2H2ZA

Crystal structure of sars-cov main protease with authentic n and c-termini
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
306
structure length
306
Chain Sequence
SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDTVYCPRHVICTAEDMLNPNYEDLLIRKSNHSFLVQAGNVQLRVIGHSMQNCLLRLKVDTSNPKTPKYKFVRIQPGQTFSVLACYNGSPSGVYQCAMRPNHTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGKFYGPFVDRQTAQAAGTDTTITLNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPLTQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGSTILEDEFTPFDVVRQCSGVTFQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Replicase polyprotein 1ab
publication title Production of authentic SARS-CoV M(pro) with enhanced activity: application as a novel tag-cleavage endopeptidase for protein overproduction
pubmed doi rcsb
source organism Sars coronavirus
molecule tags Viral protein
total genus 88
structure length 306
sequence length 306
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2006-05-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1840.10 Mainly Alpha Orthogonal Bundle main proteinase (3clpro) structure, domain 3 main proteinase (3clpro) structure, domain 3 2h2zA03
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2h2zA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2h2zA02
1O34A 2AEIH 2AERH 4A1TA 3NUMA 2STBE 3URCA 1O36A 2Z94A 1TQ7B 1P10A 1C5QA 1PPCE 8GCHF 1QBOA 1LO6A 1P02A 1CVWH 3CP7A 3MOCA 4ZKOU 4FXGH 1G30B 4K60A 5HM9A 1MCTA 1YKTA 3U8RH 4Y8ZA 2D2DA 4X1NU 2Y81A 3SGQE 1ZSLA 1P3CA 2ODPA 3T5FH 9LPRA 1OP2A 3NK8A 1C5LH 5HYOA 1QGFA 3EDXB 4A5TS 4BTIB 2ZF0H 1C5OH 2XC5A 1WUNH 2GMTB 1NRSH 2ZU2A 1OYTH 1GWAA 1W7XH 1H9IE 2HPQH 1V2UT 2ZFRH 4ISOA 3SQHE 1O3KA 5HMAA 2OINA 1XKBC 3AW0A 2B8OH 5E8EH 1GHVH 2BM2A 5TCAA 1TABE 1C4U2 5T3HA 3Q76A 4K5ZA 5F8TA 1SLUB 2B9LA 1AZ8A 1C1TA 1EJAA 3A8AA 3RMMH 3I77A 1C5VA 3ZZ6A 3E8LA 1C5ZB 2FS9A 4YOIA 1CU1A 1GMCG 3RXEA 1G36A 2ALVA 2GTBA 1SGCA 1WTGH 1PQ5A 4IBLH 2C4FH 3S0NA 1C5SA 3U69H 2OTVA 8GCHG 3S9BA 3KEEA 2SGQE 4X2WA 3UOPA 1IQJA 3LGYA 2QXIA 2TPIZ 1IQMA 4GCHF 1CO7E 1BMMH 1D4PB 4FVDA 3RXFA 3OX7U 1J14A 4OS1A 1CA8B 4OS2A 4CRDA 3U9AH 1O3EA 1TX6A 4DCDA 1A2CH 4KTCA 4Z6AH 1Y3VA 3SO3A 3Q3YA 1ETSH 1BRUP 1B0EA 1L1NA 2BX3A 2BLWA 7KMEH 1V2KT 2XYAA 2XXLA 1TAWA 3RC6A 4GLYA 4X8UH 1UTMA 4HZHA 1T7CA 1IOEA 1O2SA 3L33A 4AGJA 1O5FH 2C8XB 1O5BB 1A61H 1TNGA 1Z7KA 4UONA 2V6NA 2HWLB 4YOGA 2AIPA 2O8WA 2BDHA 1D6WA 1QURH 5T6GA 1QA7A 4A7IB 4JZIA 5IDKA 5C5NA 3U8TH 4WF8A 1PJPA 9ESTA 4IMQA 2BD2A 3F68H 1MKWK 3MH4A 3LC5A 1PPGE 3RMNH 3ZZ8A 1XXFA 1SGQE 1O2NA 3P8NA 4O3UA 3GYMA 1EPTC 1TRYA 3VB4A 1KXBA 2ZECA 1QB9A 3A85A 1ZPCA 3M7UA 2BZ6H 3B8JA 4MNVA 2BD4A 1O2HA 3RMLH 3T26A 2VH0A 2NU0E 1LCYA 1CA0C 1HXEH 1GI5A 1ANCA 2ASUB 1GBEA 2BDAA 3RLWH 2Q6FA 1YLCA 4XE4A 1IQGA 2BHGA 4I8HA 1HAGE 1QR3E 1C1PA 1VJ9U 1ELAA 1P06A 3GY7A 3URDA 3ZZ5A 1SHYA 1HAOH 1AO5A 4XSKU 5HXFA 4Z0KA 1CBWC 3P8FA 1P2IA 1D3TB 1XUIA 3IG6B 3ATWA 1OKXA 2Y82A 3SJKA 1EOLA 3SU5A 4B2BA 1YGCH 3VXFH 2PGQB 5TJXA 3STJA 1DE7H 1HGTH 2RCEA 2M5TA 4NIWA 2BXUH 1O3IA 3A81A 1BHXF 4ZROA 3F9GA 2BY6X 3RU4T 3SU6A 4ISNA 1PQ8A 1PPFE 3T62A 4IS5A 5F8ZA 3RXRA 1EQ9A 2AGEX 2EI7A 1P2JA 1YPHE 3TH2H 4E7NA 4YO9A 1UTQA 3Q3KA 1HUTH 3OY5U 1B7XB 4INHA 1GI9B 1OX1A 2G5VA 2GCHF 2ZWLH 3ZVGA 2IPHA 1IQLA 2Z7FE 1O3HA 1GHWH 2XWBI 5DJ7A 3SNBA 5BPEA 1ELGA 4DIHH 3QDZB 4IC5A 4D8NA 2JKHA 2FPZA 2ZZUH 3EA8A 2GX4A 3M61U 5JBAS 3GCHC 1JBUH 1EP6A 1NU7B 3SBKA 3LGTA 2FODA 2FX4A 1WBGB 3RLYH 1XXDA 3BTFE 1FY5A 3GISB 3LGUA 1SHHB 5DP8A 1YPGH 2ZFPH 2ANWA 5E0JA 4MG3A 1SMFE 1EJNA 4VGCC 2HOBA 2Y6TA 1OS8A 3GDUA 1QRWA 2VIVA 3A8CA 2B7DH 1AY6H 1FXYA 1IQHA 5JBBS 4TWWA 4I7YH 1BA8B 5F8XA 3BTGE 1QJ6B 1EOJA 1TE0A 1UTNA 2F9UA 3RM2H 1UK3A 3ATIA 5FHTA 1GMHF 5GCHF 1Y3XA 1SGRE 4ABFA 3E91A 1EXFA 3P6ZB 2ZDVH 3SU2A 3IWMA 3LOXA 5DG6A 5LPFA 1AKSA 2C90B 2FI4E 5GDSH 1QRZA 2OXSA 2FESH 2WPJS 3MNCA 5A09A 2ZQ1A 3TNTA 4XBDA 4OS4A 1GI8B 3CS0A 3RU4D 1SI5H 1RFNA 1P01A 3TGIE 2GCHG 2BXTH 2QY0B 2Z3DA 4GAWA 2ZTXA 4UFEH 1ZYOA 1FAKH 1RJXB 3A86A 3FZZA 1A3EH 4AX9H 1O5DH 3P95A 4ABDA 2UWLA 4ABHA 1ZTKA 3KHVA 1P3EA 1SGEE 3RXGA 5EW2H 2Q1JA 2BOKA 5JPMH 1VCQA 2Z9LA 1FLEE 4FUDA 4KGAA 3SOSA 5LPRA 1J17T 1H9HE 1B0FA 1XM1A 1TA2A 4ZKNU 1IQFA 4DJZB 4IN2A 1K1MA 3V13A 1VITH 4HI3A 2RA3A 1RXPA 1GI6A 2ZU5A 4JZFH 5HM2A 3ZZBA 3MO3A 4NA8A 1JOUB 1HYLA 1HAVA 1N8OB 1D6RA 2AMPA 1WTHD 1O2MA 4IN1A 2A4QA 2QC2A 3RXMA 3GY4A 1DT2A 1P11E 3MWIU 4X8VH 2NU4E 1BJUA 3PTBA 4BAKB 4KKDA 5GXPA 3BF6H 3ZV9A 3V7TA 3F1SB 3R0FA 2FMJA 4B75A 1C5RA 1Y5UT 1L2EA 5IYTA 2F9OA 3ODDA 2PV9B 3GCTF 4INKA 2G55A 1K21H 3AW1A 1BRCE 1EZSC 1SOTA 2SGFE 4Q7ZA 3VGCC 4ZHMU 3QGNB 1IHTH 1SGFG 1FPCH 5FX5A 2FTMA 3UPEA 2PFEA 4DVAU 4ABGA 3P8GA 1MZDA 1G37A 1S81A 3OU0A 1NRQH 3ATMA 2GMTC 5DO4H 1Z6EA 1HCGA 1Y5BT 3VB5A 2V0BA 2FI5E 3GOVB 1CHOF 4MPVA 2A31A 2BVXH 5AFZH 3D49H 1HAYB 3GCOA 5FX6A 1GBFA 3ITIA 1P2MA 2O8TA 1VITF 3TK9A 1XUFA 3QTVH 1O3GA 1XX9A 2HALA 1T4VH 2QN5T 1OWEA 1W11U 1ABJH 1OWKA 4YM9A 4CBOA 2FZZA 1DUEA 4H6TA 5JBTA 1MQ6A 2BD5A 1GBCA 2XWAA 4I8LA 4ESTE 3P70B 5CHAB 2XBXA 1TB6H 3S7KB 2OBOA 1FQ3A 4OS5A 1K22H 1W3CA 3MU0A 3OY6U 3GY6A 3SJOA 4RN6A 4X8TH 1HAIH 5EU8A 4AFZA 1W12U 4LXBH 3NKKA 3E1XB 3LGVA 1V6DA 5DP4A 1A5HA 2WPIS 1T31A 1V2ST 2ZDNA 2ZGHA 2F3CE 2Z6BD 3ODFA 3BG8A 3GCTG 3ZZ9A 3UQVA 2ZFSA 4IGDA 1AU8A 2EA3A 1PPEE 4THNH 1MU6B 3RXHA 2GZ7A 1PYTD 2R2WU 3TJOA 2W5EA 2VIPA 1O2QA 8KME2 2A2QH 1GBIA 4IMZA 3ZVAA 1UMAH 3RXPA 4ZXXH 1HBTH 2ZU1A 4OGYA 1EP5A 1F0RA 1GHAF 3P8OA 3A7VA 1CHOG 3M5MA 3A80A 5CE1A 4M7GA 1Y5AT 3SU0A 3SUDA 1OWHA 3KQCA 1O2UA 2Z3CA 1T32A 4MPUA 4B71A 4NIVA 5A8XA 2BDGA 1XUJA 4YOJA 1BQYA 1ZR0A 3B23B 1DITH 3A82A 4ISLA 2A7HA 3AAUA 3TK6A 3BTTE 3PMJA 2CMYA 4D9QA 3JZ1B 1CT4E 1V3XA 1LHCH 1C9PA 5E2PA 5B6OA 2A4OA 3BSQA 1XVOA 1MBMA 2CF9H 5EXMA 2VGCB 4X0WU 1GGDB 1S82A 1AWHB 2QF0A 2WV5A 3SU3A 3GY3A 1DM4B 1MD7A 3RXAA 4IW4E 1ELBA 1DICA 2BVRH 1HDTH 1Q2WA 3LDXH 1TPAE 2J4IA 3BTHE 1QQ4A 3RXSA 1BRAA 1CGHA 3ZZ7A 2J9NA 1DWDH 1H9LB 4WXIA 1ZJDA 3FP8E 3MI4A 1WQSA 4CRBA 1HPGA 1W8BH 2BY9X 1NESE 5F6MA 2BDCA 2I6QA 1MZAA 3RC5A 4JMYA 1A0LA 1ANBA 4GHQA 1C5MD 2HNTF 1FIWA 1P05A 5EPYA 4B1TA 2P3FH 1SQOA 3M36A 1MUEB 1LVBA 2EI8A 1O32A 3W94A 2OD3B 1TIOA 3LT3A 4Y7AA 4TWYA 1BRBE 4FU9A 1GL1A 1MTWA 1O37A 2ZHEH 2BLOA 2BVSH 1NRPH 1YPHC 1QJ1B 4R0IA 6CHAC 3GY8A 1WV7H 1SGNE 1ZSJA 2G5NA 2NU2E 4ZKRU 3ZZCA 3SNDA 2YNBA 3SZNA 3SGAE 1TBZH 1Z8JB 1C2JA 1KLIH 1O2VA 3GY5A 4KTSA 1IQNA 3ZV8A 1PPHE 5FPTA 3TIUA 4J2YB 3M3VA 2R9PA 4WMDA 1TNLA 1CSOE 3K2UA 1S6HA 1HJ9A 3QUMP 1F5RA 1T8LA 1TONA 3SV6A 1TGSZ 1TBQH 3SGBE 3QN7A 1CE5A 4X6NA 3FP6E 3ZZDA 6GCHG 2BDBA 7GCHF 1H8DH 1DWCH 1O3AA 3PLBA 1WYKA 1AVWA 3MU1A 5FCRA 2CXVA 1GMCF 1S0QA 1GBLA 1PPZA 4FUJA 2WINI 1ELTA 2BY8X 2BDIA 3LIWA 4I33A 4WMFA 1EZXC 4ISIH 2TBSA 2RA0A 3T2NA 5DKMA 2FDAA 3KN2A 1SQTA 2VB0A 1J15A 4GVUA 1TGCA 2QYIA 3QZRA 2VU8E 1GJBB 2VH6A 4O9VA 1CQQA 5AFYH 2FOCA 5EQQA 3RXLA 3BEUA 1Y3UA 3EE0B 4DOQA 1F2SE 3GY2A 1S0RA 1SVPA 2BQWB 3BIVH 3SHAH 1QNJA 3ZVCA 1C2LA 2ZPRA 3D65E 2QXGA 3MNSA 1C5XB 1GBAA 1D3QB 3RXVA 3TLOA 1AWFH 1AQ7A 2VWMA 2PTCE 4K8BA 2VIWA 1ANDA 3EGKH 2D26C 1THRH 3ZVFA 1Z71A 1EAWA 3QTOH 4X2YA 7LPRA 1GBJA 4AYVB 1BZXE 4ZUHA 3DFJA 3LH3A 3MH6A 1ZRKA 3TGJE 4AB9A 5EPNA 4A1XA 1A1RA 1W7GH 2GZ9A 1BTZA 4MNXA 3NXPA 3VPKA 4BXWA 1A0HB 7GCHG 2FOAA 1UVPA 1BHXB 1YC0A 2QGRA 4CRAA 1SGFA 2JETB 4FUEA 4Y76A 1O2TA 4CR9A 1TGBA 1E34B 1T8NA 2ZC9H 3BIUH 1P0SH 2HGTH 5A0CA 1SFIA 3KQEA 2TGAA 2OP9A 2OBQA 1AGJA 5ETXA 2VVUA 1AVGH 3RC4A 4ZMAH 2VWLA 1MAYA 2Y5HA 5GPIB 2SFAA 3NPSA 2C8YB 2G4UA 4B76A 1P04A 3DHKH 1JIRA 3RU4E 2PHBA 2YOLA 4CR5A 2CN0H 1C5PA 2B0FA 2C3SA 3KQBA 1LVOA 3DT0H 1SL3A 3PMAB 1GDQA 2ODQA 1QBVH 2BYAX 4FUGA 3R3GB 1C2DA 2Z9JA 1AVXA 1NRNH 1GMDG 3MNBA 2EEKA 1E38B 3HKJB 3PLPA 1RIWC 1SR5C 2J2UA 1O3DA 1NO9H 1V2NT 2PW8H 5EOKA 1Y3WA 1C1OA 1C9TA 2BD9A 3SHCH 2HPPH 3A83A 3DA9B 1C2MA 2WUCA 3O8RA 4K2YA 4NWLA 1O3NA 1ZHMA 1GHZA 1L4DA 1SFQB 1K1LA 1TRNA 1ZLRA 2G8TA 2PKSC 1VZQH 1O31A 2XBVA 3PTNA 2PUXB 4E7RG 1V2MT 2F9VA 2AGIX 4CBNA 4U32A 4AFSA 1L0ZA 2GDDA 4UFGH 1HJAB 1LDTT 1BIOA 1SPJA 5C20A 1GHXH 2A5AA 1O2WA 2H9TH 2XW9A 4AORA 5LH8A 1QY6A 5J4QA 5CHAC 4ZXYH 2CJIA 2G4TA 4FU7A 1KY9A 1DS2E 2ANMH 1GL0E 1MAXA 4CH2B 3TVJB 4JK6A 1OPHB 1OSSA 1LMWB 1QL8A 2OC1A 2A0QB 4AZ2B 3MU5A 4NIYA 3FANA 2NU1E 4JYVH 4AG1A 3L3TA 4Y7BA 1T4UH 3ENSB 2ZGJA 2BD3A 3UUZA 1YPLH 1ELDE 3FZDA 8LPRA 4Y8XA 5JB9S 3A88A 2GV6A 1ZHRA 1FZZA 4I8JA 4K69A 1V2WT 2H5DA 2J95A 4QT8C 1SGDE 2I6SA 5JYIA 1MKXH 3HK6B 5C1UA 2XC4A 5FXLA 2QXHA 2QXJA 3HATH 2R2MB 2XRCA 1TNHA 2QV1A 2SGDE 3T25A 4CREA 1FY8E 1FIZA 5A0AE 1JRTA 1K2I1 4JYTA 5EGMA 1EZQA 2DUCA 1RTLA 4X2XA 3ZVEA 1C2IA 1G2LA 1Q3XA 3SU1A 2JH5D 3ATKA 1AE5A 1LHGH 1INCA 1D3DB 1NPMA 2ANKH 3BTEE 2J38A 1G3BA 3UNRA 1JWTA 2LIZA 4CHAB 1KSNA 2BB4A 1VR1H 1ACBE 1F92A 1RTFB 2ZCKP 1GJDB 3PMBB 1UJ1A 1N6XA 1TPPA 2CV3A 2ODYB 3MO6A 5FPSA 3DD2H 5AHGH 1OWJA 1DPOA 3CS7A 2F9PA 1O3CA 1AI8H 1GJ9B 1Q31A 1AFEH 2VIQA 3PO1B 3RMOH 1BDAA 4H4FA 2LNCA 4B2AA 4DW2U 1O5EH 1IHSH 2Y7ZA 1S84A 1TPOA 1A3BH 5T6FA 1YM0A 2LPRA 1XMNB 1ELVA 1UTLM 4NFFA 1MQ5A 5DP9A 1EJMA 2GCTC 1LHDH 3M35A 5HGGA 1LHEH 2DE8A 3MTYA 1EX3A 3BTME 1VCWA 3GICB 1PQAA 1ETRH 3ELAH 1SLVB 4LOYH 4MPXA 1RRKA 2A7CA 7ESTE 5F03A 1UK4A 1BTXA 4LZ1H 3FVFB 1E35B 2BLQA 4UDWH 1RS0A 2KAIA 1IQKA 2XCNA 3QGJA 3F9EA 3H5CB 5C3NA 1UHBA 2H9EH 1O2ZA 4F4OC 3UWIA 3LGIA 1YPKH 2FYRA 4ZAEA 1BJVA 3TNSA 2A1DB 1BMNH 4B74A 1WQVH 4KTUA 3UTUH 1TALA 3RP2A 2WPLS 4Q7YA 1C2KA 3QWCH 5TCCA 4INLA 1SC8U 2G52A 2FIRH 1TFXA 4GPGA 2D1JA 4MQAA 2UUKB 1P9UA 1SQAA 2R3UA 2W7UA 1KXAA 2R0LA 1W0YH 1GBKA 3SNCA 5EW1H 3PLKA 4F49A 1UCYH 5FCKA 2PUQH 1NFXA 2VVCA 3PROA 1D3PB 1LHFH 4NIXA 4AYYB 1UTKA 1CGIE 4X1SU 2ZEBA 1BT7A 4WWYA 5H4IB 1THPB 3H7OA 2ZI2H 2W26A 2O8UA 3SUGA 1O33A 5LGOA 4O3TA 4DIIH 1ZPZA 4DG4A 1RD3B 3MH5A 1MTNB 1LTOA 1WSSH 5C1XA 3E3TA 2SNVA 1DANH 1KDQB 2EI6A 1OWIA 1DY9A 1TX8A 2SGEE 2J34A 1ARCA 1O5CB 5C5OA 2IJOB 5PTPA 2ZU4A 4YTAA 1BTYA 1V2TT 1KTTB 3EA7A 2KAIB 1TYNA 4Y11E 2ZCHP 2ZTYA 1CT2E 3RXDA 1BBRH 1FONA 1UHBB 3M5NA 2P59A 1UVTH 4TPIZ 1K1NA 2P94A 1GJ5H 2NU3E 1AZZA 1GHYH 4BXSA 4WY3A 4A1VA 2SGAA 3O8BA 2O8MA 4WJG2 2K7XA 3BV9B 2FI3E 1SGPE 4I8KA 4Q7XA 3GYLB 1QQUA 2HNTE 3VB6A 1BB0B 8ESTE 1ELFA 3S69A 2A32A 1AUTC 1QHRB 2ZGBH 5LPEA 2UUJB 1TPSA 3RXKA 3E0NB 3KNXA 1TMUH 1CA0B 1ZPBA 1O2GH 3BTQE 3FP7E 4KP0A 2Q6GA 1LPGB 2GKVE 5DPAA 1EAXA 1JMOH 3ESTA 3RXIA 1DDJA 2Y7XA 1OP8A 1S6FA 1BTUA 3TU7H 1L4ZA 1P8VC 3ZYEA 2FM2A 3ZZ3A 1A4WH 2K1QA 1OP0A 4IC6A 1DWBH 1EAIA 2BDYA 3TGKE 2Q6DA 4NA9H 3UREA 4BAHB 5G4BA 3SNAA 1J8AA 1U6QA 1GCTB 2ESTE 2FX6A 3A87A 3TJNA 4MVNA 2O9QA 1W0ZU 1AUJA 4U30A 3UIRA 2PGBB 3U98H 4E05H 2H9HA 3EAJA 1G32B 1O3BA 1OXGA 2H6MA 1FV9A 4OS6A 1Z1IA 5GWZA 1ETTH 2A5KA 1O39A 5J4SA 1C2GA 3LGWA 1Z8RA 1O2KA 2WPMS 4A6LA 3LC3A 2ZFQH 2H1UA 5A8ZA 5AF9H 2R0KA 2A7JA 1NY22 1K28D 3T27A 1P2OA 2V3OH 6GCHF 2ZP0H 1E0FD 4ABJA 3Q00A 1YBWA 1TMBH 1TLDA 4X6OA 3M5OA 1K9OE 3GCHB 4WH8A 3TH4H 1LQEA 2ZFFH 2OC0A 1ESBA 3MFJA 3SNEA 3RXOA 2W3IA 3VXEH 5E0GA 1CHGA 4WXVA 4FUCA 2FOEA 3IITA 2CF8H 2QAAA 4Y10E 3SQEE 1RGQA 1QBNA 1O38A 3P17H 3L6PA 3SI4H 2FYQA 1OWDA 3EBNA 3P92A 2QCYA 3F9FA 2A45B 5FBEA 4J1YA 4O97A 3E6PH 5FPYA 1C1WH 4NG9H 4NZLA 1EATA 2ZIQH 1HRTH 1BMLA 3E0PB 1O2OA 3I29A 1ELCA 1O0DH 4XBBA 4JYUH 1E37B 2VWNA 2OLGA 1EAUA 1LVYA 1S5SA 1P12E 1C5NH 3LONA 3OSYA 4JZ1A 1C1SA 4ZHLU 1HAZB 4MTBA 1PQ7A 1C5YB 5L2ZH 1SBWA 1G2MA 5GJ4B 1G3EA 2QIQA 5L30H 2Y5GA 1MTVA 4MNWA 4O03A 1HXFH 1T8MA 1QL7A 3JZ2B 2GVFA 1OOKB 4GUXA 3LU9B 2GZ8A 4K1EA 2ZDKA 1OYQA 1ZZZA 1E36B 5GIBA 5C67A 2UUFB 1PYTC 3OYPA 3PWBA 3OTJE 4Y6DA 1CGJE 1GDNA 5DP5A 1A46H 4FUIA 2PLXA 4CHAC 2A4GA 4H6SB 2H2ZA 4FVBA 3AASA 1PFXC 2OUAA 4RKJB 1ABIH 4ABIA 4MPWA 2G00A 1YPMH 2ALPA 4RSPA 1KXFA 1O2XA 1O3JA 1SOZA 1TWXB 1NM6A 3C1KA 1EZUC 2FWWA 1P09A 3SORA 2FOFA 3RXUA 4R8TB 4CH8B 2BQ6B 2GP9B 3M5LA 3A84A 1EB2A 2AMQA 4DGJA 1GHBG 1SSXA 5SGAE 1DXPA 1UVUH 4KELA 4X6MA 3LKWA 2A4RA 3BN9A 1C1VH 4BAQB 3MYWA 3VGCB 3SV8A 1UTJA 3TJVA 3VEQB 2D8WA 1GMDF 3QZQA 4D7FA 1JXPA 3D62A 2AS9A 1THSH 1DWEH 3S7HB 2QA9E 1QIXB 2ZQ2A 1YCPH 2FLRH 4D7GA 1O3FA 4WH6A 2AGGX 3C27B 1O3LA 1GBDA 2P93A 1B5GH 3TK5A 1LQDB 1DY8A 1C5WB 1NT1A 1Z8IB 5A2MH 1HAHH 1TX7A 3HK3B 1WCZA 2VNTA 3T28A 3E90B 2ZHDA 4OGXA 4B2CA 1BTPA 1K1IA 1YPEH 4UD9H 1C1MA 2F91A 5DP3A 3NCLA 2ZPSA 1ZSKA 3VFEA 1G9IE 1P2KA 3K9XB 1C5UA 5DGJA 1N8OC 3MU4A 2Z9KA 1M9UA 2JH6D 1TMTH 2BD8A 4PROA 2AIQA 2O8LA 4ZH8A 1P9SA 1ZTLA 1NZQH 1P2NA 3BTDE 3U1JB 2A2XH 2NWNA 4XOJA 1O2IA 2VWOA 1TGNA 2AMDA 3TJUA 1MTSA 1MCVA 3SV7A 1MTNC 1TRMA 1GI2A 3F6UH 2C8ZB 4BTUB 4B73A 3PV4A 1MH0A 4FUBA 3EQ0H 1H4WA 1NTPA 3FFGA 1A7SA 2CHAB 2P16A 1XVMA 1GJ8B 1GJ6A 1V2JT 3M37A 2STAE 3ZZAA 5K0HA 1GI3A 2VINA 1MKXK 1IQEA 2FTLE 2ZDLA 1UTPA 2QF3A 3SJIA 2G51A 3Q3XA 3SJ8A 3SUFA 3A7WA 1GI7B 3V0XA 2VIOA 4K1TA 2HNTC 5AVDA 4CRCA 4K8YA 3RXBA 1FPHH 3KIDU 2WPHS 1FY1A 3PMHB 1P2QA 1TNJA 4XBCA 2SGPE 3EA9A 1SLXB 2ANYA 2AYWA 4CRGA 1YP9A 2XBYA 3MU8A 4U01A 1KIGH 1NFYA 3MHWU 2BD7A 3BTKE 4AFUA 2GD4B 1DX5M 1EASA 2ZG0H 5T6DA 1GI1A 5ESBA 1AFQB 1V2PT 2CGAA 5A0BA 2GT8A 4Q80A 2PSYA 2GGVB 4ABBA 2PKAA 1FY4A 4GCHG 2XCFA 1W13U 4Y8YA 1AB9B 5JBCS 2XBWA 2RG3A 1HV7A 1F0TA 2P95A 1TOCB 3NZIA 1NRRH 3ZYDA 1VGCB 3ZZ4A 3D23A 2ZTZA 5EQRA 5CMXH 1XUHA 2AFQB 1P57B 1F0SA 1W14U 2ZDMA 4BAOB 3UFAA 3A7YA 5DP7A 2UWPA 4FUHA 1JRSA 1GJ7B 1UTOA 2F9NA 2F9BH 5ESTE 2R3YA 1LPKB 2HRVA 4UEHH 4MLFB 4Y79A 5L6NH 1EKBB 3W95A 1C5TA 2B5TB 1V2VT 1L1JA 2VJ1A 4AFQA 2YNAA 1Y8TA 4XFQA 1KYNA 1HAXB 1GCTC 2P8OB 5EG4A 1NROH 1ESTA 4UFDH 6CHAB 3RUOA 1BUIA 1MKWH 1A0JA 3A8BA 1EB1H 2PSXA 1AD8H 4X1RU 1C1UH 4Y0YE 2C93B 2VGCC 1BOQA 3S9AA 1GGDC 1KTSB 2ZGXH 1GVZA 4MNYA 2BX4A 1O2YA 3BG4B 2ZHQH 1GG6B 1AE8H 3T29A 1O30A 3O8CA 1AHTH 1C2HA 1BTWA 3SN8A 3BEFB 1QB6A 3LH1A 4E06H 4TYDA 3ZVBA 3RXTA 5JDUB 2WV4A 3LPRA 1DOJA 5FAHA 3KQDA 4SGAE 3A89A 2PKAB 1UCYK 1TA6A 1GJ4H 3TITA 3HKIB 3M3SA 1S85A 1BCUH 2VVVA 1KDQA 1QFKH 2DE9A 2XTTB 1UCYE 4H42U 1BTHH 3GDSA 1V2OT 1YYY1 1CT0E 1YF4A 3ZVDA 1C1QA 1QB1A 1QCPA 3RXCA 3V3MA 1J9CH 4NSVA 1V2LT 1ZGVA 2UUYA 1O5AB 4HTCH 2ZKSA 1FNIA 1FY3A 1SGIB 3MO9A 1GBHA 1LVMA 1LPZB 2Y80A 1H1BA 1F0UA 3UY9A 4JCNA 2W7SA 1Z8GA 2C8WB 1Y59T 2TGPZ 4HGCA 4FUFA 4YLUA 1HNEE 1K1PA 4X1QU 1FJSA 5C1YA 3U1IB 1HAPH 1ESAA 1BBRK 1C2FA 3H7TA 2OCVB 3NWUA 2ZGCA 1XKAC 1NC6A 1NN6A 1O2PA 1EPTA 4JZDH 3VB3A 5ABWA 1TQ0B 2P3UB 3AAVA 3Q77A 3VB7A 1C2EA 1TBRH 4GHTA 1BBRE 2TGTA 3QLPH 1ARBA 2THFB 4AOQA 4WMEA 1RTKA 2AH4X 4ZKSU 4I32A 3M7TA 1N1LA 1S83A 2ULLA 5A8YA 1F5KU 1UVSH 2TGDA 5K7RA 1C1NA 4ABAA 1BMAA 2BMGB 2A5IA 1D9IA 1KXCA 3PM3A 3AVZA 3TPIZ 2UWOA 3ATLA 2ZPQA 1Z6JH 1XUGA 4DURA 3SW2B 1TGTA 1ZOMA 4NFEA 1L1GA 1SB1H 3A8DA 2WPKS 3B9FH 1LKBA 4YT7H 3BEIB 1QA0A 4I8GA 1O2RA 1DVAH 1GMHG 4I31A 4K3JA 5GCHG 2JH0D 1ID5H 4Y71A 5EXNA 1X7AC 1WAYB 2ZNKH 1HIAA 1NU9A 1A5IA 1Y3YA 4AN7A 4U2WA 5BRRE 1FN6A 1C4V2 4LK4A 3A7XA 4D9RA 3G01A 1QJ7B 1GBTA 3I78A 2FEQH 2J94A 2FOBA 1DLKB 1GBBA 2EC9H 4XDEA 1RIWB 1FAXA 3UR6A 4LZ4B 2HLCA 3KF2A 1A5GH 4JK5A 1AKSB 1GBMA 3UWJH 1QL9A 2BZAA 2OC7A 1HLTH 2ZU3A 1FN8A 3HPTB 2ZHWH 1V2QT 2FLBH 2ZHFH 5EXLA 4TY7A 1GJAB 2PKSB 2FS8A 2V35A 2ILNA 2FOHA 1VCPA 2HVXA 2PWXA 1NFWA 1EPTB 2OQUA 2JETC 1SG8B 1K1JA 3N7OA 3O8DA 4BOHA 2H5CA 1K1OA 5DK1A 5JB8S 5I46H 5C2ZA 2V3HH 1SGYE 1AMHA 1IQIA 4X8SH 1TOMH 3GCNA 3KGPA 3PB1E 1GJCB 4OS7A 5DP6A 1MD8A 4X1PU 1YCPM 1O3PB 3PWCA 5E0HA 1MTUA 3M7QA 2XC0A 3M3TA 2BOHB 2ZA5A 2FOGA 4AG2A 6ESTA 1HAVB 4DT7B 4ZHAA 5FBIA 2FP7B 1CBWB 1KLTA 1ZJKA 1MBQA 4AGKA 3K65B 3QK1A 2BTCE 1ZMNA 2BQ7B 2ZFTA 1G3CA 1ANEA 6LPRA 1O3MA 1GI0A 1O5GH 2G81E 4NCYA 1FDPA 1HIAB 3E16B 1AN1E 4UFFH 3K6YA 1GVKB 2BLVA 2J92A 2ZO3H 3KL6A 1GCDA 5EQSA 3SU4A 1KLJH 2CHAC 2TRMA 1UVOA 1ZMLA 2IOTA 2F83A 2OC8A 1ZRBA 3HGPA 4JZEH 3MNXA 2ZDAH 3HGNA 3K6ZA 1GI4A 2XNIA 3CENA 3S9CA 2WYJA 1W10U 1GPZA 1GVLA 1VITG 1P03A 1XUKA 1PPBH 1DSTA 5EODA 3DFLA 3EYDA 2W3KA 4TPYA 1HB0B 3RDZA 3WY8A 1TNKA 1H8IH 4NWKA 2FXRA 1FUJA 2GT7A 4CRFA 1HJAC 2FO9A 4DY7B 1C1RA 1MU8B 1ZGIA 2P3TB 1G3DA 1HFDA 1ZHPA 4UE7H 3KCGH 1QTFA 4RKOB 4MDSA 1ZMJA 1MMJN 1UO6A 1GDUA 1UK2A 1FMGA 1WOFA 5L2YH 4YLQH 3LJJA 1BITA 1AFQC 1F7ZA 2Z3EA 2WYGA 4NSYA 2GV7A 1NFUA 3LJOA 2OQ5A 4VGCB 1T8OA 3U8OH 3SV9A 1AB9C 4FU8A 1VGCC 2ZCLP 3MMGA 1AIXH 3RXQA 4YESB 2BY5X 5E2OA 2Y5FA 4Y0ZE 2GCTB 2PTNA 3SI3H 1VJAU 1IAUA 1GHBF 1DSUA 1O35A 1KXEA 3STIA 4D76A 3SV2H 1SGTA 4NGAH 3RM0H 3UOUA 1LKAA 1GHAG 1QRXA 2Z9GA 1J16A 5I25A 1W2KH 4ASHA 1NS3A 4TY6A 3SUEA 4BANB 1DFPA 2VIDA 4X6PA 4A92A 3UQOA 2SNWA 3UR9A 2P8OC 3QO6A 4BNRA 3BTWE 3FAOA 4YT6H 4NZQA 4NA7A 2PR3A 4K1SA 1HJ8A 1O2JA 1ELEE 1YCPK 3V12A 3PYHA 3RXJA 4GSOA 1DLEA 4BAMB 1O2LA 1O3OA 3F9HA 2Z9IA 1KXDA 3TH3H 3DUXH 4BTTB 1DXWA 2IN2A 4SGBE 1TNIA 1N6YA 1YLDA 1FI8A 4ISHH 2GDEH 1C4Y2 2BY7X 2FOMB 1V2RT 3GDVA 2TIOA 4X2VA 1DUAA 1WU1A 3A7ZA 1EUFA 2RDLA 1Z1JA 3BG4C 3QX5H 1GG6C 4AB8A 3MH7A 4WVPE 3A7TA 1SLWB 3PO1C 4ABEA 4Q2KA 4HFPB 4YZUA 3SJ9A 3UNQA 1F5LA 1ORFA 1YPJH 2WUBA 1JIMA 1ZTJA 3UNSA
chains in the Genus database with same CATH superfamily
1O34A 2AEIH 2AERH 4A1TA 3NUMA 2STBE 3URCA 1O36A 2Z94A 1TQ7B 3VG8A 1P10A 1C5QA 1PPCE 8GCHF 1QBOA 1LO6A 1P02A 1CVWH 3CP7A 3MOCA 4ZKOU 4FXGH 1G30B 4K60A 5HM9A 1MCTA 1YKTA 3U8RH 5EJLA 4Y8ZA 5B6LA 2D2DA 4X1NU 2Y81A 3SGQE 1ZSLA 1P3CA 3FN8A 2ODPA 3T5FH 9LPRA 1OP2A 3NK8A 1C5LH 5HYOA 1QGFA 3EDXB 4A5TS 3ZIAD 4BTIB 4Z1MD 2ZF0H 1C5OH 2XC5A 1WUNH 2GMTB 1NRSH 2ZU2A 1OYTH 1GWAA 1W7XH 1H9IE 2HPQH 1V2UT 2ZFRH 4ISOA 3SQHE 1O3KA 3F2FA 5HMAA 2OINA 1XKBC 3AW0A 2B8OH 5E8EH 1GHVH 2BM2A 2QE7D 2WPDD 5TCAA 1TABE 1C4U2 5T3HA 3Q76A 4K5ZA 5F8TA 3N7EA 1SLUB 2B9LA 1AZ8A 1C1TA 1EJAA 3A8AA 3RMMH 3I77A 1C5VA 3ZZ6A 3E8LA 1C5ZB 2FS9A 4YOIA 1CU1A 1GMCG 3RXEA 1G36A 2ALVA 2GTBA 1SGCA 1WTGH 1PQ5A 4IBLH 2C4FH 3S0NA 1C5SA 3U69H 2OTVA 8GCHG 3S9BA 3KEEA 2SGQE 4X2WA 3UOPA 1IQJA 3LGYA 2QXIA 2TPIZ 1IQMA 4GCHF 1CO7E 1BMMH 1D4PB 4FVDA 3RXFA 3OX7U 1J14A 4OS1A 1CA8B 4OS2A 4CRDA 3U9AH 1O3EA 1TX6A 4DCDA 1A2CH 2LELA 2YMSC 4KTCA 4Z6AH 1Y3VA 3SO3A 3FO8D 3Q3YA 1ETSH 1BRUP 1B0EA 1L1NA 2BX3A 2BLWA 7KMEH 1V2KT 2XYAA 2XXLA 1TAWA 3RC6A 4GLYA 4X8UH 1UTMA 4HZHA 1T7CA 1IOEA 3WWBA 1O2SA 3L33A 4AGJA 1O5FH 2C8XB 1O5BB 1A61H 1TNGA 1Z7KA 4UONA 2V6NA 2HWLB 4YOGA 2AIPA 2O8WA 2BDHA 1D6WA 1QURH 5T6GA 1QA7A 4A7IB 2F4LA 4JZIA 5IDKA 5C5NA 2XOKD 3U8TH 4WF8A 1PJPA 2KR7A 9ESTA 4IMQA 2BD2A 3F68H 1MKWK 3MH4A 3LC5A 1PPGE 3RMNH 3ZZ8A 1XXFA 1SGQE 1O2NA 3P8NA 4O3UA 3GYMA 2RDEA 1EPTC 1TRYA 3VB4A 1KXBA 2ZECA 1QB9A 3A85A 1ZPCA 3M7UA 2BZ6H 3B8JA 4MNVA 3DSGA 2BD4A 1O2HA 3RMLH 3T26A 2VH0A 2NU0E 1LCYA 1CA0C 1HXEH 1GI5A 1ANCA 2ASUB 1OHHD 1H8HD 1GBEA 2BDAA 3RLWH 2Q6FA 1YLCA 4XE4A 1IQGA 2BHGA 4I8HA 1HAGE 1QR3E 1C1PA 1VJ9U 1ELAA 1P06A 3GY7A 3URDA 3PV5A 3ZZ5A 1SHYA 1HAOH 1AO5A 4XSKU 5HXFA 4Z0KA 1CBWC 3P8FA 1P2IA 2KCOA 1D3TB 1XUIA 3IG6B 3ATWA 1OKXA 2Y82A 3SJKA 1EOLA 3SU5A 4B2BA 1YGCH 3OEHD 3VXFH 2PGQB 5TJXA 3STJA 1DE7H 1HGTH 3N7DA 2RCEA 2M5TA 4NIWA 2BXUH 1O3IA 3A81A 1BHXF 4ZROA 3F9GA 2BY6X 3RU4T 3SU6A 4ISNA 1PQ8A 1SQRA 5IK2D 1PPFE 3T62A 4IS5A 5F8ZA 3RXRA 1EQ9A 2AGEX 2EI7A 1P2JA 1YPHE 3TH2H 4E7NA 4YO9A 1MABB 1UTQA 3Q3KA 1HUTH 3OY5U 1B7XB 4INHA 1GI9B 1OX1A 2G5VA 2GCHF 2ZWLH 3ZVGA 2IPHA 1IQLA 2Z7FE 1O3HA 1GHWH 2XWBI 5DJ7A 3SNBA 5BPEA 1ELGA 4DIHH 3QDZB 4IC5A 4D8NA 2JKHA 2FPZA 2ZZUH 1BMFD 3EA8A 2GX4A 3M61U 5JBAS 3GCHC 4ZCNA 1JBUH 1EP6A 1NU7B 3SBKA 3LGTA 2FODA 2FX4A 1WBGB 3RLYH 1XXDA 3BTFE 1W0KD 1FY5A 3GISB 3LGUA 1SHHB 5DP8A 1YPGH 2ZFPH 2ANWA 5E0JA 4MG3A 1SMFE 1EJNA 4VGCC 2HOBA 2Y6TA 3DSPA 1OS8A 3GDUA 1QRWA 2VIVA 3A8CA 2B7DH 1AY6H 1FXYA 1IQHA 5JBBS 4TWWA 4I7YH 1BA8B 5F8XA 3BTGE 1QJ6B 4FETA 1EOJA 1TE0A 1UTNA 2F9UA 3RM2H 1UK3A 3ATIA 5FHTA 1GMHF 5GCHF 1Y3XA 1SGRE 4ABFA 3E91A 1EXFA 3P6ZB 2ZDVH 3SU2A 3IWMA 3LOXA 5DG6A 5LPFA 1AKSA 1E1QD 2C90B 2FI4E 5GDSH 1QRZA 2OXSA 2FESH 2WPJS 3MNCA 5A09A 2ZQ1A 3TNTA 4XBDA 4OS4A 1GI8B 3CS0A 3RU4D 1SI5H 1RFNA 1P01A 2J5UA 3TGIE 2GCHG 2BXTH 2QY0B 2Z3DA 4GAWA 3W1EA 2ZTXA 4UFEH 1ZYOA 1FAKH 1RJXB 3A86A 3FZZA 1A3EH 4AX9H 1O5DH 3P95A 4ABDA 2UWLA 4ABHA 1ZTKA 3KHVA 1P3EA 1SGEE 3RXGA 5EW2H 2Q1JA 2BOKA 5JPMH 1VCQA 2Z9LA 1FLEE 4FUDA 4KGAA 3SOSA 5LPRA 1J17T 1H9HE 1B0FA 1XM1A 1TA2A 4ZKNU 1IQFA 4DJZB 4IN2A 1K1MA 3V13A 1VITH 4HI3A 2RA3A 1RXPA 1GI6A 2ZU5A 4JZFH 5HM2A 3ZZBA 3MO3A 4NA8A 1JOUB 1HYLA 1HAVA 1N8OB 1D6RA 2AMPA 1WTHD 1O2MA 4IN1A 2A4QA 2W6ID 2QC2A 3RXMA 3GY4A 1DT2A 1P11E 3MWIU 1UW7A 4X8VH 2NU4E 1BJUA 3PTBA 4BAKB 4KKDA 5GXPA 3BF6H 3ZV9A 3V7TA 3F1SB 3R0FA 2FMJA 4B75A 1C5RA 1Y5UT 1L2EA 5IYTA 2F9OA 3ODDA 2PV9B 3GCTF 4INKA 2G55A 1K21H 3AW1A 1BRCE 1EZSC 1SOTA 2SGFE 4Q7ZA 3VGCC 4ZHMU 3QGNB 1IHTH 1SGFG 1FPCH 5FX5A 2FTMA 1WXRA 3UPEA 2PFEA 4DVAU 4ABGA 3P8GA 1MZDA 1G37A 1S81A 3OU0A 5FL7D 1NRQH 3ATMA 2GMTC 5DO4H 1Z6EA 1HCGA 1Y5BT 3VB5A 2V0BA 2FI5E 3GOVB 1CHOF 4MPVA 2LP6A 2A31A 2BVXH 5AFZH 3D49H 1HAYB 3GCOA 5FX6A 1GBFA 3ITIA 1P2MA 2O8TA 1VITF 3TK9A 1XUFA 3QTVH 1O3GA 4P02A 4TT3D 1XX9A 2HALA 1T4VH 2QN5T 1OWEA 1W11U 1ABJH 1OWKA 4YM9A 4CBOA 2FZZA 5C0UA 1DUEA 4H6TA 5JBTA 1MQ6A 2BD5A 1GBCA 2XWAA 4I8LA 4ESTE 3P70B 5CHAB 2XBXA 1TB6H 3S7KB 2OBOA 1FQ3A 4OS5A 1K22H 1W3CA 3MU0A 3OY6U 3GY6A 3SJOA 4RN6A 4X8TH 1HAIH 5EU8A 4AFZA 1W12U 4LXBH 3NKKA 3E1XB 3LGVA 1V6DA 5DP4A 1A5HA 2WPIS 1T31A 1V2ST 2ZDNA 2ZGHA 2J97A 2RFKC 2F3CE 2Z6BD 3ODFA 3BG8A 3GCTG 3ZZ9A 3UQVA 2ZFSA 4IGDA 3KYGA 1AU8A 2EA3A 1PPEE 4THNH 1MU6B 3RXHA 2GZ7A 1PYTD 2R2WU 5C17A 3TJOA 2W5EA 2VIPA 1O2QA 8KME2 2A2QH 1GBIA 4IMZA 3ZVAA 1UMAH 3RXPA 4ZXXH 1HBTH 2ZU1A 4OGYA 1EP5A 1F0RA 1GHAF 3P8OA 3A7VA 1CHOG 3M5MA 3A80A 5CE1A 4M7GA 1Y5AT 3SU0A 3SUDA 1OWHA 3KQCA 1O2UA 2Z3CA 1T32A 4MPUA 4B71A 4NIVA 5A8XA 2BDGA 1XUJA 4YOJA 1BQYA 1ZR0A 3B23B 2KZ4A 1DITH 3A82A 4ISLA 2A7HA 3AAUA 3TK6A 3BTTE 3PMJA 2CMYA 4D9QA 3JZ1B 1CT4E 1V3XA 3PRDA 1LHCH 1C9PA 5E2PA 5B6OA 2A4OA 2F43B 3BSQA 1XVOA 1MBMA 2CF9H 5EXMA 2VGCB 4X0WU 1GGDB 1S82A 1AWHB 2QF0A 2WV5A 3SU3A 3GY3A 1DM4B 1MD7A 4RT0A 3RXAA 4IW4E 1ELBA 4FOUC 1DICA 2BVRH 1HDTH 1Q2WA 3LDXH 1TPAE 2J4IA 3BTHE 1QQ4A 3RXSA 1BRAA 1CGHA 3ZZ7A 2J9NA 1DWDH 1H9LB 4WXIA 1ZJDA 3FP8E 3MI4A 3EE7A 1WQSA 4CRBA 1HPGA 1W8BH 2BY9X 1NESE 5F6MA 1FX0B 2BDCA 2I6QA 1MZAA 2JJ2D 5T1VA 4JMYA 3RC5A 1A0LA 1ANBA 4GHQA 1C5MD 2HNTF 1FIWA 1P05A 5EPYA 4B1TA 2P3FH 1SQOA 3M36A 1MUEB 1LVBA 2EI8A 1O32A 3W94A 2OD3B 1TIOA 3LT3A 4Y7AA 4TWYA 1BRBE 4FU9A 1GL1A 1MTWA 1O37A 2ZHEH 2BLOA 2BVSH 1NRPH 1YPHC 1QJ1B 4R0IA 6CHAC 3GY8A 1WV7H 1SGNE 1ZSJA 2G5NA 2NU2E 4ZKRU 3ZZCA 3SNDA 2YNBA 3SZNA 3SGAE 1TBZH 1Z8JB 1C2JA 1KLIH 1O2VA 3GY5A 4KTSA 1IQNA 3ZV8A 5EIYA 1PPHE 5FPTA 3TIUA 4J2YB 3M3VA 2R9PA 4WMDA 2IJD1 1TNLA 1CSOE 3K2UA 4OM9A 1S6HA 1HJ9A 3QUMP 1F5RA 1T8LA 1TONA 3SV6A 1TGSZ 1TBQH 3SGBE 3QN7A 1CE5A 4X6NA 3FP6E 3ZZDA 6GCHG 2BDBA 7GCHF 1H8DH 1DWCH 1O3AA 3PLBA 1WYKA 1AVWA 3MU1A 5FCRA 2CXVA 1GMCF 1S0QA 1GBLA 1PPZA 4FUJA 2WINI 2M2AA 1ELTA 2BY8X 2BDIA 3LIWA 4I33A 4WMFA 1EZXC 4ISIH 2TBSA 2RA0A 3T2NA 5DKMA 2FDAA 3KN2A 1SQTA 2VB0A 1J15A 4GVUA 1TGCA 2QYIA 3QZRA 2VU8E 1GJBB 2VH6A 4O9VA 1CQQA 5AFYH 2FOCA 3FKSD 5EQQA 3RXLA 3BEUA 1Y3UA 3EE0B 5HIZA 4DOQA 1H8ED 1F2SE 3GY2A 1S0RA 1SVPA 2BQWB 3BIVH 3SHAH 1QNJA 3ZVCA 1C2LA 2ZPRA 3D65E 2QXGA 2QF5A 3MNSA 1C5XB 1GBAA 1D3QB 3RXVA 3TLOA 1AWFH 1AQ7A 2VWMA 2PTCE 4K8BA 2VIWA 1ANDA 3EGKH 2D26C 3CNRA 1THRH 3ZVFA 1Z71A 1EAWA 5DSFA 3QTOH 4X2YA 3WW7A 1GBJA 4AYVB 7LPRA 1BZXE 4ZUHA 3DFJA 2GJGA 3LH3A 1ZRKA 3MH6A 3TGJE 4AB9A 5EPNA 4A1XA 1A1RA 1W7GH 2GZ9A 1BTZA 4MNXA 3NXPA 3VPKA 4BXWA 1A0HB 7GCHG 2FOAA 1UVPA 1BHXB 1YC0A 2QGRA 4CRAA 1SGFA 2JETB 4FUEA 4Y76A 1O2TA 4CR9A 1TGBA 1E34B 1T8NA 2ZC9H 3BIUH 4B6EA 1P0SH 2HGTH 5A0CA 1SFIA 3KQEA 2TGAA 2OP9A 2OBQA 1AGJA 5ETXA 2VVUA 1AVGH 3RC4A 4ZMAH 2VWLA 2EQNA 1MAYA 2Y5HA 5GPIB 2SFAA 3NPSA 2C8YB 2G4UA 4B76A 1P04A 4ACBA 3DHKH 1JIRA 3RU4E 2PHBA 2YOLA 4CR5A 2CN0H 1C5PA 2B0FA 2C3SA 3KQBA 1LVOA 3DT0H 5C94A 1SL3A 3PMAB 1GDQA 2ODQA 1QBVH 2BYAX 4FUGA 3R3GB 1C2DA 2Z9JA 1AVXA 1NRNH 1GMDG 3MNBA 2EEKA 1E38B 3HKJB 3PLPA 1RIWC 1SR5C 2J2UA 1O3DA 1NO9H 1V2NT 2PW8H 5EOKA 1Y3WA 1C1OA 1C9TA 2BD9A 3SHCH 2HPPH 3A83A 3DA9B 1C2MA 2WUCA 3O8RA 4K2YA 4NWLA 1O3NA 1ZHMA 1GHZA 1L4DA 1SFQB 1K1LA 1TRNA 1ZLRA 2G8TA 2PKSC 1VZQH 1O31A 2XBVA 3PTNA 2K0QA 2PUXB 4E7RG 1V2MT 2F9VA 2AGIX 4CBNA 4U32A 4AFSA 1L0ZA 3MQKC 2GDDA 4UFGH 1HJAB 1LDTT 1BIOA 1SPJA 5C20A 1GHXH 2A5AA 1O2WA 2H9TH 2XW9A 4AORA 5LH8A 1QY6A 5J4QA 5CHAC 4ZXYH 2CJIA 2G4TA 4FU7A 1KY9A 1DS2E 3F0OA 2ANMH 1GL0E 1MAXA 4CH2B 3TVJB 4JK6A 1OPHB 1OSSA 1LMWB 1QL8A 2OC1A 2A0QB 4AZ2B 3MU5A 4NIYA 3FANA 2NU1E 4JYVH 4AG1A 3L3TA 4Y7BA 1T4UH 3ENSB 2ZGJA 2BD3A 3UUZA 1YPLH 1ELDE 3FZDA 8LPRA 4Y8XA 5JB9S 3PRBA 3A88A 2GV6A 1ZHRA 1FZZA 4I8JA 4K69A 1V2WT 2H5DA 2J95A 4QT8C 1SGDE 2I6SA 5JYIA 1MKXH 3HK6B 5C1UA 2XC4A 5FXLA 2QXHA 2QXJA 3HATH 2R2MB 2XRCA 1TNHA 2QV1A 2SGDE 3T25A 2IPQX 4CREA 1FY8E 1FIZA 5A0AE 1JRTA 2QF4A 1K2I1 4JYTA 5EGMA 1EZQA 2DUCA 1RTLA 4X2XA 3ZVEA 1C2IA 1G2LA 1Q3XA 3SU1A 2JH5D 3ATKA 5GNDA 1AE5A 1LHGH 1INCA 1D3DB 1NPMA 2ANKH 3BTEE 2J38A 1G3BA 3UNRA 1JWTA 2LIZA 4CHAB 1KSNA 2BB4A 1VR1H 1ACBE 1F92A 1RTFB 2ZCKP 1GJDB 3PMBB 1UJ1A 1N6XA 3FOAA 1TPPA 2CV3A 2ODYB 3MO6A 5FPSA 3DD2H 5AHGH 1OWJA 1DPOA 2WSSD 3CS7A 2F9PA 1O3CA 1AI8H 1GJ9B 1Q31A 1AFEH 2VIQA 3PO1B 3RMOH 1BDAA 4HG6A 4H4FA 2LNCA 4B2AA 4DW2U 1O5EH 1IHSH 2Y7ZA 2XNDD 1S84A 1TPOA 1A3BH 5T6FA 1YM0A 2LPRA 1XMNB 1ELVA 1UTLM 4NFFA 1MQ5A 5DP9A 1EJMA 2GCTC 1LHDH 3M35A 5HGGA 1LHEH 2DE8A 3MTYA 1EX3A 3BTME 1VCWA 3GICB 1PQAA 1ETRH 3ELAH 1SLVB 4LOYH 4MPXA 1RRKA 2A7CA 7ESTE 5F03A 1UK4A 1BTXA 4LZ1H 4RI0A 3FVFB 1E35B 2BLQA 4UDWH 1RS0A 2KAIA 1IQKA 2J98A 2XCNA 3QGJA 3F9EA 3H5CB 5C3NA 1UHBA 2H9EH 1O2ZA 4F4OC 3UWIA 3LGIA 1YPKH 2FYRA 4ZAEA 1BJVA 3TNSA 2A1DB 1BMNH 4B74A 2L74A 1WQVH 2WZQA 4KTUA 3UTUH 1TALA 3RP2A 2WPLS 4Q7YA 1C2KA 3QWCH 5TCCA 4INLA 1SC8U 2G52A 2FIRH 1TFXA 4GPGA 2D1JA 3UAIC 4MQAA 2VBCA 2UUKB 2WV9A 1P9UA 1SQAA 2R3UA 2W7UA 1KXAA 2R0LA 1W0YH 1GBKA 3SNCA 5EW1H 3PLKA 4F49A 1UCYH 5FCKA 2PUQH 1NFXA 2VVCA 3PROA 1D3PB 1LHFH 4NIXA 4AYYB 1UTKA 1CGIE 4X1SU 2ZEBA 1BT7A 4WWYA 5H4IB 1THPB 3H7OA 2ZI2H 2W26A 2O8UA 3SUGA 1O33A 5LGOA 4O3TA 4DIIH 1ZPZA 4DG4A 1RD3B 3MH5A 1MTNB 1LTOA 1WSSH 5C1XA 3E3TA 2SNVA 1DANH 1KDQB 2V7QD 2EI6A 1OWIA 1DY9A 1TX8A 2YMSB 2SGEE 2J34A 4TSFD 1ARCA 1O5CB 5C5OA 2IJOB 5PTPA 2ZU4A 4YTAA 1BTYA 1V2TT 1KTTB 3EA7A 2KAIB 1TYNA 4Y11E 2ZCHP 2J98B 2ZTYA 1CT2E 3RXDA 1BBRH 1FONA 1UHBB 3M5NA 2P59A 1UVTH 4TPIZ 1K1NA 2P94A 1GJ5H 2NU3E 1AZZA 1GHYH 4BXSA 1E1RD 4WY3A 4A1VA 2SGAA 3O8BA 2O8MA 3AK5A 4WJG2 2K7XA 3BV9B 2FI3E 1SGPE 4I8KA 4Q7XA 3GYLB 1QQUA 2HNTE 3VB6A 1BB0B 8ESTE 1ELFA 3S69A 1SKYE 2A32A 1AUTC 1QHRB 2ZGBH 5LPEA 2UUJB 1TPSA 3RXKA 3E0NB 4RT1A 3KNXA 1TMUH 1CA0B 1ZPBA 1O2GH 3BTQE 3FP7E 4KP0A 2Q6GA 1LPGB 2GKVE 5DPAA 1EAXA 1JMOH 3ESTA 3RXIA 1DDJA 2Y7XA 1OP8A 1S6FA 1BTUA 3TU7H 5KEDA 1L4ZA 1P8VC 3ZYEA 2FM2A 3NRLA 3ZZ3A 2AHME 1A4WH 2K1QA 1OP0A 4IC6A 1DWBH 1EAIA 2BDYA 3TGKE 2Q6DA 4NA9H 3UREA 4BAHB 5G4BA 3SNAA 1NBMD 1J8AA 1U6QA 1GCTB 2ESTE 2FX6A 3A87A 3TJNA 4MVNA 2O9QA 1W0ZU 1AUJA 4U30A 3UIRA 2PGBB 3U98H 4E05H 2H9HA 3EAJA 1G32B 1O3BA 1OXGA 2H6MA 1FV9A 4OS6A 5EJZA 1K0HA 4AC9A 1Z1IA 5GWZA 1ETTH 2A5KA 1O39A 3OFND 3H09A 5J4SA 1C2GA 3LGWA 1Z8RA 1O2KA 2WPMS 4A6LA 3LC3A 2ZFQH 2H1UA 5HIYA 5A8ZA 5AF9H 2JIZD 2R0KA 2A7JA 3OE7D 1NY22 1K28D 3T27A 1P2OA 2V3OH 6GCHF 2ZP0H 1E0FD 4ABJA 4Q4LA 3Q00A 1YBWA 1TMBH 1TLDA 4X6OA 3M5OA 1K9OE 2K8IA 3GCHB 4WH8A 3TH4H 1LQEA 2ZFFH 2OC0A 1ESBA 3MFJA 3SNEA 3RXOA 2W3IA 3VXEH 5E0GA 1CHGA 4WXVA 4FUCA 2FOEA 3IITA 2CF8H 2QAAA 4Y10E 3SQEE 1RGQA 1QBNA 1O38A 3P17H 3L6PA 3SI4H 2FYQA 1OWDA 3EBNA 4ACAA 3P92A 2KM0A 2QCYA 3KQ5A 3F9FA 2A45B 5FBEA 4J1YA 4O97A 3E6PH 5FPYA 1C1WH 4NG9H 4NZLA 1EATA 2ZIQH 1HRTH 1BMLA 3E0PB 1O2OA 3I29A 1ELCA 1O0DH 4XBBA 4JYUH 1E37B 2VWNA 2OLGA 1EAUA 1LVYA 1S5SA 1P12E 1C5NH 2JDID 3LONA 3OSYA 4JZ1A 1C1SA 4ZHLU 1HAZB 4MTBA 1PQ7A 1C5YB 5L2ZH 1SBWA 1G2MA 5GJ4B 1G3EA 2QIQA 5L30H 2Y5GA 1MTVA 4MNWA 4O03A 1HXFH 1T8MA 1QL7A 3JZ2B 2GVFA 1OOKB 4GUXA 3LU9B 2GZ8A 4K1EA 2ZDKA 1OYQA 1ZZZA 1E36B 5GIBA 5C67A 2UUFB 2KCYA 2YMSD 1PYTC 3OYPA 3PWBA 3OTJE 4Y6DA 1CGJE 1GDNA 5DP5A 1A46H 4FUIA 2PLXA 4CHAC 2A4GA 4H6SB 2H2ZA 4FVBA 3AASA 1PFXC 4I86A 2OUAA 1VKYA 4RKJB 1ABIH 4ABIA 4MPWA 2G00A 1YPMH 2ALPA 4RSPA 1KXFA 3GS9A 1O2XA 1O3JA 1SOZA 1TWXB 1NM6A 3C1KA 1EZUC 2FWWA 1P09A 3SORA 5KECA 2FOFA 3RXUA 4R8TB 4CH8B 2BQ6B 2GP9B 3M5LA 3A84A 3SYJA 1EB2A 2AMQA 4DGJA 1GHBG 1SSXA 5SGAE 1DXPA 1UVUH 4KELA 4X6MA 3LKWA 2A4RA 3BN9A 1C1VH 4BAQB 3DSOA 3MYWA 3VGCB 3SV8A 1UTJA 3TJVA 3VEQB 2D8WA 1GMDF 3QZQA 4D7FA 1JXPA 3D62A 2AS9A 1THSH 1DWEH 3S7HB 2QA9E 1QIXB 2ZQ2A 1YCPH 2FLRH 3OTPA 4D7GA 1O3FA 4WH6A 2AGGX 3C27B 1O3LA 1GBDA 2P93A 1B5GH 3TK5A 1LQDB 1DY8A 3PV2A 1C5WB 1NT1A 1Z8IB 5A2MH 4ASUD 1HAHH 1TX7A 3HK3B 1WCZA 2VNTA 3T28A 3E90B 2ZHDA 4OGXA 4B2CA 1BTPA 1K1IA 1YPEH 4UD9H 1C1MA 2F91A 5DP3A 3NCLA 2ZPSA 1ZSKA 3VFEA 1G9IE 1P2KA 3K9XB 1C5UA 5DGJA 1N8OC 3MU4A 2Z9KA 1M9UA 2JH6D 1TMTH 2BD8A 4PROA 2AIQA 2O8LA 4ZH8A 1P9SA 1ZTLA 1NZQH 1P2NA 3BTDE 3U1JB 2A2XH 2NWNA 4XOJA 1S6LA 1O2IA 2VWOA 5EJ1A 1TGNA 2AMDA 3TJUA 1MTSA 1MCVA 3SV7A 1MTNC 1TRMA 1GI2A 3F6UH 2C8ZB 4BTUB 3WWFA 4B73A 3PV4A 1MH0A 4FUBA 3EQ0H 1H4WA 1NTPA 3FFGA 1A7SA 2CHAB 2P16A 1EFRD 1XVMA 1GJ8B 1GJ6A 1V2JT 3M37A 2STAE 3ZZAA 5CHBA 5K0HA 1GI3A 2VINA 1MKXK 1IQEA 2FTLE 2ZDLA 1UTPA 2QF3A 3SJIA 2G51A 3Q3XA 3SJ8A 3SUFA 3DCLA 3A7WA 1GI7B 3V0XA 2VIOA 3OEED 4K1TA 2HNTC 5AVDA 4CRCA 4K8YA 3RXBA 1FPHH 3KIDU 2WPHS 1FY1A 3PMHB 1P2QA 1TNJA 4XBCA 2SGPE 3OAAD 3EA9A 1SLXB 2ANYA 2AYWA 4CRGA 1YP9A 2XBYA 3MU8A 4U01A 1KIGH 1NFYA 3MHWU 2BD7A 3BTKE 4AFUA 2GD4B 1DX5M 1EASA 2ZG0H 5T6DA 1GI1A 5ESBA 1AFQB 1V2PT 2CGAA 5A0BA 2GT8A 2KCPA 4Q80A 2PSYA 2GGVB 4ABBA 2PKAA 1FY4A 4GCHG 2XCFA 1W13U 4Y8YA 1AB9B 5JBCS 2XBWA 2RG3A 1HV7A 1F0TA 2P95A 1TOCB 3NZIA 1NRRH 3ZYDA 1VGCB 3ZZ4A 3D23A 2ZTZA 5EQRA 5CMXH 1XUHA 2AFQB 1P57B 1F0SA 1W14U 1YY3A 2ZDMA 4BAOB 3UFAA 3A7YA 5DP7A 2UWPA 4FUHA 1JRSA 1GJ7B 1UTOA 2F9NA 2F9BH 5ESTE 2R3YA 1LPKB 2HRVA 4UEHH 4MLFB 4Y79A 5L6NH 1EKBB 3W95A 1C5TA 2B5TB 1E79D 1L1JA 1V2VT 2VJ1A 4AFQA 1W0JD 2YNAA 5CDFE 1Y8TA 4XFQA 1KYNA 1HAXB 1GCTC 2P8OB 5EG4A 1NROH 1ESTA 3N99A 4UFDH 6CHAB 3RUOA 1BUIA 1MKWH 1A0JA 1COWD 3A8BA 1EB1H 2PSXA 5DN6D 1AD8H 4X1RU 1C1UH 4Y0YE 2C93B 2VGCC 1BOQA 3S9AA 4DT4A 1GGDC 1KTSB 2ZGXH 1GVZA 4MNYA 2BX4A 1O2YA 3BG4B 2ZHQH 1GG6B 1AE8H 3T29A 1O30A 3O8CA 1AHTH 1C2HA 1BTWA 3SN8A 3BEFB 1QB6A 3LH1A 4E06H 4TYDA 3ZVBA 3RXTA 5JDUB 1NBME 2WV4A 3LPRA 1DOJA 5FAHA 3KQDA 1QZ8A 4SGAE 3A89A 2W6JD 2PKAB 1UCYK 1TA6A 1GJ4H 3TITA 3HKIB 3M3SA 1S85A 1BCUH 2VVVA 1KDQA 1QFKH 2DE9A 2XTTB 1UCYE 4H42U 1BTHH 3GDSA 1V2OT 1YYY1 1CT0E 5C0TA 1YF4A 3ZVDA 1C1QA 1QB1A 1QCPA 3RXCA 3V3MA 1J9CH 4NSVA 1V2LT 1ZGVA 2UUYA 1O5AB 4HTCH 2ZKSA 1FNIA 1FY3A 1SGIB 3MO9A 1GBHA 1LVMA 1LPZB 2Y80A 1H1BA 1F0UA 1KMHB 3UY9A 4JCNA 2W7SA 1Z8GA 2C8WB 1Y59T 2TGPZ 2KFWA 4HGCA 4FUFA 4YLUA 1HNEE 1K1PA 4X1QU 1FJSA 5C1YA 3U1IB 1HAPH 1ESAA 1BBRK 1C2FA 3H7TA 2OCVB 3NWUA 2ZGCA 1XKAC 1NC6A 1NN6A 1O2PA 1EPTA 4JZDH 5KGOA 3VB3A 5ABWA 1TQ0B 2P3UB 3AAVA 3Q77A 3VB7A 1C2EA 1TBRH 4GHTA 1YWUA 1BBRE 2TGTA 3QLPH 1ARBA 2THFB 4AOQA 4WMEA 1RTKA 2AH4X 4ZKSU 4I32A 3M7TA 4P00A 1N1LA 1S83A 2ULLA 5A8YA 1F5KU 1UVSH 2TGDA 5K7RA 1C1NA 4ABAA 1BMAA 2BMGB 4F48B 2A5IA 1D9IA 1KXCA 3PM3A 3AVZA 3TPIZ 2UWOA 3ATLA 2ZPQA 2JJ1D 1Z6JH 1XUGA 4DURA 3SW2B 1TGTA 1ZOMA 4NFEA 1L1GA 1SB1H 3A8DA 2WPKS 3B9FH 1LKBA 4YT7H 3BEIB 1QA0A 4I8GA 1O2RA 1DVAH 1GMHG 4I31A 4K3JA 5GCHG 2JH0D 1ID5H 4Y71A 5EXNA 1X7AC 1WAYB 2ZNKH 1HIAA 1NU9A 1A5IA 1Y3YA 4AN7A 4U2WA 5BRRE 1FN6A 1C4V2 4LK4A 3A7XA 4D9RA 3G01A 1QJ7B 1GBTA 2PP6A 3I78A 2FEQH 2J94A 2FOBA 1DLKB 1GBBA 2EC9H 2HLDD 4XDEA 1RIWB 1FAXA 3UR6A 5HKKD 4LZ4B 2HLCA 3KF2A 1A5GH 4JK5A 1AKSB 1GBMA 3UWJH 1QL9A 2BZAA 2OC7A 1HLTH 2ZU3A 1FN8A 3HPTB 2ZHWH 1V2QT 2FLBH 2ZHFH 5EXLA 4TY7A 4XRNA 1GJAB 2PKSB 2FS8A 2V35A 2ILNA 2FOHA 1VCPA 2HVXA 2PWXA 1NFWA 1EPTB 2OQUA 2JETC 1SG8B 1K1JA 3N7OA 3O8DA 4BOHA 2H5CA 1K1OA 5DK1A 5JB8S 5I46H 5C2ZA 2V3HH 2OK5A 1SGYE 1AMHA 1IQIA 4X8SH 1TOMH 3GCNA 3KGPA 3PB1E 1GJCB 4OS7A 5DP6A 1MD8A 4X1PU 1YCPM 1O3PB 3PWCA 5E0HA 1MTUA 3M7QA 2XC0A 3M3TA 2BOHB 2ZA5A 2FOGA 4AG2A 6ESTA 1HAVB 4DT7B 4ZHAA 5FBIA 2FP7B 1CBWB 1KLTA 1ZJKA 4F55A 1MBQA 4AGKA 3K65B 3QK1A 2BTCE 1ZMNA 2BQ7B 2ZFTA 1G3CA 1ANEA 6LPRA 1O3MA 1GI0A 1O5GH 2G81E 4NCYA 4M9FA 1FDPA 1HIAB 3E16B 1AN1E 4UFFH 3K6YA 1GVKB 2BLVA 2V3MA 2J92A 2ZO3H 3KL6A 1WDIA 1GCDA 2KCAA 5EQSA 3SU4A 1KLJH 2CHAC 2KX4A 1UVOA 2TRMA 1ZMLA 2IOTA 2F83A 2OC8A 1ZRBA 3HGPA 3F0PA 4JZEH 3MNXA 5F53A 2ZDAH 3HGNA 3K6ZA 1GI4A 2XNIA 3CENA 3S9CA 2WYJA 1W10U 1GPZA 1GVLA 1VITG 2L6OA 1P03A 4YXWD 1XUKA 1PPBH 1DSTA 5EODA 3DFLA 3EYDA 2W3KA 4TPYA 1HB0B 3RDZA 3WY8A 1TNKA 1H8IH 4NWKA 2FXRA 1FUJA 2GT7A 4CRFA 1HJAC 2FO9A 4DY7B 1C1RA 1MU8B 1YLNA 1ZGIA 1G3DA 1HFDA 1ZHPA 2P3TB 3F3BA 4UE7H 3KCGH 1QTFA 4RKOB 4MDSA 1ZMJA 1MMJN 1UO6A 1GDUA 1UK2A 1FMGA 1WOFA 5L2YH 4Q63A 3UB0A 4YLQH 3LJJA 1BITA 3F2GA 1AFQC 2EY4C 1F7ZA 2Z3EA 2WYGA 4NSYA 2GV7A 1NFUA 3LJOA 2OQ5A 4VGCB 1T8OA 3U8OH 3SV9A 1AB9C 4FU8A 1VGCC 2ZCLP 3MMGA 1AIXH 3RXQA 4YESB 2BY5X 5E2OA 2Y5FA 4Y0ZE 2GCTB 2PTNA 3SI3H 1VJAU 1IAUA 1GHBF 1DSUA 1O35A 1KXEA 3STIA 4D76A 3SV2H 1SGTA 4NGAH 3RM0H 3UOUA 1LKAA 1GHAG 3KYFA 1QRXA 2HVYB 2Z9GA 1J16A 5I25A 1W2KH 4ASHA 1NS3A 4TY6A 3SUEA 4BANB 1DFPA 2VIDA 4X6PA 4A92A 3UQOA 2SNWA 3UR9A 2P8OC 4XD7D 3QO6A 4BNRA 3BTWE 3FAOA 4YT6H 4NZQA 4NA7A 2PR3A 4K1SA 1HJ8A 1O2JA 1ELEE 1YCPK 3V12A 3PYHA 3RXJA 4GSOA 1DLEA 4BAMB 1O2LA 1O3OA 3F9HA 2Z9IA 1KXDA 3TH3H 3DUXH 4BTTB 1DXWA 2IN2A 4SGBE 1TNIA 3SZEA 1N6YA 2WHXA 1YLDA 1FI8A 4ISHH 1C4Y2 2GDEH 3U28C 2BY7X 2FOMB 1V2RT 4B6FA 3GDVA 3F2HA 2CK3D 2TIOA 4X2VA 1DUAA 1WU1A 3A7ZA 1EUFA 2RDLA 1Z1JA 3BG4C 3QX5H 1GG6C 4AB8A 3MH7A 4WVPE 3A7TA 1SLWB 3PO1C 4ABEA 4Q2KA 4HFPB 4YZUA 3SJ9A 3UNQA 1F5LA 1ORFA 1YPJH 2WUBA 1JIMA 1ZTJA 3UNSA
chains in the Genus database with same CATH topology
1O34A 2AEIH 2AERH 4A1TA 3NUMA 2STBE 3URCA 1O36A 2Z94A 1TQ7B 1P10A 1C5QA 1PPCE 8GCHF 1QBOA 1LO6A 1P02A 1CVWH 3CP7A 3MOCA 4ZKOU 4FXGH 1G30B 4K60A 5HM9A 1MCTA 1YKTA 3U8RH 4Y8ZA 2D2DA 4X1NU 2Y81A 3SGQE 1ZSLA 1P3CA 2ODPA 3T5FH 9LPRA 1OP2A 3NK8A 1C5LH 5HYOA 1QGFA 3EDXB 4A5TS 4BTIB 2ZF0H 1C5OH 2XC5A 1WUNH 2GMTB 1NRSH 2ZU2A 1OYTH 1GWAA 1W7XH 1H9IE 2HPQH 1V2UT 2ZFRH 4ISOA 3SQHE 1O3KA 5HMAA 2OINA 1XKBC 3AW0A 2B8OH 5E8EH 1GHVH 2BM2A 5TCAA 1TABE 1C4U2 5T3HA 3Q76A 4K5ZA 5F8TA 1SLUB 2B9LA 1AZ8A 1C1TA 1EJAA 3A8AA 3RMMH 3I77A 1C5VA 3ZZ6A 3E8LA 1C5ZB 2FS9A 4YOIA 1CU1A 1GMCG 3RXEA 1G36A 2ALVA 2GTBA 1SGCA 1WTGH 1PQ5A 4IBLH 2C4FH 3S0NA 1C5SA 3U69H 2OTVA 8GCHG 3S9BA 3KEEA 2SGQE 4X2WA 3UOPA 1IQJA 3LGYA 2QXIA 2TPIZ 1IQMA 4GCHF 1CO7E 1BMMH 1D4PB 4FVDA 3RXFA 3OX7U 1J14A 4OS1A 1CA8B 4OS2A 4CRDA 3U9AH 1O3EA 1TX6A 4DCDA 1A2CH 4KTCA 4Z6AH 1Y3VA 3SO3A 3Q3YA 1ETSH 1BRUP 1B0EA 1L1NA 2BX3A 2BLWA 7KMEH 1V2KT 2XYAA 2XXLA 1TAWA 3RC6A 4GLYA 4X8UH 1UTMA 4HZHA 1T7CA 1IOEA 1O2SA 3L33A 4AGJA 1O5FH 2C8XB 1O5BB 1A61H 1TNGA 1Z7KA 4UONA 2V6NA 2HWLB 4YOGA 2AIPA 2O8WA 2BDHA 1D6WA 1QURH 5T6GA 1QA7A 4A7IB 4JZIA 5IDKA 5C5NA 3U8TH 4WF8A 1PJPA 9ESTA 4IMQA 2BD2A 3F68H 1MKWK 3MH4A 3LC5A 1PPGE 3RMNH 3ZZ8A 1XXFA 1SGQE 1O2NA 3P8NA 4O3UA 3GYMA 1EPTC 1TRYA 3VB4A 1KXBA 2ZECA 1QB9A 3A85A 1ZPCA 3M7UA 2BZ6H 3B8JA 4MNVA 2BD4A 1O2HA 3RMLH 3T26A 2VH0A 2NU0E 1LCYA 1CA0C 1HXEH 1GI5A 1ANCA 2ASUB 1GBEA 2BDAA 3RLWH 2Q6FA 1YLCA 4XE4A 1IQGA 2BHGA 4I8HA 1HAGE 1QR3E 1C1PA 1VJ9U 1ELAA 1P06A 3GY7A 3URDA 3ZZ5A 1SHYA 1HAOH 1AO5A 4XSKU 5HXFA 4Z0KA 1CBWC 3P8FA 1P2IA 1D3TB 1XUIA 3IG6B 3ATWA 1OKXA 2Y82A 3SJKA 1EOLA 3SU5A 4B2BA 1YGCH 3VXFH 2PGQB 5TJXA 3STJA 1DE7H 1HGTH 2RCEA 2M5TA 4NIWA 2BXUH 1O3IA 3A81A 1BHXF 4ZROA 3F9GA 2BY6X 3RU4T 3SU6A 4ISNA 1PQ8A 1PPFE 3T62A 4IS5A 5F8ZA 3RXRA 1EQ9A 2AGEX 2EI7A 1P2JA 1YPHE 3TH2H 4E7NA 4YO9A 1UTQA 3Q3KA 1HUTH 3OY5U 1B7XB 4INHA 1GI9B 1OX1A 2G5VA 2GCHF 2ZWLH 3ZVGA 2IPHA 1IQLA 2Z7FE 1O3HA 1GHWH 2XWBI 5DJ7A 3SNBA 5BPEA 1ELGA 4DIHH 3QDZB 4IC5A 4D8NA 2JKHA 2FPZA 2ZZUH 3EA8A 2GX4A 3M61U 5JBAS 3GCHC 1JBUH 1EP6A 1NU7B 3SBKA 3LGTA 2FODA 2FX4A 1WBGB 3RLYH 1XXDA 3BTFE 1FY5A 3GISB 3LGUA 1SHHB 5DP8A 1YPGH 2ZFPH 2ANWA 5E0JA 4MG3A 1SMFE 1EJNA 4VGCC 2HOBA 2Y6TA 1OS8A 3GDUA 1QRWA 2VIVA 3A8CA 2B7DH 1AY6H 1FXYA 1IQHA 5JBBS 4TWWA 4I7YH 1BA8B 5F8XA 3BTGE 1QJ6B 1EOJA 1TE0A 1UTNA 2F9UA 3RM2H 1UK3A 3ATIA 5FHTA 1GMHF 5GCHF 1Y3XA 1SGRE 4ABFA 3E91A 1EXFA 3P6ZB 2ZDVH 3SU2A 3IWMA 3LOXA 5DG6A 5LPFA 1AKSA 2C90B 2FI4E 5GDSH 1QRZA 2OXSA 2FESH 2WPJS 3MNCA 5A09A 2ZQ1A 3TNTA 4XBDA 4OS4A 1GI8B 3CS0A 3RU4D 1SI5H 1RFNA 1P01A 3TGIE 2GCHG 2BXTH 2QY0B 2Z3DA 4GAWA 2ZTXA 4UFEH 1ZYOA 1FAKH 1RJXB 3A86A 3FZZA 1A3EH 4AX9H 1O5DH 3P95A 4ABDA 2UWLA 4ABHA 1ZTKA 3KHVA 1P3EA 1SGEE 3RXGA 5EW2H 2Q1JA 2BOKA 5JPMH 1VCQA 2Z9LA 1FLEE 4FUDA 4KGAA 3SOSA 5LPRA 1J17T 1H9HE 1B0FA 1XM1A 1TA2A 4ZKNU 1IQFA 4DJZB 4IN2A 1K1MA 3V13A 1VITH 4HI3A 2RA3A 1RXPA 1GI6A 2ZU5A 4JZFH 5HM2A 3ZZBA 3MO3A 4NA8A 1JOUB 1HYLA 1HAVA 1N8OB 1D6RA 2AMPA 1WTHD 1O2MA 4IN1A 2A4QA 2QC2A 3RXMA 3GY4A 1DT2A 1P11E 3MWIU 4X8VH 2NU4E 1BJUA 3PTBA 4BAKB 4KKDA 5GXPA 3BF6H 3ZV9A 3V7TA 3F1SB 3R0FA 2FMJA 4B75A 1C5RA 1Y5UT 1L2EA 5IYTA 2F9OA 3ODDA 2PV9B 3GCTF 4INKA 2G55A 1K21H 3AW1A 1BRCE 1EZSC 1SOTA 2SGFE 4Q7ZA 3VGCC 4ZHMU 3QGNB 1IHTH 1SGFG 1FPCH 5FX5A 2FTMA 3UPEA 2PFEA 4DVAU 4ABGA 3P8GA 1MZDA 1G37A 1S81A 3OU0A 1NRQH 3ATMA 2GMTC 5DO4H 1Z6EA 1HCGA 1Y5BT 3VB5A 2V0BA 2FI5E 3GOVB 1CHOF 4MPVA 2A31A 2BVXH 5AFZH 3D49H 1HAYB 3GCOA 5FX6A 1GBFA 3ITIA 1P2MA 2O8TA 1VITF 3TK9A 1XUFA 3QTVH 1O3GA 1XX9A 2HALA 1T4VH 2QN5T 1OWEA 1W11U 1ABJH 1OWKA 4YM9A 4CBOA 2FZZA 1DUEA 4H6TA 5JBTA 1MQ6A 2BD5A 1GBCA 2XWAA 4I8LA 4ESTE 3P70B 5CHAB 2XBXA 1TB6H 3S7KB 2OBOA 1FQ3A 4OS5A 1K22H 1W3CA 3MU0A 3OY6U 3GY6A 3SJOA 4RN6A 4X8TH 1HAIH 5EU8A 4AFZA 1W12U 4LXBH 3NKKA 3E1XB 3LGVA 1V6DA 5DP4A 1A5HA 2WPIS 1T31A 1V2ST 2ZDNA 2ZGHA 2F3CE 2Z6BD 3ODFA 3BG8A 3GCTG 3ZZ9A 3UQVA 2ZFSA 4IGDA 1AU8A 2EA3A 1PPEE 4THNH 1MU6B 3RXHA 2GZ7A 1PYTD 2R2WU 3TJOA 2W5EA 2VIPA 1O2QA 8KME2 2A2QH 1GBIA 4IMZA 3ZVAA 1UMAH 3RXPA 4ZXXH 1HBTH 2ZU1A 4OGYA 1EP5A 1F0RA 1GHAF 3P8OA 3A7VA 1CHOG 3M5MA 3A80A 5CE1A 4M7GA 1Y5AT 3SU0A 3SUDA 1OWHA 3KQCA 1O2UA 2Z3CA 1T32A 4MPUA 4B71A 4NIVA 5A8XA 2BDGA 1XUJA 4YOJA 1BQYA 1ZR0A 3B23B 1DITH 3A82A 4ISLA 2A7HA 3AAUA 3TK6A 3BTTE 3PMJA 2CMYA 4D9QA 3JZ1B 1CT4E 1V3XA 1LHCH 1C9PA 5E2PA 5B6OA 2A4OA 3BSQA 1XVOA 1MBMA 2CF9H 5EXMA 2VGCB 4X0WU 1GGDB 1S82A 1AWHB 2QF0A 2WV5A 3SU3A 3GY3A 1DM4B 1MD7A 3RXAA 4IW4E 1ELBA 1DICA 2BVRH 1HDTH 1Q2WA 3LDXH 1TPAE 2J4IA 3BTHE 1QQ4A 3RXSA 1BRAA 1CGHA 3ZZ7A 2J9NA 1DWDH 1H9LB 4WXIA 1ZJDA 3FP8E 3MI4A 1WQSA 4CRBA 1HPGA 1W8BH 2BY9X 1NESE 5F6MA 2BDCA 2I6QA 1MZAA 3RC5A 4JMYA 1A0LA 1ANBA 4GHQA 1C5MD 2HNTF 1FIWA 1P05A 5EPYA 4B1TA 2P3FH 1SQOA 3M36A 1MUEB 1LVBA 2EI8A 1O32A 3W94A 2OD3B 1TIOA 3LT3A 4Y7AA 4TWYA 1BRBE 4FU9A 1GL1A 1MTWA 1O37A 2ZHEH 2BLOA 2BVSH 1NRPH 1YPHC 1QJ1B 4R0IA 6CHAC 3GY8A 1WV7H 1SGNE 1ZSJA 2G5NA 2NU2E 4ZKRU 3ZZCA 3SNDA 2YNBA 3SZNA 3SGAE 1TBZH 1Z8JB 1C2JA 1KLIH 1O2VA 3GY5A 4KTSA 1IQNA 3ZV8A 1PPHE 5FPTA 3TIUA 4J2YB 3M3VA 2R9PA 4WMDA 1TNLA 1CSOE 3K2UA 1S6HA 1HJ9A 3QUMP 1F5RA 1T8LA 1TONA 3SV6A 1TGSZ 1TBQH 3SGBE 3QN7A 1CE5A 4X6NA 3FP6E 3ZZDA 6GCHG 2BDBA 7GCHF 1H8DH 1DWCH 1O3AA 3PLBA 1WYKA 1AVWA 3MU1A 5FCRA 2CXVA 1GMCF 1S0QA 1GBLA 1PPZA 4FUJA 2WINI 1ELTA 2BY8X 2BDIA 3LIWA 4I33A 4WMFA 1EZXC 4ISIH 2TBSA 2RA0A 3T2NA 5DKMA 2FDAA 3KN2A 1SQTA 2VB0A 1J15A 4GVUA 1TGCA 2QYIA 3QZRA 2VU8E 1GJBB 2VH6A 4O9VA 1CQQA 5AFYH 2FOCA 5EQQA 3RXLA 3BEUA 1Y3UA 3EE0B 4DOQA 1F2SE 3GY2A 1S0RA 1SVPA 2BQWB 3BIVH 3SHAH 1QNJA 3ZVCA 1C2LA 2ZPRA 3D65E 2QXGA 3MNSA 1C5XB 1GBAA 1D3QB 3RXVA 3TLOA 1AWFH 1AQ7A 2VWMA 2PTCE 4K8BA 2VIWA 1ANDA 3EGKH 2D26C 1THRH 3ZVFA 1Z71A 1EAWA 3QTOH 4X2YA 7LPRA 1GBJA 4AYVB 1BZXE 4ZUHA 3DFJA 3LH3A 3MH6A 1ZRKA 3TGJE 4AB9A 5EPNA 4A1XA 1A1RA 1W7GH 2GZ9A 1BTZA 4MNXA 3NXPA 3VPKA 4BXWA 1A0HB 7GCHG 2FOAA 1UVPA 1BHXB 1YC0A 2QGRA 4CRAA 1SGFA 2JETB 4FUEA 4Y76A 1O2TA 4CR9A 1TGBA 1E34B 1T8NA 2ZC9H 3BIUH 1P0SH 2HGTH 5A0CA 1SFIA 3KQEA 2TGAA 2OP9A 2OBQA 1AGJA 5ETXA 2VVUA 1AVGH 3RC4A 4ZMAH 2VWLA 1MAYA 2Y5HA 5GPIB 2SFAA 3NPSA 2C8YB 2G4UA 4B76A 1P04A 3DHKH 1JIRA 3RU4E 2PHBA 2YOLA 4CR5A 2CN0H 1C5PA 2B0FA 2C3SA 3KQBA 1LVOA 3DT0H 1SL3A 3PMAB 1GDQA 2ODQA 1QBVH 2BYAX 4FUGA 3R3GB 1C2DA 2Z9JA 1AVXA 1NRNH 1GMDG 3MNBA 2EEKA 1E38B 3HKJB 3PLPA 1RIWC 1SR5C 2J2UA 1O3DA 1NO9H 1V2NT 2PW8H 5EOKA 1Y3WA 1C1OA 1C9TA 2BD9A 3SHCH 2HPPH 3A83A 3DA9B 1C2MA 2WUCA 3O8RA 4K2YA 4NWLA 1O3NA 1ZHMA 1GHZA 1L4DA 1SFQB 1K1LA 1TRNA 1ZLRA 2G8TA 2PKSC 1VZQH 1O31A 2XBVA 3PTNA 2PUXB 4E7RG 1V2MT 2F9VA 2AGIX 4CBNA 4U32A 4AFSA 1L0ZA 2GDDA 4UFGH 1HJAB 1LDTT 1BIOA 1SPJA 5C20A 1GHXH 2A5AA 1O2WA 2H9TH 2XW9A 4AORA 5LH8A 1QY6A 5J4QA 5CHAC 4ZXYH 2CJIA 2G4TA 4FU7A 1KY9A 1DS2E 2ANMH 1GL0E 1MAXA 4CH2B 3TVJB 4JK6A 1OPHB 1OSSA 1LMWB 1QL8A 2OC1A 2A0QB 4AZ2B 3MU5A 4NIYA 3FANA 2NU1E 4JYVH 4AG1A 3L3TA 4Y7BA 1T4UH 3ENSB 2ZGJA 2BD3A 3UUZA 1YPLH 1ELDE 3FZDA 8LPRA 4Y8XA 5JB9S 3A88A 2GV6A 1ZHRA 1FZZA 4I8JA 4K69A 1V2WT 2H5DA 2J95A 4QT8C 1SGDE 2I6SA 5JYIA 1MKXH 3HK6B 5C1UA 2XC4A 5FXLA 2QXHA 2QXJA 3HATH 2R2MB 2XRCA 1TNHA 2QV1A 2SGDE 3T25A 4CREA 1FY8E 1FIZA 5A0AE 1JRTA 1K2I1 4JYTA 5EGMA 1EZQA 2DUCA 1RTLA 4X2XA 3ZVEA 1C2IA 1G2LA 1Q3XA 3SU1A 2JH5D 3ATKA 1AE5A 1LHGH 1INCA 1D3DB 1NPMA 2ANKH 3BTEE 2J38A 1G3BA 3UNRA 1JWTA 2LIZA 4CHAB 1KSNA 2BB4A 1VR1H 1ACBE 1F92A 1RTFB 2ZCKP 1GJDB 3PMBB 1UJ1A 1N6XA 1TPPA 2CV3A 2ODYB 3MO6A 5FPSA 3DD2H 5AHGH 1OWJA 1DPOA 3CS7A 2F9PA 1O3CA 1AI8H 1GJ9B 1Q31A 1AFEH 2VIQA 3PO1B 3RMOH 1BDAA 4H4FA 2LNCA 4B2AA 4DW2U 1O5EH 1IHSH 2Y7ZA 1S84A 1TPOA 1A3BH 5T6FA 1YM0A 2LPRA 1XMNB 1ELVA 1UTLM 4NFFA 1MQ5A 5DP9A 1EJMA 2GCTC 1LHDH 3M35A 5HGGA 1LHEH 2DE8A 3MTYA 1EX3A 3BTME 1VCWA 3GICB 1PQAA 1ETRH 3ELAH 1SLVB 4LOYH 4MPXA 1RRKA 2A7CA 7ESTE 5F03A 1UK4A 1BTXA 4LZ1H 3FVFB