2H2ZA

Crystal structure of sars-cov main protease with authentic n and c-termini
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
306
structure length
306
Chain Sequence
b'SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDTVYCPRHVICTAEDMLNPNYEDLLIRKSNHSFLVQAGNVQLRVIGHSMQNCLLRLKVDTSNPKTPKYKFVRIQPGQTFSVLACYNGSPSGVYQCAMRPNHTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGKFYGPFVDRQTAQAAGTDTTITLNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPLTQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGSTILEDEFTPFDVVRQCSGVTFQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Replicase polyprotein 1ab
publication title Production of authentic SARS-CoV M(pro) with enhanced activity: application as a novel tag-cleavage endopeptidase for protein overproduction
pubmed doi rcsb
source organism Sars coronavirus
molecule tags Viral protein
total genus 88
structure length 306
sequence length 306
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2006-05-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1840.10 Mainly Alpha Orthogonal Bundle main proteinase (3clpro) structure, domain 3 main proteinase (3clpro) structure, domain 3 2h2zA03
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2h2zA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2h2zA02
3BG4B 1AKSA 3ODDA 1P2QA 3LKWA 3G01A 1NFWA 7GCHG 3HPTB 2F9PA 1S84A 1PPZA 1DX5M 1HAOH 4Q7YA 5EXNA 2R2MB 1AVXA 1XXFA 1XVOA 3TH3H 3SU2A 1F7ZA 2BY6X 4CRFA 1DY8A 2AYWA 2XBWA 4GVUA 2NU3E 4IS5A 3B8JA 4BAQB 3SV7A 2THFB 3ZVBA 1TMBH 2ZIQH 2QXJA 1GBLA 1QA0A 4NIXA 1ELDE 4H42U 4PROA 2FOEA 3T2NA 1MH0A 4AORA 1PPFE 2BY5X 3M7UA 2ZQ1A 1D6WA 3A84A 2QYIA 2A5KA 5DP4A 1DFPA 1YKTA 2ZPQA 2VIOA 4X6MA 2EC9H 3RXHA 1QFKH 3P8FA 1AE8H 1EUFA 2FIRH 4YO9A 1C5MD 1OOKB 4FU7A 1EAUA 2YOLA 3SI4H 2GT7A 1ID5H 1FPHH 1Y5BT 3T62A 3ZZ7A 1A7SA 2BXTH 2GV6A 1IQHA 5C5NA 4ABFA 3QUMP 3JZ1B 3NK8A 1AWHB 2SGDE 3A85A 2FOBA 2VVUA 5HGGA 2ZPSA 3V7TA 2QF0A 4B76A 3GY3A 2ZNKH 3TGIE 1NO9H 1D9IA 2ZA5A 1TOMH 4KP0A 1TA2A 1EPTB 1A61H 4Q2KA 1HYLA 1L4ZA 1ETRH 1EZSC 1J8AA 1UTOA 4A6LA 3ELAH 2A4GA 1ANBA 3IWMA 5I46H 1C9TA 3RXGA 4Y7AA 5DK1A 1G2MA 3BIVH 3TNTA 8ESTE 3A87A 1D3PB 1C5WB 1D3DB 1V2QT 3M5LA 3U98H 1YCPM 1DDJA 4JZ1A 2P3FH 2SGAA 1TGTA 2BD8A 1MTNC 1C2HA 1QRXA 1OKXA 4IC6A 1Y3XA 1NRNH 1GJ4H 2FTMA 2BMGB 1ELVA 1FJSA 3B9FH 4TWWA 1QR3E 1AFEH 5EOKA 3H7OA 3A80A 3EA9A 5GIBA 5AHGH 2ZDNA 1PPCE 3BTHE 3GY5A 2OCVB 2P94A 3RLYH 1JOUB 1GG6C 1BTZA 3A8AA 3BTWE 3I77A 3PTNA 2BD9A 1P04A 2FLRH 1J16A 1IOEA 3D62A 3W95A 1O2TA 2FOMB 1BRBE 2SGFE 4FUIA 1O2SA 4I8KA 2ZTYA 3TH4H 1HDTH 1TAWA 2I6SA 4ISIH 2GCHG 2QIQA 1GI2A 2Q6GA 1ZHRA 1RFNA 4YLQH 4E7NA 2FX4A 1GG6B 1E35B 3RXVA 4ZXYH 1MD8A 4K5ZA 1VZQH 2HPQH 2BDCA 3QDZB 2Z3CA 3STJA 3QLPH 1HJAB 3FAOA 1CT0E 4DW2U 1MZAA 1T8LA 2FDAA 3GY7A 2Y82A 1FY8E 4NA8A 5AFZH 1O5AB 2O9QA 6CHAC 1YPKH 3KL6A 3A89A 2XWBI 2A1DB 2ZFFH 1LVMA 3SU3A 4H6SB 3RXTA 1EXFA 3QTVH 1OXGA 5LH8A 4Y6DA 2KAIA 1BUIA 1TB6H 5EPNA 3SJIA 1V2MT 4HGCA 1XUHA 2OBOA 5ESTE 4FUBA 1QCPA 1EOJA 1O2GH 2BYAX 3QK1A 4MNYA 1GI0A 1ZZZA 2XBXA 3DFJA 3ZZ4A 1RTKA 4BAHB 2FI4E 3BEUA 4ABGA 1TOCB 1NU9A 4X1RU 3RM0H 2CXVA 4K8BA 2FS9A 4K69A 2AMDA 2UWOA 1J9CH 1SFQB 1ZPZA 1SLWB 3E6PH 4WF8A 4ISNA 1ANDA 1GHBF 1GVLA 1LMWB 4AG2A 3QN7A 4A5TS 1FN6A 3VFEA 1TA6A 1EP5A 1HAIH 2F9UA 2XBYA 4I33A 4DOQA 1LCYA 1C2GA 1NRRH 4NCYA 3RMMH 4AFUA 2BD3A 2BY9X 3TJOA 3GCHC 1DPOA 3SV2H 2OP9A 2ZU1A 1A5GH 3GISB 3CS0A 4OS1A 1J15A 4MPXA 1GMDG 4XFQA 3E90B 2Y80A 4I8GA 8LPRA 4JZEH 4WY3A 1S83A 1YPJH 2UWPA 4IGDA 5LPRA 1HJ8A 2OQ5A 4FUGA 3ATIA 1HAGE 1ZGVA 4YZUA 4DG4A 2ZWLH 1FY1A 5C1UA 4NZLA 1C2DA 1KXAA 3GDUA 3TJVA 3MWIU 2ODYB 1IQMA 2ASUB 2GTBA 4CH2B 1LQEA 1O5GH 2RG3A 1A3EH 2V6NA 1JXPA 4GHQA 3TH2H 5FAHA 1J14A 4GUXA 1XKBC 5DP8A 5CHAB 5F8XA 4YOIA 2NU1E 4LZ4B 4OGXA 3M61U 1FI8A 1C1OA 2XC0A 2O8UA 1WOFA 4WH6A 4NFEA 1LKAA 3SN8A 3LJJA 5C1XA 3GY2A 2AIPA 3TPIZ 3QX5H 1GGDB 3SU4A 2H5DA 2QAAA 1K21H 3QZQA 1NPMA 2ZGHA 5F6MA 1P9SA 2DE8A 3LOXA 2CHAC 4NA7A 3A82A 3LONA 3MO3A 1H4WA 1OPHB 1YYY1 1AVWA 1LPGB 3O8BA 3SZNA 4GHTA 1QL9A 1YLDA 2NWNA 5EQQA 1UVSH 2ZDAH 1AZ8A 1VITF 4NIYA 3NCLA 4Q7ZA 2LPRA 3GYLB 3PV4A 4ZHLU 4X2XA 4HI3A 5A0AE 1UCYE 2Z9LA 4X1SU 1UTLM 4X8SH 4TPIZ 1NFUA 4CRDA 3UOUA 1GJDB 1MCVA 1S85A 1EX3A 2PKAB 1K2I1 2H6MA 4DIIH 5H4IB 1GBHA 3FVFB 3E0NB 3Q77A 1O2KA 3GCTF 1O2IA 1HLTH 2BZAA 1TX8A 4GLYA 1V2LT 1ANCA 2A45B 3HKIB 3M35A 1TGSZ 1W12U 1LVBA 2BQ7B 1F5RA 2P93A 2ESTE 1Y3WA 3SV9A 1UK3A 1FMGA 2ZZUH 2G8TA 1SOTA 1ABJH 1HFDA 1HAVB 3BF6H 3U69H 1ARCA 2SGPE 1TMUH 4XOJA 3VGCC 1G3CA 3P17H 2PSXA 3ESTA 1P3CA 5FPSA 2O8WA 1C5PA 3VB4A 1N6XA 1OX1A 3TLOA 1W11U 3GYMA 1IQLA 3NUMA 1SQTA 1BIOA 2RA3A 4Y0ZE 1YF4A 1UTKA 1BTXA 2BX3A 5EGMA 2C8ZB 3SJOA 1QJ1B 1EATA 1TNKA 2K1QA 3RXSA 1H8DH 2IN2A 2ZDMA 2F83A 1Q31A 3ZVEA 2VVCA 3TGKE 3UREA 1QGFA 2SNVA 3VGCB 1EJMA 1O3OA 1BHXB 1HRTH 3SNEA 1DWBH 5B6OA 4BANB 1SGFA 1RIWB 4CRGA 2OUAA 4I8HA 1O3JA 4FU9A 2JETC 2ZI2H 3D23A 2FXRA 3A7XA 1CT4E 3MI4A 3VB7A 2WYGA 3BEIB 1EQ9A 3PO1B 2ZDLA 1EZXC 1O2UA 1XMNB 2HRVA 4KTUA 4TY6A 5A2MH 3F68H 1UTQA 1FAKH 1V2ST 5EW2H 3LGVA 1O3GA 3PMHB 1DWCH 1VGCB 1V2JT 2H9HA 3P70B 2JH5D 3RXMA 3F9GA 1V3XA 1JRSA 4B1TA 2FOCA 2P8OB 1OWJA 1SMFE 4OS6A 2W7UA 2HOBA 1E37B 3E1XB 3V12A 5PTPA 3GY6A 1PQ8A 1ETTH 2GMTB 3VEQB 2OC8A 3ZZ3A 4H4FA 1GHYH 1Q2WA 1CT2E 1TE0A 4FXGH 1QBNA 1Z6JH 1IQFA 1GCDA 1SHHB 1DVAH 5FBIA 1UK4A 4WXVA 1T8MA 2GZ7A 2LNCA 1BTUA 3MFJA 1O3BA 1QRZA 3MH7A 1ZR0A 4JK6A 4YESB 1HGTH 2C3SA 1TNHA 1T8OA 1KXFA 1C1VH 3A7VA 3URCA 1YPLH 1P8VC 4ABIA 1HAXB 2WPJS 5JBTA 1C4Y2 1O5DH 2FYRA 3UY9A 2G4UA 4CRBA 1AMHA 3GCOA 3A7ZA 3GCNA 3U8RH 1KLJH 2ZHWH 3U1JB 1QA7A 1Z8IB 2B9LA 1UTPA 3F9EA 5LPFA 2FOFA 3STIA 1ZSKA 2ZTXA 1C1PA 1SLVB 3UWJH 5FCRA 3MTYA 1O2JA 3TIUA 5DP6A 3T27A 5CE1A 2OC0A 2BVXH 1KDQB 1W13U 3QGNB 1SR5C 4D76A 1CA0B 3PYHA 1MTWA 3SJ8A 2VINA 8GCHG 3A88A 4CBNA 1W0ZU 1QB9A 3N7OA 2UUYA 5CMXH 1O3MA 1ZTKA 1L1JA 2V3HH 4KTCA 1KLTA 1O3IA 1C4V2 3DHKH 1YP9A 1S82A 2G52A 4AB8A 1ELAA 1P2JA 1C9PA 2O8LA 1AIXH 4AZ2B 1X7AC 1QB1A 2ZU4A 3LH3A 4BAKB 4AN7A 1CU1A 4J1YA 5TCAA 2ZCHP 1BMLA 2B8OH 4DIHH 3BG4C 1Z6EA 2PLXA 2ULLA 1MU8B 3E16B 2BOHB 1XUFA 1SLXB 1NM6A 2TBSA 2V0BA 1FDPA 2GX4A 1BTWA 1TBRH 4AFQA 2BQ6B 1BTPA 1XKAC 1DITH 2FI3E 2XCFA 4KKDA 4ZUHA 1BITA 2ZU3A 2TIOA 1BJVA 3A8CA 3TVJB 3KF2A 2A4OA 2ANMH 1GL0E 4FVBA 2W26A 2GVFA 1ZYOA 2Y81A 2Z6BD 5HM2A 3T25A 1C5TA 1MKXK 4AFZA 1A3BH 3RM2H 1CQQA 4OGYA 3ZYEA 4Z0KA 1WU1A 1XXDA 2BM2A 2Y5HA 2WPLS 2QGRA 1MTUA 3EE0B 2BD2A 3S69A 3AVZA 1G3EA 1C1TA 2BOKA 5G4BA 3IG6B 4ISHH 3AAUA 1VJAU 2YNBA 3OX7U 1C5UA 2QXHA 1A0LA 1P03A 1TONA 4UFEH 2D1JA 1BBRK 5L2YH 1RD3B 1GVZA 4UE7H 1OP0A 1HPGA 2VIVA 1CGHA 4FUDA 4INLA 5HMAA 7ESTE 1O2MA 2CJIA 2RCEA 1RGQA 5DGJA 3SUDA 3VB5A 1NRSH 1V2UT 2W7SA 3ZVCA 2D26C 2K7XA 1TYNA 1TFXA 3SW2B 1O2RA 1B7XB 2R3UA 1ZLRA 1ANEA 2FPZA 5DPAA 2C90B 3DUXH 2BXUH 2A2XH 3KQCA 1EPTC 2F3CE 4FU8A 2H9EH 3EQ0H 4CHAB 1O39A 1O0DH 1EZUC 1ESBA 1FPCH 2UUFB 1GHBG 3MHWU 2G5VA 1A2CH 3SOSA 1OYQA 1QBVH 5L6NH 1LHEH 3U9AH 5I25A 2NU2E 1H1BA 1PJPA 2GCTB 4JMYA 1C2KA 3SV8A 1FLEE 2ZHDA 2GP9B 1T31A 3FZDA 3A7YA 4ABEA 3VXEH 2BDYA 2A0QB 2FESH 1MU6B 2A4RA 2J9NA 1SGTA 2BDGA 4MNVA 1P09A 1F5LA 3EYDA 3L6PA 5JBBS 1FV9A 2PKSB 1B5GH 3A81A 1ZMNA 1W7GH 2XNIA 1P2IA 1ZMJA 1WTHD 1BT7A 4Y76A 2J92A 1BTHH 2FI5E 1NESE 4B2CA 1ESTA 4U01A 1IQKA 2BVSH 2XRCA 2FX6A 1AY6H 3PM3A 2ZFQH 3LGWA 3UUZA 1DT2A 2CV3A 2J95A 1O35A 4B71A 3DT0H 3I78A 4B73A 1N1LA 1HIAB 2A31A 1IQJA 1SGNE 5HYOA 3E91A 3R3GB 1KXEA 1UTMA 1A4WH 5C1YA 2J34A 1V2NT 2AGGX 1GDNA 3A86A 1OP2A 1TPOA 1SHYA 1OP8A 1HJAC 1FQ3A 1C5VA 1G3DA 2Z94A 1UK2A 3S7KB 3MNSA 7KMEH 4ZKRU 1ELCA 1QQUA 3NPSA 5JYIA 3RLWH 1SGQE 4FUCA 1KXBA 1GCTB 1NRPH 4NG9H 1LPZB 3FP8E 1SI5H 2XYAA 2D2DA 3M3SA 2A7HA 3A8DA 3TJNA 1MD7A 2TPIZ 3IITA 3D65E 2ZQ2A 4GCHF 5F03A 3MO6A 1EASA 4ABAA 1VITG 3O8DA 3SJ9A 1V2TT 1C1MA 2ZTZA 2R3YA 3A7WA 3KEEA 1NU7B 4TWYA 1YCPK 4GPGA 2ZDVH 5E2OA 1AE5A 1OYTH 5GDSH 1WYKA 1C2IA 2Z9KA 2Y7ZA 3ZZCA 3ATMA 3RC4A 4X2WA 4HFPB 4GAWA 1AWFH 4Y71A 3LC5A 4JCNA 3GCTG 2ZKSA 1G37A 4I31A 3K9XB 3EAJA 4Y79A 2HLCA 1P2MA 1KYNA 2ALVA 1E34B 1NTPA 1O3EA 1YC0A 3SJKA 1ZSJA 1DICA 4ZHMU 1SQOA 1SGIB 2C8YB 5JBCS 2PTCE 3TU7H 4NSVA 4XBBA 5BPEA 2GGVB 2Z7FE 1BB0B 2PUQH 3DD2H 5ABWA 2ODQA 3SHAH 2BB4A 3FZZA 3SU0A 1CO7E 1XUIA 1C2MA 2VIWA 5JDUB 1KTTB 3F9HA 3RXAA 1PYTD 1CVWH 1XUGA 2NU4E 2VB0A 1Z71A 2VGCB 2ALPA 1FIZA 1YPHE 1K1MA 4D9QA 1AGJA 1DSUA 1FIWA 1O3LA 1SBWA 2FODA 1C5ZB 2OD3B 1Z7KA 4WXIA 1UTJA 4AG1A 3RC5A 1A5HA 2OC1A 4X1NU 4ZHAA 1SGFG 2VWNA 2G00A 4AYYB 1QL8A 4I8LA 4ABHA 4WMEA 1P10A 5FPTA 1IAUA 2BTCE 3OTJE 3M3VA 3S0NA 1PPBH 4CR5A 1EAIA 4DY7B 2OXSA 4WWYA 1HAPH 1KLIH 1SQAA 1WAYB 2W5EA 2BLWA 1G30B 3GY8A 4AGJA 1Y59T 4E05H 1OWDA 5CHAC 1V2PT 1TRYA 1LVYA 5E2PA 3SORA 2ZU5A 1EPTA 5FX6A 3SUFA 1AB9C 1Y3UA 1OWIA 1MQ6A 1SOZA 4O3UA 4IMZA 3LT3A 1Q3XA 3K6YA 4YM9A 3RU4E 4ZMAH 1O2LA 5C20A 1BQYA 2BD5A 3M5OA 5TJXA 5K7RA 1MKWK 2EA3A 1SGDE 1GGDC 1QHRB 1FY4A 4Y7BA 2ZF0H 4MG3A 4A92A 1TABE 1O2OA 2WV5A 4Y8ZA 1O2XA 2BD4A 2R0LA 4ABBA 1GBDA 3MU1A 3E8LA 3PB1E 3LGTA 3EA7A 3RXOA 3QTOH 1TNLA 3AASA 2F9VA 3WY8A 1AB9B 2EI8A 2J2UA 5HXFA 4O9VA 1JRTA 3V0XA 3BG8A 1GI9B 5T3HA 3EGKH 4LZ1H 6ESTA 2RA0A 4ABDA 4D7GA 2TGAA 3EA8A 4ISOA 2C8XB 1SGEE 2XXLA 3MU0A 5A0CA 4D9RA 1C1WH 1O2ZA 3F9FA 1K1JA 2UUJB 2ZHEH 1SPJA 1C5RA 3SUEA 1AUTC 1EB2A 2ZG0H 2ZFTA 1GJ9B 4B74A 4A1TA 2FOAA 1AUJA 1GHAF 4E06H 1KXCA 3OU0A 4MNXA 1TX7A 2VU8E 2ZFPH 2GT8A 3RDZA 1EJNA 3SBKA 3M5MA 2FEQH 3PLPA 4AGKA 1HAHH 3BTTE 1DANH 4B2AA 2G5NA 4BTUB 1LO6A 2GZ9A 4DJZB 3OYPA 1XUJA 1LHDH 5L2ZH 1HNEE 1RRKA 1ACBE 1UVTH 1MKXH 4UFFH 2A32A 1GBEA 1DWDH 2PGBB 3M36A 1GI1A 1EZQA 1NS3A 1LQDB 3RU4T 1ZRKA 4BAMB 1G3BA 1C5OH 1EAWA 3V13A 1EJAA 2OBQA 3W94A 3SU1A 1MTVA 2P59A 1UHBB 2CN0H 4MQAA 1CHGA 2O8TA 1VCPA 2SGEE 1IHTH 2PV9B 3DFLA 1BBRH 3UNQA 1L0ZA 2IPHA 2Y6TA 4MPVA 1JMOH 4WVPE 1JBUH 3M7QA 3RUOA 1HAZB 1IQEA 2G81E 4K60A 4SGAE 1W14U 3BTME 3KCGH 3T28A 1RIWC 1OS8A 2BQWB 3UNRA 4I8JA 2PGQB 1N8OB 1SGPE 3PO1C 9ESTA 2FM2A 1QB6A 2HWLB 1O30A 4MVNA 1EAXA 1RJXB 1Y5UT 1C1UH 3UPEA 1ABIH 1D4PB 3BEFB 1K1LA 3FANA 1AFQB 1VGCC 1S81A 1H9HE 1IHSH 2EI7A 1T4UH 1HJ9A 3MMGA 3PLKA 4YOGA 1O3HA 3MU4A 2NU0E 2CF9H 1P05A 6GCHF 2P8OC 2EEKA 3V3MA 2BDIA 3KN2A 3UNSA 3KIDU 1GBFA 1QY6A 1D6RA 2GMTC 4X2VA 1O5BB 1W2KH 1B0EA 1AI8H 1TBQH 3RXKA 3B23B 3P6ZB 4I32A 4Q7XA 1AKSB 3FP6E 1U6QA 1GBMA 3HK3B 4U30A 3VXFH 3RXUA 2R2WU 1V2OT 2J94A 1GHXH 3ZV8A 4ZAEA 1TPAE 3HKJB 3RMNH 5DKMA 2XW9A 1L4DA 2VIDA 4A1VA 1FZZA 1A0HB 4ZKOU 5JBAS 1P3EA 1O31A 3ZVFA 5JPMH 3C27B 3F6UH 3SO3A 3ZZ6A 5EG4A 1FAXA 1WQVH 4U2WA 1AO5A 3TGJE 1CHOF 3U1IB 5E8EH 1C5SA 3PLBA 1MAYA 1SVPA 2ZP0H 1JIMA 3UFAA 1O3CA 2VH0A 2ZDKA 1KY9A 1RS0A 2QCYA 4R0IA 1O5CB 2BX4A 4AYVB 3A83A 2O8MA 1QJ6B 1NN6A 2FZZA 2Y7XA 1NZQH 4AOQA 1GJ6A 4XE4A 1YPGH 2VIPA 2BDHA 1YPEH 4B75A 4X0WU 3UQVA 1O3KA 9LPRA 1CA0C 3EBNA 1ZPBA 1QNJA 4K1EA 3KNXA 1EKBB 1P02A 5E0GA 1HV7A 5EQRA 4INKA 1W10U 1GI4A 1O2NA 1S6HA 2Y5FA 5FHTA 4X1QU 1DUEA 1WTGH 2P16A 4NA9H 1GBTA 4ABJA 2ZO3H 5AVDA 3ZVGA 1Z8GA 1VR1H 1OSSA 2F9NA 1TPPA 3L33A 4CRAA 1C1SA 4X8TH 4XSKU 3QGJA 3C1KA 4K3JA 1GBAA 1YGCH 3O8CA 3GDVA 1UVOA 1C1NA 4GSOA 3KGPA 1CBWC 3RXBA 5JB9S 2PKAA 3KQBA 1F0RA 2AGEX 1TALA 1JWTA 2ZHQH 2ANYA 1DS2E 1WSSH 4FUHA 1AHTH 1O2HA 2H1UA 3P8GA 1ORFA 1THRH 5IYTA 1YCPH 2WPKS 1O2YA 1P2KA 1GJAB 2B5TB 1S0QA 4HZHA 1BCUH 4D8NA 1BOQA 1J17T 3RU4D 3BV9B 4JZIA 4ZXXH 3Q3XA 1RTFB 2BD7A 1HAYB 1TNIA 5EQSA 1PPEE 4BTIB 1PPHE 1GHZA 1CBWB 3GOVB 3MU8A 1Y8TA 4K1TA 1AD8H 2H9TH 2WYJA 1VCWA 2C8WB 1HAVA 2PHBA 1S5SA 1MMJN 1MAXA 4IMQA 4RKJB 5DG6A 1O2QA 3FFGA 2EI6A 3BTQE 2H2ZA 4GCHG 3EDXB 4YLUA 2TGTA 1Y5AT 2WV4A 1C5QA 1ESAA 1FNIA 1BHXF 3SUGA 2OLGA 2Z3EA 3P92A 3T26A 3UR9A 2XC5A 4E7RG 1O2VA 1QBOA 1ETSH 3SU5A 3OSYA 1KIGH 1PQAA 4AX9H 1K9OE 3Q3YA 1DM4B 2XWAA 3VB3A 1SFIA 2BDBA 2STBE 2Z9IA 1P0SH 1WCZA 3F1SB 2ZGCA 1LHCH 3ATWA 1A0JA 1G36A 4XBDA 1TRMA 2C93B 1ZTLA 4K2YA 4CHAC 1T4VH 4YT7H 3BN9A 5BRRE 4RKOB 4Y10E 4KGAA 1DLKB 1ELGA 3RXRA 1HB0B 5J4QA 2CGAA 2WPIS 4X6PA 1G2LA 2GCTC 5GWZA 1T7CA 1DWEH 1DY9A 1KTSB 2KAIB 1AQ7A 1L2EA 3A7TA 3S7HB 1SGRE 1D3TB 4RSPA 1MKWH 3RXPA 2BVRH 1O3NA 3R0FA 2FYQA 1QURH 2WUBA 4A7IB 2PKSC 1O32A 2VWMA 1F0UA 3SGAE 1P06A 3UOPA 3PROA 4JZDH 2Z9GA 1GMCF 1LDTT 3TNSA 2UUKB 3H7TA 4H6TA 1AU8A 3ENSB 1GBIA 4JK5A 1O33A 4NSYA 1GVKB 4Y8YA 3LJOA 3LU9B 3ZVAA 4AFSA 1G9IE 1D3QB 3M7TA 1O5EH 1XX9A 1C2LA 1C5NH 4NIVA 1MBMA 4JYUH 1HXEH 1MQ5A 1ZMLA 1GJCB 3MH4A 1BTYA 2ZCLP 2OTVA 1QL7A 3TK6A 2PWXA 3AW1A 4CR9A 4ESTE 4O97A 3ZVDA 4X6NA 1SG8B 3SU6A 3CS7A 3O8RA 1GDQA 4DT7B 1UMAH 3RXCA 1L1GA 4ZKSU 2HPPH 4WH8A 3NZIA 5AFYH 3HGPA 3BTKE 1IQGA 1E36B 2ZHFH 1KDQA 2BZ6H 1GPZA 1QIXB 1BMMH 3KHVA 4Z6AH 1PYTC 8KME2 2ZCKP 2W3KA 1GCTC 2GD4B 3T29A 3UIRA 4BAOB 4UONA 1NFYA 1ELTA 1ZHPA 3SHCH 3K65B 3RXQA 2TGPZ 1C5LH 2M5TA 1PPGE 4CH8B 3RMOH 1GMHF 4ISLA 1LVOA 1E38B 1ZJKA 3ODFA 3RXJA 1TGNA 2PFEA 1NROH 5FCKA 4NFFA 3PMJA 5GCHF 4NWKA 1UTNA 8GCHF 4MLFB 1GJ8B 1L1NA 2FMJA 1GJBB 4F49A 4BXWA 2QV1A 1VJ9U 1FXYA 4ZH8A 1GBBA 1W3CA 3D49H 3AAVA 3K2UA 1UO6A 3E3TA 1WBGB 4UEHH 2HGTH 3SI3H 1EP6A 5A8YA 1GHAG 2V3OH 2IJOB 1PFXC 1SC8U 2HNTE 1ZHMA 1MTNB 5T6GA 5L30H 1V2VT 4X6OA 1KSNA 3K6ZA 5K0HA 2G4TA 1HBTH 4IC5A 1BBRE 3QWCH 1GI7B 1LPKB 1ZGIA 3PTBA 1GBKA 1HUTH 3RXFA 2A7JA 4O03A 2Z9JA 1CSOE 2R0KA 3PWCA 1SL3A 2FOHA 1H9LB 4WJG2 1ZSLA 3ITIA 4YT6H 2HVXA 3UQOA 2OC7A 1K1OA 2VGCC 2ILNA 1T8NA 3DA9B 3HATH 4ZROA 2PUXB 5E0HA 1NRQH 2W3IA 3OY5U 2DUCA 3MNXA 3SNBA 3SNCA 1A1RA 2F9BH 4INHA 1NC6A 4OS2A 2FS8A 4Q80A 3M5NA 1GL1A 1BDAA 1GHWH 1ZPCA 3RP2A 2DE9A 2BLVA 2PR3A 7GCHF 4QT8C 3PMAB 4NGAH 1C1RA 2VWOA 1DLEA 1DUAA 1GI6A 3LPRA 4FVDA 4THNH 1C2EA 1Z8RA 1UCYK 2VNTA 4I7YH 1VITH 2J4IA 5SGAE 3S9CA 5DP9A 4MTBA 3U8OH 1V2KT 4UFGH 1C1QA 1GI8B 4O3TA 2QF3A 4UDWH 3A8BA 2BHGA 2FOGA 1SGYE 3M37A 1KXDA 4IW4E 4NWLA 3SV6A 2J38A 1P9UA 3L3TA 5LGOA 1FN8A 6CHAB 2RDLA 5C5OA 1O3AA 2CF8H 3ATKA 1C5XB 1JIRA 1BMAA 1ELBA 1TNJA 1YLCA 4KELA 2Q6DA 1GWAA 1C2JA 4CBOA 3Q3KA 6GCHG 3HK6B 5GPIB 1K1PA 1P01A 5A8ZA 1PQ5A 1F0TA 1F92A 1BRUP 2BY8X 2QC2A 2G51A 1F2SE 1MZDA 2FTLE 4MPWA 1K28D 4FUFA 1K1IA 5TCCA 4RN6A 1O3DA 2PSYA 4DVAU 2VVVA 3LIWA 1HXFH 5EU8A 3SGQE 1CA8B 3AW0A 1ZRBA 1GHVH 4ASHA 2A7CA 2GV7A 5J4SA 3BTEE 1TRNA 1RXPA 2ZFRH 5F8TA 2WUCA 2V35A 3ZYDA 1WUNH 1A5IA 1CHOG 1DOJA 2CMYA 5FBEA 4LK4A 1HIAA 1V2RT 4Y0YE 2WPHS 3GCHB 3VB6A 4CREA 6LPRA 1QQ4A 2ANKH 2AFQB 4TYDA 2ZECA 4K8YA 5ETXA 5EXLA 1F5KU 5EW1H 1TGBA 2JH6D 2OINA 2VH6A 1BMNH 3LH1A 4JYTA 5FX5A 1DXPA 2G55A 5DP3A 2IOTA 1OWKA 4HTCH 2HNTC 1V6DA 2Q1JA 1LTOA 2FP7B 3UWIA 4KTSA 4Y8XA 4X8VH 3U8TH 1TGCA 1IQNA 2R9PA 1GBJA 5EODA 1GJ7B 2XTTB 2A5IA 1ELFA 5F8ZA 4OS5A 1W0YH 3UR6A 1RTLA 1DE7H 2VWLA 1T32A 4NIWA 3Q76A 1O5FH 3MNBA 3S9BA 2F91A 3MOCA 1BRAA 1MBQA 1Z8JB 3NWUA 5ESBA 3LC3A 4JYVH 3CP7A 2GCHF 5C67A 2TRMA 1Y3YA 3LGYA 5FPYA 1FY3A 4BOHA 4R8TB 2FLBH 1MCTA 1XVMA 4TPYA 1O36A 1XUKA 3TJUA 2Y5GA 4IN2A 3ZZ8A 1THPB 2BDAA 2XC4A 1SLUB 3NKKA 2FWWA 2XBVA 1C5YB 1MUEB 1N8OC 1QJ7B 3LDXH 3UTUH 1G32B 3BIUH 2AMPA 1TBZH 5C2ZA 3SGBE 2CHAB 4OS7A 3OY6U 1SGCA 2ZC9H 4X2YA 1CGIE 4X8UH 2C4FH 3E0PB 1SB1H 1AFQC 1P2NA 1O37A 2ZGJA 1BZXE 4UD9H 1ARBA 2XCNA 1W7XH 1YPHC 1V2WT 1C2FA 3P8OA 1H9IE 3HGNA 1EB1H 2UWLA 5FXLA 2QXIA 3BSQA 2TGDA 1UVPA 3SNAA 1UJ1A 2B0FA 1XM1A 1LKBA 1TWXB 1P11E 1HCGA 3H5CB 2QA9E 5DP7A 1GI3A 4LXBH 3NXPA 2FO9A 1M9UA 2ZFSA 5EPYA 5T6FA 4ZKNU 3RXLA 3T5FH 5JB8S 2ZU2A 2ODPA 4A1XA 1VCQA 2ZEBA 1O38A 1GJ5H 3TK5A 1NFXA 1O3PB 1N6YA 2AGIX 4BTTB 3SQEE 4TY7A 1C4U2 3ZV9A 4XDEA 1DXWA 3MYWA 1OWHA 1K22H 1EOLA 5EXMA 2Q6FA 3BTGE 4FUEA 5DJ7A 4BXSA 1CE5A 1O2PA 3QZRA 5GXPA 1BJUA 3TITA 2AH4X 3M3TA 3MO9A 2B7DH 1GI5A 5A8XA 4IBLH 2JKHA 1GMDF 1NY22 3MU5A 4BNRA 2AEIH 4J2YB 1TPSA 2F9OA 2ZGBH 3P95A 2I6QA 1AZZA 1O3FA 4VGCC 1CGJE 1GBCA 3QO6A 3GY4A 4DGJA 1TIOA 3S9AA 1K1NA 4X1PU 1GMCG 1NT1A 1ZOMA 3RXEA 2ANWA 1W8BH 1WV7H 4XBCA 1H8IH 2AIQA 2SNWA 7LPRA 1A46H 3GDSA 1P12E 3SNDA 4SGBE 1P57B 2WPMS 1AN1E 5C3NA 2JETB 2GZ8A 4MDSA 4DURA 2VJ1A 1LHGH 4YOJA 1ZTJA 3PMBB 1WQSA 2Z3DA 2LIZA 1THSH 4VGCB 4B2BA 1AVGH 1SSXA 3BTFE 5DP5A 1Y3VA 2GKVE 3SQHE 1ZJDA 4Y11E 3ZZ9A 2QXGA 1S0RA 3GICB 3MH5A 1O34A 3RMLH 2VIQA 2P3TB 1TLDA 2HNTF 1FUJA 3CENA 5IDKA 2P3UB 3ZZBA 3ZZ5A 2AERH 2STAE 1ELEE 2YNAA 2PW8H 2ZGXH 2ZPRA 1TNGA 5AF9H 2BLQA 2H5CA 4MNWA 1INCA 1TX6A 4MPUA 1P2OA 2HALA 4U32A 4CRCA 1YBWA 1IQIA 4K1SA 1BRCE 1DSTA 5A0BA 1YPMH 2SFAA 3KQEA 1FY5A 2AS9A 3RXDA 4DCDA 2A5AA 2BLOA 1GMHG 1Z1JA 1QRWA 3ZZAA 2JH0D 1UHBA 5GCHG 1GDUA 1QTFA 2OQUA 4FUJA 1TMTH 3RXIA 3JZ2B 2QN5T 3LGIA 3TK9A 1TQ0B 4YTAA 1OWEA 3FP7E 1LHFH 3ATLA 4M7GA 4F4OC 3LGUA 1UVUH 3P8NA 3BTDE 3RC6A 2A4QA 1UCYH 3VPKA 5A09A 1E0FD 1Z1IA 1MTSA 1PQ7A 3I29A 2PTNA 1O2WA 4OS4A 3KQDA 5T6DA 3MNCA 3URDA 4AB9A 1YM0A 1FONA 4D7FA 4JZFH 2AMQA 2P95A 4IN1A 3ZZDA 2SGQE 2QY0B 2D8WA 3MH6A 5LPEA 3Q00A 2GDEH 4LOYH 4WMDA 2A2QH 2WINI 5HM9A 4UFDH 5E0JA 4NZQA 1B0FA 1TQ7B 5GJ4B 2BY7X 4WMFA 1S6FA 1BA8B 2GDDA 5DO4H 3PWBA 1F0SA
chains in the Genus database with same CATH superfamily
3BG4B 1AKSA 3ODDA 1P2QA 3LKWA 3G01A 1NFWA 7GCHG 3HPTB 3OEHD 2F9PA 1S84A 1PPZA 1DX5M 1HAOH 4Q7YA 5EXNA 2R2MB 1AVXA 1XXFA 1XVOA 3TH3H 3SU2A 1F7ZA 2BY6X 4CRFA 1DY8A 2AYWA 4ACAA 2XBWA 4GVUA 2NU3E 4IS5A 3B8JA 4BAQB 3SV7A 2KX4A 2THFB 3ZVBA 1TMBH 2ZIQH 2QXJA 1GBLA 1QA0A 4NIXA 2HVYB 1ELDE 4H42U 4PROA 2FOEA 3T2NA 1MH0A 3VG8A 4AORA 1PPFE 2BY5X 3M7UA 2ZQ1A 1D6WA 3A84A 2QYIA 2A5KA 5DP4A 1DFPA 1YKTA 2ZPQA 2VIOA 4X6MA 2EC9H 3RXHA 1QFKH 3P8FA 1AE8H 1EUFA 2FIRH 4YO9A 1C5MD 1OOKB 4FU7A 1EAUA 2YOLA 3SI4H 2GT7A 1ID5H 1FPHH 1Y5BT 3T62A 3ZZ7A 1A7SA 2BXTH 2GV6A 1IQHA 5C5NA 4ABFA 2LP6A 3QUMP 3JZ1B 3NK8A 1AWHB 2SGDE 3A85A 2FOBA 2VVUA 5HGGA 2ZPSA 3V7TA 2QF0A 2F4LA 4B76A 3GY3A 2ZNKH 3TGIE 1NO9H 4Z1MD 1D9IA 2ZA5A 5EJ1A 1TOMH 4KP0A 1TA2A 1EPTB 1A61H 4Q2KA 1HYLA 1L4ZA 1ETRH 1EZSC 1J8AA 2K0QA 1UTOA 4A6LA 3ELAH 2A4GA 1ANBA 3IWMA 5I46H 1C9TA 3RXGA 4Y7AA 5DK1A 1G2MA 3BIVH 3TNTA 8ESTE 3A87A 1D3PB 2QE7D 1C5WB 1D3DB 1V2QT 3M5LA 3U98H 1YCPM 1DDJA 4JZ1A 2P3FH 1E79D 2SGAA 1TGTA 2BD8A 4RT1A 1MTNC 1C2HA 1QRXA 2EQNA 1OKXA 4IC6A 1Y3XA 1NRNH 1GJ4H 2FTMA 2BMGB 3F3BA 1ELVA 1FJSA 3DSGA 3B9FH 4TWWA 1QR3E 1AFEH 5EOKA 3H7OA 3A80A 3EA9A 5GIBA 5C17A 5AHGH 2ZDNA 1PPCE 3BTHE 3GY5A 2OCVB 2P94A 3RLYH 1JOUB 1GG6C 1BTZA 3A8AA 3BTWE 3I77A 3PTNA 4YXWD 2BD9A 1P04A 2FLRH 1J16A 1IOEA 3D62A 3W95A 1O2TA 2FOMB 1BRBE 2SGFE 4FUIA 1O2SA 4I8KA 2ZTYA 3TH4H 1HDTH 1TAWA 4F48B 2I6SA 4ISIH 2GCHG 2QIQA 1GI2A 2Q6GA 1ZHRA 1RFNA 4YLQH 4E7NA 2FX4A 1GG6B 1E35B 3RXVA 4ZXYH 1MD8A 4K5ZA 1VZQH 2HPQH 2BDCA 3QDZB 2Z3CA 3STJA 3QLPH 1HJAB 3FAOA 1CT0E 4DW2U 1MZAA 1T8LA 2FDAA 3GY7A 2Y82A 1FY8E 4NA8A 5AFZH 1O5AB 4B6FA 2O9QA 6CHAC 1YPKH 3KL6A 3A89A 2XWBI 2A1DB 2ZFFH 1LVMA 3SU3A 4H6SB 3RXTA 1EXFA 3QTVH 1OXGA 5LH8A 4Y6DA 2KAIA 1BUIA 1TB6H 5EPNA 3SJIA 1V2MT 4HGCA 1XUHA 2OBOA 5ESTE 4FUBA 1QCPA 1S6LA 1EOJA 1O2GH 2BYAX 3QK1A 4MNYA 1GI0A 1ZZZA 2XBXA 3DFJA 3ZZ4A 1RTKA 4BAHB 2FI4E 3BEUA 4ABGA 1TOCB 1H8ED 1NU9A 4X1RU 2KZ4A 3RM0H 2CXVA 4K8BA 2FS9A 4K69A 2AMDA 2UWOA 1J9CH 1SFQB 1ZPZA 1SLWB 3E6PH 4WF8A 4ISNA 1ANDA 1GHBF 1GVLA 1LMWB 4AG2A 3QN7A 1E1RD 4A5TS 3WWBA 1FN6A 3VFEA 1TA6A 1EP5A 1HAIH 2F9UA 2XBYA 4I33A 4DOQA 1LCYA 1C2GA 2J98A 1NRRH 4NCYA 3RMMH 4AFUA 2BD3A 2BY9X 3TJOA 3GCHC 1DPOA 3SV2H 5FL7D 2OP9A 2ZU1A 1A5GH 3GISB 3CS0A 4OS1A 1J15A 4MPXA 1GMDG 4XFQA 3E90B 2Y80A 4I8GA 8LPRA 4JZEH 4WY3A 1S83A 1YPJH 2UWPA 2L74A 4IGDA 5LPRA 1HJ8A 2OQ5A 4FUGA 3ATIA 1HAGE 1ZGVA 4YZUA 4DG4A 2ZWLH 1FY1A 5C1UA 4NZLA 1C2DA 1KXAA 3GDUA 3TJVA 3MWIU 2ODYB 1IQMA 2ASUB 2GTBA 4CH2B 1LQEA 1O5GH 2RG3A 1A3EH 2V6NA 1JXPA 4GHQA 3TH2H 5FAHA 1J14A 4GUXA 1XKBC 5DP8A 5CHAB 5F8XA 4YOIA 2NU1E 4LZ4B 4OGXA 3M61U 5HKKD 1FI8A 1C1OA 2XC0A 2O8UA 1WOFA 4WH6A 4NFEA 1LKAA 5CDFE 3SN8A 3LJJA 5C1XA 3GY2A 2AIPA 3TPIZ 3QX5H 1GGDB 3SU4A 2H5DA 2QAAA 1K21H 3QZQA 1NPMA 2ZGHA 5F6MA 1P9SA 2DE8A 3LOXA 2CHAC 4NA7A 3A82A 3LONA 3MO3A 1H4WA 1OPHB 1YYY1 1AVWA 1LPGB 3O8BA 3SZNA 4GHTA 1QL9A 3WW7A 1YLDA 2NWNA 5EQQA 1UVSH 2ZDAH 1AZ8A 5IK2D 1VITF 4NIYA 3NCLA 4Q7ZA 2LPRA 3GYLB 3PV4A 4ZHLU 4X2XA 4HI3A 5A0AE 1UCYE 2Z9LA 4X1SU 1UTLM 4X8SH 4TPIZ 1NFUA 4CRDA 3UOUA 1GJDB 1MCVA 1S85A 3SZEA 1EX3A 2PKAB 1K2I1 2H6MA 4DIIH 5H4IB 1QZ8A 1GBHA 3FVFB 3E0NB 3Q77A 1O2KA 3GCTF 1O2IA 1HLTH 2BZAA 1TX8A 2K8IA 4GLYA 1V2LT 1ANCA 2A45B 3HKIB 3M35A 1TGSZ 1W12U 1LVBA 2BQ7B 1F5RA 2P93A 2ESTE 1Y3WA 2V7QD 3SV9A 1UK3A 1FMGA 2ZZUH 2G8TA 2IPQX 1SOTA 1ABJH 1HFDA 2KM0A 2GJGA 1HAVB 3BF6H 3U69H 1ARCA 3DSOA 2SGPE 1TMUH 4XOJA 3VGCC 2EY4C 1G3CA 3P17H 2PSXA 1YY3A 3ESTA 1P3CA 5FPSA 2O8WA 1C5PA 3VB4A 1N6XA 1OX1A 3TLOA 1W11U 3GYMA 1IQLA 3NUMA 1SQTA 1BIOA 5EJLA 2RA3A 4Y0ZE 1YF4A 1UTKA 1BTXA 2BX3A 5EGMA 2C8ZB 3SJOA 1QJ1B 1YLNA 1EATA 1TNKA 1YWUA 2K1QA 3RXSA 1H8DH 2IN2A 2ZDMA 2F83A 1Q31A 3ZVEA 2VVCA 3TGKE 3UREA 1QGFA 2SNVA 3VGCB 1WDIA 1EJMA 1O3OA 1BHXB 1HRTH 3SNEA 1DWBH 5B6OA 4BANB 1SGFA 1RIWB 4CRGA 2OUAA 4I8HA 1O3JA 4FU9A 2W6JD 2JETC 2ZI2H 3D23A 2FXRA 3A7XA 1CT4E 3MI4A 3VB7A 1NBME 2WYGA 3BEIB 1EQ9A 3PO1B 2ZDLA 1EZXC 1O2UA 1XMNB 2HRVA 4KTUA 4TY6A 5A2MH 3F68H 1UTQA 1FAKH 1V2ST 5EW2H 3LGVA 1O3GA 3PMHB 1DWCH 1VGCB 1V2JT 2H9HA 3P70B 2JH5D 3RXMA 3F9GA 1V3XA 1JRSA 4B1TA 2FOCA 2P8OB 1OWJA 1SMFE 4OS6A 2W7UA 2HOBA 3UB0A 1E37B 3E1XB 3V12A 5PTPA 3GY6A 1E1QD 1PQ8A 1ETTH 2GMTB 3VEQB 2OC8A 3ZZ3A 4H4FA 1COWD 1GHYH 1Q2WA 1CT2E 1TE0A 4FXGH 1QBNA 1Z6JH 1IQFA 1GCDA 1SHHB 1DVAH 5FBIA 1UK4A 4WXVA 1T8MA 2GZ7A 2LNCA 1BTUA 3MFJA 1O3BA 1QRZA 3MH7A 1ZR0A 4JK6A 4YESB 1HGTH 2C3SA 1TNHA 2KFWA 1T8OA 1KXFA 1C1VH 3A7VA 3URCA 1YPLH 1P8VC 4ABIA 1HAXB 2WPJS 5JBTA 1C4Y2 1O5DH 2FYRA 3UY9A 2G4UA 4CRBA 1AMHA 3NRLA 3GCOA 3A7ZA 3GCNA 3U8RH 1KLJH 2ZHWH 3U1JB 1QA7A 1Z8IB 2B9LA 1UTPA 3F9EA 5LPFA 2FOFA 3STIA 1ZSKA 2ZTXA 1C1PA 1SLVB 3UWJH 5FCRA 3MTYA 1O2JA 3F2FA 3TIUA 5DP6A 3T27A 5CE1A 2OC0A 2BVXH 1KDQB 1W13U 3QGNB 2V3MA 1SR5C 4D76A 1CA0B 3PYHA 1MTWA 3SJ8A 2VINA 8GCHG 3A88A 4CBNA 1W0ZU 1QB9A 2L6OA 2YMSB 3N7OA 2UUYA 5CMXH 1O3MA 1ZTKA 1L1JA 2V3HH 4KTCA 1KLTA 1O3IA 1C4V2 3DHKH 1YP9A 1S82A 2G52A 4AB8A 1ELAA 1P2JA 1SQRA 1C9PA 2O8LA 1AIXH 4AZ2B 1X7AC 3OEED 1QB1A 2ZU4A 3LH3A 4BAKB 4AN7A 1CU1A 4J1YA 5TCAA 2ZCHP 1BMLA 2LELA 2B8OH 4DIHH 3BG4C 1Z6EA 2PLXA 2ULLA 1MU8B 3E16B 2BOHB 1XUFA 1SLXB 1NM6A 2TBSA 2V0BA 1FDPA 2GX4A 1BTWA 1TBRH 4AFQA 2BQ6B 1BTPA 1XKAC 1DITH 2FI3E 2XCFA 4KKDA 4ZUHA 1BITA 2ZU3A 2TIOA 1BJVA 3A8CA 3TVJB 1MABB 3KF2A 2A4OA 2ANMH 1GL0E 4FVBA 2W26A 2GVFA 1ZYOA 2Y81A 2Z6BD 5HM2A 1WXRA 3T25A 2IJD1 1C5TA 1MKXK 4AFZA 1A3BH 2RDEA 3RM2H 1CQQA 4OGYA 3ZYEA 4Z0KA 1WU1A 1XXDA 2BM2A 2Y5HA 2WPLS 2QGRA 1MTUA 3EE0B 2BD2A 3S69A 3AVZA 1G3EA 1C1TA 2BOKA 5G4BA 3IG6B 4ISHH 3AAUA 1VJAU 2YNBA 3OX7U 1C5UA 2QXHA 1A0LA 1P03A 1TONA 4UFEH 2D1JA 1BBRK 5L2YH 1RD3B 1GVZA 4UE7H 1OP0A 1HPGA 2VIVA 1CGHA 4FUDA 1W0KD 4INLA 5HMAA 7ESTE 1O2MA 2CJIA 2RCEA 4B6EA 1RGQA 5DGJA 3SUDA 3VB5A 1NRSH 1V2UT 2J5UA 2W7SA 3ZVCA 2D26C 2K7XA 1TYNA 1TFXA 3SW2B 1O2RA 1B7XB 2R3UA 3F0OA 1ZLRA 1ANEA 2FPZA 5DPAA 2C90B 3DUXH 2BXUH 2A2XH 3KQCA 1EPTC 2F3CE 4FU8A 2H9EH 3EQ0H 4CHAB 1O39A 1O0DH 3F0PA 1EZUC 1ESBA 1FPCH 2UUFB 1GHBG 3MHWU 2G5VA 1A2CH 3SOSA 1OYQA 1QBVH 5L6NH 1LHEH 3U9AH 5I25A 2NU2E 1H1BA 1PJPA 1UW7A 2GCTB 4JMYA 1C2KA 3SV8A 1FLEE 2ZHDA 2GP9B 1T31A 5CHBA 3FZDA 3A7YA 2WPDD 3VXEH 4ABEA 2BDYA 2A0QB 2KR7A 2FESH 1MU6B 2A4RA 2J9NA 1SGTA 2BDGA 4MNVA 1P09A 3FN8A 1F5LA 3EYDA 3L6PA 5JBBS 1FV9A 2PKSB 1B5GH 3A81A 1ZMNA 2JJ1D 1W7GH 2XNIA 1P2IA 1ZMJA 1WTHD 1BT7A 4Y76A 2J92A 1BTHH 2FI5E 1NESE 4B2CA 1ESTA 4U01A 1IQKA 2BVSH 2XRCA 2FX6A 1AY6H 3PM3A 2ZFQH 3LGWA 3UUZA 5KEDA 1DT2A 1NBMD 2CV3A 2J95A 1O35A 4B71A 3DT0H 3I78A 4B73A 1N1LA 1HIAB 2A31A 1IQJA 1SGNE 5HYOA 3DSPA 3E91A 3R3GB 1KXEA 1UTMA 1A4WH 5C1YA 2J34A 1V2NT 2AGGX 1GDNA 3A86A 1OP2A 1TPOA 1SHYA 1OP8A 1HJAC 1FQ3A 1C5VA 1G3DA 2Z94A 1UK2A 3S7KB 3MNSA 7KMEH 4ZKRU 1ELCA 1QQUA 3NPSA 5JYIA 2JIZD 3RLWH 1SGQE 4FUCA 1KXBA 2AHME 1GCTB 1NRPH 4NG9H 1LPZB 3FP8E 1SI5H 2XYAA 2D2DA 3M3SA 2A7HA 3A8DA 3TJNA 1MD7A 2TPIZ 3DCLA 3IITA 3D65E 2ZQ2A 5C0TA 4GCHF 5F03A 3MO6A 1EASA 4ABAA 1VITG 3O8DA 3FO8D 3SJ9A 1V2TT 1C1MA 2ZTZA 2R3YA 3A7WA 3KEEA 1NU7B 4TWYA 1YCPK 5DSFA 4GPGA 2ZDVH 5E2OA 1AE5A 1OYTH 5GDSH 1WYKA 1C2IA 2Z9KA 2Y7ZA 3ZZCA 3ATMA 3RC4A 4X2WA 4HFPB 4GAWA 1AWFH 4Y71A 2JDID 3LC5A 4JCNA 3GCTG 2ZKSA 1G37A 4I31A 3K9XB 3EAJA 4Y79A 2HLCA 1EFRD 1P2MA 1KYNA 2ALVA 1E34B 1NTPA 1O3EA 1YC0A 3SJKA 1ZSJA 1DICA 4ZHMU 1SQOA 1SGIB 2C8YB 5JBCS 2PTCE 3TU7H 4NSVA 4XBBA 5BPEA 2GGVB 3OFND 2Z7FE 1BB0B 2PUQH 3DD2H 5ABWA 2ODQA 3SHAH 2BB4A 3FZZA 2QF5A 3SU0A 1CO7E 1XUIA 1C2MA 2VIWA 5JDUB 1KTTB 3F9HA 3RXAA 1PYTD 1CVWH 1XUGA 2NU4E 4I86A 2VB0A 1Z71A 2VGCB 2ALPA 1FIZA 1YPHE 3W1EA 1K1MA 4D9QA 1AGJA 1DSUA 1FIWA 1O3LA 1SBWA 2FODA 1C5ZB 2OD3B 1Z7KA 4WXIA 1UTJA 4AG1A 3RC5A 3N7DA 1A5HA 2OC1A 4X1NU 4ZHAA 1SGFG 2VWNA 2G00A 4AYYB 1QL8A 4I8LA 4ABHA 4WMEA 1P10A 5FPTA 1IAUA 2BTCE 3OTJE 3M3VA 4RT0A 3S0NA 1PPBH 4CR5A 1EAIA 4DY7B 2OXSA 4WWYA 1HAPH 1KLIH 1SQAA 1WAYB 5C0UA 2W5EA 2BLWA 1G30B 3GY8A 3N7EA 4AGJA 1Y59T 4E05H 1OWDA 5CHAC 1V2PT 1TRYA 1LVYA 5E2PA 3SORA 2ZU5A 1EPTA 5FX6A 3SUFA 1AB9C 1Y3UA 1OWIA 1MQ6A 1SOZA 4O3UA 4IMZA 3LT3A 1Q3XA 3K6YA 4YM9A 3RU4E 4ZMAH 1O2LA 5C20A 1BQYA 2BD5A 3M5OA 5TJXA 5K7RA 1MKWK 2EA3A 1SGDE 1GGDC 1QHRB 1FY4A 4Y7BA 2ZF0H 4MG3A 4A92A 1TABE 4DT4A 3PV5A 1O2OA 2WV5A 4Y8ZA 1O2XA 2BD4A 2R0LA 4ABBA 1GBDA 3MU1A 3E8LA 3PB1E 3LGTA 3EA7A 3RXOA 3QTOH 1TNLA 3AASA 2F9VA 3WY8A 1AB9B 2EI8A 2J2UA 5HXFA 4O9VA 1JRTA 2OK5A 3V0XA 3BG8A 1GI9B 5T3HA 3EGKH 4LZ1H 2KCOA 6ESTA 2WHXA 2RA0A 4ABDA 4D7GA 1VKYA 2TGAA 3EA8A 4ISOA 2C8XB 1SGEE 2XXLA 3MU0A 5A0CA 4D9RA 1C1WH 1O2ZA 3F9FA 1K1JA 2UUJB 2ZHEH 1SPJA 1C5RA 2M2AA 3SUEA 1AUTC 1EB2A 2ZG0H 2ZFTA 1GJ9B 4B74A 4A1TA 2FOAA 1AUJA 1GHAF 4E06H 1KXCA 3OU0A 4MNXA 1TX7A 2VU8E 2ZFPH 2GT8A 3RDZA 1EJNA 3SBKA 3M5MA 2FEQH 3PLPA 4AGKA 1HAHH 3BTTE 1DANH 4B2AA 2G5NA 4BTUB 1LO6A 2GZ9A 4DJZB 3OYPA 1XUJA 1LHDH 3KYFA 5L2ZH 1H8HD 1HNEE 1RRKA 1ACBE 1UVTH 1MKXH 4UFFH 2A32A 1GBEA 1DWDH 2PGBB 3M36A 1GI1A 3GS9A 1EZQA 1NS3A 3OE7D 1LQDB 3RU4T 1ZRKA 4BAMB 1G3BA 1C5OH 1EAWA 3V13A 1EJAA 2OBQA 3W94A 3SU1A 1MTVA 2P59A 1UHBB 2CN0H 4MQAA 1CHGA 5KECA 2O8TA 1K0HA 1VCPA 2SGEE 1IHTH 2PV9B 3DFLA 1BBRH 3UNQA 1L0ZA 2IPHA 2Y6TA 4MPVA 1JMOH 4WVPE 1JBUH 3M7QA 3RUOA 1HAZB 1IQEA 2G81E 4K60A 4SGAE 1W14U 3BTME 3KCGH 3T28A 1RIWC 1OS8A 2BQWB 3UNRA 4I8JA 2PGQB 5HIZA 1N8OB 4ASUD 1SGPE 3PO1C 9ESTA 2FM2A 1QB6A 2HWLB 1O30A 4MVNA 1EAXA 1RJXB 1Y5UT 1C1UH 5KGOA 3UPEA 1ABIH 1D4PB 3BEFB 1K1LA 3KYGA 3PRBA 3FANA 1AFQB 5B6LA 1VGCC 1S81A 1H9HE 1IHSH 2EI7A 1T4UH 1HJ9A 3MMGA 3PLKA 4YOGA 1O3HA 3MU4A 2NU0E 2CF9H 1P05A 6GCHF 2P8OC 2EEKA 3V3MA 2BDIA 3KN2A 3UNSA 3KIDU 1GBFA 1QY6A 1D6RA 2GMTC 4X2VA 1O5BB 1W2KH 1B0EA 1AI8H 1TBQH 3RXKA 3B23B 3P6ZB 4I32A 4Q7XA 1AKSB 3FP6E 1U6QA 1GBMA 3HK3B 4U30A 3VXFH 3RXUA 2R2WU 1W0JD 1V2OT 2J94A 1GHXH 3ZV8A 4ZAEA 1TPAE 3HKJB 3RMNH 5DKMA 2XW9A 1L4DA 2VIDA 4A1VA 1FZZA 1A0HB 4ZKOU 5JBAS 1P3EA 1O31A 3ZVFA 5JPMH 3C27B 3F6UH 3SO3A 3ZZ6A 5EG4A 1FAXA 1WQVH 4U2WA 1AO5A 3TGJE 1CHOF 3U1IB 5E8EH 3MQKC 1C5SA 3PLBA 1MAYA 1SVPA 2ZP0H 1JIMA 3UFAA 1O3CA 2VH0A 2ZDKA 1KY9A 1RS0A 2QCYA 4R0IA 1O5CB 2BX4A 4AYVB 3A83A 2O8MA 1QJ6B 1NN6A 2FZZA 2Y7XA 1NZQH 4AOQA 1GJ6A 4XE4A 1YPGH 2VIPA 2BDHA 1YPEH 4B75A 3PRDA 4X0WU 3UQVA 1O3KA 9LPRA 1CA0C 3EBNA 1ZPBA 1QNJA 4K1EA 3KNXA 1EKBB 1P02A 5E0GA 1HV7A 2YMSC 4FETA 5EQRA 4INKA 1W10U 1GI4A 1O2NA 1S6HA 2Y5FA 5FHTA 4X1QU 1DUEA 1WTGH 2P16A 4NA9H 1GBTA 4ABJA 2ZO3H 5AVDA 3ZVGA 1Z8GA 1VR1H 4OM9A 1OSSA 2F9NA 1TPPA 3L33A 4CRAA 1C1SA 4X8TH 4XSKU 3QGJA 3C1KA 4K3JA 1GBAA 1YGCH 3O8CA 3GDVA 1UVOA 1C1NA 4GSOA 3KGPA 1CBWC 3RXBA 5JB9S 2PKAA 2KCAA 3KQBA 1F0RA 2AGEX 1TALA 1JWTA 2ZHQH 2ANYA 1DS2E 1WSSH 4FUHA 1AHTH 1O2HA 2H1UA 3P8GA 1ORFA 1THRH 5IYTA 1YCPH 2WPKS 1O2YA 1P2KA 1GJAB 2B5TB 4P02A 1S0QA 4HZHA 3F2GA 1BCUH 4D8NA 1BOQA 1J17T 3RU4D 3BV9B 4JZIA 4ZXXH 3Q3XA 1RTFB 2BD7A 1HAYB 1TNIA 5EQSA 1PPEE 4XD7D 4BTIB 1PPHE 1GHZA 1CBWB 3GOVB 3MU8A 1Y8TA 4K1TA 1AD8H 2H9TH 2WYJA 1VCWA 2C8WB 1HAVA 2PHBA 3F2HA 1S5SA 1MMJN 1MAXA 4IMQA 4RKJB 5DG6A 1O2QA 3FFGA 2EI6A 3BTQE 2H2ZA 4GCHG 3EDXB 2QF4A 4YLUA 2TGTA 1Y5AT 2WV4A 1C5QA 1ESAA 1FNIA 1BHXF 3SUGA 2OLGA 2Z3EA 3P92A 3T26A 3UR9A 2XC5A 4E7RG 1O2VA 1QBOA 1ETSH 3SU5A 3OSYA 1KIGH 2CK3D 1PQAA 4AX9H 1K9OE 3Q3YA 1DM4B 2XWAA 3VB3A 1SFIA 2BDBA 2STBE 2Z9IA 2XOKD 1P0SH 1WCZA 3F1SB 2ZGCA 2YMSD 1LHCH 3ATWA 1A0JA 1G36A 2WSSD 4XBDA 1TRMA 2C93B 1ZTLA 4K2YA 3WWFA 4CHAC 1T4VH 4YT7H 3BN9A 5BRRE 4RKOB 4Y10E 4KGAA 1DLKB 1ELGA 3RXRA 1HB0B 5J4QA 2CGAA 2WPIS 4X6PA 1G2LA 2GCTC 5GWZA 1T7CA 2KCYA 1DWEH 1DY9A 1KTSB 4TSFD 5GNDA 2KAIB 1AQ7A 1L2EA 3A7TA 3S7HB 1SGRE 1D3TB 4RSPA 1MKWH 3RXPA 2BVRH 1O3NA 3FKSD 3R0FA 2FYQA 1QURH 4XRNA 2WUBA 4A7IB 2PKSC 1O32A 2VWMA 1F0UA 3SGAE 1P06A 3UOPA 3PROA 4JZDH 2Z9GA 1GMCF 1LDTT 3TNSA 2UUKB 3H7TA 4H6TA 1AU8A 3ENSB 1GBIA 4JK5A 1O33A 1KMHB 4NSYA 1GVKB 4Y8YA 3LJOA 3LU9B 3ZVAA 4AFSA 1G9IE 1D3QB 3M7TA 1SKYE 1O5EH 1XX9A 5T1VA 1C2LA 1C5NH 4NIVA 1MBMA 4JYUH 1HXEH 1MQ5A 1ZMLA 1GJCB 3MH4A 1BTYA 2ZCLP 2OTVA 1QL7A 3TK6A 2PWXA 3AW1A 4CR9A 2J98B 4ESTE 4O97A 3ZVDA 4X6NA 1SG8B 3CNRA 3SU6A 3CS7A 3O8RA 1GDQA 4DT7B 1UMAH 2WZQA 3RXCA 1L1GA 4ZKSU 2HPPH 4WH8A 3NZIA 5AFYH 3HGPA 3BTKE 1IQGA 1E36B 2ZHFH 1KDQA 2BZ6H 1GPZA 1QIXB 1BMMH 3KHVA 4Z6AH 1PYTC 8KME2 2ZCKP 2W3KA 1GCTC 3PV2A 2GD4B 3T29A 3UIRA 4BAOB 4UONA 1NFYA 3SYJA 1ELTA 1ZHPA 3SHCH 3K65B 3RXQA 2TGPZ 1C5LH 2M5TA 1PPGE 4CH8B 3RMOH 1GMHF 4ISLA 1LVOA 1E38B 1ZJKA 3ODFA 3RXJA 1TGNA 2PFEA 1NROH 5FCKA 4NFFA 3PMJA 5GCHF 4NWKA 1UTNA 8GCHF 4MLFB 1GJ8B 1L1NA 2FMJA 1GJBB 4F49A 4BXWA 2QV1A 1VJ9U 1FXYA 2HLDD 4ZH8A 3KQ5A 1GBBA 1W3CA 3D49H 3AAVA 3K2UA 1UO6A 3E3TA 1WBGB 4UEHH 2HGTH 3SI3H 1EP6A 5A8YA 1GHAG 2V3OH 2IJOB 1PFXC 1SC8U 2HNTE 1ZHMA 1MTNB 5T6GA 5L30H 1V2VT 4X6OA 1KSNA 3K6ZA 5K0HA 2G4TA 1HBTH 4IC5A 1BBRE 3QWCH 1GI7B 2WV9A 1LPKB 1ZGIA 3PTBA 1GBKA 1HUTH 3RXFA 2A7JA 4O03A 2Z9JA 1CSOE 2R0KA 3PWCA 1SL3A 2FOHA 1H9LB 4WJG2 1ZSLA 3ITIA 4YT6H 2HVXA 3UQOA 2OC7A 1K1OA 2VGCC 2ILNA 1T8NA 2RFKC 3DA9B 3HATH 4ZROA 2PUXB 5E0HA 1NRQH 2W3IA 3OY5U 2DUCA 3MNXA 3SNBA 3SNCA 1A1RA 2F9BH 4INHA 1NC6A 4OS2A 2FS8A 4Q80A 3M5NA 1GL1A 3U28C 1BDAA 1GHWH 1ZPCA 3RP2A 2DE9A 2BLVA 2PR3A 7GCHF 4QT8C 3PMAB 4NGAH 1C1RA 2VWOA 1DLEA 1DUAA 3OAAD 1GI6A 3LPRA 4FVDA 4THNH 1C2EA 1Z8RA 1UCYK 2VNTA 4I7YH 1VITH 2J4IA 5SGAE 3S9CA 5DP9A 4MTBA 3U8OH 1V2KT 4UFGH 4F55A 1C1QA 1GI8B 4O3TA 2QF3A 4UDWH 3A8BA 2BHGA 2FOGA 1SGYE 3AK5A 3M37A 1KXDA 4IW4E 4NWLA 3SV6A 2J38A 1P9UA 3L3TA 5LGOA 1FN8A 6CHAB 2RDLA 5C5OA 1O3AA 2CF8H 3ATKA 4Q63A 2J97A 1C5XB 1JIRA 1BMAA 1ELBA 1TNJA 1YLCA 4KELA 2Q6DA 1GWAA 1C2JA 4CBOA 3Q3KA 6GCHG 3HK6B 5GPIB 5HIYA 1K1PA 1P01A 5A8ZA 1PQ5A 1F0TA 1F92A 1BRUP 2BY8X 2QC2A 2G51A 1F2SE 1MZDA 2FTLE 4MPWA 1K28D 4FUFA 1K1IA 5TCCA 4RN6A 1O3DA 2PSYA 4DVAU 2VVVA 3LIWA 1HXFH 5EU8A 3SGQE 1CA8B 3AW0A 1ZRBA 1GHVH 4FOUC 4ASHA 2A7CA 2GV7A 5J4SA 3BTEE 1TRNA 1RXPA 2ZFRH 5F8TA 2WUCA 2V35A 5C94A 3ZYDA 1WUNH 1A5IA 1CHOG 1DOJA 2CMYA 5FBEA 4LK4A 1HIAA 1V2RT 4Y0YE 1BMFD 2WPHS 3GCHB 3VB6A 4CREA 6LPRA 1QQ4A 2ANKH 2AFQB 4TYDA 2ZECA 4K8YA 1OHHD 5ETXA 5EXLA 1F5KU 5EW1H 4P00A 1TGBA 2JH6D 2OINA 2VH6A 1BMNH 3LH1A 4JYTA 5FX5A 1DXPA 2G55A 5DP3A 2IOTA 1OWKA 4HTCH 2HNTC 1V6DA 2Q1JA 1LTOA 2FP7B 3UWIA 4KTSA 4Y8XA 4X8VH 3U8TH 1TGCA 1IQNA 2R9PA 1GBJA 5EODA 1GJ7B 2XTTB 2A5IA 1ELFA 5F8ZA 4OS5A 1W0YH 3UR6A 1RTLA 1DE7H 2VWLA 1T32A 4NIWA 3Q76A 1O5FH 3MNBA 3S9BA 2F91A 3MOCA 1BRAA 1MBQA 1Z8JB 1FX0B 3NWUA 5ESBA 3LC3A 4JYVH 3CP7A 2GCHF 5C67A 2TRMA 1Y3YA 3LGYA 5FPYA 1FY3A 4BOHA 4R8TB 2FLBH 1MCTA 1XVMA 4TPYA 1O36A 1XUKA 3TJUA 2Y5GA 4IN2A 3ZZ8A 1THPB 2BDAA 2XC4A 1SLUB 3NKKA 2FWWA 2XBVA 1C5YB 1MUEB 1N8OC 1QJ7B 3LDXH 2W6ID 3UTUH 1G32B 3BIUH 2AMPA 1TBZH 5C2ZA 3SGBE 2CHAB 4OS7A 3OY6U 1SGCA 2ZC9H 4X2YA 1CGIE 4X8UH 2C4FH 3E0PB 1SB1H 1AFQC 1P2NA 1O37A 2ZGJA 1BZXE 5F53A 4UD9H 1ARBA 2XCNA 1W7XH 1YPHC 1V2WT 1C2FA 3P8OA 1H9IE 3HGNA 1EB1H 2UWLA 5FXLA 2QXIA 3BSQA 2TGDA 2KCPA 1UVPA 3SNAA 1UJ1A 2B0FA 1XM1A 1LKBA 1TWXB 1P11E 1HCGA 3H5CB 2QA9E 5DP7A 1GI3A 4LXBH 3NXPA 2FO9A 1M9UA 2ZFSA 5EPYA 5T6FA 4ZKNU 3RXLA 4ZCNA 3T5FH 5JB8S 2ZU2A 2ODPA 4A1XA 1VCQA 2ZEBA 1O38A 1GJ5H 3TK5A 1NFXA 1O3PB 1N6YA 2AGIX 4BTTB 3SQEE 4TY7A 1C4U2 3ZV9A 4XDEA 3FOAA 4M9FA 1DXWA 3MYWA 1OWHA 1K22H 1EOLA 5EXMA 2Q6FA 3BTGE 4FUEA 5DJ7A 4BXSA 1CE5A 4HG6A 1O2PA 3QZRA 5GXPA 1BJUA 3TITA 2AH4X 3M3TA 3MO9A 2B7DH 1GI5A 5EJZA 4IBLH 2JKHA 5A8XA 1GMDF 1NY22 3MU5A 4BNRA 2AEIH 4J2YB 1TPSA 2F9OA 2ZGBH 3P95A 2I6QA 1AZZA 1O3FA 4VGCC 1CGJE 1GBCA 3QO6A 3GY4A 4DGJA 1TIOA 3S9AA 1K1NA 4X1PU 1GMCG 1NT1A 1ZOMA 3RXEA 2ANWA 1W8BH 1WV7H 4XBCA 1H8IH 2AIQA 2SNWA 7LPRA 1A46H 3GDSA 1P12E 3SNDA 4SGBE 1P57B 2WPMS 1AN1E 5C3NA 2JETB 3UAIC 2GZ8A 4MDSA 4DURA 2VJ1A 1LHGH 2F43B 4YOJA 1ZTJA 3PMBB 1WQSA 2Z3DA 2LIZA 1THSH 3ZIAD 4VGCB 4B2BA 1AVGH 1SSXA 3BTFE 5DP5A 1Y3VA 2GKVE 3SQHE 1ZJDA 4Y11E 3ZZ9A 2QXGA 1S0RA 2PP6A 3GICB 3MH5A 1O34A 3RMLH 2VIQA 2P3TB 1TLDA 2HNTF 1FUJA 3CENA 5IDKA 2P3UB 3ZZBA 2VBCA 3ZZ5A 4RI0A 2AERH 2STAE 1ELEE 2YNAA 2PW8H 2ZGXH 2ZPRA 1TNGA 5AF9H 2BLQA 2H5CA 4MNWA 1INCA 1TX6A 4ACBA 4MPUA 1P2OA 2HALA 4U32A 4CRCA 1YBWA 1IQIA 4K1SA 1BRCE 1DSTA 5A0BA 1YPMH 2SFAA 5EIYA 3KQEA 1FY5A 2AS9A 3RXDA 4DCDA 2A5AA 2BLOA 1GMHG 1Z1JA 1QRWA 3ZZAA 4Q4LA 2JH0D 1UHBA 3OTPA 5GCHG 1GDUA 3EE7A 1QTFA 2OQUA 4FUJA 1TMTH 3RXIA 3JZ2B 2QN5T 3LGIA 3TK9A 1TQ0B 4YTAA 4AC9A 1OWEA 3FP7E 1LHFH 3ATLA 4M7GA 4F4OC 3LGUA 1UVUH 3P8NA 3BTDE 3RC6A 2A4QA 3N99A 1UCYH 2XNDD 3VPKA 5A09A 1E0FD 1Z1IA 1MTSA 1PQ7A 3I29A 2PTNA 1O2WA 4OS4A 3KQDA 5T6DA 3MNCA 3URDA 4AB9A 1YM0A 1FONA 4D7FA 4JZFH 2AMQA 2P95A 4IN1A 3ZZDA 2SGQE 2QY0B 2JJ2D 2D8WA 3MH6A 5LPEA 3Q00A 2GDEH 4LOYH 4WMDA 2A2QH 2WINI 5HM9A 4UFDH 5E0JA 4NZQA 1B0FA 1TQ7B 4TT3D 5GJ4B 2BY7X 4WMFA 1S6FA 5DN6D 1BA8B 2GDDA 5DO4H 3PWBA 1F0SA 3H09A
chains in the Genus database with same CATH topology
3BG4B 1AKSA 3ODDA 1P2QA 3LKWA 3G01A 1NFWA 7GCHG 3HPTB 2F9PA 1S84A 1PPZA 1DX5M 1HAOH 4Q7YA 5EXNA 2R2MB 1AVXA 1XXFA 1XVOA 3TH3H 3SU2A 1F7ZA 2BY6X 4CRFA 1DY8A 2AYWA 2XBWA 4GVUA 2NU3E 4IS5A 3B8JA 4BAQB 3SV7A 2THFB 3ZVBA 1TMBH 2ZIQH 2QXJA 1GBLA 1QA0A 4NIXA 1ELDE 4H42U 4PROA 2FOEA 3T2NA 1MH0A 4AORA 1PPFE 2BY5X 3M7UA 2ZQ1A 1D6WA 3A84A 2QYIA 2A5KA 5DP4A 1DFPA 1YKTA 2ZPQA 2VIOA 4X6MA 2EC9H 3RXHA 1QFKH 3P8FA 1AE8H 1EUFA 2FIRH 4YO9A 1C5MD 1OOKB 4FU7A 1EAUA 2YOLA 3SI4H 2GT7A 1ID5H 1FPHH 1Y5BT 3T62A 3ZZ7A 1A7SA 2BXTH 2GV6A 1IQHA 5C5NA 4ABFA 3QUMP 3JZ1B 3NK8A 1AWHB 2SGDE 3A85A 2FOBA 2VVUA 5HGGA 2ZPSA 3V7TA 2QF0A 4B76A 3GY3A 2ZNKH 3TGIE 1NO9H 1D9IA 2ZA5A 1TOMH 4KP0A 1TA2A 1EPTB 1A61H 4Q2KA 1HYLA 1L4ZA 1ETRH 1EZSC 1J8AA 1UTOA 4A6LA 3ELAH 2A4GA 1ANBA 3IWMA 5I46H 1C9TA 3RXGA 4Y7AA 5DK1A 1G2MA 3BIVH 3TNTA 8ESTE 3A87A 1D3PB 1C5WB 1D3DB 1V2QT 3M5LA 3U98H 1YCPM 1DDJA 4JZ1A 2P3FH 2SGAA 1TGTA 2BD8A 1MTNC 1C2HA 1QRXA 1OKXA 4IC6A 1Y3XA 1NRNH 1GJ4H 2FTMA 2BMGB 1ELVA 1FJSA 3B9FH 4TWWA 1QR3E 1AFEH 5EOKA 3H7OA 3A80A 3EA9A 5GIBA 5AHGH 2ZDNA 1PPCE 3BTHE 3GY5A 2OCVB 2P94A 3RLYH 1JOUB 1GG6C 1BTZA 3A8AA 3BTWE 3I77A 3PTNA 2BD9A 1P04A 2FLRH 1J16A 1IOEA 3D62A 3W95A 1O2TA 2FOMB 1BRBE 2SGFE 4FUIA 1O2SA 4I8KA 2ZTYA 3TH4H 1HDTH 1TAWA 2I6SA 4ISIH 2GCHG 2QIQA 1GI2A 2Q6GA 1ZHRA 1RFNA 4YLQH 4E7NA 2FX4A 1GG6B 1E35B 3RXVA 4ZXYH 1MD8A 4K5ZA 1VZQH 2HPQH 2BDCA 3QDZB 2Z3CA 3STJA 3QLPH 1HJAB 3FAOA 1CT0E 4DW2U 1MZAA 1T8LA 2FDAA 3GY7A 2Y82A 1FY8E 4NA8A 5AFZH 1O5AB 2O9QA 6CHAC 1YPKH 3KL6A 3A89A 2XWBI 2A1DB 2ZFFH 1LVMA 3SU3A 4H6SB 3RXTA 1EXFA 3QTVH 1OXGA 5LH8A 4Y6DA 2KAIA 1BUIA 1TB6H 5EPNA 3SJIA 1V2MT 4HGCA 1XUHA 2OBOA 5ESTE 4FUBA 1QCPA 1EOJA 1O2GH 2BYAX 3QK1A 4MNYA 1GI0A 1ZZZA 2XBXA 3DFJA 3ZZ4A 1RTKA 4BAHB 2FI4E 3BEUA 4ABGA 1TOCB 1NU9A 4X1RU 3RM0H 2CXVA 4K8BA 2FS9A 4K69A 2AMDA 2UWOA 1J9CH 1SFQB 1ZPZA 1SLWB 3E6PH 4WF8A 4ISNA 1ANDA 1GHBF 1GVLA 1LMWB 4AG2A 3QN7A 4A5TS 1FN6A 3VFEA 1TA6A 1EP5A 1HAIH 2F9UA 2XBYA 4I33A 4DOQA 1LCYA 1C2GA 1NRRH 4NCYA 3RMMH 4AFUA 2BD3A 2BY9X 3TJOA 3GCHC 1DPOA 3SV2H 2OP9A 2ZU1A 1A5GH 3GISB 3CS0A 4OS1A 1J15A 4MPXA 1GMDG 4XFQA 3E90B 2Y80A 4I8GA 8LPRA 4JZEH 4WY3A 1S83A 1YPJH 2UWPA 4IGDA 5LPRA 1HJ8A 2OQ5A 4FUGA 3ATIA 1HAGE 1ZGVA 4YZUA 4DG4A 2ZWLH 1FY1A 5C1UA 4NZLA 1C2DA 1KXAA 3GDUA 3TJVA 3MWIU 2ODYB 1IQMA 2ASUB 2GTBA 4CH2B 1LQEA 1O5GH 2RG3A 1A3EH 2V6NA 1JXPA 4GHQA 3TH2H 5FAHA 1J14A 4GUXA 1XKBC 5DP8A 5CHAB 5F8XA 4YOIA 2NU1E 4LZ4B 4OGXA 3M61U 1FI8A 1C1OA 2XC0A 2O8UA 1WOFA 4WH6A 4NFEA 1LKAA 3SN8A 3LJJA 5C1XA 3GY2A 2AIPA 3TPIZ 3QX5H 1GGDB 3SU4A 2H5DA 2QAAA 1K21H 3QZQA 1NPMA 2ZGHA 5F6MA 1P9SA 2DE8A 3LOXA 2CHAC 4NA7A 3A82A 3LONA 3MO3A 1H4WA 1OPHB 1YYY1 1AVWA 1LPGB 3O8BA 3SZNA 4GHTA 1QL9A 1YLDA 2NWNA 5EQQA 1UVSH 2ZDAH 1AZ8A 1VITF 4NIYA 3NCLA 4Q7ZA 2LPRA 3GYLB 3PV4A 4ZHLU 4X2XA 4HI3A 5A0AE 1UCYE 2Z9LA 4X1SU 1UTLM 4X8SH 4TPIZ 1NFUA 4CRDA 3UOUA 1GJDB 1MCVA 1S85A 1EX3A 2PKAB 1K2I1 2H6MA 4DIIH 5H4IB 1GBHA 3FVFB 3E0NB 3Q77A 1O2KA 3GCTF 1O2IA 1HLTH 2BZAA 1TX8A 4GLYA 1V2LT 1ANCA 2A45B 3HKIB 3M35A 1TGSZ 1W12U 1LVBA 2BQ7B 1F5RA 2P93A 2ESTE 1Y3WA 3SV9A 1UK3A 1FMGA 2ZZUH 2G8TA 1SOTA 1ABJH 1HFDA 1HAVB 3BF6H 3U69H 1ARCA 2SGPE 1TMUH 4XOJA 3VGCC 1G3CA 3P17H 2PSXA 3ESTA 1P3CA 5FPSA 2O8WA 1C5PA 3VB4A 1N6XA 1OX1A 3TLOA 1W11U 3GYMA 1IQLA 3NUMA 1SQTA 1BIOA 2RA3A 4Y0ZE 1YF4A 1UTKA 1BTXA 2BX3A 5EGMA 2C8ZB 3SJOA 1QJ1B 1EATA 1TNKA 2K1QA 3RXSA 1H8DH 2IN2A 2ZDMA 2F83A 1Q31A 3ZVEA 2VVCA 3TGKE 3UREA 1QGFA 2SNVA 3VGCB 1EJMA 1O3OA 1BHXB 1HRTH 3SNEA 1DWBH 5B6OA 4BANB 1SGFA 1RIWB 4CRGA 2OUAA 4I8HA 1O3JA 4FU9A 2JETC 2ZI2H 3D23A 2FXRA 3A7XA 1CT4E 3MI4A 3VB7A 2WYGA 3BEIB 1EQ9A 3PO1B 2ZDLA 1EZXC 1O2UA 1XMNB 2HRVA 4KTUA 4TY6A 5A2MH 3F68H 1UTQA 1FAKH 1V2ST 5EW2H 3LGVA 1O3GA 3PMHB 1DWCH 1VGCB 1V2JT 2H9HA 3P70B 2JH5D 3RXMA 3F9GA 1V3XA 1JRSA 4B1TA 2FOCA 2P8OB 1OWJA 1SMFE 4OS6A 2W7UA 2HOBA 1E37B 3E1XB 3V12A 5PTPA 3GY6A 1PQ8A 1ETTH 2GMTB 3VEQB 2OC8A 3ZZ3A 4H4FA 1GHYH 1Q2WA 1CT2E 1TE0A 4FXGH 1QBNA 1Z6JH 1IQFA 1GCDA 1SHHB 1DVAH 5FBIA 1UK4A 4WXVA 1T8MA 2GZ7A 2LNCA 1BTUA 3MFJA 1O3BA 1QRZA 3MH7A 1ZR0A 4JK6A 4YESB 1HGTH 2C3SA 1TNHA 1T8OA 1KXFA 1C1VH 3A7VA 3URCA 1YPLH 1P8VC 4ABIA 1HAXB 2WPJS 5JBTA 1C4Y2 1O5DH 2FYRA 3UY9A 2G4UA 4CRBA 1AMHA 3GCOA 3A7ZA 3GCNA 3U8RH 1KLJH 2ZHWH 3U1JB 1QA7A 1Z8IB 2B9LA 1UTPA 3F9EA 5LPFA 2FOFA 3STIA 1ZSKA 2ZTXA 1C1PA 1SLVB 3UWJH 5FCRA 3MTYA 1O2JA 3TIUA 5DP6A 3T27A 5CE1A 2OC0A 2BVXH 1KDQB 1W13U 3QGNB 1SR5C 4D76A 1CA0B 3PYHA 1MTWA 3SJ8A 2VINA 8GCHG 3A88A 4CBNA 1W0ZU 1QB9A 3N7OA 2UUYA 5CMXH 1O3MA 1ZTKA 1L1JA 2V3HH 4KTCA 1KLTA 1O3IA 1C4V2 3DHKH 1YP9A 1S82A 2G52A 4AB8A 1ELAA 1P2JA 1C9PA 2O8LA 1AIXH 4AZ2B 1X7AC 1QB1A 2ZU4A 3LH3A 4BAKB 4AN7A 1CU1A 4J1YA 5TCAA 2ZCHP 1BMLA 2B8OH 4DIHH 3BG4C 1Z6EA 2PLXA 2ULLA 1MU8B 3E16B 2BOHB 1XUFA 1SLXB 1NM6A 2TBSA 2V0BA 1FDPA 2GX4A 1BTWA 1TBRH 4AFQA 2BQ6B 1BTPA 1XKAC 1DITH 2FI3E 2XCFA 4KKDA 4ZUHA 1BITA 2ZU3A 2TIOA 1BJVA 3A8CA 3TVJB 3KF2A 2A4OA 2ANMH 1GL0E 4FVBA 2W26A 2GVFA 1ZYOA 2Y81A 2Z6BD 5HM2A 3T25A 1C5TA 1MKXK 4AFZA 1A3BH 3RM2H 1CQQA 4OGYA 3ZYEA 4Z0KA 1WU1A 1XXDA 2BM2A 2Y5HA 2WPLS 2QGRA 1MTUA 3EE0B 2BD2A 3S69A 3AVZA 1G3EA 1C1TA 2BOKA 5G4BA 3IG6B 4ISHH 3AAUA 1VJAU 2YNBA 3OX7U 1C5UA 2QXHA 1A0LA 1P03A 1TONA 4UFEH 2D1JA 1BBRK 5L2YH 1RD3B 1GVZA 4UE7H 1OP0A 1HPGA 2VIVA 1CGHA 4FUDA 4INLA 5HMAA 7ESTE 1O2MA 2CJIA 2RCEA 1RGQA 5DGJA 3SUDA 3VB5A 1NRSH 1V2UT 2W7SA 3ZVCA 2D26C 2K7XA 1TYNA 1TFXA 3SW2B 1O2RA 1B7XB 2R3UA 1ZLRA 1ANEA 2FPZA 5DPAA 2C90B 3DUXH 2BXUH 2A2XH 3KQCA 1EPTC 2F3CE 4FU8A 2H9EH 3EQ0H 4CHAB 1O39A 1O0DH 1EZUC 1ESBA 1FPCH 2UUFB 1GHBG 3MHWU 2G5VA 1A2CH 3SOSA 1OYQA 1QBVH 5L6NH 1LHEH 3U9AH 5I25A 2NU2E 1H1BA 1PJPA 2GCTB 4JMYA 1C2KA 3SV8A 1FLEE 2ZHDA 2GP9B 1T31A 3FZDA 3A7YA 4ABEA 3VXEH 2BDYA 2A0QB 2FESH 1MU6B 2A4RA 2J9NA 1SGTA 2BDGA 4MNVA 1P09A 1F5LA 3EYDA 3L6PA 5JBBS 1FV9A 2PKSB 1B5GH 3A81A 1ZMNA 1W7GH 2XNIA 1P2IA 1ZMJA 1WTHD 1BT7A 4Y76A 2J92A 1BTHH 2FI5E 1NESE 4B2CA 1ESTA 4U01A 1IQKA 2BVSH 2XRCA 2FX6A 1AY6H 3PM3A 2ZFQH 3LGWA 3UUZA 1DT2A 2CV3A 2J95A 1O35A 4B71A 3DT0H 3I78A 4B73A 1N1LA 1HIAB 2A31A 1IQJA 1SGNE 5HYOA 3E91A 3R3GB 1KXEA 1UTMA 1A4WH 5C1YA 2J34A 1V2NT 2AGGX 1GDNA 3A86A 1OP2A 1TPOA 1SHYA 1OP8A 1HJAC 1FQ3A 1C5VA 1G3DA 2Z94A 1UK2A 3S7KB 3MNSA 7KMEH 4ZKRU 1ELCA 1QQUA 3NPSA 5JYIA 3RLWH 1SGQE 4FUCA 1KXBA 1GCTB 1NRPH 4NG9H 1LPZB 3FP8E 1SI5H 2XYAA 2D2DA 3M3SA 2A7HA 3A8DA 3TJNA 1MD7A 2TPIZ 3IITA 3D65E 2ZQ2A 4GCHF 5F03A 3MO6A 1EASA 4ABAA 1VITG 3O8DA 3SJ9A 1V2TT 1C1MA 2ZTZA 2R3YA 3A7WA 3KEEA 1NU7B 4TWYA 1YCPK 4GPGA 2ZDVH 5E2OA 1AE5A 1OYTH 5GDSH 1WYKA 1C2IA 2Z9KA 2Y7ZA 3ZZCA 3ATMA 3RC4A 4X2WA 4HFPB 4GAWA 1AWFH 4Y71A 3LC5A 4JCNA 3GCTG 2ZKSA 1G37A 4I31A 3K9XB 3EAJA 4Y79A 2HLCA 1P2MA 1KYNA 2ALVA 1E34B 1NTPA 1O3EA 1YC0A 3SJKA 1ZSJA 1DICA 4ZHMU 1SQOA 1SGIB 2C8YB 5JBCS 2PTCE 3TU7H 4NSVA 4XBBA 5BPEA 2GGVB 2Z7FE 1BB0B 2PUQH 3DD2H 5ABWA 2ODQA 3SHAH 2BB4A 3FZZA 3SU0A 1CO7E 1XUIA 1C2MA 2VIWA 5JDUB 1KTTB 3F9HA 3RXAA 1PYTD 1CVWH 1XUGA 2NU4E 2VB0A 1Z71A 2VGCB 2ALPA 1FIZA 1YPHE 1K1MA 4D9QA 1AGJA 1DSUA 1FIWA 1O3LA 1SBWA 2FODA 1C5ZB 2OD3B 1Z7KA 4WXIA 1UTJA 4AG1A 3RC5A 1A5HA 2OC1A 4X1NU 4ZHAA 1SGFG 2VWNA 2G00A 4AYYB 1QL8A 4I8LA 4ABHA 4WMEA 1P10A 5FPTA 1IAUA 2BTCE 3OTJE 3M3VA 3S0NA 1PPBH 4CR5A 1EAIA 4DY7B 2OXSA 4WWYA 1HAPH 1KLIH 1SQAA 1WAYB 2W5EA 2BLWA 1G30B 3GY8A 4AGJA 1Y59T 4E05H 1OWDA 5CHAC 1V2PT 1TRYA 1LVYA 5E2PA 3SORA 2ZU5A 1EPTA 5FX6A 3SUFA 1AB9C 1Y3UA 1OWIA 1MQ6A 1SOZA 4O3UA 4IMZA 3LT3A 1Q3XA 3K6YA 4YM9A 3RU4E 4ZMAH 1O2LA 5C20A 1BQYA 2BD5A 3M5OA 5TJXA 5K7RA 1MKWK 2EA3A 1SGDE 1GGDC 1QHRB 1FY4A 4Y7BA 2ZF0H 4MG3A 4A92A 1TABE 1O2OA 2WV5A 4Y8ZA 1O2XA 2BD4A 2R0LA 4ABBA 1GBDA 3MU1A 3E8LA 3PB1E 3LGTA 3EA7A 3RXOA 3QTOH 1TNLA 3AASA 2F9VA 3WY8A 1AB9B 2EI8A 2J2UA 5HXFA 4O9VA 1JRTA 3V0XA 3BG8A 1GI9B 5T3HA 3EGKH 4LZ1H 6ESTA 2RA0A 4ABDA 4D7GA 2TGAA 3EA8A 4ISOA 2C8XB 1SGEE 2XXLA 3MU0