2H2ZA

Crystal structure of sars-cov main protease with authentic n and c-termini
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
306
structure length
306
Chain Sequence
SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDTVYCPRHVICTAEDMLNPNYEDLLIRKSNHSFLVQAGNVQLRVIGHSMQNCLLRLKVDTSNPKTPKYKFVRIQPGQTFSVLACYNGSPSGVYQCAMRPNHTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGKFYGPFVDRQTAQAAGTDTTITLNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPLTQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGSTILEDEFTPFDVVRQCSGVTFQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Production of authentic SARS-CoV M(pro) with enhanced activity: application as a novel tag-cleavage endopeptidase for protein overproduction
pubmed doi rcsb
molecule keywords Replicase polyprotein 1ab
molecule tags Viral protein
source organism Sars coronavirus
total genus 88
structure length 306
sequence length 306
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2006-05-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1840.10 Mainly Alpha Orthogonal Bundle main proteinase (3clpro) structure, domain 3 main proteinase (3clpro) structure, domain 3 2h2zA03
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2h2zA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2h2zA02
2WPLS 1OSSA 2O8LA 3S9BA 3AASA 1FI8A 4SGAE 3GCTF 5F03A 3BG4B 5C1XA 1SGNE 1J16A 1SR5C 3QTVH 1W0YH 2CHAC 3RMOH 2QYIA 2FPZA 3MO9A 1O3MA 1SLXB 5EPNA 3RXFA 3RC4A 1GVKB 1A1RA 4WF8A 1TGNA 5FAHA 3Q77A 3ZZ3A 5A8ZA 3B23B 1HGTH 3D62A 1ZYOA 1IHTH 5EQSA 5GIBA 5GPIB 4CRAA 1KDQB 3TU7H 4NWLA 1K1OA 2AERH 2ZU3A 2RA0A 1BRUP 1TQ7B 2VH0A 4Y0YE 2V0BA 4JZ1A 3KQBA 2BB4A 3PLKA 1DWCH 1GJ9B 1HAHH 1K1NA 1WQSA 1O38A 4THNH 3ATKA 1MUEB 1P05A 1Z71A 2FYQA 3MU8A 5DGJA 1LCYA 1GHYH 1GJBB 2QN5T 1MTNC 2AGGX 3A7TA 3BTKE 3O8DA 2HVXA 4JZIA 2FTMA 4X6MA 4MNWA 7ESTE 3MNCA 3HATH 4BAMB 3GCNA 1DX5M 1TGSZ 1GMDF 1EB1H 1XX9A 1NRSH 3SU2A 2BD7A 3AAVA 4JMYA 2VVVA 5FX6A 1L2EA 5EODA 3ZYEA 3RU4T 1XKBC 2C3SA 5FPYA 3UPEA 2PSXA 2Y6TA 4OGYA 2BY9X 2F9OA 1P57B 2ODYB 1O39A 2QXGA 2B0FA 3RXDA 1TGCA 1PYTD 3TK6A 1H1BA 1UVUH 4Y79A 2PGQB 3BEFB 5TCAA 1P10A 2VU8E 1GBDA 3AW0A 1XXDA 4B71A 2GVFA 1HAYB 1N6XA 2OINA 4Y7BA 1Z8GA 1TLDA 4DW2U 1Z8IB 3HKIB 2XW9A 4NZLA 4O9VA 1K2I1 2HGTH 3UREA 1GHAF 1OXGA 2NU3E 1AVWA 1ZMLA 2BY5X 2HWLB 2ZFSA 4NA7A 3U9AH 4HFPB 4IW4E 3U8OH 1SHHB 4H42U 3U1JB 8KME2 1GI5A 1NZQH 1GBLA 1VITF 1H4WA 4GCHF 4K60A 1YGCH 2P94A 1FXYA 4YZUA 1TALA 2OQUA 3BN9A 3FAOA 4YT6H 4MVNA 1HB0B 2BYAX 2OBOA 5EQQA 4AORA 4I7YH 2QXHA 1NFWA 1TFXA 1Z8RA 3CENA 1C5OH 1P0SH 2A1DB 3ATMA 3SHAH 3F6UH 3A7ZA 1HJ8A 4HZHA 2ZHEH 5GXPA 3U8TH 3A86A 3L33A 1L1GA 1HJ9A 1O0DH 2GV7A 4R0IA 4WH6A 3ZVAA 2WUCA 1AGJA 1SGYE 4CBOA 4K3JA 1YBWA 3RXBA 1AI8H 1HPGA 3DHKH 2W7UA 3A8DA 1S6HA 2IPHA 3OSYA 1UK4A 3ZV8A 3RC5A 1THSH 3SNBA 1A3BH 2GZ9A 1FIZA 1BRBE 4D7FA 1P2JA 1P2QA 3K6ZA 2P8OC 1V6DA 1IQNA 3AAUA 4GHQA 3RU4E 1BBRH 3DFJA 2FS8A 2XBXA 4ISNA 4TY6A 5GJ4B 3TJUA 1ABIH 1BMMH 1C5RA 4ZKOU 2GP9B 4UFDH 2WPIS 2ILNA 4LXBH 3D65E 2SGEE 2AYWA 2VIVA 1F0SA 1FN6A 1Z6JH 2V3HH 4JYUH 1EOJA 1MU8B 2ZEBA 1EQ9A 3EE0B 2AH4X 3UY9A 1A5GH 5DP9A 1V2MT 3TNSA 2ESTE 1ZJKA 3ATIA 3QZQA 3SZNA 1NRNH 3KQCA 4BNRA 1O5CB 1F92A 2BTCE 5F6MA 1O2GH 1AIXH 3UWIA 2OC7A 2ZU4A 1BTYA 3BIUH 1DANH 2HNTF 2F83A 1C4U2 1THPB 1DOJA 5LPFA 1ZPBA 3MFJA 2Y5GA 2G5VA 8GCHG 1EJAA 1TE0A 3RP2A 6GCHG 3VPKA 1E38B 3SNAA 3QDZB 3SNEA 1IQLA 1SC8U 2TBSA 1TGBA 2FS9A 4Z0KA 1P9SA 2D8WA 2H1UA 2VIWA 1AUTC 3GDUA 2VJ1A 3BTEE 1SGFA 2BHGA 1K1LA 2ODQA 1J17T 1GL0E 1MZDA 3TH4H 1SGQE 1HCGA 2Y7ZA 1S81A 4Z6AH 2BXTH 3OY6U 1GI9B 1FJSA 2H2ZA 1OYQA 1ACBE 4K1TA 1C2MA 3LGTA 2AFQB 3V7TA 2HPQH 5FCKA 2BLWA 2XNIA 1PPFE 2FI3E 2DE9A 1UTQA 2ZTXA 3ATWA 2A5KA 1QB9A 3M36A 3MTYA 3ZVCA 1AZ8A 4AN7A 1SGPE 3SJIA 4AG2A 5E2OA 5T6FA 1EOLA 5DG6A 3K2UA 2LIZA 1NN6A 5G4BA 3VGCC 3ENSB 5C67A 4IC5A 1E34B 3A83A 2PHBA 4MLFB 3P95A 4FVBA 2Y5FA 3OU0A 2BY6X 2H5CA 1F5RA 1JBUH 3S69A 3PROA 5FBIA 1PPCE 4WMDA 3M5MA 2BD2A 2ZIQH 3GY2A 1A46H 1OKXA 3AW1A 3QK1A 3F68H 3ZZBA 2ZGBH 4YM9A 5A0CA 4TPYA 1QJ6B 1S0RA 1O3GA 1P03A 3HGNA 2CGAA 4INLA 4NIVA 1F5LA 4Y10E 1IQEA 1GBIA 4YTAA 6ESTA 1GDUA 1ETTH 1C5WB 3ZYDA 2KAIA 2QIQA 2F9UA 4NZQA 1TIOA 2Z9KA 3RXTA 1PFXC 2ZPRA 5CE1A 1TQ0B 3KN2A 1TMUH 3SJOA 1GHXH 3VB6A 2P93A 3PB1E 1C9TA 1VGCB 2PKAB 3QGJA 1CHOG 4X2YA 1DICA 4X8UH 4BAQB 4CRBA 3EQ0H 2HPPH 2G55A 3SJKA 3KHVA 1UTNA 2GDEH 1Z8JB 2H9HA 1SLUB 1SGIB 2OC0A 1JMOH 4X1QU 1EB2A 3M37A 4NSVA 3TGKE 4XBDA 1O2TA 3SNCA 3LH3A 5CHAB 3ZZ9A 3S9CA 4MPWA 4JZFH 1UK2A 2GKVE 1C1TA 2GCHF 2TIOA 2BD5A 3LGWA 2PW8H 1ZR0A 1O5DH 4RKOB 4U01A 3MU4A 4DGJA 2TGPZ 3V13A 2XBWA 6CHAC 2AS9A 1AO5A 1BMAA 3TLOA 3TVJB 2A4GA 2J34A 2FODA 2WINI 3F9FA 1YPHC 4H6TA 1D6RA 1YPGH 1RS0A 1BZXE 1VJ9U 5F8ZA 4MDSA 1SQAA 3ZVDA 3WY8A 4ZUHA 2P16A 1FY3A 1EPTB 5F8TA 3NPSA 1THRH 1BA8B 1NC6A 2XC0A 1EASA 4I31A 3Q00A 1GBBA 1ELBA 1GCTB 1ZLRA 1TA2A 3B9FH 3SNDA 1YCPK 2FX4A 2G8TA 1TAWA 1VGCC 1RFNA 3DUXH 2ZQ1A 1D3TB 1TRYA 1CU1A 1DUEA 2ZFFH 4AOQA 2WV4A 1CBWB 3Q76A 3TK9A 3GYMA 1QQUA 1MD8A 4ABAA 3MNXA 2P59A 1BQYA 1K22H 1EX3A 1YPKH 1JIMA 3CS7A 3O8CA 1HAVA 1C5LH 5CHAC 2I6QA 4NIXA 1GBMA 1O2QA 3SUGA 1D3QB 5DJ7A 1NFUA 1W3CA 7GCHG 4KTCA 4YOGA 2R0LA 3MMGA 1GDNA 1TNJA 5GDSH 1KXEA 4I8KA 1O3BA 3RXRA 1RD3B 2BOKA 3FFGA 3H7OA 4ESTE 2R3UA 2BDGA 5L6NH 4WMFA 4X8TH 3HKJB 3SV7A 1FUJA 4O97A 4VGCB 1C1WH 1SMFE 3A8BA 5EQRA 1T31A 3QO6A 2NU0E 5GCHF 5EXMA 4ZKRU 1DWDH 1GCTC 1S84A 2SGAA 3EA7A 1WSSH 1CA0B 1IOEA 1ZPCA 4KGAA 1ANBA 1BBRE 4FXGH 1UJ1A 1O5BB 3EAJA 1E37B 2J38A 3DFLA 1ELDE 3M7QA 4YT7H 1YP9A 1F0RA 1CBWC 4ZXXH 5AF9H 2R2MB 1SGEE 4ZROA 2PSYA 3E6PH 1O3NA 1P04A 4AGKA 2FIRH 1BT7A 1BJUA 1AUJA 1HIAA 1LO6A 2FESH 2RCEA 3KF2A 1MU6B 2XXLA 1AY6H 3SU1A 4BAHB 2FOCA 1UK3A 1FIWA 1O3OA 2XC5A 3MU5A 5EXLA 4A5TS 4LOYH 1YLDA 2XBVA 2ZPSA 3G01A 3MO3A 2B9LA 1A0HB 1FZZA 1O33A 1CVWH 3NUMA 1ZOMA 2BDAA 2QAAA 3TGIE 4AG1A 4I8HA 1QBVH 2ZQ2A 3OTJE 2Q6GA 1ZRBA 3HK6B 4UFEH 3VB4A 4DJZB 2JH6D 2ZFQH 1V2OT 5DKMA 4F49A 2PLXA 1YKTA 4D8NA 3BTTE 2ZTZA 4AFUA 2BDCA 3RXGA 3M3TA 1F7ZA 1VJAU 3E3TA 4ABGA 1KDQA 3SUEA 2ZDLA 1LHDH 2K1QA 3F1SB 1AVGH 4XBCA 3ELAH 3TH2H 1G32B 1LPGB 1O3LA 3NZIA 4I8JA 3S0NA 5DO4H 5E0JA 1ZSJA 5JYIA 3JZ2B 3E0NB 3GY4A 1Y5AT 3KQEA 2BMGB 3STIA 2FLRH 4K1EA 1GI4A 1PQ8A 4IMQA 1ZGVA 2WUBA 1O36A 4Q7YA 2I6SA 2OLGA 1C1OA 4KKDA 1DDJA 5HM9A 1LMWB 2R0KA 2ZP0H 1ZRKA 1AB9C 2FOBA 1NFXA 4BAKB 1O2YA 3PTBA 1O5EH 4TWWA 1ANDA 2AGEX 2CJIA 2EI6A 1NS3A 2R9PA 1C9PA 3B8JA 3SV8A 1UCYE 1UO6A 3LIWA 3PO1B 4DCDA 1O3JA 4I33A 4YO9A 2YNBA 1LKBA 4WVPE 4IN2A 3A87A 2ZGHA 3RXIA 4A1TA 5A2MH 1UVTH 2ZDAH 1H9HE 2BLQA 4NFFA 1UVOA 1HIAB 4JZDH 1O3DA 3EA8A 1TNLA 4BXWA 4BAOB 5B6OA 5EW1H 1GI3A 1O5FH 4JK6A 3RM0H 1UCYK 4ABEA 1DXWA 2GTBA 3RMLH 1A61H 1O3KA 3K9XB 1IQFA 3TGJE 3DT0H 3BF6H 1O2HA 2QY0B 1YPHE 4H6SB 2GT7A 1P9UA 2XCFA 4TWYA 2A32A 4XE4A 2GZ7A 5SGAE 2BLVA 1A7SA 1AWFH 4BTTB 2C4FH 4Y0ZE 4INKA 1V2JT 4Q80A 1AHTH 2FI4E 2ZC9H 1TNKA 3PMAB 2QA9E 3MU0A 2EI8A 1J15A 3M35A 1AWHB 2JETB 5F8XA 1FY4A 3I29A 2THFB 4ISOA 1V2ST 5TCCA 1O2UA 1Y3YA 2AMPA 1ESBA 2GDDA 2VIPA 2Q6FA 2FO9A 1C1PA 1P3EA 1BJVA 1LHCH 2BDIA 2VB0A 1Z6EA 1ARCA 2OXSA 3T28A 1MAYA 4NA8A 2G5NA 3PO1C 3MNBA 1GBJA 2JKHA 2SNWA 1Y3WA 1IHSH 4JYTA 1GBFA 1SGDE 4Q7ZA 3A81A 1DLKB 1GI1A 2HNTC 2TGDA 4D9RA 1QRWA 3GCHB 1FLEE 1FV9A 3M3SA 5DP5A 1O3AA 2W5EA 1DE7H 3TJNA 3BG4C 1NT1A 1HXEH 1L4DA 1W10U 1OWHA 1O32A 4ABBA 3ZVBA 3E16B 4MG3A 1QBOA 3BTDE 4CRDA 4D7GA 1GJ7B 3AVZA 1HAIH 1AMHA 1O2JA 4U32A 5ETXA 1K1MA 1SLWB 1EP6A 4ASHA 3BG8A 2WYGA 3L3TA 1CT2E 3A89A 3FVFB 3RXHA 3ZZCA 1W14U 2NU4E 5TJXA 2F9VA 1MH0A 2C8XB 4GVUA 2CN0H 3KEEA 1F0TA 3URDA 2ZHFH 2WYJA 3P17H 3A7YA 2P3TB 2J9NA 1GJCB 3KGPA 3MYWA 2PV9B 5HGGA 3E8LA 4NIWA 4X2WA 1T4UH 2QCYA 5EGMA 1GHBF 2QF3A 1KTSB 1AZZA 6LPRA 1C1NA 1CQQA 3LJJA 2ZU1A 5EOKA 1CT0E 1GJAB 2ZCLP 1HNEE 1YF4A 2F91A 2H9TH 3VB5A 4CHAB 1P2MA 3TNTA 3A7XA 3GCHC 1T7CA 5HXFA 1GMHF 1UHBB 1PYTC 1LTOA 2A2QH 2ZCHP 2WPKS 4DIIH 4X1NU 1TX6A 1ZGIA 2ZGXH 1F5KU 2OC8A 2OC1A 5FBEA 3A7VA 1QURH 4AZ2B 4QT8C 2B5TB 2A4RA 1EKBB 1FMGA 3FP7E 5K7RA 1UVSH 1IQIA 2BZ6H 2ZU2A 1LKAA 2FOFA 2SGQE 2BQ6B 1O2WA 4WJG2 1UVPA 3UNSA 3ODFA 1LHGH 3KL6A 2PFEA 2Z6BD 3RXJA 3RUOA 4I8LA 1SGRE 3MH4A 1GI2A 1FY8E 4MPVA 1BTWA 3D23A 2ANWA 1SQTA 4WXIA 3VXFH 3M61U 3VB3A 2PR3A 3M5NA 3CP7A 3ITIA 2NU2E 1C4V2 4FUCA 3VB7A 3U69H 1AVXA 2GV6A 1GMCG 1YPJH 4NG9H 5HMAA 1GI8B 3RXCA 1QRZA 3BSQA 2OD3B 1JRSA 4TY7A 2FLBH 4AB9A 2B8OH 5L2ZH 3IITA 4JCNA 5ABWA 2C8WB 4UEHH 3L6PA 3RLYH 2UUFB 3T26A 3UQOA 3FZDA 2SGDE 4CHAC 1SOTA 2CXVA 3EYDA 1N8OB 1SGCA 1C4Y2 1FN8A 2BVRH 1GJ5H 5FX5A 2UUYA 1TNHA 3TH3H 1L0ZA 1SGFG 4CH8B 2ZPQA 1DT2A 2PUQH 1TPAE 3S7KB 2ZGJA 2CV3A 4U2WA 1W12U 2A5AA 3MI4A 3SQEE 4ZHMU 2J92A 1JXPA 3LJOA 3U8RH 2VGCB 1MKXH 5I46H 4AYYB 2PKAA 1CO7E 2ZWLH 1WQVH 1QL9A 2A4QA 2FEQH 1V2RT 3M7TA 2J94A 1WTGH 1TOMH 1A0JA 1G3CA 1O2OA 1K21H 5BRRE 2V3OH 1GL1A 2A0QB 5EXNA 2ZHWH 1XUJA 1TGTA 2BY8X 1INCA 2QF0A 2H9EH 2JH5D 1QHRB 5E8EH 1WBGB 1BMLA 2Y7XA 2Z3CA 4A7IB 1RTFB 1NRPH 1BTUA 3QX5H 4AFZA 4DIHH 4U30A 1V2UT 3QWCH 3SI4H 4XDEA 3V0XA 3ZZ7A 1YCPM 3KQDA 3SU3A 3GCTG 1GBCA 1B5GH 1VR1H 2PKSB 1XUIA 2HOBA 4NSYA 3LPRA 1VCPA 1T8MA 1XUHA 3UUZA 1AFQB 2HNTE 1QQ4A 1J9CH 5H4IB 1N8OC 2EA3A 1A0LA 2QXJA 1EAXA 2VIOA 2WV5A 3RXOA 1DSTA 3P8OA 5PTPA 1EPTA 4K5ZA 1GHWH 1ZPZA 1V2WT 4B2CA 2WPHS 2XWBI 4AFQA 2ZDNA 3OY5U 1SQOA 1QA7A 2RDLA 5I25A 5JBBS 3SV2H 1K1JA 1KYNA 1QJ1B 2VGCC 4J1YA 1ZHRA 3RMNH 4WMEA 3ZZ4A 4I32A 3S9AA 1K1IA 4MPXA 3A88A 1P02A 2G81E 1QTFA 1OP8A 1C2EA 4IBLH 1TPPA 3E90B 1DPOA 1EATA 1V2NT 2A31A 1BIOA 2Q6DA 1PPGE 3RC6A 2A5IA 1A5IA 2EI7A 2XC4A 3O8RA 3GY7A 1W7GH 1RGQA 1O2MA 3QN7A 2A7CA 1EZQA 1EZSC 2C8YB 1GMDG 2BQ7B 1DS2E 2BX3A 1ELVA 1B0EA 4DURA 1Y8TA 2F9NA 4XOJA 2XWAA 1LHFH 1C2IA 1S6FA 1GJ4H 1C1SA 1GGDB 1JIRA 1HXFH 1C2GA 3R3GB 4RN6A 4CRCA 2BZAA 3EBNA 1AFQC 2D26C 3P6ZB 3SJ8A 3MH6A 3SOSA 3M5LA 3T5FH 5LPRA 4WWYA 1SFQB 2FDAA 1ZSLA 5E0GA 1HAXB 4Q7XA 3RXKA 1C2DA 2Z9LA 3RXUA 1NU9A 3RXEA 5JBTA 1W7XH 1KTTB 2F9PA 4UDWH 1V2KT 1HV7A 1YPLH 3MU1A 3BV9B 3SORA 1XUGA 1SGTA 2VNTA 1PQ7A 3DA9B 3GY5A 2GMTB 3UOUA 1C2HA 1T8NA 1AE5A 1C5PA 1SVPA 2PTCE 1GHAG 1ELAA 1ESAA 2G4UA 1V2PT 2SFAA 1K9OE 1SHYA 1TPSA 4FVDA 2UUKB 3BTFE 2GX4A 1JWTA 2J95A 2VINA 5AHGH 1Z1IA 1VITG 2VVCA 2NWNA 1GBTA 2Y5HA 4GCHG 3GY3A 3RM2H 1MTUA 4OGXA 1O30A 1JOUB 2BDBA 1XUKA 1MZAA 1HJAB 1QL7A 2HALA 3ODDA 1TMTH 1GGDC 2VIDA 2A45B 2TPIZ 3W95A 4DVAU 1G3BA 1NRQH 1GBAA 5FXLA 1Y3UA 1QB1A 5E0HA 1TPOA 4DOQA 4YLUA 1GCDA 4IN1A 3UTUH 1QIXB 3QLPH 2Z3DA 4X1RU 3A8AA 3RXLA 3RXVA 3MO6A 2FM2A 3F9HA 1DLEA 2FOGA 4FUGA 1C5ZB 2FYRA 2P95A 4FUIA 1O2RA 1ID5H 2BD8A 3ATLA 4JK5A 1MQ5A 1EPTC 2A7JA 3GYLB 1UTMA 4TYDA 4JZEH 1UTOA 1P06A 1C2JA 1PPBH 4CRFA 2W3KA 3ZZ6A 1IQGA 4B76A 3VFEA 4BTUB 1XMNB 3SGBE 3SW2B 2IN2A 3NCLA 5A09A 3SU0A 1UTJA 4ABHA 1C5VA 1P2OA 4E06H 1CGJE 3A7WA 3VEQB 4DY7B 1FONA 1ELTA 1ELCA 5CMXH 1L1NA 5L2YH 1GHVH 1LDTT 1KLIH 1AFEH 2BD3A 2FOEA 3K6YA 1LPKB 4IS5A 4BTIB 4YESB 1WTHD 2F9BH 5A0AE 3NWUA 1BBRK 3A8CA 1G9IE 1SPJA 2W26A 2XYAA 1ANCA 4A1VA 1O2KA 3GISB 3RU4D 2LPRA 4X8SH 4XFQA 3QGNB 4MNVA 1HAOH 4X1SU 1DWEH 1CHGA 3RLWH 1CA8B 1MTWA 1ZTJA 4X6OA 1O5GH 1DM4B 4D76A 3PYHA 4MNXA 4OS4A 4ZMAH 3LKWA 1QGFA 3SHCH 4Y71A 2R2WU 3MHWU 5AFZH 2Z9IA 1C1RA 1FPHH 1TX7A 5A8YA 1OP2A 4ZXYH 1C1MA 1FY1A 4VGCC 2ZHQH 1EZXC 1AE8H 1C5UA 2OCVB 2BDYA 1KXCA 1O5AB 1D9IA 1SG8B 4X0WU 2VWMA 4FUJA 2ZCKP 5GWZA 1CA0C 3STJA 2ULLA 4GUXA 4H4FA 8GCHF 6GCHF 1W11U 3LT3A 1O31A 4Y7AA 5DK1A 1IAUA 4NA9H 5DP3A 1AKSB 3NK8A 3GCOA 1P12E 2AMQA 1EJNA 1N1LA 1QJ7B 2QXIA 2VWLA 1OWDA 1HAGE 1NFYA 1IQKA 1RTKA 1ZMJA 3MH7A 1GVLA 3P8GA 3ZZ5A 3PM3A 5EG4A 2H6MA 4D9QA 4OS6A 1O3CA 2FI5E 2O8UA 1D3PB 2P3FH 5EW2H 1ELFA 4A1XA 5C2ZA 1Z1JA 3IG6B 4B1TA 2BQWB 3EDXB 4UD9H 1MTNB 1Y5UT 1CGHA 2ASUB 4WH8A 4MNYA 2O8TA 3N7OA 3MOCA 5LPEA 3PV4A 1O2VA 3TJOA 2SGPE 3SBKA 3KIDU 1LHEH 1UTLM 4Q2KA 2LNCA 4ISIH 5T3HA 1G2LA 1Z7KA 1KLJH 1IQJA 1O3HA 1GI7B 1F0UA 1O34A 3LGUA 1FDPA 3T29A 1OWJA 1SLVB 4FU7A 1MD7A 5C5NA 1PPEE 1SBWA 2G00A 3K65B 2AGIX 3RXAA 3ZZAA 1LVBA 2YOLA 1GG6B 2J4IA 1EP5A 2STBE 1MCVA 2ALPA 1T4VH 1XKAC 2GCHG 1KSNA 1H8IH 4X1PU 3OYPA 1NPMA 3FZZA 2O9QA 1FQ3A 1C5NH 2RA3A 3UNQA 1HUTH 2FMJA 2JH0D 1XVOA 5EU8A 1GVZA 1UHBA 4B74A 2ZFRH 2CMYA 3Q3XA 3URCA 1CE5A 4X2VA 1GDQA 2ANYA 3SN8A 3QZRA 4Y8ZA 2AIPA 4FUBA 3NKKA 4K8BA 4ZH8A 1OX1A 1P11E 8LPRA 1CHOF 1NROH 3LH1A 3P92A 3E1XB 1BCUH 1ZZZA 1ETRH 1O2NA 4ABDA 3SJ9A 4YOJA 1OPHB 2ZGCA 2D2DA 1BUIA 4CR9A 2M5TA 4YOIA 2Z94A 3U98H 3C27B 3GY6A 1CGIE 5K0HA 2OUAA 2A4OA 2UWLA 2XBYA 3E0PB 1P8VC 2KAIB 2BM2A 1LQEA 1OWIA 2P3UB 2PGBB 4ZAEA 3UWJH 2TGAA 2Y80A 2G4TA 1YCPH 2J2UA 3LGYA 2Z9JA 4GAWA 2VWNA 2JETC 4IC6A 3SQHE 1EZUC 1D4PB 1K1PA 1C1UH 1AU8A 3UIRA 7LPRA 1GG6C 4O3TA 3QTOH 4B2AA 1DY9A 2TRMA 1ZHPA 2Z3EA 1IQMA 3PLBA 3OX7U 5JBAS 1QCPA 3M5OA 1BOQA 3TIUA 4Y11E 1QA0A 1V2VT 3F9GA 2P8OB 4E05H 4K1SA 1ANEA 1TWXB 1NRRH 1MKWK 3UQVA 9LPRA 1PQAA 1GI0A 1C2KA 1S85A 1OWKA 4K2YA 3UFAA 1GHZA 3A82A 2FZZA 2GGVB 3GDVA 2B7DH 1NESE 2QV1A 3Q3KA 3PWCA 2A2XH 1MTVA 4MQAA 4LK4A 3RXPA 1UMAH 1AN1E 1O37A 2ZECA 4BANB 5AFYH 2QGRA 5GCHG 1LVOA 1Y59T 1Q31A 1SSXA 2UWOA 2WPMS 3SU6A 1DFPA 1KIGH 4CH2B 1YPEH 3BTGE 1O2SA 1ESTA 5JB9S 3SI3H 3UOPA 3ZZDA 2ZKSA 1GI6A 2FP7B 7GCHF 1W0ZU 3LGIA 1KXAA 1NY22 5DP6A 1RRKA 3GICB 1EAWA 1ZMNA 3SGQE 2ZFTA 4ZHLU 1LQDB 1C5MD 1W2KH 5JB8S 3A80A 1BHXB 1WCZA 1EAUA 4ZKNU 3RXSA 3MWIU 2QC2A 1V3XA 2ZDKA 4FUEA 4MPUA 3R0FA 3BEUA 1SOZA 2SNVA 3Q3YA 1Q3XA 1PQ5A 1TX8A 1NM6A 4CREA 3BTHE 4UONA 3IWMA 1G3EA 1S82A 5JPMH 4RSPA 1ETSH 5FHTA 4K8YA 1P01A 4TPIZ 1KXBA 1WOFA 3CS0A 2BY7X 2ZZUH 3BTQE 4AFSA 2ZA5A 1S5SA 3ZVEA 3VGCB 1NU7B 9ESTA 1S83A 2GT8A 2NU1E 1J8AA 4AX9H 4X8VH 4ABFA 3ESTA 1P2IA 2Z9GA 2O8WA 1BTZA 1EJMA 1P2NA 4GSOA 3SUFA 1GPZA 1ELGA 4UFGH 1M9UA 2UUJB 3PWBA 1H9LB 1J14A 1GWAA 4PROA 3TPIZ 3P8NA 1KLTA 1BRCE 5ESBA 5DP8A 4J2YB 1HYLA 4B73A 2FWWA 4ISHH 1HFDA 4LZ1H 5EPYA 1MBQA 1V2QT 2D1JA 1O2PA 4BXSA 2BVXH 4FU9A 2CF9H 3LGVA 2Y82A 2HLCA 1DWBH 1TA6A 1SFIA 2EEKA 3NXPA 3RDZA 4IGDA 1QY6A 1EAIA 3LC5A 4BOHA 1FNIA 1HBTH 1MBMA 3VXEH 1H8DH 3ZZ8A 2FXRA 1LPZB 2VH6A 2XCNA 4E7NA 1WV7H 2V35A 4GHTA 2GCTB 3H5CB 4HGCA 1WYKA 1BTHH 1UCYH 3LDXH 1TBRH 1B7XB 1FAKH 1UTKA 1MQ6A 4K69A 1G30B 1NTPA 5DP4A 1DXPA 4ISLA 1UTPA 1TNIA 2PUXB 1N6YA 1KXDA 5L30H 1IQHA 1NO9H 2WPJS 2ZI2H 1P3CA 2K7XA 1C2LA 1O3FA 4HTCH 2C8ZB 4A6LA 6CHAB 1C1VH 4ZKSU 1EXFA 1VCWA 3V3MA 1SB1H 3HGPA 4MTBA 2BXUH 1XM1A 3FP8E 2OTVA 2Z7FE 4AGJA 2XTTB 5BPEA 1O3IA 1C1QA 1V2TT 1QNJA 4FUDA 3RXMA 4CBNA 5ESTE 1B0FA 4O3UA 1FAXA 2ZO3H 1WU1A 1TMBH 1ZSKA 1C5SA 2R3YA 4X2XA 1O2XA 1QL8A 2DE8A 1QR3E 2EC9H 1ZHMA 2W7SA 4I8GA 5E2PA 4WY3A 1V2LT 5AVDA 2AMDA 2BD9A 1QB6A 1YC0A 1C5XB 1YYY1 2OP9A 1GJ6A 4INHA 1OOKB 2OBQA 1HDTH 2ZF0H 3BEIB 1C5YB 1T8OA 2STAE 3SGAE 2PKSC 1KXFA 3EGKH 2PTNA 4X6NA 5J4QA 1MMJN 1VZQH 4GPGA 1RXPA 2ZG0H 3ZVGA 4CRGA 2ZFPH 1PPHE 2GCTC 1G3DA 4NIYA 3S7HB 3E91A 3BIVH 3BTWE 1O2ZA 4UE7H 3JZ1B 1OP0A 2ZDMA 1C2FA 4OS1A 2SGFE 3U1IB 2ODPA 1TNGA 2VIQA 1LVMA 1HAZB 5C1YA 4KTSA 3SU4A 1YLCA 3LC3A 1A4WH 1W8BH 2FOMB 3A85A 1W13U 1Y3XA 2XRCA 3MNSA 1EUFA 5C3NA 1L4ZA 1OYTH 4M7GA 3I78A 1VCQA 2VVUA 5FPTA 2FTLE 3MH5A 3GY8A 1QRXA 4R8TB 3SO3A 2G52A 3LONA 3PLPA 2AIQA 4ABJA 3KNXA 1TBZH 5J4SA 1TYNA 3DD2H 2A7HA 1XVMA 4Y6DA 1GHBG 3UR6A 4SGBE 1RJXB 5T6DA 4A92A 3FP6E 2Q1JA 4KTUA 1E35B 1TONA 4AB8A 3M3VA 1GBKA 2ALVA 1QBNA 3UR9A 1BHXF 5IDKA 2IJOB 4KELA 5JBCS 1KY9A 2GD4B 4NCYA 3W94A 1RIWB 1Y3VA 5JDUB 3SUDA 2FX6A 1GMHG 1BTXA 4CR5A 1MKWH 1ZTLA 2Y81A 5A8XA 4UFFH 1HAPH 1BTPA 3RMMH 1S0QA 3LOXA 1DUAA 4Y76A 1ZTKA 4OS7A 1BMNH 3V12A 5HM2A 1AQ7A 5FCRA 1A5HA 2H5DA 2F3CE 1PPZA 2BVSH 3PTNA 5IYTA 2BOHB 1DVAH 3TITA 1C5TA 4OS5A 2C90B 1BITA 3PMJA 4F4OC 1T32A 4NFEA 4DT7B 1ZJDA 1TRMA 2GMTC 3ZVFA 4O03A 3BTME 5HYOA 2ANKH 2BD4A 4ZHAA 1X7AC 1MAXA 5DPAA 2RG3A 2O8MA 3TK5A 2G51A 1AKSA 1QFKH 3M7UA 4AYVB 1MCTA 1JRTA 8ESTE 3LU9B 3HPTB 2UWPA 2TGTA 3T27A 1PJPA 3A84A 1A2CH 1FY5A 2C93B 4E7RG 5T6GA 2ZDVH 3T25A 1RIWC 2VWOA 2OQ5A 5DP7A 1OWEA 1HJAC 1TABE 1XUFA 1E0FD 2ZHDA 2CF8H 7KMEH 3KCGH 3T62A 1AB9B 4DG4A 1BB0B 4RKJB 3P70B 3RXQA 3SU5A 1TOCB 1O35A 2BLOA 1O3EA 1TB6H 4IMZA 1P2KA 1DSUA 1GBEA 3FANA 1WAYB 1GJ8B 4HI3A 1BRAA 1VITH 1A3EH 3T2NA 4ABIA 3TJVA 1TRNA 4KP0A 3ZV9A 1F2SE 1GMCF 1AD8H 1HAVB 3O8BA 1GJDB 5C5OA 1ELEE 4JYVH 2HRVA 1DY8A 2CHAB 3GOVB 3EA9A 4NGAH 2V6NA 1G37A 4XBBA 5LGOA 1TBQH 4XSKU 4X6PA 4FU8A 5A0BA 3GDSA 1T8LA 1DITH 1G2MA 1BDAA 5LH8A 1HRTH 1H9IE 2FOAA 4LZ4B 3PMBB 1GBHA 2BX4A 2AEIH 1Y5BT 1SL3A 1YPMH 1ARBA 1HLTH 1L1JA 4Y8XA 1C5QA 3SV6A 1MKXK 1D6WA 5C20A 3QUMP 1K28D 5FPSA 1ORFA 2GZ8A 1ABJH 2ZNKH 4B75A 1SI5H 3F9EA 5C1UA 4Y8YA 4YLQH 1CSOE 3H7TA 2ZTYA 3P8FA 1D3DB 3UNRA 1FPCH 1RTLA 4OS2A 2DUCA 1XXFA 1G36A 1O2IA 2YNAA 2FOHA 3PMHB 4FUFA 1U6QA 1E36B 4FUHA 1LVYA 1Q2WA 4WXVA 4GLYA 3I77A 2ANMH 1WUNH 1O2LA 1P09A 2W3IA 2PWXA 3D49H 3C1KA 2BDHA 1YM0A 2IOTA 1CT4E 3HK3B 4B2BA 3SV9A 1O3PB 2ZU5A 1MTSA 1OS8A 4NWKA
chains in the Genus database with same CATH superfamily
2KCOA 2WPLS 1OSSA 4B6EA 1SQRA 2O8LA 3S9BA 3AASA 1FI8A 4SGAE 3GCTF 5F03A 3BG4B 5C1XA 1SGNE 1J16A 1SR5C 3QTVH 1W0YH 2CHAC 3RMOH 2QYIA 2FPZA 3MO9A 1O3MA 1SLXB 5EPNA 3RXFA 3RC4A 1GVKB 1A1RA 4WF8A 1TGNA 5FAHA 3Q77A 3ZZ3A 5A8ZA 3B23B 1HGTH 3D62A 1ZYOA 1IHTH 5EQSA 5GIBA 5GPIB 4CRAA 1KDQB 2LP6A 3TU7H 4NWLA 1K1OA 2EY4C 2AERH 2ZU3A 2RA0A 1BRUP 1TQ7B 2VH0A 3MQKC 4Y0YE 2V0BA 4JZ1A 3KQBA 2BB4A 3PLKA 1DWCH 1GJ9B 1HAHH 1K1NA 1WQSA 1O38A 4THNH 3ATKA 1MUEB 1P05A 1Z71A 2FYQA 3MU8A 5DGJA 1LCYA 1GHYH 1GJBB 2QN5T 1MTNC 2AGGX 3A7TA 3BTKE 3O8DA 2HVXA 4JZIA 2FTMA 4Q4LA 2M2AA 4MNWA 4X6MA 7ESTE 3MNCA 3HATH 4BAMB 3GCNA 1DX5M 1TGSZ 1GMDF 1EB1H 1XX9A 1NRSH 3SU2A 2BD7A 3AAVA 4JMYA 2VVVA 5FX6A 1L2EA 5EODA 3ZYEA 3RU4T 1VKYA 1XKBC 2C3SA 5FPYA 2JDID 4RT0A 4FOUC 3UPEA 2PSXA 2Y6TA 4OGYA 2BY9X 2F9OA 1P57B 2ODYB 1O39A 4I86A 2QXGA 2B0FA 3RXDA 1TGCA 1PYTD 3KQ5A 3TK6A 1H1BA 1UVUH 4Y79A 2PGQB 3BEFB 5TCAA 1P10A 2VU8E 1GBDA 3AW0A 1XXDA 4B71A 2GVFA 1HAYB 1N6XA 2OINA 4Y7BA 1Z8GA 1TLDA 3N7EA 4DW2U 2XNDD 1Z8IB 3HKIB 2XW9A 4NZLA 4O9VA 1K2I1 2HGTH 3UREA 1GHAF 1OXGA 2NU3E 4FETA 1AVWA 1ZMLA 2BY5X 2HWLB 2ZFSA 4DT4A 4NA7A 3U9AH 4HFPB 4IW4E 3U8OH 1SHHB 4H42U 3U1JB 8KME2 1GI5A 1NZQH 1GBLA 1VITF 1H4WA 4GCHF 4K60A 1YGCH 2P94A 1FXYA 4YZUA 1TALA 2OQUA 3BN9A 3FAOA 4YT6H 4MVNA 1HB0B 1KMHB 2BYAX 2OBOA 5EQQA 4AORA 4I7YH 2QXHA 1NFWA 1TFXA 1Z8RA 3CENA 1C5OH 1P0SH 2A1DB 3ATMA 3SHAH 3F6UH 3A7ZA 1HJ8A 4HZHA 2ZHEH 5GXPA 3U8TH 3A86A 3L33A 1L1GA 1HJ9A 1O0DH 2GV7A 4R0IA 4WH6A 3ZVAA 2WUCA 1AGJA 1SGYE 4CBOA 4K3JA 1YBWA 3RXBA 1AI8H 1HPGA 3DHKH 2W7UA 3A8DA 1S6HA 2IPHA 2QE7D 1UK4A 3OSYA 5F53A 3ZV8A 3RC5A 1THSH 3SNBA 1A3BH 2GZ9A 1FIZA 1BRBE 4D7FA 1P2JA 1P2QA 3K6ZA 2P8OC 1V6DA 1IQNA 3AAUA 4GHQA 3RU4E 1BBRH 3DFJA 2FS8A 2XBXA 4ISNA 4TY6A 5GJ4B 3TJUA 1ABIH 1BMMH 1C5RA 4ZKOU 2GP9B 4UFDH 2WPIS 2ILNA 4LXBH 3D65E 2SGEE 2AYWA 2VIVA 1F0SA 1FN6A 1Z6JH 2V3HH 4JYUH 2WPDD 1EOJA 1MU8B 2ZEBA 1EQ9A 3EE0B 4ACBA 2AH4X 3UY9A 1A5GH 5DP9A 1V2MT 3TNSA 3EE7A 2ESTE 1ZJKA 3ATIA 3QZQA 3SZNA 1NRNH 3KQCA 4BNRA 1O5CB 1F92A 2BTCE 3F3BA 5F6MA 1O2GH 1AIXH 3UWIA 2OC7A 2ZU4A 1BTYA 3BIUH 1DANH 2HNTF 1E1QD 2F83A 1C4U2 1THPB 1DOJA 5LPFA 1ZPBA 3MFJA 2Y5GA 3WW7A 2G5VA 8GCHG 1EJAA 1TE0A 3RP2A 6GCHG 3VPKA 1E38B 3SNAA 3QDZB 3SNEA 1IQLA 1SC8U 2TBSA 1TGBA 2FS9A 4Z0KA 1P9SA 2D8WA 2H1UA 2VIWA 1AUTC 3GDUA 2VJ1A 3BTEE 1SGFA 2BHGA 1K1LA 2ODQA 1J17T 1GL0E 1MZDA 3TH4H 1SGQE 1HCGA 2Y7ZA 1S81A 4Z6AH 2BXTH 3OY6U 1GI9B 1FJSA 2H2ZA 1OYQA 1ACBE 4K1TA 1E79D 1C2MA 3LGTA 5T1VA 2AFQB 3F0PA 3V7TA 2HPQH 5FCKA 2BLWA 5B6LA 2XNIA 1PPFE 2FI3E 2DE9A 1UTQA 2ZTXA 3ATWA 2A5KA 3N99A 1QB9A 3M36A 2J5UA 3MTYA 3ZVCA 1AZ8A 4AN7A 1SGPE 3SJIA 4AG2A 5E2OA 5T6FA 1EOLA 5DG6A 3K2UA 2LIZA 1NN6A 5G4BA 3VGCC 3ENSB 3ZIAD 5C67A 4IC5A 1E34B 3A83A 2PHBA 4MLFB 3P95A 4FVBA 2Y5FA 3OU0A 2WZQA 2BY6X 2H5CA 1F5RA 1JBUH 3S69A 3PROA 5FBIA 1PPCE 4WMDA 3M5MA 2BD2A 2ZIQH 3GY2A 1A46H 1OKXA 3AW1A 3QK1A 3F68H 3ZZBA 2ZGBH 4YM9A 5A0CA 4TPYA 1QJ6B 1S0RA 1O3GA 1P03A 3HGNA 2CGAA 4INLA 4NIVA 1F5LA 4Y10E 1IQEA 1GBIA 4YTAA 6ESTA 2KCYA 1GDUA 1ETTH 4XRNA 1C5WB 3ZYDA 2KAIA 2QIQA 2F9UA 4NZQA 1TIOA 2Z9KA 3RXTA 1PFXC 2ZPRA 5FL7D 5CE1A 1TQ0B 3KN2A 1TMUH 2F43B 3SJOA 1GHXH 3VB6A 2P93A 2KR7A 3PB1E 1C9TA 1VGCB 2PKAB 3QGJA 1CHOG 4X2YA 1DICA 4X8UH 4BAQB 4CRBA 3EQ0H 2HPPH 2G55A 2YMSB 3KHVA 1UTNA 3SJKA 2GDEH 1Z8JB 2H9HA 1SLUB 1SGIB 2OC0A 1JMOH 2V7QD 4X1QU 1EB2A 3M37A 4NSVA 3TGKE 4XBDA 1O2TA 3SNCA 3LH3A 5CHAB 3ZZ9A 3S9CA 4MPWA 4JZFH 1UK2A 2GKVE 1C1TA 2GCHF 2TIOA 2BD5A 3LGWA 2PW8H 1ZR0A 1O5DH 4RKOB 4U01A 3MU4A 4DGJA 2TGPZ 3V13A 2XBWA 6CHAC 2AS9A 1AO5A 1BMAA 3TLOA 3TVJB 2A4GA 2J34A 2FODA 2WINI 3F9FA 1YPHC 4H6TA 3DSOA 1D6RA 1YPGH 2K0QA 1RS0A 1BZXE 1VJ9U 5F8ZA 4MDSA 1SQAA 3ZVDA 3WY8A 2EQNA 4ZUHA 2P16A 1FY3A 1EPTB 3H09A 5F8TA 3NPSA 1THRH 1BA8B 1NC6A 2XC0A 1EASA 4I31A 2V3MA 3Q00A 1GBBA 1ELBA 1GCTB 1ZLRA 1TA2A 3B9FH 3SNDA 1YCPK 2FX4A 2G8TA 1TAWA 1VGCC 1RFNA 3DUXH 2ZQ1A 1D3TB 1TRYA 1CU1A 1DUEA 2ZFFH 4AOQA 2WV4A 1CBWB 2YMSC 3Q76A 1K0HA 3TK9A 2WHXA 3GYMA 1QQUA 1MD8A 4ABAA 3MNXA 2P59A 1BQYA 1K22H 1YPKH 1EX3A 1JIMA 3CS7A 3O8CA 1HAVA 1C5LH 5CHAC 2I6QA 4NIXA 2WSSD 1GBMA 1O2QA 3SUGA 1D3QB 5DJ7A 1NFUA 1W3CA 3NRLA 4HG6A 7GCHG 4KTCA 4YOGA 2R0LA 3MMGA 5IK2D 1GDNA 1TNJA 5GDSH 1KXEA 4I8KA 2IPQX 2J97A 1OHHD 1O3BA 5EIYA 3RXRA 1RD3B 2BOKA 3FFGA 3H7OA 4ESTE 2R3UA 2BDGA 5L6NH 4WMFA 4X8TH 3HKJB 3SV7A 1FUJA 4O97A 4VGCB 1C1WH 1SMFE 3A8BA 5EQRA 1T31A 3QO6A 2NU0E 5GCHF 5EXMA 4ZKRU 1DWDH 1GCTC 1S84A 2SGAA 3EA7A 1WSSH 1CA0B 1IOEA 1ZPCA 4KGAA 1ANBA 1BBRE 4FXGH 1UJ1A 1O5BB 3EAJA 1E37B 2J38A 3DFLA 1ELDE 3M7QA 4YT7H 1YP9A 4ASUD 1F0RA 1CBWC 3FN8A 4ZXXH 3W1EA 5AF9H 2R2MB 1SGEE 4ZROA 2PSYA 3E6PH 1O3NA 1P04A 4AGKA 2FIRH 1BT7A 1BJUA 1AUJA 1HIAA 1LO6A 2FESH 2RCEA 3KF2A 1MU6B 2XXLA 1AY6H 3SU1A 4BAHB 2FOCA 2L6OA 1UK3A 1FIWA 1O3OA 2XC5A 2XOKD 3MU5A 5DSFA 5EXLA 4A5TS 4LOYH 1YLDA 2XBVA 2ZPSA 3G01A 3MO3A 2B9LA 1A0HB 1FZZA 1O33A 1CVWH 1EFRD 1ZOMA 2BDAA 2QAAA 3NUMA 1FX0B 4AG1A 4I8HA 3TGIE 1QBVH 2ZQ2A 2VBCA 3OTJE 2Q6GA 1ZRBA 3HK6B 4UFEH 3VB4A 4DJZB 2JH6D 2ZFQH 1V2OT 1YY3A 5DKMA 4F49A 2PLXA 1YKTA 4D8NA 3BTTE 2ZTZA 4AFUA 2BDCA 3RXGA 3M3TA 1F7ZA 1VJAU 2LELA 3E3TA 4ABGA 1KDQA 3SUEA 2ZDLA 1LHDH 2K1QA 3F1SB 1AVGH 2W6ID 4XBCA 3ELAH 3TH2H 1G32B 1LPGB 1O3LA 3NZIA 4I8JA 3S0NA 5DO4H 5E0JA 1ZSJA 5JYIA 3JZ2B 3E0NB 3GY4A 1Y5AT 3KQEA 2BMGB 3STIA 2FLRH 4K1EA 1GI4A 1PQ8A 4IMQA 1ZGVA 2WUBA 1O36A 4Q7YA 2I6SA 2OLGA 1C1OA 4KKDA 1DDJA 5HM9A 1LMWB 2R0KA 2ZP0H 5EJZA 1ZRKA 1AB9C 2FOBA 1NFXA 4BAKB 1O2YA 3PTBA 1O5EH 4TWWA 1ANDA 5C94A 2AGEX 2CJIA 2EI6A 1NS3A 5CDFE 2R9PA 1C9PA 3B8JA 3SV8A 2QF4A 1UCYE 1UO6A 3LIWA 3PO1B 4DCDA 1O3JA 4I33A 4YO9A 2YNBA 1LKBA 4WVPE 4IN2A 3A87A 2ZGHA 3RXIA 4A1TA 5A2MH 1UVTH 2ZDAH 1H9HE 2BLQA 4NFFA 1UVOA 1HIAB 4JZDH 1O3DA 3EA8A 1TNLA 4BXWA 4BAOB 4F48B 5B6OA 5EW1H 1GI3A 1O5FH 4JK6A 3RM0H 1UCYK 4ABEA 1DXWA 2GTBA 3RMLH 1A61H 1O3KA 3FKSD 1IQFA 3K9XB 3DT0H 3TGJE 3BF6H 1O2HA 2QY0B 1YPHE 4H6SB 2GT7A 1P9UA 2XCFA 4TWYA 2A32A 4XE4A 2GZ7A 5SGAE 2BLVA 1A7SA 1AWFH 4BTTB 2C4FH 4Y0ZE 4INKA 1V2JT 4Q80A 1AHTH 2FI4E 2ZC9H 1TNKA 3PMAB 2QA9E 3MU0A 2EI8A 1J15A 3M35A 1AWHB 2JETB 5F8XA 1FY4A 3I29A 2THFB 4ISOA 1V2ST 5TCCA 1O2UA 1Y3YA 2AMPA 1ESBA 2GDDA 2VIPA 2Q6FA 2FO9A 1NBME 1C1PA 1P3EA 1BJVA 1LHCH 2BDIA 2VB0A 1Z6EA 1ARCA 2OXSA 3T28A 4ZCNA 1MAYA 4NA8A 2G5NA 5HIZA 3PO1C 3MNBA 1GBJA 2JKHA 2SNWA 1Y3WA 1IHSH 4JYTA 1GBFA 1SGDE 4Q7ZA 3A81A 1DLKB 1GI1A 2HNTC 2TGDA 4D9RA 1QRWA 3GCHB 1FLEE 1MABB 1FV9A 3M3SA 3CNRA 5DP5A 1O3AA 2W5EA 1DE7H 3TJNA 3VG8A 3BG4C 1NT1A 1HXEH 1L4DA 1W10U 1OWHA 1O32A 4ABBA 3ZVBA 3E16B 4MG3A 1QBOA 3BTDE 4CRDA 4D7GA 1GJ7B 3AVZA 1HAIH 1AMHA 1O2JA 4U32A 5ETXA 1K1MA 1SLWB 2AHME 1EP6A 4ASHA 3BG8A 2WYGA 3L3TA 1CT2E 3A89A 3FVFB 3RXHA 3ZZCA 1W14U 2NU4E 5TJXA 2F9VA 1MH0A 2C8XB 2KX4A 4GVUA 2CN0H 4RT1A 3KEEA 1F0TA 3URDA 2ZHFH 2WYJA 3P17H 3A7YA 2P3TB 2J9NA 1W0KD 1GJCB 3KGPA 3MYWA 2PV9B 5HGGA 3E8LA 4NIWA 4X2WA 1T4UH 2QCYA 5EGMA 3OTPA 1GHBF 2QF3A 1KTSB 1AZZA 6LPRA 1C1NA 3PRDA 1CQQA 3LJJA 2ZU1A 5EOKA 1CT0E 1GJAB 2ZCLP 1COWD 1HNEE 1YF4A 2F91A 2H9TH 3VB5A 4CHAB 1P2MA 3TNTA 3A7XA 3GCHC 1T7CA 5HXFA 1GMHF 1UHBB 1PYTC 1LTOA 2A2QH 2ZCHP 2WPKS 4DIIH 4X1NU 1TX6A 1ZGIA 2ZGXH 3DSPA 1F5KU 2OC8A 4Q63A 2OC1A 5FBEA 3A7VA 1QURH 4AZ2B 4QT8C 2B5TB 2A4RA 1EKBB 1FMGA 3FP7E 5K7RA 1UVSH 1IQIA 2BZ6H 2ZU2A 1LKAA 2FOFA 5C0TA 2SGQE 2BQ6B 1O2WA 4WJG2 1UVPA 3UNSA 3ODFA 1LHGH 3KL6A 2PFEA 2Z6BD 3RXJA 3RUOA 4I8LA 1SGRE 3MH4A 1GI2A 5DN6D 1FY8E 4MPVA 1BTWA 3D23A 2ANWA 1SQTA 2IJD1 4WXIA 3VXFH 3M61U 3VB3A 2PR3A 3M5NA 3CP7A 3ITIA 2NU2E 1C4V2 4FUCA 3VB7A 3U69H 1AVXA 2GV6A 1GMCG 1YPJH 4NG9H 5HMAA 1GI8B 3RXCA 1QRZA 3BSQA 2OD3B 1JRSA 4TY7A 2FLBH 4AB9A 2B8OH 5L2ZH 3IITA 4JCNA 5ABWA 2C8WB 4UEHH 3L6PA 3RLYH 2UUFB 3T26A 3UQOA 3FZDA 2SGDE 4CHAC 1SOTA 2CXVA 3EYDA 1N8OB 1SGCA 1C4Y2 3OEED 1FN8A 2F4LA 2BVRH 1GJ5H 5FX5A 2UUYA 3GS9A 1TNHA 3TH3H 1L0ZA 1SGFG 4CH8B 2ZPQA 1DT2A 2PUQH 1TPAE 3S7KB 2ZGJA 2CV3A 4U2WA 1W12U 2A5AA 3MI4A 3SQEE 4ZHMU 4TT3D 2J92A 1JXPA 3LJOA 3U8RH 2VGCB 1MKXH 5I46H 4AYYB 2PKAA 1CO7E 2ZWLH 1WQVH 1QL9A 2A4QA 2FEQH 1V2RT 3M7TA 2J94A 1WTGH 1TOMH 1A0JA 1G3CA 1O2OA 1H8HD 1W0JD 1K21H 5BRRE 2V3OH 1GL1A 3DCLA 2A0QB 5EXNA 2ZHWH 1XUJA 1TGTA 2BY8X 1INCA 2QF0A 2H9EH 2JH5D 1QHRB 5E8EH 1WBGB 1BMLA 2Y7XA 2Z3CA 2KM0A 1RTFB 4A7IB 1NRPH 1BTUA 3QX5H 4AFZA 4DIHH 4U30A 1V2UT 3QWCH 3SI4H 4XDEA 3V0XA 3ZZ7A 1YCPM 3KQDA 3SU3A 3GCTG 1GBCA 1B5GH 1VR1H 2PKSB 3OAAD 1XUIA 2HOBA 4NSYA 3LPRA 1VCPA 1T8MA 1XUHA 3UUZA 1AFQB 2L74A 2HNTE 1QQ4A 1J9CH 5H4IB 1N8OC 2EA3A 1A0LA 2QXJA 1EAXA 2VIOA 2WV5A 3RXOA 1DSTA 3P8OA 5PTPA 1EPTA 4K5ZA 1GHWH 1ZPZA 1V2WT 4B2CA 2WPHS 2XWBI 4AFQA 2ZDNA 3OY5U 1SQOA 1QA7A 2RDLA 5I25A 5JBBS 3SV2H 1K1JA 1KYNA 1QJ1B 2VGCC 4J1YA 1ZHRA 3RMNH 4WMEA 3ZZ4A 4I32A 3S9AA 1K1IA 4MPXA 3A88A 1P02A 5C17A 2G81E 1QTFA 1OP8A 1C2EA 4IBLH 1TPPA 3E90B 1DPOA 1EATA 1V2NT 2A31A 2JJ1D 1BIOA 2Q6DA 1PPGE 5GNDA 3RC6A 4F55A 2A5IA 1A5IA 2EI7A 2XC4A 3O8RA 3GY7A 1W7GH 1SKYE 1RGQA 1O2MA 3QN7A 2A7CA 1EZQA 1EZSC 2C8YB 1GMDG 2BQ7B 1DS2E 2BX3A 1ELVA 1B0EA 4DURA 1Y8TA 2F9NA 4XOJA 2XWAA 1LHFH 1C2IA 5EJ1A 1S6FA 1GJ4H 1C1SA 1GGDB 1JIRA 1HXFH 1C2GA 3R3GB 4RN6A 4CRCA 2BZAA 3EBNA 1AFQC 2D26C 3P6ZB 3SJ8A 3MH6A 3SOSA 3M5LA 3T5FH 5LPRA 4WWYA 1SFQB 2FDAA 1ZSLA 5E0GA 1HAXB 4Q7XA 3RXKA 1C2DA 2Z9LA 3RXUA 1NU9A 3RXEA 5JBTA 1W7XH 1KTTB 2F9PA 4UDWH 1V2KT 1HV7A 1YPLH 3MU1A 3BV9B 3SORA 1XUGA 1SGTA 2VNTA 3KYFA 1PQ7A 3DA9B 3GY5A 2GMTB 3UOUA 1C2HA 1T8NA 1YWUA 1AE5A 1C5PA 1SVPA 2PTCE 1GHAG 4P00A 5C0UA 1ELAA 3SYJA 1ESAA 2G4UA 1V2PT 2SFAA 1K9OE 1SHYA 1TPSA 4FVDA 3OFND 2UUKB 3BTFE 2GX4A 1JWTA 2J95A 2VINA 5AHGH 1Z1IA 1VITG 2VVCA 2NWNA 1GBTA 2Y5HA 4GCHG 3GY3A 3RM2H 1MTUA 4OGXA 1O30A 1JOUB 2BDBA 1XUKA 1MZAA 2PP6A 1HJAB 1QL7A 2HALA 3ODDA 1TMTH 1GGDC 2VIDA 2A45B 2TPIZ 3W95A 4DVAU 1G3BA 1NRQH 1GBAA 5FXLA 1Y3UA 1QB1A 5E0HA 1TPOA 4DOQA 4YLUA 1GCDA 4IN1A 3UTUH 1QIXB 3QLPH 2Z3DA 4X1RU 3A8AA 3RXLA 1WDIA 3RXVA 3MO6A 2FM2A 3F9HA 1DLEA 2FOGA 4FUGA 1C5ZB 2RFKC 2FYRA 2P95A 4FUIA 1O2RA 1ID5H 2BD8A 3ATLA 4JK5A 1MQ5A 1EPTC 2A7JA 3GYLB 1UTMA 4TYDA 4JZEH 1UTOA 4B6FA 1P06A 1C2JA 1PPBH 4CRFA 2W3KA 3ZZ6A 1IQGA 4B76A 3OE7D 3VFEA 4BTUB 1XMNB 3SGBE 3SW2B 2IN2A 3NCLA 5A09A 3SU0A 1UTJA 4ABHA 1C5VA 1P2OA 4E06H 1CGJE 3A7WA 3VEQB 4DY7B 1FONA 1ELTA 1ELCA 5CMXH 1L1NA 5L2YH 1GHVH 1LDTT 1KLIH 1AFEH 2BD3A 2FOEA 3K6YA 1LPKB 4IS5A 4BTIB 4YESB 1WTHD 2F9BH 5A0AE 3NWUA 1H8ED 1BBRK 3A8CA 1G9IE 1SPJA 2W26A 2XYAA 1ANCA 4A1VA 1O2KA 3GISB 3RU4D 2LPRA 4X8SH 4XFQA 3QGNB 4MNVA 1HAOH 4X1SU 1DWEH 1CHGA 3FOAA 3RLWH 1CA8B 1MTWA 1ZTJA 4X6OA 1O5GH 1DM4B 4D76A 3PYHA 4MNXA 4OS4A 4ZMAH 3LKWA 1QGFA 3SHCH 4Y71A 2R2WU 3MHWU 5AFZH 2Z9IA 1C1RA 1FPHH 1TX7A 5A8YA 1OP2A 4ZXYH 1C1MA 1FY1A 4VGCC 2ZHQH 1EZXC 1AE8H 1C5UA 2OCVB 2BDYA 1KXCA 1O5AB 1D9IA 1SG8B 4X0WU 2VWMA 4FUJA 2ZCKP 5GWZA 1CA0C 2W6JD 3STJA 2ULLA 4GUXA 4H4FA 8GCHF 6GCHF 1W11U 3LT3A 1O31A 4Y7AA 5DK1A 1IAUA 4NA9H 5DP3A 1AKSB 3NK8A 3GCOA 1P12E 4TSFD 2AMQA 1EJNA 1N1LA 1QJ7B 2QXIA 2VWLA 1OWDA 1HAGE 1NFYA 1IQKA 1RTKA 1ZMJA 3MH7A 1GVLA 3P8GA 3ZZ5A 3PM3A 5EG4A 2H6MA 4D9QA 4OS6A 1O3CA 2FI5E 2O8UA 1D3PB 2P3FH 5EW2H 3UAIC 1ELFA 4A1XA 5C2ZA 1Z1JA 3IG6B 4B1TA 2BQWB 3EDXB 4UD9H 1MTNB 1Y5UT 1CGHA 2ASUB 4WH8A 4MNYA 2O8TA 3N7OA 3MOCA 5LPEA 3PV4A 1O2VA 2KCPA 3TJOA 2SGPE 2WV9A 3SBKA 3KIDU 2RDEA 1LHEH 1UTLM 4Q2KA 2LNCA 4ISIH 5T3HA 1G2LA 1Z7KA 1KLJH 1IQJA 1O3HA 1GI7B 1F0UA 1O34A 3LGUA 1FDPA 3T29A 1OWJA 1SLVB 4FU7A 1MD7A 5C5NA 1PPEE 1SBWA 2G00A 3K65B 5EJLA 2AGIX 3RXAA 2K8IA 3ZZAA 2JJ2D 2HVYB 1LVBA 2YOLA 1GG6B 2J4IA 3DSGA 1EP5A 2STBE 1MCVA 2ALPA 1T4VH 1XKAC 2GCHG 1KSNA 1H8IH 4X1PU 3OYPA 4AC9A 1NPMA 3FZZA 2O9QA 1FQ3A 1C5NH 2RA3A 3UNQA 1HUTH 2FMJA 2JH0D 1XVOA 5EU8A 1GVZA 1UHBA 4B74A 2ZFRH 2CMYA 3Q3XA 3URCA 1CE5A 4X2VA 1GDQA 2ANYA 3SN8A 3QZRA 4Y8ZA 2AIPA 4FUBA 3NKKA 4K8BA 4ZH8A 1OX1A 1P11E 8LPRA 1CHOF 1NROH 3AK5A 3LH1A 3P92A 3E1XB 1BCUH 1ZZZA 1ETRH 1O2NA 4ABDA 3SJ9A 4YOJA 1OPHB 2ZGCA 2D2DA 1BUIA 3WWBA 4CR9A 2M5TA 4YOIA 2Z94A 2J98B 3U98H 3C27B 3GY6A 1CGIE 5K0HA 2OUAA 2A4OA 2UWLA 2XBYA 3E0PB 1P8VC 2KAIB 2BM2A 1LQEA 1OWIA 2P3UB 2PGBB 4ZAEA 2KCAA 3UWJH 2TGAA 2Y80A 2G4TA 1YCPH 2J2UA 3LGYA 2Z9JA 4GAWA 2VWNA 2JETC 4IC6A 3SQHE 1EZUC 3FO8D 1D4PB 1K1PA 3SZEA 1C1UH 1AU8A 3UIRA 7LPRA 1GG6C 4O3TA 3QTOH 4B2AA 1DY9A 2TRMA 1ZHPA 2Z3EA 1IQMA 3PLBA 3OX7U 5JBAS 1QCPA 3M5OA 1BOQA 3TIUA 4Y11E 1QA0A 3UB0A 1V2VT 3F9GA 2P8OB 4E05H 4Z1MD 4K1SA 1ANEA 1TWXB 3OEHD 1NRRH 1MKWK 3UQVA 9LPRA 1PQAA 1GI0A 1C2KA 1S85A 1OWKA 4K2YA 3UFAA 1GHZA 3A82A 2GJGA 2FZZA 2GGVB 3GDVA 2B7DH 1NESE 2QV1A 3Q3KA 3PWCA 3F2FA 2A2XH 1MTVA 4MQAA 4LK4A 3RXPA 1UMAH 1AN1E 1O37A 2ZECA 4BANB 5AFYH 2QGRA 5GCHG 1LVOA 1Y59T 1Q31A 4ACAA 1SSXA 2UWOA 2WPMS 3SU6A 1DFPA 1KIGH 4CH2B 1YPEH 3BTGE 1O2SA 1ESTA 5JB9S 3SI3H 3UOPA 3ZZDA 2ZKSA 1E1RD 1GI6A 1QZ8A 2FP7B 7GCHF 1W0ZU 3LGIA 1KXAA 1NY22 5DP6A 1RRKA 3GICB 1EAWA 1ZMNA 3SGQE 2ZFTA 3WWFA 4ZHLU 1LQDB 1C5MD 1W2KH 5JB8S 3A80A 1BHXB 1WCZA 1EAUA 4ZKNU 3RXSA 3MWIU 2QC2A 1V3XA 2ZDKA 4FUEA 4MPUA 3R0FA 1S6LA 3BEUA 1SOZA 2SNVA 3Q3YA 1Q3XA 1PQ5A 1TX8A 1NM6A 4CREA 3BTHE 5KEDA 4UONA 3IWMA 1G3EA 1S82A 5JPMH 4RSPA 1ETSH 5FHTA 4K8YA 1P01A 5HKKD 4TPIZ 1KXBA 1WOFA 3CS0A 2BY7X 2ZZUH 3BTQE 4AFSA 2ZA5A 1S5SA 3ZVEA 3VGCB 1NU7B 1WXRA 9ESTA 1S83A 2GT8A 2NU1E 1J8AA 4AX9H 4X8VH 4ABFA 3ESTA 2HLDD 1P2IA 2Z9GA 2O8WA 1BTZA 1EJMA 1P2NA 4GSOA 3SUFA 1GPZA 1ELGA 4UFGH 1M9UA 2UUJB 3PWBA 5HIYA 1H9LB 1J14A 1GWAA 4PROA 3TPIZ 3P8NA 1KLTA 1BRCE 5ESBA 5DP8A 4J2YB 1HYLA 4B73A 2FWWA 4ISHH 1HFDA 4LZ1H 5EPYA 1MBQA 4RI0A 1V2QT 2D1JA 1O2PA 4BXSA 2BVXH 4FU9A 2CF9H 3LGVA 2Y82A 2HLCA 1DWBH 1TA6A 1SFIA 2EEKA 3NXPA 4P02A 3RDZA 4IGDA 1QY6A 1EAIA 3LC5A 4BOHA 2JIZD 1FNIA 1HBTH 1MBMA 3VXEH 1H8DH 3ZZ8A 3F2HA 2FXRA 1LPZB 2VH6A 2XCNA 4E7NA 1WV7H 2V35A 4GHTA 2GCTB 3H5CB 4HGCA 1WYKA 1BTHH 1UCYH 3LDXH 1TBRH 1B7XB 1FAKH 1UTKA 1MQ6A 4K69A 3PV2A 1G30B 1NTPA 5DP4A 1DXPA 4ISLA 1UTPA 1TNIA 2PUXB 1N6YA 1KXDA 5L30H 1IQHA 1NO9H 2WPJS 2ZI2H 1P3CA 3PRBA 2K7XA 1C2LA 1O3FA 4HTCH 2C8ZB 3F0OA 4A6LA 6CHAB 1C1VH 4ZKSU 1EXFA 1VCWA 2KFWA 3V3MA 1SB1H 3HGPA 3PV5A 4MTBA 2BXUH 1XM1A 3FP8E 2OTVA 2Z7FE 4AGJA 2XTTB 5BPEA 1O3IA 1C1QA 1V2TT 1QNJA 4FUDA 3RXMA 4CBNA 5ESTE 1B0FA 4O3UA 1FAXA 2QF5A 2ZO3H 1WU1A 1TMBH 1ZSKA 1C5SA 2R3YA 4X2XA 1O2XA 1QL8A 2DE8A 1QR3E 2EC9H 1ZHMA 2W7SA 4I8GA 5E2PA 4WY3A 1V2LT 5AVDA 2AMDA 2BD9A 1QB6A 1YC0A 1C5XB 1YYY1 2OP9A 1GJ6A 4INHA 1OOKB 2OBQA 1HDTH 2ZF0H 3BEIB 1C5YB 1T8OA 2STAE 3SGAE 1YLNA 2PKSC 1KXFA 3EGKH 2PTNA 2KZ4A 3N7DA 4X6NA 5J4QA 1MMJN 1VZQH 4GPGA 1RXPA 2ZG0H 3ZVGA 4CRGA 2ZFPH 1PPHE 2GCTC 1G3DA 4NIYA 3S7HB 3E91A 3BIVH 3BTWE 1O2ZA 4UE7H 3JZ1B 1OP0A 2ZDMA 1C2FA 4OS1A 2SGFE 3U1IB 2ODPA 1TNGA 2VIQA 1LVMA 1NBMD 1HAZB 5C1YA 4KTSA 3SU4A 1YLCA 3LC3A 1A4WH 1W8BH 2FOMB 2YMSD 3A85A 1W13U 1Y3XA 2XRCA 3MNSA 1EUFA 5C3NA 1L4ZA 1OYTH 4M7GA 3I78A 1VCQA 2VVUA 5FPTA 2FTLE 3MH5A 3GY8A 1QRXA 4R8TB 3SO3A 2G52A 3LONA 4OM9A 3PLPA 2AIQA 4ABJA 3KNXA 1TBZH 5J4SA 1TYNA 3DD2H 2A7HA 1XVMA 4Y6DA 1GHBG 3UR6A 4SGBE 1RJXB 5T6DA 4A92A 3FP6E 2Q1JA 4KTUA 1E35B 1TONA 4AB8A 3M3VA 1GBKA 2ALVA 3U28C 1QBNA 3UR9A 1BHXF 5IDKA 2IJOB 4KELA 5JBCS 1KY9A 2GD4B 4NCYA 3W94A 1RIWB 1Y3VA 5JDUB 3SUDA 2FX6A 1GMHG 1BTXA 4CR5A 1MKWH 1ZTLA 2Y81A 5A8XA 4UFFH 1HAPH 1BTPA 3RMMH 1S0QA 3LOXA 1DUAA 4Y76A 1ZTKA 4OS7A 1BMNH 3V12A 5HM2A 1AQ7A 5FCRA 1A5HA 2H5DA 2F3CE 1PPZA 2BVSH 3PTNA 5IYTA 2BOHB 1DVAH 3TITA 1C5TA 4OS5A 2C90B 2OK5A 1BITA 3PMJA 4F4OC 1T32A 4NFEA 4DT7B 1ZJDA 1TRMA 2GMTC 3ZVFA 4O03A 3BTME 5HYOA 2ANKH 2BD4A 4ZHAA 1X7AC 1MAXA 5DPAA 2RG3A 2O8MA 5KGOA 3KYGA 3TK5A 2G51A 1AKSA 1QFKH 3M7UA 4AYVB 1MCTA 1JRTA 8ESTE 3LU9B 3HPTB 2UWPA 2TGTA 3T27A 1PJPA 3A84A 1A2CH 1FY5A 2C93B 4E7RG 5T6GA 2ZDVH 1BMFD 3T25A 5CHBA 1RIWC 2VWOA 2OQ5A 5DP7A 1OWEA 1HJAC 1TABE 1XUFA 1E0FD 2ZHDA 2CF8H 7KMEH 3KCGH 3T62A 1AB9B 4DG4A 1BB0B 4RKJB 3P70B 3RXQA 3SU5A 1TOCB 1O35A 2BLOA 1O3EA 1TB6H 4IMZA 4XD7D 1P2KA 1DSUA 1GBEA 3FANA 4M9FA 1WAYB 1GJ8B 4HI3A 1BRAA 1VITH 1A3EH 3T2NA 4ABIA 3TJVA 1TRNA 4KP0A 3ZV9A 1F2SE 1GMCF 1AD8H 1HAVB 3O8BA 1GJDB 5C5OA 1ELEE 4JYVH 2HRVA 1DY8A 2CHAB 3GOVB 3EA9A 4NGAH 2V6NA 1G37A 4XBBA 5LGOA 1TBQH 4YXWD 4XSKU 4X6PA 4FU8A 5A0BA 3GDSA 1T8LA 1DITH 1G2MA 1BDAA 5LH8A 1HRTH 1H9IE 2FOAA 4LZ4B 3PMBB 1GBHA 2BX4A 2AEIH 5KECA 1Y5BT 1SL3A 1YPMH 1ARBA 1HLTH 1L1JA 4Y8XA 1C5QA 3SV6A 1MKXK 1D6WA 5C20A 3QUMP 1K28D 5FPSA 1ORFA 2GZ8A 1ABJH 2ZNKH 4B75A 1SI5H 3F9EA 5C1UA 4Y8YA 4YLQH 1CSOE 3H7TA 2ZTYA 3P8FA 1D3DB 3UNRA 1FPCH 1RTLA 2CK3D 4OS2A 2DUCA 1XXFA 1G36A 1O2IA 2YNAA 2FOHA 3PMHB 4FUFA 1U6QA 1E36B 4FUHA 1LVYA 1Q2WA 4WXVA 1UW7A 4GLYA 3I77A 2ANMH 1WUNH 1O2LA 1P09A 2J98A 2W3IA 2PWXA 3D49H 3C1KA 2BDHA 1YM0A 2IOTA 1CT4E 3HK3B 4B2BA 3F2GA 3SV9A 1O3PB 2ZU5A 1MTSA 1OS8A 4NWKA
chains in the Genus database with same CATH topology
2WPLS 1OSSA 2O8LA 3S9BA 3AASA 1FI8A 4SGAE 3GCTF 5F03A 3BG4B 5C1XA 1SGNE 1J16A 1SR5C 3QTVH 1W0YH 2CHAC 3RMOH 2QYIA 2FPZA 3MO9A 1O3MA 1SLXB 5EPNA 3RXFA 3RC4A 1GVKB 1A1RA 4WF8A 1TGNA 5FAHA 3Q77A 3ZZ3A 5A8ZA 3B23B 1HGTH 3D62A 1ZYOA 1IHTH 5EQSA 5GIBA 5GPIB 4CRAA 1KDQB 3TU7H 4NWLA 1K1OA 2AERH 2ZU3A 2RA0A 1BRUP 1TQ7B 2VH0A 4Y0YE 2V0BA 4JZ1A 3KQBA 2BB4A 3PLKA 1DWCH 1GJ9B 1HAHH 1K1NA 1WQSA 1O38A 4THNH 3ATKA 1MUEB 1P05A 1Z71A 2FYQA 3MU8A 5DGJA 1LCYA 1GHYH 1GJBB 2QN5T 1MTNC 2AGGX 3A7TA 3BTKE 3O8DA 2HVXA 4JZIA 2FTMA 4X6MA 4MNWA 7ESTE 3MNCA 3HATH 4BAMB 3GCNA 1DX5M 1TGSZ 1GMDF 1EB1H 1XX9A 1NRSH 3SU2A 2BD7A 3AAVA 4JMYA 2VVVA 5FX6A 1L2EA 5EODA 3ZYEA 3RU4T 1XKBC 2C3SA 5FPYA 3UPEA 2PSXA 2Y6TA 4OGYA 2BY9X 2F9OA 1P57B 2ODYB 1O39A 2QXGA 2B0FA 3RXDA 1TGCA 1PYTD 3TK6A 1H1BA 1UVUH 4Y79A 2PGQB 3BEFB 5TCAA 1P10A 2VU8E 1GBDA 3AW0A 1XXDA 4B71A 2GVFA 1HAYB 1N6XA 2OINA 4Y7BA 1Z8GA 1TLDA 4DW2U 1Z8IB 3HKIB 2XW9A 4NZLA 4O9VA 1K2I1 2HGTH 3UREA 1GHAF 1OXGA 2NU3E 1AVWA 1ZMLA 2BY5X 2HWLB 2ZFSA 4NA7A 3U9AH 4HFPB 4IW4E 3U8OH 1SHHB 4H42U 3U1JB 8KME2 1GI5A 1NZQH 1GBLA 1VITF 1H4WA 4GCHF 4K60A 1YGCH 2P94A 1FXYA 4YZUA 1TALA 2OQUA 3BN9A 3FAOA 4YT6H 4MVNA 1HB0B 2BYAX 2OBOA 5EQQA 4AORA 4I7YH 2QXHA 1NFWA 1TFXA 1Z8RA 3CENA 1C5OH 1P0SH 2A1DB 3ATMA 3SHAH 3F6UH 3A7ZA 1HJ8A 4HZHA 2ZHEH 5GXPA 3U8TH 3A86A 3L33A 1L1GA 1HJ9A 1O0DH 2GV7A 4R0IA 4WH6A 3ZVAA 2WUCA 1AGJA 1SGYE 4CBOA 4K3JA 1YBWA 3RXBA 1AI8H 1HPGA 3DHKH 2W7UA 3A8DA 1S6HA 2IPHA 3OSYA 1UK4A 3ZV8A 3RC5A 1THSH 3SNBA 1A3BH 2GZ9A 1FIZA 1BRBE 4D7FA 1P2JA 1P2QA 3K6ZA 2P8OC 1V6DA 1IQNA 3AAUA 4GHQA 3RU4E 1BBRH 3DFJA 2FS8A 2XBXA 4ISNA 4TY6A 5GJ4B 3TJUA 1ABIH 1BMMH 1C5RA 4ZKOU 2GP9B 4UFDH 2WPIS 2ILNA 4LXBH 3D65E 2SGEE 2AYWA 2VIVA 1F0SA 1FN6A 1Z6JH 2V3HH 4JYUH 1EOJA 1MU8B 2ZEBA 1EQ9A 3EE0B 2AH4X 3UY9A 1A5GH 5DP9A 1V2MT 3TNSA 2ESTE 1ZJKA 3ATIA 3QZQA 3SZNA 1NRNH 3KQCA 4BNRA 1O5CB 1F92A 2BTCE 5F6MA 1O2GH 1AIXH 3UWIA 2OC7A 2ZU4A 1BTYA 3BIUH 1DANH 2HNTF 2F83A 1C4U2 1THPB 1DOJA 5LPFA 1ZPBA 3MFJA 2Y5GA 2G5VA 8GCHG 1EJAA 1TE0A 3RP2A 6GCHG 3VPKA 1E38B 3SNAA 3QDZB 3SNEA 1IQLA 1SC8U 2TBSA 1TGBA 2FS9A 4Z0KA 1P9SA 2D8WA 2H1UA 2VIWA 1AUTC 3GDUA 2VJ1A 3BTEE 1SGFA 2BHGA 1K1LA 2ODQA 1J17T 1GL0E 1MZDA 3TH4H 1SGQE 1HCGA 2Y7ZA 1S81A 4Z6AH 2BXTH 3OY6U 1GI9B 1FJSA 2H2ZA 1OYQA 1ACBE 4K1TA 1C2MA 3LGTA 2AFQB 3V7TA 2HPQH 5FCKA 2BLWA 2XNIA 1PPFE 2FI3E 2DE9A 1UTQA 2ZTXA 3ATWA 2A5KA 1QB9A 3M36A 3MTYA 3ZVCA 1AZ8A 4AN7A 1SGPE 3SJIA 4AG2A 5E2OA 5T6FA 1EOLA 5DG6A 3K2UA 2LIZA 1NN6A 5G4BA 3VGCC 3ENSB 5C67A 4IC5A 1E34B 3A83A 2PHBA 4MLFB 3P95A 4FVBA 2Y5FA 3OU0A 2BY6X 2H5CA 1F5RA 1JBUH 3S69A 3PROA 5FBIA 1PPCE 4WMDA 3M5MA 2BD2A 2ZIQH 3GY2A 1A46H 1OKXA 3AW1A 3QK1A 3F68H 3ZZBA 2ZGBH 4YM9A 5A0CA 4TPYA 1QJ6B 1S0RA 1O3GA 1P03A 3HGNA 2CGAA 4INLA 4NIVA 1F5LA 4Y10E 1IQEA 1GBIA 4YTAA 6ESTA 1GDUA 1ETTH 1C5WB 3ZYDA 2KAIA 2QIQA 2F9UA 4NZQA 1TIOA 2Z9KA 3RXTA 1PFXC 2ZPRA 5CE1A 1TQ0B 3KN2A 1TMUH 3SJOA 1GHXH 3VB6A 2P93A 3PB1E 1C9TA 1VGCB 2PKAB 3QGJA 1CHOG 4X2YA 1DICA 4X8UH 4BAQB 4CRBA 3EQ0H 2HPPH 2G55A 3SJKA 3KHVA 1UTNA 2GDEH 1Z8JB 2H9HA 1SLUB 1SGIB 2OC0A 1JMOH 4X1QU 1EB2A 3M37A 4NSVA 3TGKE 4XBDA 1O2TA 3SNCA 3LH3A 5CHAB 3ZZ9A 3S9CA 4MPWA 4JZFH 1UK2A 2GKVE 1C1TA 2GCHF 2TIOA 2BD5A 3LGWA 2PW8H 1ZR0A 1O5DH 4RKOB 4U01A 3MU4A 4DGJA 2TGPZ 3V13A 2XBWA 6CHAC 2AS9A 1AO5A 1BMAA 3TLOA 3TVJB 2A4GA 2J34A 2FODA 2WINI 3F9FA 1YPHC 4H6TA 1D6RA 1YPGH 1RS0A 1BZXE 1VJ9U 5F8ZA 4MDSA 1SQAA 3ZVDA 3WY8A 4ZUHA 2P16A 1FY3A 1EPTB 5F8TA 3NPSA 1THRH 1BA8B 1NC6A 2XC0A 1EASA 4I31A 3Q00A 1GBBA 1ELBA 1GCTB 1ZLRA 1TA2A 3B9FH 3SNDA 1YCPK 2FX4A 2G8TA 1TAWA 1VGCC 1RFNA 3DUXH 2ZQ1A 1D3TB 1TRYA 1CU1A 1DUEA 2ZFFH 4AOQA 2WV4A 1CBWB 3Q76A 3TK9A 3GYMA 1QQUA 1MD8A 4ABAA 3MNXA 2P59A 1BQYA 1K22H 1EX3A 1YPKH 1JIMA 3CS7A 3O8CA 1HAVA 1C5LH 5CHAC 2I6QA 4NIXA 1GBMA 1O2QA 3SUGA 1D3QB 5DJ7A 1NFUA 1W3CA 7GCHG 4KTCA 4YOGA 2R0LA 3MMGA 1GDNA 1TNJA 5GDSH 1KXEA 4I8KA 1O3BA 3RXRA 1RD3B 2BOKA 3FFGA 3H7OA 4ESTE 2R3UA 2BDGA 5L6NH 4WMFA 4X8TH 3HKJB 3SV7A 1FUJA 4O97A 4VGCB 1C1WH 1SMFE 3A8BA 5EQRA 1T31A 3QO6A 2NU0E 5GCHF 5EXMA 4ZKRU 1DWDH 1GCTC 1S84A 2SGAA 3EA7A 1WSSH 1CA0B 1IOEA 1ZPCA 4KGAA 1ANBA 1BBRE 4FXGH 1UJ1A 1O5BB 3EAJA 1E37B 2J38A 3DFLA 1ELDE 3M7QA 4YT7H 1YP9A 1F0RA 1CBWC 4ZXXH 5AF9H 2R2MB 1SGEE 4ZROA 2PSYA 3E6PH 1O3NA 1P04A 4AGKA 2FIRH 1BT7A 1BJUA 1AUJA 1HIAA 1LO6A 2FESH 2RCEA 3KF2A 1MU6B 2XXLA 1AY6H 3SU1A 4BAHB 2FOCA 1UK3A 1FIWA 1O3OA 2XC5A 3MU5A 5EXLA 4A5TS 4LOYH 1YLDA 2XBVA 2ZPSA 3G01A 3MO3A 2B9LA 1A0HB 1FZZA 1O33A 1CVWH 3NUMA 1ZOMA 2BDAA 2QAAA 3TGIE 4AG1A 4I8HA 1QBVH 2ZQ2A 3OTJE 2Q6GA 1ZRBA 3HK6B 4UFEH 3VB4A 4DJZB 2JH6D 2ZFQH 1V2OT 5DKMA 4F49A 2PLXA 1YKTA 4D8NA 3BTTE 2ZTZA 4AFUA 2BDCA 3RXGA 3M3TA 1F7ZA 1VJAU 3E3TA 4ABGA 1KDQA 3SUEA 2ZDLA 1LHDH 2K1QA 3F1SB 1AVGH 4XBCA 3ELAH 3TH2H 1G32B 1LPGB 1O3LA 3NZIA 4I8JA 3S0NA 5DO4H 5E0JA 1ZSJA 5JYIA 3JZ2B 3E0NB 3GY4A 1Y5AT 3KQEA 2BMGB 3STIA 2FLRH 4K1EA 1GI4A 1PQ8A 4IMQA 1ZGVA 2WUBA 1O36A 4Q7YA 2I6SA 2OLGA 1C1OA 4KKDA 1DDJA 5HM9A 1LMWB 2R0KA 2ZP0H 1ZRKA 1AB9C 2FOBA 1NFXA 4BAKB 1O2YA 3PTBA 1O5EH 4TWWA 1ANDA 2AGEX 2CJIA 2EI6A 1NS3A 2R9PA 1C9PA 3B8JA 3SV8A 1UCYE 1UO6A 3LIWA 3PO1B 4DCDA 1O3JA 4I33A 4YO9A 2YNBA 1LKBA 4WVPE 4IN2A 3A87A 2ZGHA 3RXIA 4A1TA 5A2MH 1UVTH 2ZDAH 1H9HE 2BLQA 4NFFA 1UVOA 1HIAB 4JZDH 1O3DA 3EA8A 1TNLA 4BXWA 4BAOB 5B6OA 5EW1H 1GI3A 1O5FH 4JK6A 3RM0H 1UCYK 4ABEA 1DXWA 2GTBA 3RMLH 1A61H 1O3KA 3K9XB 1IQFA 3TGJE 3DT0H 3BF6H 1O2HA 2QY0B 1YPHE 4H6SB 2GT7A 1P9UA 2XCFA 4TWYA 2A32A 4XE4A 2GZ7A 5SGAE 2BLVA 1A7SA 1AWFH 4BTTB 2C4FH 4Y0ZE 4INKA 1V2JT 4Q80A 1AHTH 2FI4E 2ZC9H 1TNKA 3PMAB 2QA9E 3MU0A 2EI8A 1J15A 3M35A 1AWHB 2JETB 5F8XA 1FY4A 3I29A 2THFB 4ISOA 1V2ST 5TCCA 1O2UA 1Y3YA 2AMPA 1ESBA 2GDDA 2VIPA 2Q6FA 2FO9A 1C1PA 1P3EA 1BJVA 1LHCH 2BDIA 2VB0A 1Z6EA 1ARCA 2OXSA 3T28A 1MAYA 4NA8A 2G5NA 3PO1C 3MNBA 1GBJA 2JKHA 2SNWA 1Y3WA 1IHSH 4JYTA 1GBFA 1SGDE 4Q7ZA 3A81A 1DLKB 1GI1A 2HNTC 2TGDA 4D9RA 1QRWA 3GCHB 1FLEE 1FV9A 3M3SA 5DP5A 1O3AA 2W5EA 1DE7H 3TJNA 3BG4C 1NT1A 1HXEH 1L4DA 1W10U 1OWHA 1O32A 4ABBA 3ZVBA 3E16B 4MG3A 1QBOA 3BTDE 4CRDA 4D7GA 1GJ7B 3AVZA 1HAIH 1AMHA 1O2JA 4U32A 5ETXA 1K1MA 1SLWB 1EP6A 4ASHA 3BG8A 2WYGA 3L3TA 1CT2E 3A89A 3FVFB 3RXHA 3ZZCA 1W14U 2NU4E 5TJXA 2F9VA 1MH0A 2C8XB 4GVUA 2CN0H 3KEEA 1F0TA 3URDA 2ZHFH 2WYJA 3P17H 3A7YA 2P3TB 2J9NA 1GJCB 3KGPA 3MYWA 2PV9B 5HGGA 3E8LA 4NIWA 4X2WA 1T4UH 2QCYA 5EGMA 1GHBF 2QF3A 1KTSB 1AZZA 6LPRA 1C1NA 1CQQA 3LJJA 2ZU1A 5EOKA 1CT0E 1GJAB 2ZCLP 1HNEE 1YF4A 2F91A 2H9TH 3VB5A 4CHAB 1P2MA 3TNTA 3A7XA 3GCHC 1T7CA 5HXFA 1GMHF 1UHBB 1PYTC 1LTOA 2A2QH 2ZCHP 2WPKS 4DIIH 4X1NU 1TX6A 1ZGIA 2ZGXH 1F5KU 2OC8A 2OC1A 5FBEA 3A7VA 1QURH 4AZ2B 4QT8C 2B5TB 2A4RA 1EKBB 1FMGA 3FP7E 5K7RA 1UVSH 1IQIA 2BZ6H 2ZU2A 1LKAA 2FOFA 2SGQE 2BQ6B 1O2WA 4WJG2 1UVPA 3UNSA 3ODFA 1LHGH 3KL6A 2PFEA 2Z6BD 3RXJA 3RUOA 4I8LA 1SGRE 3MH4A 1GI2A 1FY8E 4MPVA 1BTWA 3D23A 2ANWA 1SQTA 4WXIA 3VXFH 3M61U 3VB3A 2PR3A 3M5NA 3CP7A 3ITIA 2NU2E 1C4V2 4FUCA 3VB7A 3U69H 1AVXA 2GV6A 1GMCG 1YPJH 4NG9H 5HMAA 1GI8B 3RXCA 1QRZA 3BSQA 2OD3B 1JRSA 4TY7A 2FLBH 4AB9A 2B8OH 5L2ZH 3IITA 4JCNA 5ABWA 2C8WB 4UEHH 3L6PA 3RLYH 2UUFB 3T26A 3UQOA 3FZDA 2SGDE 4CHAC 1SOTA 2CXVA 3EYDA 1N8OB 1SGCA 1C4Y2 1FN8A 2BVRH 1GJ5H 5FX5A 2UUYA 1TNHA 3TH3H 1L0ZA 1SGFG 4CH8B 2ZPQA 1DT2A 2PUQH 1TPAE 3S7KB 2ZGJA 2CV3A 4U2WA 1W12U 2A5AA 3MI4A 3SQEE 4ZHMU 2J92A 1JXPA 3LJOA 3U8RH 2VGCB 1MKXH 5I46H 4AYYB 2PKAA 1CO7E 2ZWLH 1WQVH 1QL9A 2A4QA 2FEQH 1V2RT 3M7TA 2J94A 1WTGH 1TOMH 1A0JA 1G3CA 1O2OA 1K21H 5BRRE 2V3OH 1GL1A 2A0QB 5EXNA 2ZHWH 1XUJA 1TGTA 2BY8X 1INCA 2QF0A 2H9EH 2JH5D 1QHRB 5E8EH 1WBGB 1BMLA 2Y7XA 2Z3CA 4A7IB 1RTFB 1NRPH 1BTUA 3QX5H 4AFZA 4DIHH 4U30A 1V2UT 3QWCH 3SI4H 4XDEA 3V0XA 3ZZ7A 1YCPM 3KQDA 3SU3A 3GCTG 1GBCA 1B5GH 1VR1H 2PKSB 1XUIA 2HOBA 4NSYA 3LPRA 1VCPA 1T8MA 1XUHA 3UUZA 1AFQB 2HNTE 1QQ4A 1J9CH 5H4IB 1N8OC 2EA3A 1A0LA 2