1XZ0A 3U0TB 4NWUH 1BF2A 3HC0A 4FQIH 2GJ6D 3UTTA 1MEXH 1T89A 3AXLA 3FO9A 4ZO9A 4HIXL 2C4FU 3RTQD 4O02L 4U1SA 3SDDC 5J6HA 5KSVA 2FIRT 3EYSL 4YZFE 2FB4L 3U4AA 1TVHB 4TVPE 3JVGA 1T7WA 3MLVL 5K59F 4L1DA 4D94A 3P73A 5A2IH 4PJFA 4QWWC 2VUYA 4LVNB 1M6OA 2EKSA 5FYJL 2YOCA 3CPLA 2V2TB 4RAHA 3MFFA 1AGEA 3ZSTA 5LGJA 1BZ9A 2GCYA 3BKYH 4UV4H 4DJMA 3L5WA 1EEZB 1XGYH 4J3TA 1AE6H 1MLBA 1S9XA 4KKLD 2IQ9L 1RZIA 2DL9A 1U93A 3CAFA 2XPGB 3WS6A 1BFTA 3JWOH 3QULB 1C12A 4JY4A 4XCEB 4DGIH 3SDXF 5B38B 4OUOA 4KK8C 1MCSA 1I9EA 2FEEI 2DQTH 1MOEA 1NDGB 1PZ5A 1FVDA 2IALA 4LVNC 4FS0A 2PCPA 1A14H 1B4JL 3VFRA 3RNQA 1SEQL 1LP9F 3VWKD 4WFEE 1QR1A 1NGQL 1S7RB 3BKCL 4KZEL 4QYOB 4O2EA 2DBJA 2HJLB 1NDMA 1ZV5A 2E7LA 2XKNB 1MVFA 3GNMH 4GLRI 5E5MA 1I7RB 1A2YB 2D7TL 4NKDA 5I1DA 1K2DA 3KPSE 3MRLB 5L7XH 4CVXA 5I18L 5FO8A 4BH7A 4MNQE 3WCYA 4RDQF 3RTQC 4J2XA 1FAIL 3V95A 3X13A 5I1AB 1AD9A 1KEML 4Z78B 5FGCB 5IOPA 3RWCA 1CL7H 4HMCA 5DD1H 3ZYOA 3BP6A 3ZDYF 3MRIB 2PR4H 5HVGB 3BKJL 3MMEA 3WBDA 4I9WE 4OZHA 1JGUL 1RV6X 5C71A 2AW2A 3RVVC 3AM8A 1RZJC 5IT2L 4XPGL 5TH2B 2E6QA 1KG0A 2ENYA 1QSFE 4NJ9H 3HNSH 1MFBH 5EUOB 4ELKB 3SOBH 3PV6A 3QA3A 2FEEL 4E5XA 4CU7A 1ZWIA 4AL8H 4ZSOB 4OCXL 1UJTA 5IESL 3UYRH 3K2MC 1IE5A 1JUFB 4ZUUA 3QO1A 3NTCL 1F00I 4C58B 4TOYH 2KUTA 1SJVA 2UZIH 1WIPA 3UTSE 2YRZA 1C5DB 5H8DA 1CE1L 2BX5A 3QXAA 1BAFL 3BX7C 1OWWA 3M07A 3NABH 1NUGA 1AKJA 1VFAA 4K8RC 4OLXL 3SE4C 3OKMA 3SKMA 4M1CD 5ADPH 4QCIB 4M6NL 4MD4B 4M6MH 3T65B 4MCZA 1NBYB 2AXHA 3VWKC 1QSZA 3DI3B 3QCTL 3GSNA 4PGDB 5IW1B 5C08B 4D2NA 3BUTA 4TSCL 1ZT7A 3C9NA 4ZUSB 4WWID 4N90D 1DBMH 5MEND 4I0CC 1YDPA 3L9RB 1MFNA 4W4OA 4DVRL 2VLJA 4HD9A 4Z7NE 4MAUL 3IFOA 2ADGA 5EBMA 4G9DB 2ICWI 3DMMD 3MV9B 4S1SL 2VL5A 1OPGH 4PREA 3CSYB 1WZ1H 4Y1AB 4ODHH 5D1ZD 1DDHA 3UEZA 3U48A 5C2BL 3MRHB 3WFBL 4MXQD 3KYNA 5IF0B 5ALBL 3I2CL 4IRZH 1KLGB 5A2JH 4PP1D 1S9WA 2IPUG 3BZ4A 3SEPA 4JM4L 5CWSA 3P30H 3IAPA 1OTSD 3B8YA 3FONA 3FT3B 2NY6D 1DLFL 4FFWC 2VSCA 2WQ8A 2CLZB 3KPTA 1IGIL 4U6VL 4EUPB 3BXNB 3RVXC 4G6AD 4ZOCA 4OZFB 5FECB 1T3FA 4Y8DC 2X89A 4LSQL 1NAMB 3EFFB 3WIIL 3S5LB 4ZUVB 1QLRA 5DF0A 3IYLW 4OZGF 4Q6YA 3PL6D 3DO3A 4JZJB 1GVIA 1LO2L 4PJIB 4UU9A 4O5LL 4HUUA 2KKQA 3TYGL 3C60A 4NNPH 3OSKA 2Q7YB 5B3JF 1OQOA 3TH3T 5EUKB 1T1YA 3TWCL 1U0QA 3OB8A 3L3JA 1U3HB 2VC2L 1YYMH 4NHCH 3QG7H 1P84K 1MPAL 4KKBC 5J8OA 2XWJA 4JO2L 1MRFL 4XBPB 3H0TA 4HS8H 3LS4H 3P11L 5GGSA 3TA3A 4BSVA 2JCCB 3PWPE 5KS9E 1ZKAA 4MNGB 1MLCB 1VDGA 5DEFB 4H5SA 1UVQA 4GKZB 4JZJC 5LGHL 4BSJA 3ECBB 1I8KB 2E6JA 4GG6F 4OTXH 1JTPA 1F3DJ 4DKDC 3BEWA 1LK3H 1N0LA 3PQYB 4XCFH 5EU6E 1B2WL 1U3HC 2X4RB 3CJJA 4WU5A 4L4TA 3KPMA 1ZHBA 4RFOH 5FIEA 3QFJA 4JM2A 2AJXH 4KI5E 2WBJD 3ZKMD 3QIBD 3S4SA 2MPAL 1WC7B 3KNBA 3CXHJ 2R2CA 1QHPA 3BD4A 3QH3B 1VFUA 4HHAB 3RX8A 2YKLH 1ADQA 5EZJB 1S78D 1WBXB 1RK0B 4PRIE 5DD6A 5DR5H 1U91B 3IU4H 4X6EB 1OARL 3ZL4L 3U6RA 3QQ4B 4XPHL 2VMFA 5SWSD 3I85A 1ADQH 2C5DC 4U0QB 2VISB 3BH9B 4LIQL 3LH2H 2R4SL 3LQZB 3RL2B 5L6YH 5EZIL 4U1MA 1S7UA 4Z76A 3GRWA 2OL3L 3O3EB 2MJWA 1VGEL 5TE4H 4R9HA 5EU7C 2VNCA 3MBED 4OGZA 2IPTH 4JJHA 3DETC 2CRMA 3GRWH 3GSQB 5CUSH 4BZ2L 3IRZA 3MFGB 4P2OD 3TPUA 4LSTL 4NQCE 1G6RB 5FF6B 1OWRM 3ALPA 4LGRB 3T0AA 3O8XA 5FB8B 3RVUC 4ZO8A 3OHXB 1A47A 5DRWB 3HPJB 2EDNA 4FTVE 3HS0B 4AEIH 3SKNA 1F11A 4JHWH 1GCFA 4ELMB 2E9JA 4YHIA 3N9GL 1NCUA 4YNYB 5LAXA 1OGAA 4JFFB 4JJ5B 3UJJH 3C5JA 5GZND 4X7DC 4DQOL 2H3NB 4AMKH 1LO4H 2F54A 3D69B 4YBQC 5JLZA 4XAWL 5DJ6A 1MFEL 4OCRH 5HGDA 1GPOH 4A6YA 4C57C 1V8HA 1EEYB 1JI2A 2E7BA 5ECJE 5D5MB 2W0FB 1K5NA 4YDJB 2NY0B 2OMNA 2ED8A 4NZRH 1RJLB 1NCWH 4MZ2A 4PYGA 3LD8B 2ARJB 4RMVA 4A6YH 4M7LT 1S78C 1UKSA 4HGKC 1V05A 5LCVL 2Q87A 4C56E 3PHOB 4X6FA 5L9DH 1HIML 1YNTA 5INCB 5GGRB 1D6VL 3H9HB 3SGDH 3T0XA 5FUZH 3HZMA 1L9NA 3QEUA 4HJJH 5TF1H 3QXVA 2VXVL 2G5RA 5BV7B 2R0ZH 2C9AA 3D3VE 1PQZB 4HCRA 5HHPB 4X6CB 1IAOB 1NUFA 1BVLB 4DKEH 3MLUL 3WJLC 3HPLA 1E4KC 3QUYB 1CG9B 3O11A 4KHTH 5FYKH 4UNTA 4CGTA 2NY0C 1BFOA 5F3HA 5EFIB 5F96L 4F7PB 3LD8C 4F8TA 1CGXA 5DD3H 1A6VH 1ZS8B 4P23A 5C0FA 1P4BL 2YD1A 3IDMB 2FO1A 4I8DA 1ZHLB 3NH7H 4AJ0A 3RX7A 3OZ9L 3MOBL 4NZTL 3GMLB 3QPXH 1MJ8L 3AB0B 1LEKB 2FHCA 4TQEL 2XTJE 2D2OA 5F44A 4OV5B 1KF9B 5A16B 4HKXA 5GS0L 4JB9L 5F7DB 4YZFF 3BHBB 3QUYC 4RMSA 3S36H 2BNQD 1WWWX 4WCYH 5FKAA 2BOCA 4X0KB 4NPYB 3DECA 3UBXB 4YAQB 5DJZA 3OMZA 2CLRA 2VDNH 3DVNA 2ZNWA 2DTSA 3DGGB 3VXUD 1ZGLB 3VE0B 1M4KA 1YECL 1B0GB 2PETA 3SKJL 4UQ2B 2P46B 1WAAF 1U8MA 4RFNB 2VITB 3ME0A 4RA0C 4JFHD 3CZFA 3MRNA 1YEDA 3HI5H 2BC4B 2VLKD 5D6DC 1E6JL 3P4MB 5DK0B 1U92A 3UTTE 2BY3A 2OI9B 1C8PA 2C1PB 1ZLWH 3U0WL 1IM3A 3L3GB 1FVCB 1RUAH 3GZKA 5JW5B 5E00B 1EA9C 3EAKA 2OS7A 3EYQC 3R06B 3W81A 2Z35B 4IHOB 1FIEA 3MV01 4FFYL 5CBEA 3VG0L 4Y7MA 4EDWL 2WUCH 1CICA 4MD5B 4MSWB 4W68A 2R4RL 3EDDA 4PJFE 3RVWD 4L8BB 1I1YB 3CGTA 3T3PE 3CUPB 3IKCB 4JZOB 3MXWH 2NW3A 5EN2B 5I8EB 3THML 2NXZB 4UTAL 3SBWA 5GGVH 3DSFH 1T4KA 4OCNC 4O00A 5FHBL 5MERA 1FLRL 4DW2H 2OI9C 4L4VB 4OLYL 2ATPA 4WEBL 5DC9B 1TDQA 3GSUA 4HG4J 1G7QB 5DQDL 5I1EL 5TFSL 4CADB 4WENB 1QFPA 2EIEA 4YX2L 1RUKL 2A6IA 3OKNB 5SWZD 3JV5A 1OGTB 1ZLSH 3D0LB 3CH1B 2ADFH 2XZQL 4LSRH 3QXDB 4B5EA 2BVYA 1T2XA 3QEHA 1WJ3A 3AREB 2HWZL 1HHKA 2NXZC 1FL5A 4JKWA 4ALAL 1J1XL 3EYUL 4LPXA 4F9LA 1S7XB 4X6DF 1FC2D 5D9SB 4KDVA 2CK2A 4CVZA 4AG4L 2DQIH 1XCQB 5E8NB 4RWYL 1FG9C 1RUQL 4Y19D 3WE6B 3RUGF 2DQCH 2NZIA 3KR3L 5DRNB 2VLMD 1ZVSB 3BH8B 4WFHD 4MLSA 3CU7A 2QSTA 4V1DD 4QHMB 1A9BB 1V3MA 1WWAX 2X4UB 1HKLL 2NY7L 2CDFB 4QLRA 3D2UB 2AJYL 4TVPL 1NLBH 5FM5O 3A6BL 1R3IH 5JDSB 4OZIB 3PGCB 3N1QC 4WWKB 5C9KA 5T33L 3S3JA 3FFCA 1JHTB 1JF6A 2XIDA 3AREC 3BKMH 1Y18B 4F2MB 4MDJB 1Z9MA 5HHQB 1EEZA 4I2XB 4URTB 3WNKA 1INEH 3ILQC 3BPCB 4BSWB 1J0HA 7FABH 5D2NB 2PXYD 2HVJB 3U0PB 3QPQC 2DI9A 4Q74A 3QULA 2GJ6A 2I60H 5KW9L 2C3XA 3QG6B 1TZGL 1YN6B 1WWBX 2UVEA 3G6DH 3RTQA 4LCWB 2X4NA 1CT8A 5FK9B 1NDGA 5F9OL 4ETYA 2IH3B 4MXWL 3IDXL 3PWJA 5IG7B 3M8OL 5IB3B 4JFEB 3IFLH 4NFBA 1MNUH 4Y4FD 1HCVA 4OM0H 2KQNA 2QR0B 4WWKC 1ONQB 1S7RA 1AXSA 2I9LB 3OV6A 5F1KC 2X9WA 4WFGD 4XC1H 3D48R 4OSUH 1OF2B 2W07A 5F6IB 2BNRB 4MGXA 5D2NC 4HJ0D 3D85B 5CJOL 3M1BA 4S1DD 5F7LB 1FZOB 1MRDH 2GT9B 2OXHA 4XP1L 4WHCA 4NQDB 2AEWA 4YUEL 1F4XL 1I1RA 1EJ6A 5CEXB 3FTGA 2VDML 2FBJL 1UWGL 2ESVB 4Z78A 1I8IA 4HKBB 4LGPB 4RFEB 5HI5C 4KKNA 2VLJE 2XZAL 4YK4B 1CBVH 3MRIA 5DJAA 1CXIA 1QFWH 1AXIB 4BZ1H 1I8LC 1GGTA 5EO0A 5HHME 4FZEH 3U4BL 5JHDB 3SE4A 4KV5F 3UDWA 1F6AB 1OQXA 4RISL 3VXNB 2R0WL 2G75B 43CAB 5ITBH 2JIXD 2W0LA 5KS9F 1AI1H 4YQXH 3VFMA 5F6IC 1U9KA 2H8PB 1ED3B 5EUOA 5I9QB 4B7LA 1RUPL 1XGTB 3VWKA 5AAWA 3O0RL 3MJ7B 5DJXB 5JXAH 5EO9A 3F6IA 4K8RH 4ZSOA 2Z8SA 5EU4B 2YA2A 5DSCB 1HQRB 3LEYH 5IB5B 4ISVA 3T4YB 4KVCL 4MHHG 3QDMB 1C5DA 1MHHA 2Z8WC 5J12B 2FX9L 3TNMB 5KJRH 4G5ZH 4WW2C 3TCLA 2DKUA 1I9IL 2UWEB 1YPZA 3BP5B 5ABDE 3ARDB 3MGAA 2KDGA 3T65A 1A6TA 1NBYA 1KCKA 5I9QC 4NSKA 1KIPA 1DQLH 5DJ2B 4KZDH 1J0IA 2ZUTA 5C08A 5IW1A 1OTTD 4RMTA 1K3IA 1GC1C 4JY5L 1J0YA 3MRMB 4U1IB 5CILL 1T21B 3L9RA 4PB9L 1CIUA 3QT2A 1RHHA 3OF6D 5KVEL 3DWTA 2ED7A 4LGSB 1JGVH 3RBGA 3LRSA 1AXTH 4UT9H 4PLKC 1BQUA 4Y1AA 5J12C 3WXVL 5B39G 5L88H 1T7YA 5IF0A 4M03A 1ETZB 2CK0L 4M5ZH 2X10A 5BO1H 4M5YH 3GSOB 1KLGA 4YPJA 1B88A 2YA0A 3ARDC 4HWEH 5D1XD 4Z7UB 1U8HA 4U1LA 5EULV 2FEDD 3F12B 4LRNL 4PJ9D 1T1XB 3FT3A 2QQKH 5C9JA 5F7EL 3UPRB 3CFEB 2H32A 1UACL 4MVBD 5FOJA 4G6JL 3QFJE 3OG6B 1QSEB 2WINA 4LDEB 1RSFA 5IHZB 4KJWC 3VGGA 4M8VA 1A7QL 4K3JH 2ICEB 4E42A 2X4SA 2RCSL 3MRPB 4HQQH 2H32H 4LHUG 1YNKH 2C3WA 2CIKA 2GK2A 5MENA 4I4WA 1NC4B 4U1JB 3QO0A 4ZAKD 4ZOBA 5IFJB 5IBUG 4JQIL 2Q7YA 1X5ZA 2X1PA 4WW1B 2DIJA 3DX7B 4I18A 4N0FB 1CGYA 4WHYG 2GQHA 4I1NB 1RZKL 1U3HA 2WIIA 5D1ZA 4JE4B 3VGEA 1ZE3C 5KVDH 3R1GH 4TULL 2X1XR 3WFHB 3L6FB 4XBPA 1NCBL 2VDLL 5CJXC 5LXGL 5HXMA 2H1PL 5JHLL 1MWAL 4KKCC 1N4XL 4NQTA 3WDJA 5E5RB 3RWEB 4MNGA 1DBKH 1EIBA 1T5XB 5CBAB 4LU5L 2FECI 1OTTC 3MUZ1 4K94L 5E2TH 1S5HA 3IDIB 4GKZA 2NY5L 2R2BB 3A6CH 3ECBA 1I8KA 3GM0A 4ESKA 2A83B 4M1DH 3KS0J 3C5ZD 4EIGB 3HMXH 4S10A 2X4RA 3BDYL 4P59H 5F6HI 3SKOB 1CXHA 3CDGB 1D5IH 4NDMB 1OGAE 4J3VA 3D5OF 1A22B 2VZ3A 1WC7A 2F54E 3QH3A 2AXGA 1C1EH 2FZ3A 5I8CB 1EJOH 4GSDL 3S36X 5EZJA 2DQHL 1WBXA 4DOHE 3MROA 2JJWA 4OIIH 5AAMA 1GGYA 4PJEB 3TNNB 2X1OA 2VXTL 4WTWA 2J8UF 1TETH 3DHJA 1BQHB 3QQ4A 4K9EL 3EJYC 2YUZA 5E0QA 5ESAB 2VQUA 1YY8B 3DV6B 5K33A 3RPIB 5IVOA 1I3VA 3QI9B 3BH9A 3WLBA 1C16B 1XF3B 3V52H 1A6AB 3LQZA 3RL2A 3CX5J 5I0DA 1E4XI 1VFMA 3H9SB 4KTYA 5EU3B 3KWWA 1NPUA 2FECL 5F9AC 1DUZA 1NUNB 3M17B 3VW3H 1MIML 4ZFFB 1QG3A 2QHLA 1DEDA 1YEIH 3ULVF 1K6QH 4H20L 5JW4R 4G8EB 5FYKE 3CSPA 4J4PC 2WBJA 3MLSH 4GO6B 4M3KB 1G6RA 4MJIB 3T0WA 5FF6A 3P0YH 1DQQB 4KTDL 2IBBA 2R2EB 4Z0BH 3OHXA 5DRWA 4J6RL 2NR6D 3CK0H 3HS0A 3QI9C 1TJHH 4HBCH 1BBDH 2P5EB 1QLFB 4YNYA 4KQ4L 3FO1A 4JFFA 4DN4L 4JJ5A 3WHXB 3WIHA 5KSAB 5L2KD 1F4WL 4G6FB 1I3UA 1U8JB 1IC5H 3CLFH 3TO4D 5SWSA 5GPRA 3OQ3B 4EQ3A 4ACPA 1JYXA 4PJCF 4N0CC 5MEOB 4XCCH 4FRWA 3U4EB 4U31A 3WIHH 1FORL 4X8JB 3TCXA 2IQAB 4QTIH 5IROA 5C0RL 3WJLA 1EEYA 2WIMA 1E4KA 1OAZH 1XF4B 5D5MA 4F37K 1SQ2N 4LNVA 3ROLB 5K9JL 2R2HA 1LE5A 1RJLA 4M7KL 3OB0H 5GISL 5JNYA 3AROA 2ARJA 3EYOA 1YJDH 4OQTL 3WXWH 1DQTA 1BVKA 5I30L 5BRZB 4KHXL 4PJFF 5HVHC 4MQ7A 4UT7L 5KSAC 3TZVD 1PZUB 3QUKA 2YD6A 1JZ4A 5I19H 5INCA 2AKRA 5GGRA 4MJ5A 3QWOB 3H9HA 4N1EA 1NH6A 2CMRL 1OAKH 3K0WA 2D3VA 3MR9B 3VA6A 2M8XA 2F19H 5HHPA 1EX0A 1IAOA 3LB6D 5I1IL 1G7PA 1PGRB 1BVLA 3IDUA 2GTZA 1MJ7H 1TLKA 3QUYA 4DZBB 4P46D 3RBSA 4GAGH 4Z5RB 1CLZH 4XP4H 5C0BD 3BRDA 5DHXB 3CXDH 5EFIA 4UINH 1A6PA 4ZTPL 2AV7A 5HGBA 1ZOXA 3IJHB 1Q0XH 3DROA 5GRJL 2ZCKL 5SX4I 2Y36H 4Y5XA 3QRGL 3CD4A 4E9LA 1H8OA 7CGTA 1U8NB 1D6EA 5IHUH 1G84A 2O5YL 1CLOL 1URLA 1YEJH 1G9NC 1NEUA 3BIBX 3GMLA 1KN4H 1KTDA 3NFNB 1FV1B 1BQLL 1NBVL 3D39D 4OV5A 5C0CB 3TO4C 5A16A 1KCVH 1IC1A 2AEPH 5F7DA 4JN2B 1PLGH 3BHBA 3D25B 4GJTB 3STZB 3RI5K 5D6DA 1IAII 4KTEL 2GHWB 1A8JH 5E99H 2QJDA 4TUJB 4YHML 2W65B 1INQB 3P40A 1KSRA 3UBXA 1JYVA 4YAQA 4PJXE 3C2AH 4LASH 1C5BH 4X99B 1EBPA 1R3JB 4QTHB 1FGNH 2B4CL 25C8H 1I9JL 4NZUH 3ULVL 3MO1B 3DGGA 2VWEE 1ZGLA 3SGKC 3ZO0A 1CE6A 1X5KA 3FQUA 1B0GA 3D18A 5FHAH 4I48B 2BVTA 4OZHF 4D0CB 4MNHA 1T7ZA 3FT4B 4UQ2A 4JO3L 2C4FT 5DUML 1OSPH 3I6KB 1HI6B 2BVUA 2VITA 1M7DB 1UB5A 3RQ3A 1MCLA 1EFQA 2EE6A 4JFDD 2BC4A 3AAZB 3QFDB 2PYEB 4U6HB 2ZUVA 1Z9SA 4NWUL 3MLPA 4FQIL 2XQYK 1MEXL 1OT2A 3HC3H 4ORGA 4POUB 4LKCB 3E6HB 3NAAH 1EXUB 2BVPB 1LNUB 5JW5A 5E00A 3KDMB 2Y6SC 2VLLB 3R06A 3GMOB 3RNKB 1ZLWK 2Z35A 3GJFK 4HXAL 4Y8AA 4LK4A 4MD5A 4R7DB 2WNGA 4MSWA 2P43B 1NMAL 4L8BA 1I1YA 3H9YA 2OM5A 2IMMA 5T5NF 1P9MC 2WWMC 3CUPA 3IKCA 4JZOA 2HFFB 5I8EA 2I25N 1QD0A 4OCLC 1CL7I 3FFCE 1WFTA 3BKYL 4UV4L 2GTWB 5MEPA 3T0BA 5IMLB 4GKSA 3KJ6L 4O2FA 1XGYL 3RZCB 5F7UA 2WWKT 1CF8H 1AE6L 2VERN 4J3XA 2VLKA 4JDVA 1G7QA 1A3RH 4QY8A 2NZ9D 3JWOL 4UOJA 4JKMA 2IH1B 4DGIL 2GJ6E 2DS4A 2DKSA 3QNZB 1WFUA 2AV1B 2DQTL 4DKAA 3D0LA 2ADJA 5K9KB 3WD5H 3UCRA 1FO0A 4XCYA 1EO5A 2XWTB 1EFXD 5ILTH 2YRLA 2QQQA 4EQ2A 2ENSA 4P3CL 4LEOB 5A43C 2G5BB 2MHAA 3PP3H 4K3EH 3TJHD 1S7XA 3O6FB 5C70A 1KB5A 5IKCB 3DXAB 3QZWG 3RZCC 3NMEA 1FO0H 1MHEB 4P2RB 3GNML 2J4WH 5CIPB 1XCQA 4Q9RH 3D9AH 3MRRB 2KBGA 3WE6A 2J5LB 1D3CA 2YWYA 5DRNA 4DN3H 1ZVSA 5EOQH 5L7XL 3FAXA 4CDGC 1KB5H 3OGOE 1A9BA 5L0QC 3NCFB 5DO2C 2HRLA 5T1LD 1F3JA 2CDFA 2A6DB 2QKIA 3D2UA 3K1DA 1A64A 1KJVB 1CL7L 1YZZA 5GS1C 5DD1L 2BSRA 3QNXA 4PJ7B 5F7HA 3PGCA 4OFYD 4Q0XH 4QGYA 4OZIA 2WZPD 1FNHA 4O51B 3V7AG 4PJ5D 1L9MA 1MCRA 2PR4L 3I50H 1Y18A 3SPVB 5SWZA 4F7TA 4F2MA 4PB0L 4PV8A 4MDJA 3VXOB 4JFQB 1UCBH 3NCYS 2ZOKA 2W92A 4G80A 3BPCA 3O6FC 4BSWA 1A5FH 3U0PA 5IQ9B 1L7TH 4NJ9L 3HNSL 1MFBL 3MLTB 3SOBL 3T1FB 1BIIB 2EDLA 2J5LC 1U8OB 3WL9A 5D7IB 2EDJA 4L3AA 4AL8L 3QG6A 5DDHA 3LAFA 1EPFA 2VXSH 4ZSOE 1U8PA 1B0RB 3UYRL 1HNGA 1BMGA 5FK9A 4PD4J 2EE2A 2Q86A 2UV3A 3MRFB 5HYSG 4TOYL 4JQXC 5E1AB 5IG7A 4JFEA 1W72B 2UZIL 1GH7A 1MRCH 4AEFA 1I8LA 2N4IA 4BFEA 3MLYH 4LLWB 3S8WA 2I9LA 3MRBA 1YEEH 3PABB 4JM2F 2FH8A 2AEIT 1KYOJ 2EEAA 1N59B 3EHBD 2BNRA 4OI8A 1YPZE 1PD6A 4FQ2H 4JRWA 1FZOA 2GT9A 4NN6B 1KB9K 4AM0B 4KC3B 4QOKD 4NQDA 5IMOA 2VL4A 4S1QH 3WUWB 5CEXA 5C08E 3QIWB 4FABH 3BMWA 1DBML 3SCMD 4HKBA 1RIVH 4MA1B 2D31A 5JOEA 3ZKNC 1YN7B 1OPGL 4J8RB 3O3BB 4LLVB 4AIOA 5DJYB 5TDNA 4NQXA 1WZ1L 4N1HB 2P1YA 3JV6B 4ODHL 3UJTH 4WW2A 1TENA 1NGYB 3O2WH 5JHDA 2VXUH 1S9YA 1F6AA 3VXNA 2G75A 4D9RD 1GGBH 5E6IB 1UH2A 4IRZL 4Y4FA 2AQ2A 5CSZA 1ED3A 1XGTA 4IRJB 4DEPB 2PNDA 4LSPH 3U7YH 4LHUD 3WDIA 4NN6C 3MJ7A 1NC2B 1WBZB 4QHLB 5EU4A 5DSCA 1Z0NA 4V2BA 1HQRA 3QIWC 5IB5A 4HUXB 1YEGH 2B1HH 5E2VH 4MA1C 5ICYB 5B39B 1GC1H 3L3OA 3QDMA 2Z8RA 4LLUB 3DBXA 1KTKE 3S98A 4YDKH 3TNMA 5IVZB 3EZJB 2DM3A 5MENE 1N3NB 3KLSA 1T83C 4DZ8B 4F37F 2UWEA 5TE6H 4HUWA 4NNPL 3MLXH 3BP5A 1GYAA 4JREB 2ZKHH 5FEBA 1P4IH 1I75A 5I2IA 1IFHH 4IRJC 1GSMA 1YYML 1HH9B 5HHOB 3QG7L 3OXRB 1KIRB 4KPHH 4W6YB 3QCVH 5EG6C 1X5AA 4U1IA 4HS8L 1OP3K 4P57B 3UMTA 3EYFA 4M48H 3EO0A 3F5WB 4Z95H 3U82B 4MNGE 4APQD 5HD8C 1UADC 5J57B 4YPGA 3NCMA 3SE9H 4JCLA 5HYJB 3BRFA 4YHPA 3HAEG 3MXVH 4PP2B 4Z7UA 1A6UH 1LK3L 2QV2A 3PIQB 4XCFL 4PJDB 1NFDB 4GBXB 1BFVH 5GIRB 1T1XA 1YY9D 2GIYA 3MV8B 4X83A 4PGBA 1IAKA 5DMGD 2IAMB 3UPRA 3HG1B 1W0VB 4HGWB 1JRHH 1YUHB 4RFOL 1G9MC 2ICWJ 5CJXA 2H2PD 2AJXL 5IHZA 4XH2A 4Z0XB 1KJ2B 5EU7E 3H2WA 4NQSB 4UOW1 1CZ8H 5CD5C 1SM3H 3MGTB 5DT1H 3TP4A 3HCVA 4PGEB 2I27N 1RIUH 2YKLL 2VLRD 4WO4B 3VFGH 2Z4QA 1NC4A 2YPVH 5HVWA 5IFJA 3IU4L 5TGBB 3OF6A 4EKXA 3CFKA 3EW3B 1A7NH 3O4LD 4ODSH 1IEBB 1ADQL 4DKFH 4WUKH 1MUJB 3B8SA 3LH2L 5ISZB 4GT7A 1IBGH 4GBXC 5L6YL 4P48A 4ZNEE 2QQNH 1FGVL 1NMBH 35C8H 2EIZA 1FZJA 3HI1B 5JPMB 2FJHA 2HRPL 2EYTB 5DHVA 4NZJA 2J2ZA 1DEEB 1JNNH 4BQBA 5SWQB 3MACH 5TE4L 3VD4A 4DGVH 1ROWA 1ZVHA 3OKEB 5GGTA 3VFPB 2IPTL 3QUMB 4PJ9A 3RWEA 4KVNH 3QUZB 1T5XA 2YD4A 5BXFB 1PSKH 3MPCA 3GRWL 1IGJA 5CUSL 3SGDI 5DHVH 4WO4C 4UDTB 3V8OA 5ENWB 5GGTH 4MA3B 4K3GA 2XKSA 2I24N 2L7UA 3D0VB 3RIAF 4WUUD 4X98B 5EZLB 5TDPB 5LGKA 5T1KB 1X4ZA 3DURA 3KPRD 4APQC 1FNAA 4AEIL 3P9LB 4JHWL 2OK0H 2R0KH 5F7WC 4ZAKA 1FG2A 4DFIA 3ESVF 4Z7VA 4U3CA 4NDMA 1P4LA 3UJJL 2I26N 4OI9A 4YIQB 3H9ZA 4GG8B 2DQUH 4AMKL 1LO4L 4QKXB 5SWSE 5CEZD 3CMGA 4UT6H 5E6YA 3GBML 2ZCLH 5DJ8B 2XFXB 3VFOB 4OCRL 1W2KT 3UTQB 1GPOL 1DR9A 4J4PA 5IJVB 2VSDA 1G7MB 3F7VA 2H2PC 4OFKA 1HH6B 4DUVA 4F33A 3L1OH 2BXYA 3EOAA 3QIUB 4O2CB 4JGMA 5KVFH 4FQXB 5D5ME 2YD7A 5ESAA 4DTGH 4NZRL 4NC0B 1NCWL 4TTGA 4LARH 4KGJA 1C16A 2G9HB 4MA7H 1A6AA 4A6YL 4FQJH 4HKJB 2NNAA 3N50A 5E8DH 1HHIB 2R1WB 3G5XA 3LDBB 2XG5A 1BOGA 5L9DL 3M17A 5GHWL 2A9MH 4NWTH 3LS5L 4XMLL 1BECA 3P4OB 5FUZL 2Y25A 1KIUA 1ZANH 2BMKA 4KMTH 3ZHLA 4G8EA 2R0ZL 4YLQT 3A0OA 3Q6FB 3PXHA 4XHQA 2R2EA 1WBYB 1VACB 3QIUC 4KHTL 5DVOA 5FYKL 4I3RH 4FQXC 5T3ZD 1UGNA 1OP9A 5ACMA 4P99A 3DUSB 2VDRH 3O6KH 3L95B 2F53B 3ARBD 5DD3L 1A6VL 4G43B 3U9UB 1KLFA 4JANB 1NGZA 1W8OA 3O6LH 3LDBC 3NFPA 1J87A 2A1WL 4R0LC 4RQQB 4D0BB 1WIOA 3CDCA 1DLHB 1F97A 3NH7L 1OW0C 2VOTA 5JOFA 4X8JA 2IQAA 4X5WB 3QPXL 4KROB 1XF4A 3WDHA 1NBZA 1XF2A 2GEEA 1Y6NR 3BN9D 1N5YH 1HDMA 4HT1H 2FLBT 4WCYL 3QDGD 1MHCA 3MRGB 4H88H 4WI5A 1GL4B 1KT2B 3EKCA 5BRZA 3HE7D 1BJMA 2VDNL 3LN5B 3QP3A 3KG5A 1JHKH 5IHBA 2VB5A 4ETQB 4LVOB 3MR9A 3VXMB 1YC8A 3ZYZA 1QO3B 4J23A 1FJ1B 3DUUB 3TO4A 4KROC 1KXTB 1LQSR 5KBNC 3LIZH 4JO4H 3HI5L 1AR1C 4Z5RA 5HJ3B 4WU7B 1QBLH 4IOFD 2ATKB 3OR7B 1DE4A 4L1HA 4R3SB 1OAUH 3ARXA 4G7VL 2DMCA 1MCDA 5EB9A 4MX7B 3RKPA 1RUAL 1MI5D 3PWNB 2X1WL 4LPUA 3GMNA 3LPGA 5F9WB 1EUTA 1J0KA 4DK3A 2HLFD 3KHOA 3SGKA 3DV4A 4ZXBB 2X4PB 4PS4H 4WY7H 1OM3H 1QLEH 1ERNA 2WUCL 4LVOC 2WUBH 3DUHA 4UZGA 1XAUA 3GIVA 4PJHA 5C0CA 3VJ6B 2P42B 3IJYB 3GSRA 1U95B 4WI7A 4P49A 3D25A 3MXWL 3P9MB 3STZA 3VXUE 1NANH 5DFWH 5DI8B 43C9B 5GGVL 3QDJD 1O0VA 3DSFL 2X42A 5I0ZA 3Q0HA 4TUJA 5CEYB 2W65A 1INQA 1SMAA 1UQSA 5I74C 2X2YA 1MH5A 2J8OA 4JFHE 2OSLB 4QHNA 4MA8H 5C0BA 2VLKE 1J0ZA 2LAAA 3MO1A 1HZHH 2GAZB 4L5FL 4MQSB 3S9DB 2WBWB 4I48A 2CKNA 4MMXC 4D0CA 5IVXA 3FT4A 5E9DD 5DJDB 4GUPB 3WFEH 3I6KA 5JIHA 1ZLSL 4AYFA 3VWJB 3T8XB 2ADFL 1M7DA 4LSRL 5EUOF 3BWUC 3QFDA 1AFVH 4U6HA 1O7SA 5EDXA 5J7CC 4Z18A 2IEPA 4LKCA 1I1AD 3E6HA 5D7LD 4EI5D 2BVPA 1R3KB 1LNUA 2DQIL 3KDMA 3QJFB 4Y2DB 4HWZB 1CVSC 2VLLA 1DVFD 2ZG3A 4WV1B 3RNKA 2DQCL 5C07D 4U1HB 1JZ7A 2VZUA 1AY1H 3STLB 2RQ8A 3ARFD 2B0SH 2JJTC 3MBXH 1P6FA 4R7DA 1JPFB 1P7HL 5KANI 1YPZF 3EDJA 1NLBL 3VWJC 4OD3H 1P7KB 1R3IL 2HFFA 3CLEH 3OJMB 3DJ9A 3O9WD 3C5SB 4HC1A 3BKML 5SWZE 2GTWA 4G8FB 5IMLA 3MX0A 3OAZH 3QEQB 1INEL 3NTCH 1QFWI 4L8DB 4Q9QH 2F74A 1ZA3B 7FABL 4P4KD 4HC1H 4NNYB 4PRBB 4Y2DC 4WV1C 2I60L 3HC4H 2IH1A 2AEQH 3AFLA 2Y4SA 4NO0B 3G6DL 3QNZA 1YMMB 5JQ6H 3QCUH 4WDIA 2AV1A 2HKHH 3F65A 1F45A 3BAEH 4G8GB 5K9KA 5GS1A 3ZYIA 1NKRA 5C0GA 4Y19E 4NO2A 1MNUL 4JFEE 2XWTA 2VLME 4WFHE 4OM0L 1MQKL 3C8DA 4LEOA 1OP5K 1NFKA 2G5BA 2DI7A 3ZT7A 3VMOA 3O6FA 3CIQA 3PHQA 4PY8J 3V5KA 4XC1L 3VXRB 3DXAA 5IKCA 4OSUL 5F1IB 3DTXB 3K3QA 3W2DL 3MRRA 2BNRE 1MRDL 4NO5B 3I6LD 3HZYB 1XEDA 4L9LB 4NQDE 4F7MB 4LLDA 4YHLH 4I0PB 5HYSB 5C2BH 2WV3A 3VI4E 2NXYB 2MQ0A 5F1SA 1TZIB 1LEIB 1CDBA 1CXEA 5ALBH 4JQXA 5B8CB 2A6DA 4JY6B 3OAYH 4GH7B 4FN0A 2AJUH 4LDOB 4PJ7A 4EOWL 4ERSH 4X7FC 1CBVL 1OSZA 5FO7B 1IL1B 1FNGB 1QFWL 4LBEB 4N5EC 1LE9B 4BZ1L 1L4IA 3DPBA 4X80H 1DBBH 3MUGB 3VXOA 4FZEL 1ZLVH 5JHDE 3S97C 5ITBL 3MA9H 5IQ9A 4YQXL 2JCCF 4P5TB 5T5FL 3T1FA 4D8PB 3RU8H 4JPIB 5EU6D 3V6ZB 4L9LC 3G6JE 2DLIA 3NA9L 3Q6GH 4K8RL 1LD9B 5D1QB 5E1HB 1PX3A 4LF3B 4I0PC 4WFGE 3O41B 3LEYL 2NXYC 4PRPB 4X7CC 4P4KC 5JA9A 5E1AA 5B8CC 4YR6B 5FM4A 3QYCA 2AABL 3TBYA 4OIBA 1FFNB 2YD9A 3QNYB 1OTUC 4ZDHA 3E3QC 1BF8A 2BJMH 1MPAH 4XTRD 4IBLT 5GZOD 4JDZB 1QRND 4K7PH 5T1LA 2QHRH 1QVOA 4MQXC 3PABA 3N1FC 4J3UA 1NEZG 2W0PA 4OFYA 2UWEE 2OCFD 2N7BA 2X4QB 4PPTA 4HK0B 4P5TC 4AM0A 3KYOB 4ODTH 2AK4D 3FO2B 1DQLL 4KZDL 2YSSB 3U1SH 3FT2A 3WUWA 3GSVA 5D1QC 3QIWA 3H3BC 2APTA 3IGAB 3VD7A 5DC0A 2LFGA 3EO1A 4ZPTA 2SEBB 3LQAC 3O2DA 5ACZA 1YN7A 1JGVL 5FUOH 1AXTL 2NX5D 2AI0H 2YD5A 1P69B 4UT9L 3B2VH 4YH6A 5L88L 2ZOLB 1T83A 1HK6A 3FQNB 5EA0L 1B3JA 3O2DH 4M5ZL 1BD2B 4Z6AT 1WCBB 32C2B 4JO1H 4M5YL 1R5IB 5BO1L 2XWBB 4HWEL 3Q5YA 4IRJA 3MNWB 5C09B 5C0AB 4Z7UE 1QRNB 1JWMB 3HR6A 1NC2A 1EVTC 1WBZA 2GFBB 2QQKL 3HZVA 3GI9H 1RIHH 4HIIA 5DUBB 3ULUC 4ZYKB 3ARTA 4JRXB 1AC0A 2EH8H 5B39A 4K3JL 4NKMA 4R7NB 1MQ8A 1PG7W 1UZ6F 4XXCC 2FGZA 4HQQL 4E0RB 3QHFH 1YNKL 2Y5EA 1CDJA 3SCMA 3GMMB 1JMXA 4ELMF 1N3NA 3HAEB 1JF1B 3JTSB 2CLVB 4XI5C 2PO6B 2X09A 5E24E 4GRLB 2NY1D 3MJ8A 3B43A 2DJUA 3G6AB 1RPQA 1V7ML 4ZOAA 5I8OH 1YMHB 5KVDL 3OXRA 1J18A 3R1GL 4M7JH 1PYWA 4JFXA 4BZYA 1UWEH 4WI8A 5D5MF 4LHUA 3MRCB 5EC2A 1DBKL 5F1NB 2CKBB 4JRYD 1UJ3B 5DYOB 1QEWB 2DYPD 4FXGB 3A6CL 1I1FB 3GUTA 3TN0D 1FZMA 2PO6C 4DK6A 2R56H 4GRLC 4M1DL 4PP2A 1KULA 3PIQA 3UTPE 1NFDA 3HMXL 4GBXA 2RAMA 5GIRA 5I66B 3VXSD 4WHYH 4P59L 4HGWA 4TUKH 1D5IL 4X6CF 4Z7VE 1C5CH 4HS6B 4UDUA 4PJAB 3L7FB 4MCYB 3MJ6A 3PWLB 3GGWB 4JGJA 3BQUB 1HE7A 3MGTA 1C1EL 5ANMB 5IW3A 4PGEA 1EJOL 5SV4A 3CC5B 4WO4A 4DFHA 1CXKA 1R6VA 1T0NB 5LCVH 1CGUA 4OLWH 2HN7A 1DQJB 4OIIL 2A0LD 4KDWA 5HYQB 2BVOB 5TGBA 4IRSB 4E41D 1TETL 4FQ1H 5IEKB 4APQA 1WEJH 3FMGH 2P47B 3ZYJA 1EVUA 2VXVH 3V52L 2MMXA 3U30B 4X9IA 3ULVD 2EDXA 4Q97A 4JG1H 3PWUA 5D7JD 5BVPH 3HI1A 1RJYB 2R9HD 5FOBB 2K9UA 1S3KL 3P0VH 3VW3L 4R4BB 3VFPA 3QUMA 3FFDB 1KCUH 3BQUC 1JV5B 2OYPA 1YEIL 5T1MB 3ZLQC 1K6QL 5HDBE 5EC1B 5C0JA 3H7LA 1CR9H 4QHUB 4YXLH 1GIGL 3IDJA 3MLSL 1YQVH 5ENWA 2CRYA 4MA3A 2XTLA 1XMWA 3P0YL 1R5VB 4HAGA 4IRSC 3D0VA 5HPMA 1A4KB 4Z0BL 3LY6A 4X98A 1X7QB 5T1KA 2Q20A 1CDYA 3CK0L 4JG0H 1PBYA 3BPNB 1KELH 3P9LA 1TJHL 3MOBH 3OZ9H 4HBCL 4NUGH 3UTZB 1BBDL 3SDAB 3UTTD 2EIBA 3MRDB 2AP2A 3IFPB 4P9HC 1J1PH 4NZDA 1WF5A 1I9RH 3O4LA 1IC5L 1X44A 1VCAA 3CLFL 3DX9B 1EBAA 4XWOD 5DMJB 4XCCL 4RNRB 5DJ8A 1BM3L 3UROR 3UTQA 4YGVB 3CVHA 1ZLUH 3ZTJG 3WIHL 3QQNA 4QT5A 4ZS6D 4OF5A 4QTIL 1HSBB 3BOVA 1HH6A 3MNZB 1OAZL 4OFIA 2E3VA 5F3BB 4Y4HB 3QIUA 2GSGA 4FQXA 2FHFA 3SQBA 3CVHH 4X4YB 4KH2A 1LO3H 1MAMH 3HR5A 2G9HA 3ZDZE 3BPNC 1QZ1A 1YJDL 4RGNB 3WXWL 2D9QB 3MV7B 2PF6A 3QDAA 3SDAC 3WHE0 1HHIA 5BRZE 2R1WA 4U3XA 3RWHA 5C3LD 1CN4A 5I19L 2O93L 5A2LH 3KPRA 4R0LA 3FHQA 3UPAA 1E28B 4FXKA 4UAOB 5D70H 3P4OA 1VKXB 3HI6H 1OW0A 1OAKL 3SE3C 1J8HD 1S7VA 2FR4B 5JW3L 1KXVC 1ORQA 2IG2H 2X70B 2X9YA 1X5YA 2F19L 5L2KE 2E7MA 3Q6FA 3QBTB 1MJ7L 1RVFH 2ICES 1KV3A 4GAGL 1FAKT 4Y4HC 3DO7B 1WBYA 1VACA 1CLZL 4XP4L 4PJ8D 4YDVA 3CXDL 2WW8A 1KCRH 1UXSB 2J1KA 2P5WB 3DUSA 3L95A 5SX5K 2WLZA 5CEZH 4RGNC 3TBSA 4H0HB 3U9UA 1Q0XL 3ETBF 3WHE1 2JK5B 3MGOB 2Y36L 4LCCB 1HOCB 3HUJB 4KI1A 2EDYA 5IHUL 4P2QD 4D0BA 1X5IA 1UC6A 5FHBH 1DLHA 1WQVT 1FLRH 1YEJL 1X3DA 1FHGA 2JB6B 1KN4L 5JIPA 4C4KT 1T22A 1KCVL 4GRWB 2YR3A 4PJHE 2AEPL 5INDA 5KVMC 2YZ1A 1PLGL 4QRTB 2QADD 3ZE2E 5CZXC 3LKOB 5BJTB 5E99L 1PDKA 2DMBA 3ARWA 4ONFH 3GSXB 4PTTB 1KT2A 1OAXH 2IAND 4N5UA 3LSOA 4RGMB 1XIWB 3C2AL 4W4NA 3WSQH 4LASL 3TBTB 1C5BL 2P24B 3HE6D 1AO7B 1FGNL 3BESR 4LL9A 2EDHA 1I3GH 1FNFA 4NZUL 4OZIF 4EI6A 2HWZH 1HYRC 1SYSB 5C0BE 4LCCC 4ALAH 1REIA 4OFDA 1I7ZA 5FHAL 4ETQA 1WVZA 2A38A 4ZFGL 3REVB 5T3ZH 4QRRB 1OY3B 5IVXE 1OSPL 5FUCC 3ALXA 1LK2A 3GI8H 1DN2A 1UB6B 2RHEA 1MELA 3KR3H 2P4AB 2BRRH 5HJ3A 3MJ9A 4JPKL 2IADA 1ZT1B 3VGAB 3L3KA 5CP3A 2FCBA 4ONOA 5B38G 3D39E 4MX7A 5LKNA 2JKXA 3BD3A 3NAAL 4RGMC 2H26A 4NKOA 1AKJD 1XIWC 3A6BH 3IXAA 2LVCA 3QDGA 4PJ8C 2Q8AH 2X4PA 4CW1B 3BVNB 2EXYD 3ZZ1A 2HTKC 3V0WH 3EDKA 1CD9B 1NCNA 5I73B 3MQIA 4NNXB 2C7UB 4OZ4B 3VJ6A 3IJYA 5DURB 1AR2A 3WEXB 1U95A 4HDIB 2O26U 3P9MA 5FM5M 2QSQA 3GMRA 5KN5B 4BFGA 4KJYB 5J1SC 3VI4F 3VGAC 5EBLB 4GW1A 2BSTA 1D5XB 4YHZL 1CFSA 2V9TA 4KWUA 1CF8L 1BPVA 2OTUB 4Q6IB 4GAYB 5DQ9B 1Q38A 4JFDE 5LG1A 3SDXB 4C83B 1Z0MA 2GAZA 2HKFH 5DGRA 4KK9D 5ID0A 2QTEA 4WW2F 1BZQK 1MI5A 1ZA6B 2Q7NA 4J7RA 4NT6B 4XVTH 3HE6C 3HTLX 4JN1H 1IC7H 1JPGB 3VWJA 4K7PX 3AGVA 5H2BA 3VU2A 3WD5L 5E8PA 1LP9B 1IQWL 1RURH 3P77A 1G7IB 5ILTL 2X89D 2Z31B 3HMWH 2PW2B 1NCAL 1YEFH 3CCHB 3TBWB 4K3EL 2YMXH 2FBJH 5F71A 2FWOB 3N1PC 5GGSY 4AEHH 3C6LB 1FO0L 2DWEA 5JO5A 3C60D 3DXAE 3KPLB 2J4WL 4Y2DA 1IMHC 4Q9RL 3D9AL 4Q6IC 3QDJA 4HWZA 1YEKH 4P5KA 4BQCA 4ODWB 4CJ1A 5EOQL 4HIJB 4U1HA 1KB5L 1H15A 2JJSC 1JPFA 4HH9B 2ICWB 2UWEF 4MB4A 4ZG1A 2NYYC 1DFBH 4RAVB 1P7KA 2IJ0C 4Q0XL 3GB7B 2DQEH 4PJ7E 3C5SA 2EICA 3IDYC 4YHYB 5BZDB 3T0VA 3I50L 3QZWA 5E9DA 3W0WD 2R29L 1U8IB 4X6DA 2HLAB 2HFTA 4L8DA 4P5MB 1A0QH 3BZEA 3LKNB 3WIFB 5H37G 1A5FL 3C6LC 4HUVB 3SDCB 1L7TL 2EXWD 5C8JB 4NNYA 2FX9H 1S7SA 2K1MA 4NO0A 1IQDB 4G6MH 2VXSL 1I1AA 5D7LA 4NC1C 1I9IH 2NTFB 4EI5A 1T5WB 4L4TD 3OX8A 4JM2D 4Y4KB 1DVFA 6CGTA 1KLUB 2E9BA 5F97E 5C07A 4Z7UF 3ZDYE 3B3IA 3PGFL 3T0EB 4GMSH 4YHYC 1EZVX 3MLYL 2CIIB 1I7TB 3UJIH 1YEEL 1E6OH 4HULB 1P1ZA 3QAZB 3VXRA 4NRXB 3GBNL 4FQ2L 3SDCC 4EUPG 4NO5A 3HZYA 4PJ5E 2FGWH 2B5IB 4OZFG 4L9LA 2HT4D 1CS6A 4S1QL 4ZD3H 3RY6C 4I0PA 5HYSA 3S5LG 5A3ID 2EC8A 4PBWD 4FABL 1LDPH 1LEIA 4P4KA 3KPPA 2YWZA 5HGAA 5B8CA 2OL3B 4Y4KC 4CNIA 2Y9RT 2VZSA 3U36B 5FKPA 3SO3B 4P3DB 3MLRH 3FRPG 5FO7A 1FNGA 1G7HB 4LBEA 1NEZB 3T0EC 3BP4B 3ILPB 2Z92B 5HYIA 3MUGA 3VRIA 3UJTL 3O2WL 5A2KH 3UO1H 1MCFA 2VXUL 4XHJD 3ULSB 1ES0B 1JMZA 1GGBL 2GUOB 3L7EB 4P5TA 4WGVB 2DIAA 4D8PA 3T3ME 4LSPL 3U7YL 1RI8A 4S0SD 1HSAB 2B5IC 1LD9A 3RVTD 5D1QA 2PYFB 3TIEB 1OCWH 3T2NH 3O41A 2UVFA 4KUCF 5BZWB 4CL7A 2J12B 1U41A 1YEGL 3BGAA 2EXWC 1QNZH 2B1HL 1KACB 5E2VL 3WO4C 3GIZH 3U9PH 1FPTH 4EVNA 4BUHA 1T1WB 1GC1L 5I17B 3QNYA 2VABA 4YDKL 4LDLB 4TULH 3U2SA 4UQ3A 1HN1A 2RFXB 2VDLH 5TE6L 1NLDL 3MLXL 4XRCB 2ZKHL 3HKFA 3FCTB 1JGEB 1P4IL 1IFHL 4PUBH 3KYOA 3FRUB 1UZ8A 3FO2A 4XNMB 2YSSA 4YXKH 5IWLA 1IARB 1U6AL 4KPHL 4JFZH 2OLDA 4OCMC 3QCVL 1H8SA 1MFAH 4JFYB 5CLWA 4D9RE 1CDGA 2SEBA 5GRWA 4XXCA 2HT4C 4M48L 2BSED 3PHSA 4S2SB 4Z95L 5J0BA 4OZGE 1K85A 3BDYH 1N7ML 5FYKD 2OZ4A 4FQCH 3QUXB 3IVKB 2H9GA 3FQNA 3DX6A 2LE9A 3SE9L 1XR9B 5HI4D 4HV8A 3LKSA 1BD2A 1WITA 3RWIB 2V2XA 3MXVL 1F58H 1TMCB 1A6UL 3RWFA 4G9FB 5C09A 5C0AA 5DTFB 3IXTA 5I1CH 2OZ4H 1QRNA 5EU5A 2UUDK 5HDBF 1BFVL 2RBLA 5EOTA 2GFBA 8FABA 4QRPD 1JRHL 2ITCA 5DUBA 1UA6L 1M7XA 1NUDA 3OKKB 3BIKB 1CZ8L 4R7NA 1SM3L 5DT1L 2XQBH 1JF5A 4FFVD 1ND0A 2XN9B 3LRGA 1RIUL 3GMMA 3VFGL 3C08L 3IU3A 3L3IA 4FMFA 1BQSA 1F4YH 2YPVL 3HAEA 4LSDA 3JTSA 3QUXC 1FE8H 4NQED 4GRLA 5B4MD 4YO0B 1U3JA 1MVUB 5M95B 5DA4A 5DFTA 4ZFZB 1A7NL 3BP7B 2NX5A 4XB7A 3PV7A 2R1YB 3G04B 3G6AA 4DKFL 3CFCH 1A02N 4WUKL 4H20H 1S7TB 3HAEH 4FOMA 1IBGL 2QQNL 1NMBL 35C8L 2DJSA 1P2CB 1V3LA 3UYPA 3HB3D 3C8KA 2O5XH 1I3RB 1JNNL 1EHXA 3MACL 1FYTB 2OJZH 4QRQB 4DGVL 1RUMH 3MRCA 4RMWA 4KVNL 1H3PH 5F1NA 3ZDZF 1M7IA 1TJIH 2CKBA 1PSKL 2I9TB 2ZNXA 1SBSH 5DYOA 4FXGA 4U49A 2V5TA 1I1FA 5GGTL 1DBJH 4K2UH 4JQVC 3MJGX 5GS0C 2VUOA 3VD9A 2BXZA 4R2GB 1FORH 2VLRE 2R0KL 2OK0L 1HKFA 1BFSA 3P9WB 3P3YA 1FSKC 3S96A 3PGDA 2BY1A 3W9DB 1QOKA 3X14B 2DD8H 3O4LE 2DQUL 3X3GH 5H35A 4UT6L 2XOTA 5BS0D 3GBLA 3BQUA 4NYLB 2ZCLL 3F7YA 1FL6A 1N5AB 5ANMA 4ZUTB 2HJKA 1F6FB 2A9NH 1A7OH 4MAYB 4WFFD 2W9EH 5E94A 1CICD 3DVIA 4GFTB 1P7QB 3C6SB 5HYQA 5L8LB 2HAZA 1GGCH 2WAHA 3L1OL 3Q5OA 2UZYB 1CFTB 5DRZB 3TV3H 3V5HB 3G08A 5GSVB 3VXQB 5KVFL 5IEKA 4DTGL 1N8ZB 3FL7A 4X7EC 3B5TA 4JRYA 4LARL 4MA7L 4FQJL 1WFNA 4R2GC 1ZXQA 2R1XB 3K74B 4BQ9A 1SEBB 5E70A 4S1RH 4DAGH 3SDDD 3ZSSA 5B4MC 4PJHF 5DQJB 2DQFA 5FOBA 4J1UA 5J1AA 3CH8A 5MEQA 3ZE2F 4WUUE 2RR3A 4R4BA 2A9ML 4NWTL 3KPRE 1DBAH 3VXSA 1ZANL 4KMTL 5T1MA 3Q3GA 1BVZA 4QHUA 4OF7A 1ZTXH 3HB3C 3B9DA 4QWWD 4L3ED 2ZCKH 2F9BT 3KPQB 2J8UA 1T6VN 4NRYA 5BS0B 4KRPB 5F8QC 5CEZE 1A4KA 1JN6B 5C7XL 2NY3D 2EDOA 1X7QA 4I3RL 2VE6B 1JGDB 4XPAH 4ZFOA 3NCCB 2VDRL 3O6KL 3UTZA 3VGDA 3SDAA 3BGFB 3MRDA 4KK5C 1BQLH 5AEAA 4E41A 2PTVA 3IFPA 4LLYB 4LVEA 2D9CA 3O6LL 5GS2H 2XG4A 4EIZC 5T3XE 1ACYH 3GMQB 3WFZA 3V5DA 1IM9B 3TT3H 5ICXB 1DP0A 4HIHB 4YGVA 3PWVB 4KK8D 5D7JA 1IEHA 3BJ91 4LP4A 4NM4L 4LCYB 4GAJH 3RL1B 3ULVH 1N5YL 5FYKU 4KRPC 1KN2H 4HT1L 1FL3B 1KC5L 4FHBD 2IF7A 4H88L 5TF0A 5DJ0B 1NANI 3OKLB 3N85H 1K8DB 1J5OL 1NBQA 3BGFC 2D7NA 1KNOB 2JB5H 4PTUA 3RWDA 4PJCA 5EPMA 1K4DB 5T3ZE 1E28A 1KGCD 1VKXA 3OPZH 3MA7B 1JHKL 1X5HA 1JPTH 2ORBH 1L6ZA 3CDFA 4HWUA 2VRAA 2FR4A 4PG2C 2X70A 5I1KH 4KRMB 4YFLI 4XMKH 3AS1A 4RIRB 1IC4H 3LIZL 4JO4L 1JPSL 1IAIM 1F13A 3QQ3B 1ZGLM 3IT8D 3HN3A 3WFCH 1QBLL 1Q9KB 4HXAH 1UXSA 1E27B 4U7SA 1NGPH 1T1ZA 4UMGA 1OAUL 3RVVD 1NMAH 1Z3GH 3HNTH 3DX8A 2LVEA 4OCWH 2JK5A 5ITFA 2NY3C 1P5VA 1WICA 4LCCA 3F7PC 3HUJA 3QDGE 4PS4L 4WY7L 2ARWA 1OM3L 1QLEL 1H5BB 2NY2B 3LV3A 3KJ6H 2FLRT 2WUBL 1F4HA 3LKPB 5A2FA 1MCWW 3VFNB 1WAAE 4QXWA 3MRJB 2BHUA 3KPSB 5D96B 1TFHA 1S8DA 2IFGA 1AGBB 3G5VB 4Y16B 4MNQB 3TEUA 5CCKH 3LKOA 5J13B 5HDOA 5BJTA 1J8HA 4MDIA 5JMRA 4HZAA 3GSXA 3RX5A 3OKOB 5IJKC 1XIWA 1T0MB 4K8RD 3TBTA 2Y5TA 1AO7A 2Q3AA 1OB1B 2FSEB 4PJ8A 4MA8L 4PJ7F 5IIEB 4YFDB 4TTDC 1HZHL 4QHKJ 5EIIA 4P3CH 4O4YH 1T0PB 1H5BC 3VFSB 2NY2C 1NGWB 1QSFB 3G5ZB 5CSBA 4MXVF 3WFEL 5GGUA 1MI5E 5D96C 2Z93B 1KPUB 4P2QA 2YUXA 4Y16C 1AFVL 4K07A 4RAUB 3VG9B 3B5GA 4NQUA 5J13C 3KPNB 5GRVK 1LGVA 5CMAB 3MCG1 3UTSB 1X5FA 2FBOJ 2ZPKH 5EOCL 1N2RB 1MJJA 3QDJE 2J88H 4CW1A 4GLRH 3BVNA 4PB0H 4NHUB 3NZ8B 2IANA 1AY1L 2FYYB 3GKWH 2B0SL 4FFWD 4XP6H 5C08D 3MBXL 4BYHA 2BERA 3HE6A 3RVXD 2C7UA 4AT6A 1Q9OB 1F8TL 3BO8B 4OD3L 5GRUL 3CLEL 4UIMB 3ZT5A 4CVWA 3MV9D 4OAWB 5KN5A 3H3PH 5E2WH 3VG9C 5HGHB 1AH1A 5E9DE 4Y1AD 5EBLA 1D5XA 4Q9QL 4X6DE 2YUWA 1MCJA 4HC1L 5CJBA 4GAYA 5DQ9A 3RUGE 4C83A 1H3TA 2DLGA 2BCKB 4XB8A 4YWGH 3HC4L 2AEQL 2JJSA 4KKBD 5JQ6L 3R0MA 1EUUA 3QCUL 2PW1A 4NT6A 2HKHL 5D7LE 3BAEL 1JPGA 4ZPVB 3V7AE 4KRLB 4NRZB 3T3MF 1AJ7H 5FDWB 4HK3N 4JHZA 4U6XB 5DWUH 5C07E 5IB2A 4TUOA 3Q1SH 2PW2A 4XZUA 2P8MB 4HF5L 4ODUA 1MCBA 3JWDC 2E7HA 4AIZB 4XCNB 3SDYL 3GSNH 3V4PH 4BKLB 1I85C 3K8MA 4XNQB 2FL5B 4F7EB 4ODWA 5JW4M 1OVZA 5TDOB 4AENB 4HIJA 1U3HD 4YHLL 4N1CA 1XH3B 4NJAH 4RBPK 4KGLA 1RY7B 1UWXH 2VDKH 2AJUL 4KKAC 1MWAB 1QTYT 4KMLB 4ERSL 2Z8VC 4Q7DA 3TJEH 5M7QA 5CHNA 1IEAB 4XC3H 1EK3A 1IKNA 4PIRF 5FCSH 4HJGB 4X80L 1DBBL 2HLAA 5KVGH 1KB9J 1J9CT 3PWPB 5A1AA 5KS9B 4ZUWA 1SJHB 4HUVA 3KHQA 3SDCA 3MA9L 1WT5C 2J3SA 4XNUH 3RU8L 3RY6A 3PQYD 3Q6GL 1XGQB 1IQDA 1IKFL 1II4E 3CDYA 4PV9B 3BIAX 2NTFA 4OLEA 15C8H 1T5WA 5CGYD 1UM4H 4Y0GA 3TF7C 1S7QB 1KLUA 3I6LE 4QXTA 5KSBA 3DETD 4M02A 2Q3ZA 3FQXA 1NFDF 2BJML 1JNHB 4LSUH 4WVRA 5C0IB 4U33A 1I7TA 4K7PL 2QHRL 4K94C 1F6LL 4U1NB 1CLCA 4KV5E 2NY5C 2LQRA 3SY0B 4M43H 4V2CB 1G7LA 1FFOB 3RVUD 4PYHA 5C0NC 3ZHDA 1JWSB 5HHNA 2MKWA 5IBLC 4ODTL 3W0WA 4PRIB 4NUJA 3U1SL 5BQ7B 3KYMB 4PY7A 5E8OB 3FO0H 4P2YA 3REWB 2ICCA 2XKUA 4EN3B 1FBIH 4YBQD 3U36A 4P3DA 3VFTB 5FUOL 1QHOA 1G7HA 2AI0L 1NEZA 3BP4A 1VFBB 4PRAA 3EDEA 3B2VL 1JWUA 4KI5C 1LEGA 4O58H 5I15H 1ES0A 3O2DL 4JO1L 3STBA 2GUOA 3L7EA 2NLJB 5IEHB 1HSAA 2NTSP 4K9EC 4I3GA 4NQCB 1QRNE 3TIEA 1D9KB 2YN5A 4F7CB 3GI9L 5E56A 1RIHL 4JFFD 4FQHB 4FTVB 1KFAL 3ROOB 4RZCB 4P2CG 2EH8L 4EN3C 2AK4E 5I17A 4XBEL 3LVEA 3QHFL 3B5HA 1FGVH 5MI0B 3K8KA 5I71B 1KENH 4YXHL 3I75B 5CGYC 2HRPH 4LFHD 4ODXA 5GGRY 2N1KA 2QBWA 2HJFA 3QQ9C 1J05B 1JGEA 5FO9A 1RZ8B 2NY4B 4ONHA 3F62A 1H3XA 3PDDA 2NX5E 2B2XL 2NY0D 5IV2B 3BMVA 1BJ1J 5I8OL 1U2CA 3LKRA 2C1OA 2DQJH 4M7JL 1KJMA 2VZVA 1UWEL 5FA4A 3WLWC 1CD1B 1C08A 4PFEA 1IGTB 2X44D 2DOCA 4YE4H 3ARGB 1BQHG 2APFA 5CZKA 4C56B 2OR9L 1A4JA 5MI0C 1MCWM 4IS6A 2R56L 3LZFL 4F3FB 3RWIA 3QUYD 1D5ZB 3GBMH 2FX7H 4G9FA 5DTFA 2NY4C 3D3VB 3WUZA 4HUKB 4TUKL 1C5CL 3PJSB 3OKKA 3BIKA 2EDFA 2FNBA 4PBVC 3UXFA 2M1KA 2YC1B 2HVKB 3ARGC 2BRQA 1J12A 3VCLB 3AU1B 3EUUA 4OLWL 3UZQA 1WSST 2A74B 1TZHA 3MZTA 5IK3B 2CDGB 4YO0A 1MVUA 5GHWH 4JQVA 5IFAH 3LS5H 4FQ1L 4XMLH 4ZO6A 3BP7A 1OD9A 2DDQH 1WEJL 3INUH 3FMGL 1CGWA 1VGKB 2XTJB 4JRYE 1S7TA 2V2WA 3Q5TA 3K4DA 1DUYB 1HXYB 4JG1L 2X6MA 5BVPL 2XNAB 4FNLL 3TESA 4XNZB 1FYTA 1A9EB 3P0VL 4QRQA 4H25A 3KYKH 3EYQD 3H6JA 2A6KA 4HCRH 1KCUL 2N7AA 4QRPA 3TFKC 3B9EA 4ZOEA 3VXSE 1FFQA 1CR9L 2I07B 4YXLL 2JTDA 2CGRH 4RRPG 1YQVL 1G9EA 3QUML 4WTZG 1VEOA 2J8UE 2A1WH 1RJCA 3FN9A 3LPWA 4WI9A 2GK0B 4JG0L 4MWFB 1KELL 5IB1A 3OAUL 4NUGL 3ZE0E 2XTJC 5BV7C 2VKWA 4NQEA 1RJZB 3FOMB 3P0GB 1JNLH 1J1PL 3W9DA 1A1MB 1I9RL 4E41E 2BSSB 3X14A 2XXCB 4BQ6A 4XNZC 5HHVH 1XZ0B 5IM7B 3HC0B 4HZLA 5DD0H 2MQ3A 1N5AA 3AXLB 4ZUTA 3RA7H 3ULVE 1CFQB 4QGTA 4U1SB 4GMTH 1CU4L 2E27H 3BD5A 1P7QA 4Y88A 5JPNA 3DOSA 4Q9BA 5DRZA 1CFTA 1VADB 3V5HA 2GW5A 1ZSDA 3VXQA 2AJVH 1X6NA 3CVHL 1FQ9C 1N8ZA 4X5XA 1LO3L 3F7RA 1MAML 5BOZG 2NXZD 1QPXA 2NMSA 2CO7B 4PJFB 1NSNH 5AUMA 3TH4T 5JORB 3AB0C 3CPLB 3MFFB 1KOAA 4L4VD 1FFRA 4IOIA 3I9GH 5LGJB 3GJFA 5J6GA 1BZ9B 4PJCE 2GCYB 4TNVK 4J12A 5D70L 1QP1A 3HI6L 3LCYA 3IDNB 3OJ2C 5JXEC 2P44B 4G7VH 4XVUC 3MYJB 4Q58C 1S9XB 2IG2L 1RZIB 5F89A 1BLNB 3ZTJH 2XI9A 4Z7OE 3GJFH 1WZMA 4Z7WB 1U93B 3KPQA 4DCQA 4BM7A 4PGCB 1RVFL 5BS0A 1C12B 4JY4B 4J3SA 2VE6A 3ARED 4Q2ZB 3NBNA 5ADOH 2ZSVB 1KCRL 3VRLF 1X5JA 1FVDB 1T03L 2IALB 5J06A 2IC2A 5CEZL 4HPYH 3ILQD 4YC2B 4LLYA 3HZKA 1UYWL 4RFNC 2H45A 1WISA 3MLZH 3QPQD 1EO8L 3RNQB 3BPOB 3GMQA 4PRDB 3RHWK 5JDJA 2OX5A 1IM9A 3HUJE 3JWOC 1NDMB 5HSFA 4PG2A 3V6FB 1FFPB 3PF2A 5T3XL 3SDDA 4LCYA 5FUCE 4LRIC 3N1GC 3RL1A 5I1DB 4PY8I 3D2UD 1HWGB 1B6DA 4L5FH 1KPRB 3ARYA 4BH7B 4WWKD 3X13B 1J8HE 4ONFL 4L3EA 3OKLA 1OAXL 2YEZB 1JK8B 5IOPB 3CFDA 3BE1H 4EZMA 2E5EA 1KUMA 2B1AH 2BVQA 5GRXG 3WSQL 1KNOA 3K4AA 3BP6B 4OGXH 4DGYL 3TYFB 1I3GL 3MMEB 4X8XA 4D0DA 2LTQB 4U0RB 3U0TA 3MA7A 5JOPE 3TT1H 1KG0B 4LCWD 1E4JA 1IZKA 4FXLA 5BMFH 5T3ZL 2YPLB 5KANG 4RIRA 5GRVL 4X9FA 5HI5D 4PJGB 4P9MH 4E5XB 4F57H 3GI8L 4XX1G 1ZWIB 4JFED 3QQ3A 4FA8A 3SGEH 2BRRL 4YBLB 4P2QE 1TVHA 3JWNC 1Q9KA 3QB7C 5F88B 1E27A 3QO1B 2Y23A 4PRHB 3FAWA 2V2TA 1PG7H 3HLAB 4B53A 2P49B 2BNRD 2HT3D 3D85D 4LNRB 3QXAB 2Q8AL 1H5BA 2LTQC 4NQDD 4U0RC 3AM8C 3V0WL 1VFAB 4OZHE 2IANE 1T6WA 1RD6A 3SKMB 3V79C 3LKPA 2VJXA 1MFDH 2GJZB 3MRJA 3FHAA 4MCZB 2V9QA 2ESVD 4OUUB 3MV11 2VR4A 5EZOH 2XPGA 2GSIB 3G5VA 4MNQA 3H7BB 5HHXH 4XCEA 5TPWH 5B38A 4YBLC 3ABZA 1ZT7B 1YDPB 2VLJB 1MIEH 2IPKB 5JHDD 1T0MA 3IFOB 2ADGB 5EBMB 1S5IH 1OB1A 5IIEA 5HHMB 1JIBA 1MQKH 1DDHB 4QYOA 2HKFL 3ZE1F 2YXMA 3FN0H 2HJLA 3VFSA 1NGWA 4KK6C 3GMPB 2XKNA 4XVTL 4JN1L 2WMPA 1IC7L 3W2DH 1I7RA 1S9WB 4WRLA 1J8KA 3BZ4B 3ZHKA 1A2YA 3LMJL 1RURL 1RZJH 3FONB 3MRLA 3ISWA 4RAUA 2APWA 2M26A 3CFJB 3QDMD 3HMWL 3NCYP 1CYGA 2HTLC 3LEVH 4PLKD 1YEFL 5CMAA 2FHBA 2YMXL 5I1AA 4AEHL 3UTSA 1T3FB 4W4OC 1IVLA 1PX4A 5IFHH 4BUGA 4EOWH 3ARDD 3MTRA 1YEKL 5I76B 1QLRB 4U7MA 4U1GB 2E9IA 4UU9B 5DFVC 5A40E 5C92A 2FYYA 2GYSA 5TH2A 5D8JH 4M61B 3ZMRA 1DFBL 2HT3C 1FNEB 4KJWD 5T5FH 4ELKA 1EMTH 4NC2B 4UIMA 2DQEL 2AJZB 3NA9H 2Q8BH 4OAWA 2YD2A 2XWJB 3V9FA 1JUFA 5HGHA 3S37H 3TA3B 1SMOA 4BSVB 1A0QL 5JIKA 3WUWG 3WJJC 4F9PC 2AABH 3CZJA 1FIGH 1Q9WB 4YK4C 2YZ8A 3JWDH 4U1GC 2AQ1A 2PKDA 4LAJH 2HFEB 1UT9A 4G6ML 2DRUA 4JKPH 4BELD 4OD1H 4QCIA 5MP6L 1MJUH 4YHKH 4MD4A 1RK1B 4HPOH 4NRZA 1QSED 4KKCD 2EH7H 2V17H 1OP3H 4GMSL 5KSBE 4PGDA 1PW3A 5AYUH 3T4AB 2P8MA 3QFJB 2VKXA 4ZUSA 1KEGH 3UJIL 1E6OL 3BPLB 4WI6A 3V4UH 1NC4D 4AIZA 3BUYB 3TA3C 4XCNA 1E4WH 1V7NH 3KNBB 1WT5A 1RU9L 3WNPA 4G9DA 3B6SB 3K81A 3MV9A 3DARA 4BKLA 4XNQA 2FGWL 5H37H 4F7EA 3CSYA 4HUNB 4AENA 4ZD3L 3W0WE 5TQ0H 4GXUM 3MRHA 1XH3A 3NN8B 5EH1A 5D2LB 2YPKB 5EA0H 5IMMB 1LDPL 1JYWA 3TIDB 4CDHA 1WGOA 3RWJB 3C09B 3MLRL 1IEAA 5E5UB 2ZP0T 1BJ1H 1S7UB 1UWXK 4HJGA 4Z76B 2CLZA 4X5LA 3S3PA 4L4TE 4EUPA 3UO1L 3TPKA 3BXNA 2NW2B 3BPLC 4KUCD 4OZFA 4NOBA 5FECA 3B9KB 3AVEA 1N64H 1NAMA 2UY6A 3EFFA 3EJYD 3S5LA 4ZUVA 5K9QI 3UTPD 4EUPH 1FCGA 4JZJA 4I13B 4PJIA 1XGQA 3JV4B 3TPUB 4OZFH 1OCWL 3T2NL 4OV6F 5LBSH 4Z8FH 2R0LH 1KJ3H 2MNUA 3O8XB 3FRPA 1NAMH 1NCCH 3QEGH 1QNZL 5EUKA 1HCFX 1S7QA 3GIZL 3U9PL 1FPTL 1ZK9A 4M7LH 3SKNB 1F11B 1V7MH 1EO7A 4AK1A 3C09C 3T08A 2AGJH 4YHIB 1Q0YH 5LAXB 1OGAB 3OKYA 2XACC 3AY4C 3UAJD 1I4FB 4J4PD 1TCRB 3S35H 4OF3A 2F54B 1TTFA 2JCCA 4PJAF 5JLZB 3C2SA 1FFOA 3B9KC 5DC4B 1JWSA 1MLCA 4PUBL 5DEFA 2FATH 1WTGT 2YD8A 1JHLL 4PRIA 2XA3A 3QI9D 4YXKL 3O3UN 4XWGH 3RAJH 4A6YB 2D7OA 4JFZL 4AH2B 2DQGH 5F9JB 1KPVB 3KYMA 1MFAL 3RGVB 3GFUA 1K5NB 3CNKA 5E8OA 3H9SD 2OP4H 2ZCHH 3REWA 1G1CA 1K3ZA 2FX8H 4N0CD 3PQYA 3VFTA 4LVHB 2MFNA 1NAKH 3KGRA 1VFBA 1ORSB 4B0MM 4FQCL 2BFVH 3MCKB 4X6FB 1YNTB 4LSVH 4POZC 4MJID 2NLJA 1F58L 1HEZB 3HRZB 5I1CL 2OZ4L 2ERJB 3ORJA 4G9FE 4HHAA 3WMSA 2MCG1 3SJVB 3FB5B 1PY4A 1RK0A 3VMNA 4F7CA 1K9TA 2P5ED 4X7TB 1A6ZB 1U91A 4X6EA 1HQ4B 3RGVC 5KSAD 1RULH 1E0OB 3RHWF 4G6FD 3ROOA 5KZCD 3O6ML 5F3HB 1GAFH 2VISA 2XQBL 3FZUC 1SJXA 3E1F1 3ZE0F 4LVHC 3GHBH 1AGFB 1BGXH 1F02I 3I75A 1F4YL 2KH2B 3O3EA 4P23B 2BY2A 1EEUA 5C0FB 1FE8L 1TTUA 1S3KH 4GQ9H 3VFUB 1J05A 1RZ8A 3X11B 5M94B 3CFCL 5IV2A 3GSQA 4B7IA 2ERJC 4OKVB 1GIGH 3UAJC 2EYRB 1QBMH 2ZZUT 4H1LG 5BRZD 3T04D 2O5XL 2XRAH 4AY0A 5FB8A 5AD0B 2OJZL 4MZ3A 1RUML 3Q2CA 1FYTE 3IAGC 3HPJA 1E4XH 1Z9LA 4PLJC 1H3PL 3ARGA 1TJIL 4ELMA 1G6RH 4QRPE 1SBSL 1SVCP 2CLRB 2F5AL 1CD8A 3DVNB 2ID5A 5KZCB 1CVRA 4P23C 4Y5YB 1DBJL 2H3NA 4YEEA 3D69A 4JKLA 4K2UL 3B2UD 1CLYH 2OR8A 1BM3H 3D3VA 4CUCA 2HMIC 4Z7OF 4OLVH 4NQEE 1FVEB 1YEDB 5J1TC 2W0FA 2DD8L 4ENEC 3X3GL 4YDJA 2I5YH 2FJFB 3LOWA 4AEEA 4LPTA 2A9NL 1A7OL 1IM3B 3V4VH 3VD5A 2DBLH 3TVMB 4WEMB 4HSQA 2W9EL 3AU1A 1EERB 2VDPH 5AG8A 5IK3A 3PHOA 1GGCL 1FCCA 2CDGA 2P45B 4Y2OA 3TV3L 5C0CD 4Y5YC 3TLRA 3BT2H 5CBEB 3HUJF 4DUXA 2CDEB 3RRQA 1VGKA 4XAKD 5JW3H 1DUYA 1PQZA 1HXYA 4I5BB 4PJBB 4X6CA 1DSFH 4S1RL 4DAGL 3IJSB 2BOBB 1J1OH 1A9EA 1CG9A 2Y6SD 3BJLA 4CKVX 4M93B 5BV7H 1T4KB 4TSBH 1INDH 3RDTB 3D6GA 5MERB 1DBAL 4F7PA 4PJXB 1UM5H 2W59A 4IM8A 1ZTXL 3TVMC 1ZS8A 4WHDA 2WWMD 2OJEB 3IDMA 2VAJA 3VA2C 5BS0E 1ZHLA 5HGGS 1PG7X 4XPAL 4L8CB 2PYED 1LHZA 4WFFE 3L5HA 1LEKA 1RJZA 2BDNH 1A1MA 3JSSA 1JFQH 3B2UC 1B90A 1ACYL 1HHKB 4ZFOL 3NACH 3SBWC 5IM7A 5C0EB 5JXEA 4M93C 3TT3L 4OLUH 3RDTC 5SX4H 4X0KA 4NPYA 1CFQA 4M4PA 5E2UH 4GXVH 4CVZB 2F8VA 5DZOA 4GAJL 1UENA 1A1NB 1UFUA 2VWEC 1VADA 1G0YR 1VPOH 4HBQA 1ITBB 5AWNH 1KN2L 4UB0H 3MC0A 3VE0A 1BP3B 4HWBA 4FZ8H 2IBZY 4ZFGH 2HT2C 3N85L 1IAIH 2D7MA 2V5MA 4JVWA 1JZ3A 5JORA 4L3EE 3RZCD 5F21B 2JB5L 3ET9F 3FFCB 1OAQL 4HWBH 4OFVA 4D9QD 4JPKH 1CDIA 4XNYL 3OPZL 3P4MA 3IDNA 4JEGB 4ZTOL 5DK0A 1JPTL 4KY1H 5CLTA 2ZUXA 2ADIB 2ORBL 4F9LC 1N0XH 2C1PA 3MYJA 3L3GA 1B6UA 5DO2D 1FVCA 4LRIA 5I1KL 1BLNA 4Z7WA 4XMKL 3GK8H 4FP8L 4UBDC 1U8KB 1IC4L 4PGCA 3T09A 4EDXB 2GJ6B 2DIBA 4IHOA 3NVQA 4GW5B 3RTQB 3WFCL 3IKKA 2X4NB 1CT8B 1VEMA 4Q2ZA 2ZSVA 2HFGH 1NGPL 3PWJB 1Z3GL 3HNTL 4LAQH 1CQYA 3O6FD 4OCWL 3DXAD 4P2RD 5EN2A 4PRDA 4M7ZB 1AXSB 5J3HC 3NCBB 4FQLH 3KLDA 1R3LB 2D0FA 3U7WH 1CI5A 4YHZH 2G2RB 5ESQB 4JVPA 1FFPA 3V6FA 2DLFL 4L4VA 1KTRL 4H0GA 3M1BB 2E8ZA 5FM8A 2CJUH 3S37X 5C1MB 3VXPB 1Z5LB 4CADA 1KGCE 5CCKL 1KPRA 1MCQA 5AZ2H 2Y06H 4HFWB 3FTGB 3OKNA 1T20B 4TYUA 1B4RA 3MRQB 4K7PY 1I8IB 2P7TB 1JK8A 1OGTA 2YEZA 3CH1A 1OP5H 3L5IA 2AXFB 3EFDH 3NPSB 4KJQD 3QXDA 1VEPA 1IQWH 5DJAB 3AREA 3TYFA 3BZFB 5EO0B 3BISA 4M7ZC 5L2JB 3PE9A 1LDSA 1NCAH 4O4YL 2XV6B 3MOAH 3WFDL 1P6AB 3DYPA 5D9SA 2K7QA 3FB8B 2YPLA 3VFMB 4RCAA 2WANA 5DK3A 5E8NA 3VWKB 5FGRA 4PJGA 1CTNA 1NFIB 5EO9B 1KCSH 3ZKND 4LLMB 4P4RB 3BH8A 4HAFA 4QHMA 1I1CA 5F88A 3MNVB 2X4UA 2AK1L 4KKLC 4PRHA 3GO1H 4ISVB 5E2JA 3L3DB 3MZGB 2ZPKL 1N26A 5FGCE 1N6VA 3NPSC