2H30A

Crystal structure of the n-terminal domain of pilb from neisseria gonorrhoeae
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
151
structure length
151
Chain Sequence
b'ATVPHTMSTMKTADNRPASVYLKKDKPTLIKFWASWCPLCLSELGQAEKWAQDAKFSSANLITVASPGFLHEKKDGEFQKWYAGLNYPKLPVVTDNGGTIAQNLNISVYPSWALIGKDGDVQRIVKGSINEAQALALIRNPNADLGSLKHS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Peptide methionine sulfoxide reductase msrA/msrB
publication title The Thioredoxin Domain of Neisseria gonorrhoeae PilB Can Use Electrons from DsbD to Reduce Downstream Methionine Sulfoxide Reductases.
pubmed doi rcsb
source organism Neisseria gonorrhoeae
molecule tags Oxidoreductase
total genus 41
structure length 151
sequence length 151
ec nomenclature ec 1.8.4.11: Peptide-methionine (S)-S-oxide reductase.
pdb deposition date 2006-05-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08534 Redoxin Redoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 2h30A00
1PRXA 2ON7A 2WULA 3LGCA 2IWTA 5CO3A 5HFKA 2VL3A 1RW1A 3ZMKA 5JCWA 2H74A 3ZVJA 5JWOB 4G9HA 4HJMA 6GSYA 5DJMA 1OE8A 4BWQA 4FO5A 5DCGA 5CNWA 2I3YA 4K7NA 5G5FA 5EPFA 3C71A 1B9YC 4GRFA 2JADA 2DSAA 4HDEA 19GSA 11GSA 3ZIVA 2VCVA 5HQPA 5IIZA 5GAND 3EYTA 1FB0A 1YEXA 2HLSA 4YH2A 5DDLA 4J56E 1XOBA 4WXTA 4IP1A 2IPAA 1SYXA 5IOXA 4O92A 5E4WA 17GSA 1AQWA 1T8EB 18GSA 3W8SA 1GRXA 3I9V2 4DEJA 1A2LA 2NTOA 3G9BA 4GSTA 4MK3A 4FYBA 2CZ2A 1FAAA 3RPPA 1NHOA 1XWGA 1Q98A 5KN0A 4IP6A 3F3QA 5ECKB 1HNBA 2IN3A 2FY6A 5ECQB 2XPEA 2C80A 4QL7A 4ECCA 2HRFA 4H86A 4L0WA 4RI7A 3RHCA 2K18A 3P90A 1GSUA 5KN1A 1F3BA 3TUEA 5A4UA 3UVTA 4HU9A 4TW5A 5H5SA 1FW1A 3TOUA 4GQCA 1DUGA 2DJ1A 3BD2A 3VI7A 1CQHA 2AYTA 4X0XA 2XBQA 2OA7A 2VD0A 2HFDA 3VWWA 3ZIJA 2K6VA 2MMAA 1X9SB 1G7EA 2F9SA 5ECHB 2VLTA 2L6DA 3HJPA 1GNWA 2C0FA 2GTUA 4MF7A 4ZBAA 2FWEA 1DBYA 2V6OA 1TI3A 4PUFC 3O76A 4DSSB 1TU7A 1GL8A 5DAKA 4TR3A 1PKWA 7GSSA 3GRXA 4TR0A 3EINA 1BQ7A 3HJOA 5EL8A 3EU4A 2WCIA 3IAM2 1GTBA 4IBPA 2WRTA 2GQKA 2C0GA 2EIQA 1JZOA 4QQ7A 3HY2A 2O7KA 1TJDA 2B7JA 4V2LA 3LQ7A 2LQOA 1ACVA 3D4MA 6GSTA 3IR4A 1PN9A 3ME8A 1XCCA 1Z7PA 4L5OA 1F2EA 1FHEA 2ALBA 2H8LA 1B9XC 1Z3EA 1GUKA 4IW9A 4N11A 2VO4A 2XPDA 5FWGA 1O85A 2OBKA 2VM1A 3DWVA 1SYRA 2IMDA 1Z6MA 2YWIA 4EF0A 1USBA 2O87A 3CSHA 2KLXA 3WGXA 4NHZA 1IYHA 2FA4A 1AQXA 4GQFA 4MZWA 3IHQA 4WF4A 2H6ZA 5DQSA 1PX7A 5D73A 2L59A 1DE1A 4K1FA 1K0BA 4PX1A 5JWQB 2TRXA 2FD3A 1AW9A 5CRDA 1TXXA 1S3DA 1EOGA 3ZFLA 2B6MA 2C3QA 1TK8B 1QGVA 2LUSA 2D2ZA 1GSYA 1VF1A 2KHPA 5ID2B 1G6WA 1B4QA 1UN2A 3ZREA 2V6KA 4V1Ag 3TCOA 5JCGA 2HZEB 3MWHA 3M0FA 3KM6A 2CQ9A 4ULXA 3FEUA 1PQNA 5ECIB 2YZUA 1EP7A 4RUVA 1M9AA 3TJBA 1GH2A 2E2MA 4XS1A 4TVEA 2HT9A 2DBCA 3A2VA 1AQVA 3VPTA 3BOAA 2LRNA 1URMA 1G7OA 1HD2A 2P5RA 2JZTA 4YAPA 4MZBA 4PXOA 2DLXA 4ZXGA 2J9HA 2HXKA 4MDCA 1KEBA 1TK5B 3CXGA 3VURA 2X8GA 1B48A 4K8MA 1V57A 4I2TA 3N5OA 3FR6A 2IJYA 1WOUA 3U6VA 3IRAA 2YJ7A 5IPGA 3IDVA 2FA8A 2AB6A 4YQVA 4X1UA 1A24A 2N5BA 4ZBBA 4EDZA 2JSYA 2LRTA 1FG4A 5J4UA 1OAZA 1K3LA 4G19A 3UJ1A 1AAZA 1GULA 1TDIA 2IIYA 4D73B 4NAXA 1VGLA 5IMAA 2HSHA 3HVSA 4ACSA 5B6MA 1LBKA 4K7IA 1GP1A 4JU5A 3EWLA 2GDRA 5G1KA 1FO5A 1JZDA 4J57E 2R37A 3IBHA 3F0IA 5DQYA 2B5XA 3F8UA 4KB3A 3HZ4A 2P5QA 2C4JA 2B5EA 4EXJA 2H1AA 4DSSA 4HQZA 1MDJA 3G7JA 3DVWA 2ZUPA 3GL5A 1U3IA 4ECBA 4O32A 3FW2A 3LYKA 1FVKA 1F3AA 3FZ9A 4TN8A 2C8UA 2V1MA 2YN1A 1VF2A 3KMOA 2DMMA 4MJBA 2RM6A 1SL2B 4J2FA 5D8IA 1MDIA 2ZNMA 1O6JA 5CREA 3F3RA 3D4TA 3GX0A 3A5WA 1CQGA 2WGRA 1VF3A 3M3MA 5FT3A 3G7IA 2VD1A 2CT6A 2QSIA 1ERVA 4ECIA 3H4KA 2GZZA 3QFBC 4MPGA 2CVDA 4MJAA 4OFNA 1XZOA 1UA5A 2XBIA 4FYUA 1PX6A 4HS1A 1HYUA 3I69A 5H5RA 1BJXA 3GN3A 3F4SA 5LD0A 3MSZA 1PGTA 2PVQA 2FHEA 3LWAA 4ILFA 5B8AA 2H70A 2PWJA 4Q5NA 2LNSA 3A2WA 1PKZA 3DXBA 3PR8A 1U88A 4EDYA 1E6BA 9GSSA 2H0IA 1SENA 5CYYA 1SKWB 3TKPA 4IHUA 4K7OA 3E0UA 2B1LA 5ID2A 1SD8A 2CV4A 3ISOA 4KX4A 4FYCA 4JE1A 4OO4A 5IMDA 4EUYA 5ECMB 2HZEA 4KSMA 2LJAA 3RPNA 3UEMA 1OC3A 1U3AA 2VIMA 3GUSA 2H66A 1J0FA 4ML6A 4GLTA 2L57A 1V98A 2H1DA 1TRVA 3ZZXA 4AGSA 1I5GA 4ECJA 4TRXA 2MBTA 3VK9A 3HA9A 3HCZA 5D96A 2V32A 5IO0A 3WYWA 1K3YA 1MEKA 2H1BA 2MMZA 1NHYA 2JZRA 2H6YA 3NOFA 3EU3A 1V58A 4I6XA 5G30A 1WMJA 2PN8A 4OWYA 3UAPA 3J7Yb 1XPVA 3TJJA 4NPBA 2JU5A 1GSFA 2PU9C 1M0UA 2WJUA 1N8JA 2YV7A 3KD0A 3V1WA 5F8BA 2EC4A 3H93A 2H75A 1M2BA 1YKCA 5B8BA 3US3A 4BWSA 1RK4A 5J9CA 1GLQA 2M72A 2H1GA 1ST9A 4E8EA 2VL9A 5ECSA 1Z6NA 1GSDA 3KGKA 3IC4A 5EY6A 3FRCA 2H76A 1F6MC 1W4VA 1M2AA 2JSZA 8GSSA 2AAWA 1XBSA 1AIUA 1YKAA 4LMWA 4N0VA 4D73A 4KCAA 1XIYA 1JLVA 1THOA 1XVQA 4POMA 1GTUA 4AJ8A 4TXOA 3APQA 4K2DA 2LRCA 3IOSA 3L0HA 4JR6A 4K0NA 4NMUA 1B4PA 4Z7XA 3VI5A 1EEMA 3C7MA 2YJHA 2CZ3A 4MPFA 1F37A 5D93A 2DIZA 4WR4A 1GSEA 3GHAA 3JCML 1SK2A 2FWGA 1XFLA 1WE0A 2VCQA 2OJLA 1QUWA 5D9TA 4IQ1A 3IK9A 1JHBA 1AC1A 4TKYA 4HOJA 3LYPA 5G31A 1YZXA 3UVHA 4F0BA 3EMPA 1MD4A 2HYXA 1A0FA 4TOPA 2YV9A 2LTKA 1QXHA 5CRGA 1TRSA 2B3SA 5D9WA 4BVXA 4CDOA 4IVFA 2M46A 3IAS2 5IMFA 4HEA2 3CRTA 1JZWA 1R5PA 1FVJA 5COHA 4HZ4A 6GSXA 2BJXA 3WGDA 1HQOA 3ERWA 3KP9A 1XXUA 2X64A 5IMCA 2DJ2A 1X5CA 3RAZA 3GNJA 4WR5A 3DIEA 3SBCA 1G0TA 4JRRA 3UMAA 1EGOA 5HR2A 3R2QA 4KDYA 2Z9SA 1V2AA 4TR4A 1PA3A 3FHKA 2PMTA 1DSBA 1ZOFA 3GFKA 4XTSA 4PNGA 3VWXA 2H71A 1X5DA 2CVBA 1K0CA 1O8XA 2IL3A 3GH6A 3UIWA 5J41A 4XRAA 6GSVA 4KH7A 3ZTLA 1XWKA 4RI6A 2NVLA 4PQ1A 1N2AA 3WGEA 1O73A 3D22A 2GSQA 1T4YA 4NHWA 3EE2A 5E59A 5IO2A 2VCXA 2VCTA 4WBRD 22GSA 3F9UA 3FR9A 3W6GA 2R3XA 3FKFA 3MAKA 1EOHA 5INYA 3TRXA 1YF1A 3HHVA 4NWYA 4ZILA 4DSQA 4HU7A 4KDUA 4KGIA 2LKUA 5HFIA 3P7XA 2H6XA 1MDKA 4ML1A 3QR6A 1X0RA 5GAPD 2VL2C 5HFGA 6GSSA 4JR4A 2CA8A 3D0ZA 1FB6A 3ZRDA 3CYNA 1K3OA 1XW5A 3CTFA 4GSSA 1JLWA 6GSWA 2JL4A 2B1KA 4MA9A 1LU4A 5KN2A 2AV4A 5HR1A 4OFTA 1GNEA 5CRHA 1ILOA 2IMKA 4N30A 1XVWA 4XS4B 5D9VA 1A2JA 3TGZA 3ZL5A 2MYGA 2CVKA 1J08A 3HZ8A 2PBJA 1ON4A 3E3EA 3ED3A 1H4OA 5AGYA 16GSA 1EGRA 2E0QA 2GT5A 4IGJA 5GSSA 2LV3A 4XIHA 1V9WA 1K0OA 4F2IA 3L4NA 3O6TA 2FGXA 1GTIA 2X8CA 1A8LA 2G2QA 1KTEA 1GTAA 2FCHA 2LS5A 4WETA 3ZITA 1WWJA 1TRUA 1JZRA 3DKSA 4G2EA 5KN3A 2C0EA 2JZSA 2PERA 3MNGA 4GXZA 2QKEA 2QC7A 1M2DA 5ELAA 3K8NA 4MJCA 1Z5YE 2C0DA 5DBQA 1YDKA 1W89A 4OCFA 3OR5A 3GV1A 3S9FA 2LEGA 4P3YB 3TKSE 2PUKC 1GSSA 20GSA 3U5RE 5H5QA 2EIRA 1T00A 4DVCA 1ERTA 3ME7A 2F3MA 1HNCA 1YY7A 2LQQA 2TRCP 1R26A 2YWOA 3WD6A 2MMOA 2YOIA 1GSQA 1UVZA 5A5KA 1O7UA 1Z7RA 3GKNA 2GZYA 4IQAA 2LSTA 2RIIA 1BG5A 3LXZA 4ZB6A 4TXOB 2VL2A 3TB2A 5AISA 1WRYA 2RLIA 4NV5A 2KP1A 1QQ2A 4K9ZA 1I9DA 3M8NA 2X99A 3UBLA 3TRPA 2YWNA 1J9BA 1JFUA 3L78A 2VLVA 4L5LA 5G5EA 3HVXA 6GSUA 2PPTA 3ERFA 3LXTA 5HR3A 5HR0A 1FOVA 1KNGA 2GT6A 2IFQB 2LNTA 5F0GA 1SL0B 3ERGA 3G7YA 2R6KA 1RQMA 5JCUA 3GKMA 2OACA 2PVOC 1K0MA 4LL4B 2C3TA 4OFMA 3E9JB 2LJRA 3QPMA 5DCHA 3I43A 4TXVA 1XWBA 3LJRA 1DE2A 3FYGA 2XC2A 2N5FA 1BEDA 1GUMA 1E2YA 2FUG2 2AJQB 2YANA 1SJZA 1SKRB 3L9UA 1SK1A 4F0CA 1XWCA 4PQIA 5ENUA 2GQMA 4KW6A 1OC8A 3VFIA 4F82A 4ZL9A 2OADA 4TR1B 1SL1B 2R5GA 2FLSA 3HDCA 3VWVA 3AY8A 5G2ZA 3FK8A 3N9JA 3WT2A 2ES7A 3GIXA 5D9XA 2KP2A 4ISDA 4I2UA 3ZLPA 2K8VA 2VCZA 4MH3A 5KEJA 3LORA 5AIXA 1QK8A 4EVMA 2C1YA 4KDXA 13GSA 1T1VA 4X43A 3GTUB 4GCIA 4BVYA 1SK0A 3EVIA 4XS4A 4DSRA 3L9VA 1GWCA 2O8VB 1ZYEA 3GH9A 2GZPA 1WPIA 3EURA 4ZL7A 2H30A 2MBSA 1SKSB 2DC5A 3KZQA 3TKQA 2YP6A 2OBIA 1OVNA 2KUCA 5IM9A 4LL1B 2WS2A 3TJGA 1EWXA 2WDUA 3GKXA 4MCUA 4O7HA 3QAGA 1WIKA 3RBTA 1ZYQB 4L8EA 3CTGA 1ZCPA 1HNAA 4POKA 3HVVA 3TJFA 1R5AA 4HUAA 3Q18A 2CAIA 3O3TA 2HRNA 1T3BA 4EL1A 2DJ3A 1ZZYA 4AF2A 2IMFA 4HI7A 2I81A 4ZB9A 2OE1A 1NW2A 3IPZA 2L4QA 3KTBA 2E2GA 3QFAC 1MD3A 2R2JA 2K8SA 3MDKA 5DALB 4I97A 3QCPA 2MZCA 1YJ6A 3ZFBA 4WEYA 3L9SA 3QMXA 2DIYA 3DGQA 2L6CA 2H73A 1AXDA 3QDNA 4YQUA 3IV4A 3GYKA 2KOKA 4Q5QA 4MF5A 3W8JA 2VAFA 1IYIA 2DJJA 1WP0A 1A2MA 5EVOA 3TRQA 2PGTA 3D5JA 3UARA 2IMEA 4NXIA 1EV9A 4IJ3A 4IS0A 3M9JA 4V2NA 14GSA 5IPHA 4MP4A 2DJKA 1BYEA 2O89A 5J9BA 4XRDA 4KUNA 2CX3A 3BCIA 1ZGNA 3DMLA 5ECNB 4ZL8A 2CX4A 2V2GA 3QAVA 3D6IA 1V40A 3VWUA 4IKHA 4MZCA 3H8QA 2REMA 1KBNA 2LJKA 2IFQA 2L5LA 3KP8A 3ZYWA 1OKTA 4AJ7A 2MMNA 4KE3A 3IK7A 1EV4A 1Y6EA 3NIVA 3DEXA 3KJYA 5A4VA 1OC9B 1S3CA 4LA1A 2P31A 1ABAA 2F8FA 2YWMA 2FWHA 2YNXA 2GVPA 2A2SA 3F63A 4K0GA 1TP9A 4TR1A 3TDGA 2P0GA 1SD9A 2K9FA 2E7PA 4Q5FA 1K0DA 4GF0A 4MMMA 3KMNA 2HNLA 2BMXA 2OE3A 3C8EA 2WB9A 2F8AA 3GL3A 4AJ6A 1F9MA 5L71A 4XS6A 1WJKA 1B8XA 1QFNA 4IJIA 1UC7A 2BTOT 2FWFA 1TK0B 3GTUA 5IOWA 2H72A 2H01A 2RM5A 4WKWA 1M9BA 2B5YA 10GSA 3KH7A 3TJKA 4KCEA 4ZB8A 3BJ5A 4FIWA 3H1NA 1TW9A 4KA0A 5C00A 4XHMA 3APSA 1LJRA 1ML6A 2OKAA 4JEDA 4PNFA 4Q5RA 3Q19A 3DRNA 1K0NA 3Q6OA 1X9MB 2WZ9A 1G6YA 3TKSC 3A3TA 5DJLA 3BBYA 3TOTA 3WT1A 1A8YA 4EC0A 4F9ZA 3PH9A 4I5QA 5ELGA 4ZBDA 1OYJA 5ECPB 1GLPA 1BAYA 3M1GA 4OCEA 2O85A 2GQLA 1XW6A 4PQHA 2VM2A 4O5RA 4GWRA 4HQSA 1EP8A 2X8HA 5DALA 2H19A 1MTCA 2M80A 1PL2A 4YQMA 1T4ZA 1Q4JA 4LLRA 1BX9A 1XOAA 3HD5A 3PGTA 4BA7A 3GMFA 3VLNA 4OMVA 4WBJA 3DVXA 3D21A 3I6AA 1U87A 1X5EA 1AUCA 5A4WA 2VUPA 1ERUA 5C04A 4FH8A 1Z9HA 2IMIA 1TU8A 5CRWA 4BPYA 5DVBA 1S3AA 2NBSA 3SWLA 1TI1A 3TKRA 4JBBA 3IXRA 3C1RA 2YCDA 2YZHA 4OO5A 3EMXA 2I1UA 4BL7A 3RDWA 1XW9A 5F07A 5B7CA 1TOFA 3IE3A 4MH2A 1TTZA 2NPBA 1M99A 3EC3A 4WF5A 3GURA 4PURA 1ZMAA 4MABA 1YEPA 1TKDB 3GSTA 1EEJA 5CAXA 1YF0A 4IN0A 3HXSA 1T7PB 3UL3A 3RHBA 3BCKA 2G0FA 1O81A 3TKSA 5ECRB 5GZZB 1A0RP 1PD21 4POBA 4QL9A 2V41A 1ZL9A 3KH9A 1A23A 4EE0A 5IMZA 1OC9A 1K0AA 2QGVA 2F51A 1THXA 3CRUA 2GLRA 4POLA 3FZ5A 2DMLA 1OKDA 2I9HA 1OE7A 1R4WA 3A2XA 4G10A 2J23A 3GA4A 3QAWA 1TRWA 4LMVA 4EO3A 2HE3A 5LNKe 5G1LA 1ERWA 5J3RA 4N0ZA 4KAEA 3KTLA 2VOCA 2YPMA 5ABRA 3P2AA 2C3NA 4ZIJA 4KNDA 2VCWA 3F6DA 4V1Ap 3F4RA 3HYPA 2GSRA 2I4AA 2JACA 5LCZA 3PINA 3FZAA 3C1SA 1Y25A 4GTUA 3ZVJD 3UOMA 1PMTA 1C72A 2VLUA 3Q74A 5B6NA 2WFCA 3H79A 2GS3A 3QD9A 2ON5A 5F06A 5ECLB 3C73A 12GSA 2EIOA 1X9WB 4V2MA 2RUEA 1SJ6A 5IMVA 2DJ0A 3KIJA 1PSQA 2OE0A 3CMIA 1PL1A 4F03A 2ZCTA 4I8BA 3KCMA 3J7Yk 4GSNA 3P8WA 4XCSA 2L4CA 3M9KA 3QOUA 1NM3A 1H75A 3LG6A 2HSYA 3VPQA 1SJIA 4MJEA 1SU9A 1U6TA 2AHEA 1QMVA 3LFLA 3KXOA 3FY7A 1VF4A 4K6XA 5J5NA 4HJ2A 4PGTA 3HJMA 2NDOA 2A4VA 2H0HA 2H0GA 4JZQA 3F6FA 4RQXA 2AUVA 3FR3A 4EKZA 2HI7A 5AN1A 4PUAA 3UBKA 3CSIA 1YQ1A 5FHIA 5DAKB 5ECOB 4IELA 4YAVA 1EZKA 1NSWA 5IQYA 3GX8A 2RUFA 3GSSA 4N10A 4HZ2A 2HZFA 3DYRA 3FZ4A 3F4TA 5CP1A 2TIRA 3KEBA 4RQRA 2B7KA 2GGTA 2R4VA 4CW9A 3GKKA 2A2RA 4MF6A 2FNOA 4KSOA 2CAQA 3DD3A 4ID0A 3LEFA 4E8HA 1R7HA 1XWAA 2GSSA 4MLYA 2GSTA 3HKRA 3CSJA 3CBUA 3NZNA 5AIVA 4NV2A 3ZMLA 1O8WA 4L0UA 5GSTA 1GUHA 3APOA 1M7TA 3LSZA 5F05A 2XHFA 3IA1A 4CHSA 2L5OA 4OD7A 1VRSD 2N5AA 5JWRB
chains in the Genus database with same CATH superfamily
1PRXA 2ON7A 2WULA 3LGCA 2IWTA 5CO3A 5HFKA 2VL3A 1RW1A 3ZMKA 5JCWA 2H74A 3ZVJA 5JWOB 4G9HA 4HJMA 6GSYA 5DJMA 1OE8A 4BWQA 4FO5A 5DCGA 5CNWA 2I3YA 4K7NA 5G5FA 5EPFA 3C71A 1B9YC 4GRFA 2JADA 2DSAA 4HDEA 19GSA 11GSA 3ZIVA 2VCVA 5HQPA 5IIZA 5GAND 3EYTA 1FB0A 1YEXA 2HLSA 4YH2A 5DDLA 4J56E 1XOBA 4WXTA 4IP1A 2IPAA 1SYXA 5IOXA 4O92A 5E4WA 17GSA 1AQWA 1T8EB 18GSA 3W8SA 1GRXA 3I9V2 4DEJA 1A2LA 2NTOA 3G9BA 4GSTA 4MK3A 4FYBA 2CZ2A 1FAAA 3RPPA 1NHOA 1XWGA 1Q98A 5KN0A 4IP6A 3F3QA 5ECKB 1HNBA 2IN3A 2FY6A 5ECQB 2XPEA 2C80A 4QL7A 4ECCA 2HRFA 4H86A 4L0WA 4RI7A 3RHCA 2K18A 3P90A 1GSUA 5KN1A 1F3BA 3TUEA 5A4UA 3UVTA 4HU9A 4TW5A 5H5SA 1FW1A 3TOUA 4GQCA 1DUGA 2DJ1A 3BD2A 3VI7A 1CQHA 4O5QA 2AYTA 4X0XA 2XBQA 2OA7A 2VD0A 2HFDA 3VWWA 3ZIJA 2K6VA 2MMAA 1X9SB 1G7EA 2F9SA 5ECHB 2VLTA 2L6DA 3HJPA 1GNWA 2C0FA 2GTUA 4MF7A 4ZBAA 2FWEA 1DBYA 2V6OA 1TI3A 4PUFC 3O76A 4DSSB 1TU7A 2HRKA 1GL8A 5DAKA 4TR3A 1PKWA 7GSSA 3GRXA 4TR0A 3EINA 1BQ7A 3HJOA 5EL8A 3EU4A 2WCIA 3IAM2 1GTBA 4IBPA 2WRTA 2GQKA 2C0GA 2EIQA 1JZOA 4QQ7A 3HY2A 2O7KA 1TJDA 2B7JA 3FMWA 4V2LA 3LQ7A 2LQOA 1ACVA 3D4MA 6GSTA 3IR4A 1PN9A 3ME8A 1XCCA 1Z7PA 4L5OA 1F2EA 1FHEA 2ALBA 2H8LA 1B9XC 1Z3EA 1GUKA 4IW9A 4N11A 2VO4A 2XPDA 5FWGA 1O85A 2OBKA 2VM1A 3DWVA 1SYRA 2IMDA 1Z6MA 2YWIA 4EF0A 1USBA 2O87A 3CSHA 2KLXA 3WGXA 4NHZA 1IYHA 5BRTA 2FA4A 1AQXA 4GQFA 4MZWA 3IHQA 4WF4A 2H6ZA 5DQSA 1PX7A 5D73A 2L59A 1DE1A 4K1FA 1K0BA 4PX1A 5JWQB 2TRXA 2FD3A 1AW9A 1M3IA 5CRDA 1TXXA 1S3DA 3LW9A 1EOGA 3ZFLA 2B6MA 2C3QA 1TK8B 1QGVA 2LUSA 5KOXA 2D2ZA 1GSYA 1VF1A 2KHPA 5ID2B 1G6WA 1B4QA 1UN2A 3ZREA 2V6KA 4V1Ag 3TCOA 5JCGA 2HZEB 3MWHA 3M0FA 3KM6A 2CQ9A 4ULXA 3FEUA 1PQNA 5ECIB 2YZUA 1EP7A 4RUVA 1M9AA 3TJBA 1GH2A 2E2MA 4XS1A 4TVEA 2HT9A 2DBCA 3A2VA 1AQVA 3VPTA 3BOAA 2LRNA 1URMA 1G7OA 4HSCX 1HD2A 2P5RA 2JZTA 4YAPA 4MZBA 4PXOA 2DLXA 4ZXGA 2J9HA 2HXKA 4MDCA 1KEBA 3R3EA 1TK5B 3CXGA 3VURA 2X8GA 1B48A 4K8MA 1V57A 4I2TA 3N5OA 3FR6A 2IJYA 1WOUA 3U6VA 3IRAA 2YJ7A 5IPGA 3IDVA 2FA8A 2AB6A 4YQVA 4X1UA 1A24A 2N5BA 4ZBBA 4EDZA 2JSYA 2LRTA 1FG4A 5J4UA 1OAZA 1K3LA 4G19A 3UJ1A 1AAZA 1GULA 3MIXA 1TDIA 2IIYA 4D73B 4NAXA 1VGLA 5IMAA 2HSHA 3HVSA 4ACSA 5B6MA 1LBKA 4K7IA 1GP1A 4JU5A 3EWLA 2GDRA 5G1KA 1FO5A 1JZDA 4J57E 2R37A 3IBHA 3F0IA 5DQYA 2B5XA 3F8UA 4KB3A 3HZ4A 2P5QA 2C4JA 2B5EA 4EXJA 2H1AA 4DSSA 4HQZA 4K2XA 1MDJA 3G7JA 3DVWA 2ZUPA 3GL5A 1U3IA 4ECBA 4O32A 3FW2A 3LYKA 1FVKA 1F3AA 3FZ9A 4TN8A 2C8UA 2V1MA 2YN1A 1VF2A 3KMOA 2DMMA 4MJBA 2RM6A 1SL2B 4J2FA 5D8IA 1MDIA 2ZNMA 1O6JA 4BVXB 5CREA 3F3RA 3D4TA 3GX0A 3A5WA 3IC8A 1CQGA 2WGRA 1VF3A 3M3MA 2HSMA 5FT3A 3G7IA 2VD1A 2DKIA 2CT6A 2QSIA 4CY6A 1ERVA 4ECIA 3H4KA 2GZZA 3QFBC 4MPGA 2CVDA 4MJAA 4OFNA 1XZOA 1UA5A 2XBIA 4FYUA 1PX6A 4HS1A 1HYUA 3I69A 5H5RA 4G0IA 4EIPA 1BJXA 3GN3A 3F4SA 5LD0A 3MSZA 1PGTA 2PVQA 2FHEA 3LWAA 4ILFA 5B8AA 2H70A 2PWJA 4Q5NA 2LNSA 3A2WA 1PKZA 3DXBA 3PR8A 1U88A 4EDYA 1E6BA 9GSSA 2H0IA 1SENA 5CYYA 1SKWB 3TKPA 4IHUA 4K7OA 3E0UA 2B1LA 5ID2A 1SD8A 2CV4A 3ISOA 4KX4A 4FYCA 4Z2UA 4JE1A 4OO4A 5IMDA 4EUYA 5ECMB 2HZEA 4KSMA 2LJAA 3RPNA 3UEMA 1OC3A 1U3AA 2VIMA 3GUSA 4CY8A 2H66A 1J0FA 4ML6A 4GLTA 2L57A 1V98A 2H1DA 1TRVA 3ZZXA 4PTSA 4AGSA 1I5GA 4ECJA 4TRXA 2MBTA 3VK9A 3HA9A 3HCZA 5D96A 2V32A 5IO0A 3WYWA 1K3YA 1MEKA 2A2PA 2H1BA 1NHYA 2MMZA 2JZRA 2H6YA 3NOFA 3EU3A 2R0GA 1V58A 4I6XA 5G30A 3EPTA 1WMJA 2PN8A 4OWYA 3UAPA 3J7Yb 1XPVA 3TJJA 4NPBA 2JU5A 1GSFA 2PU9C 1M0UA 2WJUA 1N8JA 2YV7A 3KD0A 3V1WA 5F8BA 2EC4A 3H93A 2A4HA 2H75A 1M2BA 1YKCA 5B8BA 3US3A 4BWSA 1RK4A 5J9CA 1GLQA 2M72A 2H1GA 1ST9A 4E8EA 2VL9A 5ECSA 1Z6NA 1GSDA 3KGKA 3IC4A 5EY6A 3FRCA 2H76A 1F6MC 1W4VA 1M2AA 2JSZA 8GSSA 2AAWA 1XBSA 1AIUA 1YKAA 4LMWA 4N0VA 4D73A 4KCAA 1XIYA 2R0PA 1JLVA 1THOA 1XVQA 4POMA 1GTUA 4AJ8A 4TXOA 3APQA 4K2DA 2LRCA 3IOSA 3L0HA 4JR6A 4K0NA 4NMUA 1B4PA 4Z7XA 3VI5A 1EEMA 3C7MA 2YJHA 2CZ3A 4MPFA 1S3RA 1F37A 5D93A 2DIZA 4WR4A 1GSEA 3GHAA 3JCML 1SK2A 2FWGA 1XFLA 1WE0A 2VCQA 2OJLA 1QUWA 5D9TA 4IQ1A 3IK9A 1JHBA 1AC1A 4TKYA 4HOJA 3LYPA 5G31A 1YZXA 3UVHA 4F0BA 3EMPA 1MD4A 2HYXA 1A0FA 4TOPA 2YV9A 2LTKA 1QXHA 5CRGA 1TRSA 2B3SA 5D9WA 4BVXA 4CDOA 4IVFA 2M46A 3IAS2 5IMFA 4HEA2 3CRTA 1JZWA 1R5PA 1FVJA 5COHA 4HZ4A 6GSXA 2BJXA 3WGDA 1HQOA 3ERWA 3KP9A 1XXUA 2X64A 5IMCA 2DJ2A 4FQUA 1X5CA 3RAZA 3GNJA 4WR5A 3DIEA 3SBCA 1G0TA 4JRRA 3UMAA 1EGOA 5HR2A 3R2QA 4KDYA 2Z9SA 1V2AA 4TR4A 1PA3A 3FHKA 2PMTA 1DSBA 1ZOFA 3GFKA 4XTSA 4PNGA 3VWXA 2H71A 1X5DA 2CVBA 1K0CA 1O8XA 2IL3A 3GH6A 3UIWA 5J41A 4XRAA 6GSVA 4KH7A 3ZTLA 1XWKA 4RI6A 2NVLA 4PQ1A 1N2AA 3WGEA 1O73A 3D22A 2GSQA 1T4YA 3CQFA 4NHWA 3EE2A 5E59A 5IO2A 1FOHA 2VCXA 2VCTA 4WBRD 22GSA 3F9UA 3FR9A 3W6GA 2R3XA 3FKFA 3MAKA 1EOHA 5INYA 3TRXA 1YF1A 3HHVA 4NWYA 4ZILA 4DSQA 4HU7A 4KDUA 4KGIA 2LKUA 5HFIA 3P7XA 2H6XA 4K5RA 1MDKA 4ML1A 3QR6A 1X0RA 5GAPD 2VL2C 5HFGA 6GSSA 4JR4A 2CA8A 1ZYNA 1PN0A 3D0ZA 1FB6A 3ZRDA 3CYNA 1K3OA 1XW5A 3CTFA 4GSSA 1JLWA 6GSWA 2JL4A 2B1KA 4MA9A 1LU4A 5KN2A 2AV4A 5HR1A 4OFTA 1GNEA 5CRHA 1ILOA 2IMKA 4N30A 1XVWA 4XS4B 5D9VA 1A2JA 3TGZA 3ZL5A 2MYGA 2CVKA 1J08A 3HZ8A 2PBJA 1ON4A 3E3EA 3ED3A 1H4OA 5AGYA 16GSA 1EGRA 2E0QA 4ICYA 2GT5A 4IGJA 5GSSA 2LV3A 4XIHA 1V9WA 1K0OA 4F2IA 3L4NA 3O6TA 2FGXA 1GTIA 2X8CA 1A8LA 2G2QA 1KTEA 1GTAA 2FCHA 2LS5A 4WETA 3ZITA 1WWJA 1TRUA 1JZRA 2X49A 3DKSA 4G2EA 5KN3A 2C0EA 2JZSA 2PERA 3MNGA 4GXZA 2QKEA 2QC7A 1M2DA 5ELAA 3K8NA 4MJCA 1Z5YE 2C0DA 5DBQA 1YDKA 1W89A 4G0LA 4OCFA 3OR5A 3GV1A 3S9FA 2LEGA 4P3YB 3TKSE 2PUKC 1GSSA 20GSA 3U5RE 5H5QA 2EIRA 1T00A 4DVCA 1ERTA 3ME7A 2F3MA 1HNCA 1YY7A 2LQQA 2TRCP 1R26A 2YWOA 3WD6A 2MMOA 2YOIA 1GSQA 1UVZA 5A5KA 1O7UA 1Z7RA 3GKNA 2GZYA 4IQAA 2LSTA 2RIIA 1BG5A 3LXZA 4ZB6A 4TXOB 2VL2A 3TB2A 5AISA 1WRYA 2RLIA 4NV5A 2KP1A 1QQ2A 4K9ZA 1I9DA 3M8NA 2X99A 3UBLA 3TRPA 2YWNA 1J9BA 1JFUA 3L78A 2VLVA 4L5LA 5G5EA 3HVXA 6GSUA 2PPTA 3ERFA 3LXTA 5HR3A 1PFOA 5HR0A 1FOVA 1KNGA 2GT6A 2IFQB 2LNTA 5F0GA 1SL0B 3ERGA 5BMUA 3G7YA 2R6KA 1RQMA 5JCUA 2DKHA 3GKMA 2OACA 2PVOC 1K0MA 4LL4B 2C3TA 4OFMA 3E9JB 2LJRA 3QPMA 5DCHA 3I43A 4TXVA 1XWBA 3LJRA 1DE2A 3FYGA 2XC2A 2HRAA 2N5FA 1BEDA 1GUMA 1E2YA 2FUG2 2AJQB 2YANA 1SJZA 1SKRB 3L9UA 1SK1A 4F0CA 1XWCA 4PQIA 5ENUA 2GQMA 4KW6A 1OC8A 3VFIA 4F82A 4ZL9A 2OADA 4TR1B 1SL1B 2R5GA 2FLSA 3HDCA 3VWVA 3AY8A 5G2ZA 3FK8A 3N9JA 1ZYPA 4EIQA 3WT2A 2ES7A 3GIXA 5D9XA 2KP2A 2UZ8A 4ISDA 4I2UA 3ZLPA 2K8VA 2VCZA 4MH3A 5KEJA 3LORA 5AIXA 1QK8A 4EVMA 2C1YA 4KDXA 13GSA 1T1VA 4X43A 3GTUB 3MYDA 4GCIA 4BVYA 1SK0A 3EVIA 4XS4A 4DSRA 3L9VA 1GWCA 2O8VB 1ZYEA 3GH9A 2GZPA 1WPIA 3A5IA 3EURA 4ZL7A 2H30A 2MBSA 1SKSB 2DC5A 3KZQA 3TKQA 2YP6A 2OBIA 1OVNA 2KUCA 5IM9A 4LL1B 2WS2A 3TJGA 1EWXA 2WDUA 3GKXA 4MCUA 4O7HA 3QAGA 1WIKA 3RBTA 1ZYQB 4L8EA 3CTGA 1ZCPA 1HNAA 4POKA 3HVVA 3TJFA 1R5AA 4HUAA 3Q18A 2CAIA 3O3TA 2HRNA 1T3BA 4EL1A 2DJ3A 1ZZYA 4AF2A 2IMFA 4HI7A 2I81A 4ZB9A 2OE1A 1NW2A 3IPZA 2L4QA 3KTBA 2E2GA 3QFAC 1MD3A 2R2JA 2K8SA 3MDKA 5DALB 4I97A 3QCPA 2MZCA 1YJ6A 3ZFBA 4WEYA 3L9SA 3QMXA 2DIYA 3DGQA 2L6CA 2H73A 1AXDA 3QDNA 4YQUA 3IV4A 3GYKA 2KOKA 4Q5QA 4MF5A 3W8JA 2VAFA 1IYIA 2DJJA 1WP0A 1A2MA 5EVOA 3TRQA 2PGTA 3D5JA 3UARA 2IMEA 4NXIA 1EV9A 4IJ3A 4IS0A 3M9JA 4V2NA 14GSA 5IPHA 4MP4A 2DJKA 1BYEA 2O89A 4X4JA 5J9BA 4XRDA 4KUNA 2CX3A 3BCIA 1ZGNA 3DMLA 5ECNB 4ZL8A 2CX4A 2V2GA 3QAVA 3D6IA 4BL7B 1V40A 3VWUA 4IKHA 4MZCA 3H8QA 2REMA 1KBNA 2LJKA 2IFQA 2L5LA 3KP8A 4MNNA 3ZYWA 1OKTA 4AJ7A 2MMNA 4KE3A 3IK7A 1EV4A 1Y6EA 3NIVA 3DEXA 3KJYA 5A4VA 3HVNA 1OC9B 4G0KA 1S3CA 4LA1A 2P31A 1ABAA 2F8FA 2YWMA 2FWHA 2YNXA 2GVPA 2A2SA 3F63A 4K0GA 1TP9A 4TR1A 3TDGA 2P0GA 1SD9A 2K9FA 2E7PA 4Q5FA 1K0DA 4GF0A 4MMMA 3KMNA 2HNLA 2BMXA 2OE3A 3C8EA 2WB9A 2F8AA 3GL3A 4AJ6A 1F9MA 5L71A 4XS6A 1WJKA 1B8XA 1QFNA 4IJIA 1UC7A 2BTOT 2FWFA 1TK0B 3GTUA 5IOWA 2H72A 2H01A 2RM5A 4WKWA 1M9BA 2B5YA 10GSA 3KH7A 3TJKA 4KCEA 4ZB8A 3BJ5A 4FIWA 3H1NA 1TW9A 4K5SA 4KA0A 5C00A 4XHMA 3APSA 4Z2RA 1LJRA 1ML6A 2OKAA 4JEDA 4PNFA 4Q5RA 3Q19A 3DRNA 1K0NA 3Q6OA 1X9MB 2WZ9A 4USSA 1G6YA 3TKSC 3A3TA 5DJLA 3BBYA 3TOTA 3WT1A 1A8YA 4EC0A 4F9ZA 3PH9A 4I5QA 5ELGA 1M3JA 4ZBDA 1OYJA 5ECPB 1GLPA 1BAYA 3M1GA 4OCEA 2O85A 2GQLA 1XW6A 4PQHA 2VM2A 4O5RA 4GWRA 4HQSA 1EP8A 2X8HA 5DALA 2H19A 1MTCA 2M80A 1PL2A 4YQMA 1T4ZA 1Q4JA 4LLRA 1BX9A 1XOAA 3HD5A 4BVYB 3PGTA 4BIKA 4BA7A 3GMFA 3VLNA 4OMVA 4WBJA 3DVXA 3D21A 3I6AA 1U87A 1X5EA 1AUCA 5A4WA 2VUPA 1ERUA 5C04A 4FH8A 1Z9HA 2IMIA 1TU8A 5CRWA 4BPYA 5DVBA 1S3AA 4KF9A 2NBSA 3SWLA 1TI1A 3TKRA 4JBBA 3IXRA 3C1RA 2YCDA 2YZHA 4OO5A 3EMXA 2I1UA 4BL7A 3RDWA 1XW9A 5F07A 5B7CA 1TOFA 3IE3A 4MH2A 1TTZA 2NPBA 1M99A 3EC3A 4WF5A 3GURA 4PURA 1ZMAA 4MABA 1YEPA 1TKDB 3GSTA 1EEJA 5CAXA 1YF0A 4IN0A 3HXSA 1T7PB 3UL3A 3RHBA 3BCKA 2G0FA 1O81A 3TKSA 5ECRB 5GZZB 1A0RP 1PD21 4POBA 4QL9A 2V41A 1ZL9A 3KH9A 1A23A 4EE0A 5IMZA 1OC9A 1K0AA 2QGVA 2F51A 1THXA 3CRUA 2GLRA 4POLA 3FZ5A 2DMLA 1OKDA 2I9HA 1OE7A 1R4WA 3A2XA 4G10A 2J23A 3GA4A 3QAWA 1TRWA 4LMVA 4EO3A 2HE3A 5LNKe 5G1LA 1ERWA 5J3RA 4N0ZA 4KAEA 3KTLA 2VOCA 2YPMA 5ABRA 3P2AA 2C3NA 4ZIJA 4KNDA 2VCWA 3F6DA 4V1Ap 3F4RA 3HYPA 4O5UA 2GSRA 2I4AA 2JACA 5LCZA 3PINA 3FZAA 3C1SA 1XG8A 1Y25A 4GTUA 3ZVJD 3UOMA 1PMTA 1C72A 2VLUA 3Q74A 5B6NA 2WFCA 3H79A 2GS3A 3QD9A 3PPUA 2ON5A 5F06A 5ECLB 3C73A 12GSA 2EIOA 1X9WB 4V2MA 2RUEA 1SJ6A 5IMVA 2DJ0A 3KIJA 2QA2A 4A5PA 1PSQA 2OE0A 3CMIA 1PL1A 4F03A 2ZCTA 4I8BA 3KCMA 3J7Yk 4GSNA 3P8WA 4XCSA 2R0CA 2L4CA 3M9KA 5KOWA 3QOUA 1NM3A 1H75A 3LG6A 2HSYA 3VPQA 1SJIA 2X4AA 4MJEA 1SU9A 1U6TA 2AHEA 1QMVA 3LFLA 3KXOA 3FY7A 1VF4A 4K6XA 5J5NA 4HJ2A 4PGTA 3HJMA 2NDOA 2A4VA 2H0HA 2H0GA 4JZQA 4Z2TA 3F6FA 3IHGA 2AUVA 3FR3A 4RQXA 4EKZA 2HI7A 5AN1A 4PUAA 3UBKA 3CSIA 1YQ1A 5FHIA 5DAKB 5ECOB 4IELA 4YAVA 1EZKA 1NSWA 4YKGA 5IQYA 3GX8A 2RUFA 3GSSA 4N10A 4HZ2A 2HZFA 3DYRA 3FZ4A 3F4TA 5CP1A 2TIRA 3KEBA 4RQRA 2B7KA 2GGTA 2R4VA 4CW9A 3GKKA 2A2RA 4MF6A 2FNOA 4KSOA 2CAQA 3DD3A 4YKFA 4ID0A 3LEFA 4E8HA 1R7HA 1XWAA 2GSSA 4MLYA 2GSTA 3HKRA 3CSJA 3CBUA 3NZNA 5AIVA 4NV2A 3ZMLA 1O8WA 4L0UA 5GSTA 1GUHA 3APOA 1M7TA 3LSZA 5F05A 2XHFA 2QA1A 3IA1A 4CHSA 2L5OA 4OD7A 1VRSD 2N5AA 5JWRB
chains in the Genus database with same CATH topology
1PRXA 2ON7A 2WULA 3LGCA 2IWTA 5CO3A 5HFKA 2VL3A 1RW1A 3ZMKA 5JCWA 2H74A 3ZVJA 5JWOB 4G9HA 4HJMA 6GSYA 5DJMA 1OE8A 4BWQA 4FO5A 5DCGA 5CNWA 2I3YA 4K7NA 5G5FA 5EPFA 3C71A 1B9YC 4GRFA 2JADA 2DSAA 4HDEA 19GSA 11GSA 3ZIVA 2VCVA 5HQPA 5IIZA 5GAND 3EYTA 1FB0A 1YEXA 2HLSA 4YH2A 5DDLA 4J56E 1XOBA 4WXTA 4IP1A 2IPAA 1SYXA 5IOXA 4O92A 5E4WA 17GSA 1AQWA 1T8EB 18GSA 3W8SA 1GRXA 3I9V2 4DEJA 1A2LA 2NTOA 3G9BA 4GSTA 4MK3A 4FYBA 2CZ2A 1FAAA 3RPPA 1NHOA 1XWGA 1Q98A 5KN0A 4IP6A 3F3QA 5ECKB 1HNBA 2IN3A 2FY6A 5ECQB 2XPEA 2C80A 4QL7A 4ECCA 2HRFA 4H86A 4L0WA 4RI7A 3RHCA 2K18A 3P90A 1GSUA 5KN1A 1F3BA 3TUEA 5A4UA 3UVTA 4HU9A 4TW5A 5H5SA 1FW1A 3TOUA 4GQCA 1DUGA 2DJ1A 3BD2A 3VI7A 1CQHA 4O5QA 2AYTA 4X0XA 2XBQA 2OA7A 2VD0A 2HFDA 3VWWA 3ZIJA 2K6VA 2MMAA 1X9SB 1G7EA 2F9SA 5ECHB 2VLTA 2L6DA 3HJPA 1GNWA 2C0FA 2GTUA 4MF7A 4ZBAA 2FWEA 1DBYA 2V6OA 1TI3A 4PUFC 3O76A 4DSSB 1TU7A 2HRKA 1GL8A 5DAKA 4TR3A 1PKWA 7GSSA 3GRXA 4TR0A 3EINA 1BQ7A 3HJOA 5EL8A 3EU4A 2WCIA 3IAM2 1GTBA 4IBPA 2WRTA 2GQKA 2C0GA 2EIQA 1JZOA 4QQ7A 3HY2A 2O7KA 1TJDA 2B7JA 3FMWA 4V2LA 3LQ7A 2LQOA 1ACVA 3D4MA 6GSTA 3IR4A 1PN9A 3ME8A 1XCCA 1Z7PA 4L5OA 1F2EA 1FHEA 2ALBA 2H8LA 1B9XC 1Z3EA 1GUKA 4IW9A 4N11A 2VO4A 2XPDA 5FWGA 1O85A 2OBKA 2VM1A 3DWVA 1SYRA 2IMDA 1Z6MA 2YWIA 4EF0A 1USBA 2O87A 3CSHA 2KLXA 3WGXA 4NHZA 1IYHA 5BRTA 2FA4A 1AQXA 4GQFA 4MZWA 3IHQA 4WF4A 2H6ZA 5DQSA 1PX7A 5D73A 2L59A 1DE1A 4K1FA 1K0BA 4PX1A 5JWQB 2TRXA 2FD3A 1AW9A 5CRDA 1TXXA 1S3DA 3LW9A 1EOGA 3ZFLA 2B6MA 2C3QA 1TK8B 1QGVA 2LUSA 5KOXA 2D2ZA 1GSYA 1VF1A 2KHPA 5ID2B 1G6WA 1B4QA 1UN2A 3ZREA 2V6KA 4V1Ag 3TCOA 5JCGA 2HZEB 3MWHA 3M0FA 3KM6A 2CQ9A 4ULXA 3FEUA 1PQNA 5ECIB 2YZUA 1EP7A 4RUVA 1M9AA 3TJBA 1GH2A 2E2MA 4XS1A 4TVEA 2HT9A 2DBCA 3A2VA 1AQVA 3VPTA 3BOAA 2LRNA 1URMA 1G7OA 1HD2A 2P5RA 2JZTA 4YAPA 4MZBA 4PXOA 2DLXA 4ZXGA 2J9HA 2HXKA 4MDCA 1KEBA 3R3EA 1TK5B 3CXGA 3VURA 2X8GA 1B48A 4K8MA 1V57A 4I2TA 3N5OA 3FR6A 2IJYA 1WOUA 3U6VA 3IRAA 2YJ7A 5IPGA 3IDVA 2FA8A 2AB6A 4YQVA 4X1UA 1A24A 2N5BA 4ZBBA 4EDZA 2JSYA 2LRTA 1FG4A 5J4UA 1OAZA 1K3LA 4G19A 3UJ1A 1AAZA 1GULA 3MIXA 1TDIA 2IIYA 4D73B 4NAXA 1VGLA 5IMAA 2HSHA 3HVSA 4ACSA 5B6MA 1LBKA 4K7IA 1GP1A 4JU5A 3EWLA 2GDRA 5G1KA 1FO5A 1JZDA 4J57E 2R37A 3IBHA 3F0IA 5DQYA 2B5XA 3F8UA 4KB3A 3HZ4A 2P5QA 2C4JA 2B5EA 4EXJA 2H1AA 4DSSA 4HQZA 4K2XA 1MDJA 3G7JA 3DVWA 2ZUPA 3GL5A 1U3IA 4ECBA 4O32A 3FW2A 3LYKA 1FVKA 1F3AA 3FZ9A 4TN8A 2C8UA 2V1MA 2YN1A 1VF2A 3KMOA 2DMMA 4MJBA 2RM6A 1SL2B 4J2FA 5D8IA 1MDIA 2ZNMA 1O6JA 4BVXB 5CREA 3F3RA 3D4TA 3GX0A 3A5WA 3IC8A 1CQGA 2WGRA 1VF3A 3M3MA 2HSMA 5FT3A 3G7IA 2VD1A 2DKIA 2CT6A 2QSIA 4CY6A 1ERVA 4ECIA 3H4KA 2GZZA 3QFBC 4MPGA 2CVDA 4MJAA 4OFNA 1XZOA 1UA5A 2XBIA 4FYUA 1PX6A 4HS1A 1HYUA 3I69A 5H5RA 4G0IA 4EIPA 1BJXA 3GN3A 3F4SA 5LD0A 3MSZA 1PGTA 2PVQA 2FHEA 3LWAA 4ILFA 5B8AA 2H70A 2PWJA 4Q5NA 2LNSA 3A2WA 1PKZA 3DXBA 3PR8A 1U88A 4EDYA 1E6BA 9GSSA 2H0IA 1SENA 5CYYA 1SKWB 3TKPA 4IHUA 4K7OA 3E0UA 2B1LA 5ID2A 1SD8A 2CV4A 3ISOA 4KX4A 4FYCA 4Z2UA 4JE1A 4OO4A 5IMDA 4EUYA 5ECMB 2HZEA 4KSMA 2LJAA 3RPNA 3UEMA 1OC3A 1U3AA 2VIMA 3GUSA 4CY8A 2H66A 1J0FA 4ML6A 4GLTA 2L57A 1V98A 2H1DA 1TRVA 3ZZXA 4PTSA 4AGSA 1I5GA 4ECJA 4TRXA 2MBTA 3VK9A 3HA9A 3HCZA 5D96A 2V32A 5IO0A 3WYWA 1K3YA 1MEKA 2A2PA 2H1BA 1NHYA 2MMZA 2JZRA 2H6YA 3NOFA 3EU3A 2R0GA 1V58A 4I6XA 5G30A 3EPTA 1WMJA 2PN8A 4OWYA 3UAPA 3J7Yb 1XPVA 3TJJA 4NPBA 2JU5A 1GSFA 2PU9C 1M0UA 2WJUA 1N8JA 2YV7A 3KD0A 3V1WA 5F8BA 2EC4A 3H93A 2A4HA 2H75A 1M2BA 1YKCA 5B8BA 3US3A 4BWSA 1RK4A 5J9CA 1GLQA 2M72A 2H1GA 1ST9A 4E8EA 2VL9A 5ECSA 1Z6NA 1GSDA 3KGKA 3IC4A 5EY6A 3FRCA 2H76A 1F6MC 1W4VA 1M2AA 2JSZA 8GSSA 2AAWA 1XBSA 1AIUA 1YKAA 4LMWA 4N0VA 4D73A 4KCAA 1XIYA 2R0PA 1JLVA 1THOA 1XVQA 4POMA 1GTUA 4AJ8A 4TXOA 3APQA 4K2DA 2LRCA 3IOSA 3L0HA 4JR6A 4K0NA 4NMUA 1B4PA 4Z7XA 3VI5A 1EEMA 3C7MA 2YJHA 2CZ3A 4MPFA 1F37A 5D93A 2DIZA 4WR4A 1GSEA 3GHAA 3JCML 1SK2A 2FWGA 1XFLA 1WE0A 2VCQA 2OJLA 1QUWA 5D9TA 4IQ1A 3IK9A 1JHBA 1AC1A 4TKYA 4HOJA 3LYPA 5G31A 1YZXA 3UVHA 4F0BA 3EMPA 1MD4A 2HYXA 1A0FA 4TOPA 2YV9A 2LTKA 1QXHA 5CRGA 1TRSA 2B3SA 5D9WA 4BVXA 4CDOA 4IVFA 2M46A 3IAS2 5IMFA 4HEA2 3CRTA 1JZWA 1R5PA 1FVJA 5COHA 4HZ4A 6GSXA 2BJXA 3WGDA 1HQOA 3ERWA 3KP9A 1XXUA 2X64A 5IMCA 2DJ2A 4FQUA 1X5CA 3RAZA 3GNJA 4WR5A 3DIEA 3SBCA 1G0TA 4JRRA 3UMAA 1EGOA 5HR2A 3R2QA 4KDYA 2Z9SA 1V2AA 4TR4A 1PA3A 3FHKA 2PMTA 1DSBA 1ZOFA 3GFKA 4XTSA 4PNGA 3VWXA 2H71A 1X5DA 2CVBA 1K0CA 1O8XA 2IL3A 3GH6A 3UIWA 5J41A 4XRAA 6GSVA 4KH7A 3ZTLA 1XWKA 4RI6A 2NVLA 4PQ1A 1N2AA 3WGEA 1O73A 3D22A 2GSQA 1T4YA 4NHWA 3EE2A 5E59A 5IO2A 1FOHA 2VCXA 2VCTA 4WBRD 22GSA 3F9UA 3FR9A 3W6GA 2R3XA 3FKFA 3MAKA 1EOHA 5INYA 3TRXA 1YF1A 3HHVA 4NWYA 4ZILA 4DSQA 4HU7A 4KDUA 4KGIA 2LKUA 5HFIA 3P7XA 2H6XA 4K5RA 1MDKA 4ML1A 3QR6A 1X0RA 5GAPD 2VL2C 5HFGA 6GSSA 4JR4A 2CA8A 1ZYNA 1PN0A 3D0ZA 1FB6A 3ZRDA 3CYNA 1K3OA 1XW5A 3CTFA 4GSSA 1JLWA 6GSWA 2JL4A 2B1KA 4MA9A 1LU4A 5KN2A 2AV4A 5HR1A 4OFTA 1GNEA 5CRHA 1ILOA 2IMKA 4N30A 1XVWA 4XS4B 5D9VA 1A2JA 3TGZA 3ZL5A 2MYGA 2CVKA 1J08A 3HZ8A 2PBJA 1ON4A 3E3EA 3ED3A 1H4OA 5AGYA 16GSA 1EGRA 2E0QA 4ICYA 2GT5A 4IGJA 5GSSA 2LV3A 4XIHA 1V9WA 1K0OA 4F2IA 3L4NA 3O6TA 2FGXA 1GTIA 2X8CA 1A8LA 2G2QA 1KTEA 1GTAA 2FCHA 2LS5A 4WETA 3ZITA 1WWJA 1TRUA 1JZRA 2X49A 3DKSA 4G2EA 5KN3A 2C0EA 2JZSA 2PERA 3MNGA 4GXZA 2QKEA 2QC7A 1M2DA 5ELAA 3K8NA 4MJCA 1Z5YE 2C0DA 5DBQA 1YDKA 1W89A 4G0LA 4OCFA 3OR5A 3GV1A 3S9FA 2LEGA 4P3YB 3TKSE 2PUKC 1GSSA 20GSA 3U5RE 5H5QA 2EIRA 1T00A 4DVCA 1ERTA 3ME7A 2F3MA 1HNCA 1YY7A 2LQQA 2TRCP 1R26A 2YWOA 3WD6A 2MMOA 2YOIA 1GSQA 1UVZA 5A5KA 1O7UA 1Z7RA 3GKNA 2GZYA 4IQAA 2LSTA 2RIIA 1BG5A 3LXZA 4ZB6A 4TXOB 2VL2A 3TB2A 5AISA 1WRYA 2RLIA 4NV5A 2KP1A 1QQ2A 4K9ZA 1I9DA 3M8NA 2X99A 3UBLA 3TRPA 2YWNA 1J9BA 1JFUA 3L78A 2VLVA 4L5LA 5G5EA 3HVXA 6GSUA 2PPTA 3ERFA 3LXTA 5HR3A 5HR0A 1FOVA 1KNGA 2GT6A 2IFQB 2LNTA 5F0GA 1SL0B 3ERGA 5BMUA 3G7YA 2R6KA 1RQMA 5JCUA 2DKHA 3GKMA 2OACA 2PVOC 1K0MA 4LL4B 2C3TA 4OFMA 3E9JB 2LJRA 3QPMA 5DCHA 3I43A 4TXVA 1XWBA 3LJRA 1DE2A 3FYGA 2XC2A 2HRAA 2N5FA 1BEDA 1GUMA 1E2YA 2FUG2 2AJQB 2YANA 1SJZA 1SKRB 3L9UA 1SK1A 4F0CA 1XWCA 4PQIA 5ENUA 2GQMA 4KW6A 1OC8A 3VFIA 4F82A 4ZL9A 2OADA 4TR1B 1SL1B 2R5GA 2FLSA 3HDCA 3VWVA 3AY8A 5G2ZA 3FK8A 3N9JA 1ZYPA 4EIQA 3WT2A 2ES7A 3GIXA 5D9XA 2KP2A 2UZ8A 4ISDA 4I2UA 3ZLPA 2K8VA 2VCZA 4MH3A 5KEJA 3LORA 5AIXA 1QK8A 4EVMA 2C1YA 4KDXA 13GSA 1T1VA 4X43A 3GTUB 3MYDA 4GCIA 4BVYA 1SK0A 3EVIA 4XS4A 4DSRA 3L9VA 1GWCA 2O8VB 1ZYEA 3GH9A 2GZPA 1WPIA 3A5IA 3EURA 4ZL7A 2H30A 2MBSA 1SKSB 2DC5A 3KZQA 3TKQA 2YP6A 2OBIA 1OVNA 2KUCA 5IM9A 4LL1B 2WS2A 3TJGA 1EWXA 2WDUA 3GKXA 4MCUA 4O7HA 3QAGA 1WIKA 3RBTA 1ZYQB 4L8EA 3CTGA 1ZCPA 1HNAA 4POKA 3HVVA 3TJFA 1R5AA 4HUAA 3Q18A 2CAIA 3O3TA 2HRNA 1T3BA 4EL1A 2DJ3A 1ZZYA 4AF2A 2IMFA 4HI7A 2I81A 4ZB9A 2OE1A 1NW2A 3IPZA 2L4QA 3KTBA 2E2GA 3QFAC 1MD3A 2R2JA 2K8SA 3MDKA 5DALB 4I97A 3QCPA 2MZCA 1YJ6A 3ZFBA 4WEYA 3L9SA 3QMXA 2DIYA 3DGQA 2L6CA 2H73A 1AXDA 3QDNA 4YQUA 3IV4A 3GYKA 2KOKA 4Q5QA 4MF5A 3W8JA 2VAFA 1IYIA 2DJJA 1WP0A 1A2MA 5EVOA 3TRQA 2PGTA 3D5JA 3UARA 2IMEA 4NXIA 1EV9A 4IJ3A 4IS0A 3M9JA 4V2NA 14GSA 5IPHA 4MP4A 2DJKA 1BYEA 2O89A 4X4JA 5J9BA 4XRDA 4KUNA 2CX3A 3BCIA 1ZGNA 3DMLA 5ECNB 4ZL8A 2CX4A 2V2GA 3QAVA 3D6IA 4BL7B 1V40A 3VWUA 4IKHA 4MZCA 3H8QA 2REMA 1KBNA 2LJKA 2IFQA 2L5LA 3KP8A 4MNNA 3ZYWA 1OKTA 4AJ7A 2MMNA 4KE3A 3IK7A 1EV4A 1Y6EA 3NIVA 3DEXA 3KJYA 5A4VA 1OC9B 4G0KA 1S3CA 4LA1A 2P31A 1ABAA 2F8FA 2YWMA 2FWHA 2YNXA 2GVPA 2A2SA 3F63A 4K0GA 1TP9A 4TR1A 3TDGA 2P0GA 1SD9A 2K9FA 2E7PA 4Q5FA 1K0DA 4GF0A 4MMMA 3KMNA 2HNLA 2BMXA 2OE3A 3C8EA 2WB9A 2F8AA 3GL3A 4AJ6A 1F9MA 5L71A 4XS6A 1WJKA 1B8XA 1QFNA 4IJIA 1UC7A 2BTOT 2FWFA 1TK0B 3GTUA 5IOWA 2H72A 2H01A 2RM5A 4WKWA 1M9BA 2B5YA 10GSA 3KH7A 3TJKA 4KCEA 4ZB8A 3BJ5A 4FIWA 3H1NA 1TW9A 4K5SA 4KA0A 5C00A 4XHMA 3APSA 4Z2RA 1LJRA 1ML6A 2OKAA 4JEDA 4PNFA 4Q5RA 3Q19A 3DRNA 1K0NA 3Q6OA 1X9MB 2WZ9A 4USSA 1G6YA 3TKSC 3A3TA 5DJLA 3BBYA 3TOTA 3WT1A 1A8YA 4EC0A 4F9ZA 3PH9A 4I5QA 5ELGA 4ZBDA 1OYJA 5ECPB 1GLPA 1BAYA 3M1GA 4OCEA 2O85A 2GQLA 1XW6A 4PQHA 2VM2A 4O5RA 4GWRA 4HQSA 1EP8A 2X8HA 5DALA 2H19A 1MTCA 2M80A 1PL2A 4YQMA 1T4ZA 1Q4JA 4LLRA 1BX9A 1XOAA 3HD5A 4BVYB 3PGTA 4BA7A 3GMFA 3VLNA 4OMVA 4WBJA 3DVXA 3D21A 3I6AA 1U87A 1X5EA 1AUCA 5A4WA 2VUPA 1ERUA 5C04A 4FH8A 1Z9HA 2IMIA 1TU8A 5CRWA 4BPYA 5DVBA 1S3AA 4KF9A 2NBSA 3SWLA 1TI1A 3TKRA 4JBBA 3IXRA 3C1RA 2YCDA 2YZHA 4OO5A 3EMXA 2I1UA 4BL7A 3RDWA 1XW9A 5F07A 5B7CA 1TOFA 3IE3A 4MH2A 1TTZA 2NPBA 1M99A 3EC3A 4WF5A 3GURA 4PURA 1ZMAA 4MABA 1YEPA 1TKDB 3GSTA 1EEJA 5CAXA 1YF0A 4IN0A 3HXSA 1T7PB 3UL3A 3RHBA 3BCKA 2G0FA 1O81A 3TKSA 5ECRB 5GZZB 1A0RP 1PD21 4POBA 4QL9A 2V41A 1ZL9A 3KH9A 1A23A 4EE0A 5IMZA 1OC9A 1K0AA 2QGVA 2F51A 1THXA 3CRUA 2GLRA 4POLA 3FZ5A 2DMLA 1OKDA 2I9HA 1OE7A 1R4WA 3A2XA 4G10A 2J23A 3GA4A 3QAWA 1TRWA 4LMVA 4EO3A 2HE3A 5LNKe 5G1LA 1ERWA 5J3RA 4N0ZA 4KAEA 3KTLA 2VOCA 2YPMA 5ABRA 3P2AA 2C3NA 4ZIJA 4KNDA 2VCWA 3F6DA 4V1Ap 3F4RA 3HYPA 4O5UA 2GSRA 2I4AA 2JACA 5LCZA 3PINA 3FZAA 3C1SA 1Y25A 4GTUA 3ZVJD 3UOMA 1PMTA 1C72A 2VLUA 3Q74A 5B6NA 2WFCA 3H79A 2GS3A 3QD9A 3PPUA 2ON5A 5F06A 5ECLB 3C73A 12GSA 2EIOA 1X9WB 4V2MA 2RUEA 1SJ6A 5IMVA 2DJ0A 3KIJA 2QA2A 4A5PA 1PSQA 2OE0A 3CMIA 1PL1A 4F03A 2ZCTA 4I8BA 3KCMA 3J7Yk 4GSNA 3P8WA 4XCSA 2R0CA 2L4CA 3M9KA 5KOWA 3QOUA 1NM3A 1H75A 3LG6A 2HSYA 3VPQA 1SJIA 2X4AA 4MJEA 1SU9A 1U6TA 2AHEA 1QMVA 3LFLA 3KXOA 3FY7A 1VF4A 4K6XA 5J5NA 4HJ2A 4PGTA 3HJMA 2NDOA 2A4VA 2H0HA 2H0GA 4JZQA 4Z2TA 3F6FA 3IHGA 2AUVA 3FR3A 4RQXA 4EKZA 2HI7A 5AN1A 4PUAA 3UBKA 3CSIA 1YQ1A 5FHIA 5DAKB 5ECOB 4IELA 4YAVA 1EZKA 1NSWA 4YKGA 5IQYA 3GX8A 2RUFA 3GSSA 4N10A 4HZ2A 2HZFA 3DYRA 3FZ4A 3F4TA 5CP1A 2TIRA 3KEBA 4RQRA 2B7KA 2GGTA 2R4VA 4CW9A 3GKKA 2A2RA 4MF6A 2FNOA 4KSOA 2CAQA 3DD3A 4YKFA 4ID0A 3LEFA 4E8HA 1R7HA 1XWAA 2GSSA 4MLYA 2GSTA 3HKRA 3CSJA 3CBUA 3NZNA 5AIVA 4NV2A 3ZMLA 1O8WA 4L0UA 5GSTA 1GUHA 3APOA 1M7TA 3LSZA 5F05A 2XHFA 2QA1A 3IA1A 4CHSA 2L5OA 4OD7A 1VRSD 2N5AA 5JWRB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1PRX A;  2ON7 A;  2WUL A;  3LGC A;  2IWT A;  5CO3 A;  5HFK A;  2VL3 A;  1RW1 A;  3ZMK A;  5JCW A;  2H74 A;  3ZVJ A;  5JWO B;  4G9H A;  4HJM A;  6GSY A;  5DJM A;  1OE8 A;  4BWQ A;  4FO5 A;  5DCG A;  5CNW A;  2I3Y A;  4K7N A;  5G5F A;  5EPF A;  3C71 A;  1B9Y C;  4GRF A;  2JAD A;  2DSA A;  4HDE A;  19GS A;  11GS A;  3ZIV A;  2VCV A;  5HQP A;  5IIZ A;  5GAN D;  3EYT A;  1FB0 A;  1YEX A;  2HLS A;  4YH2 A;  5DDL A;  4J56 E;  1XOB A;  4WXT A;  4IP1 A;  2IPA A;  1SYX A;  5IOX A;  4O92 A;  5E4W A;  17GS A;  1AQW A;  1T8E B;  18GS A;  3W8S A;  1GRX A;  3I9V 2;  4DEJ A;  1A2L A;  2NTO A;  3G9B A;  4GST A;  4MK3 A;  4FYB A;  2CZ2 A;  1FAA A;  3RPP A;  1NHO A;  1XWG A;  1Q98 A;  5KN0 A;  4IP6 A;  3F3Q A;  5ECK B;  1HNB A;  2IN3 A;  2FY6 A;  5ECQ B;  2XPE A;  2C80 A;  4QL7 A;  4ECC A;  2HRF A;  4H86 A;  4L0W A;  4RI7 A;  3RHC A;  2K18 A;  3P90 A;  1GSU A;  5KN1 A;  1F3B A;  3TUE A;  5A4U A;  3UVT A;  4HU9 A;  4TW5 A;  5H5S A;  1FW1 A;  3TOU A;  4GQC A;  1DUG A;  2DJ1 A;  3BD2 A;  3VI7 A;  1CQH A;  2AYT A;  4X0X A;  2XBQ A;  2OA7 A;  2VD0 A;  2HFD A;  3VWW A;  3ZIJ A;  2K6V A;  2MMA A;  1X9S B;  1G7E A;  2F9S A;  5ECH B;  2VLT A;  2L6D A;  3HJP A;  1GNW A;  2C0F A;  2GTU A;  4MF7 A;  4ZBA A;  2FWE A;  1DBY A;  2V6O A;  1TI3 A;  4PUF C;  3O76 A;  4DSS B;  1TU7 A;  1GL8 A;  5DAK A;  4TR3 A;  1PKW A;  7GSS A;  3GRX A;  4TR0 A;  3EIN A;  1BQ7 A;  3HJO A;  5EL8 A;  3EU4 A;  2WCI A;  3IAM 2;  1GTB A;  4IBP A;  2WRT A;  2GQK A;  2C0G A;  2EIQ A;  1JZO A;  4QQ7 A;  3HY2 A;  2O7K A;  1TJD A;  2B7J A;  4V2L A;  3LQ7 A;  2LQO A;  1ACV A;  3D4M A;  6GST A;  3IR4 A;  1PN9 A;  3ME8 A;  1XCC A;  1Z7P A;  4L5O A;  1F2E A;  1FHE A;  2ALB A;  2H8L A;  1B9X C;  1Z3E A;  1GUK A;  4IW9 A;  4N11 A;  2VO4 A;  2XPD A;  5FWG A;  1O85 A;  2OBK A;  2VM1 A;  3DWV A;  1SYR A;  2IMD A;  1Z6M A;  2YWI A;  4EF0 A;  1USB A;  2O87 A;  3CSH A;  2KLX A;  3WGX A;  4NHZ A;  1IYH A;  2FA4 A;  1AQX A;  4GQF A;  4MZW A;  3IHQ A;  4WF4 A;  2H6Z A;  5DQS A;  1PX7 A;  5D73 A;  2L59 A;  1DE1 A;  4K1F A;  1K0B A;  4PX1 A;  5JWQ B;  2TRX A;  2FD3 A;  1AW9 A;  5CRD A;  1TXX A;  1S3D A;  1EOG A;  3ZFL A;  2B6M A;  2C3Q A;  1TK8 B;  1QGV A;  2LUS A;  2D2Z A;  1GSY A;  1VF1 A;  2KHP A;  5ID2 B;  1G6W A;  1B4Q A;  1UN2 A;  3ZRE A;  2V6K A;  4V1A g;  3TCO A;  5JCG A;  2HZE B;  3MWH A;  3M0F A;  3KM6 A;  2CQ9 A;  4ULX A;  3FEU A;  1PQN A;  5ECI B;  2YZU A;  1EP7 A;  4RUV A;  1M9A A;  3TJB A;  1GH2 A;  2E2M A;  4XS1 A;  4TVE A;  2HT9 A;  2DBC A;  3A2V A;  1AQV A;  3VPT A;  3BOA A;  2LRN A;  1URM A;  1G7O A;  1HD2 A;  2P5R A;  2JZT A;  4YAP A;  4MZB A;  4PXO A;  2DLX A;  4ZXG A;  2J9H A;  2HXK A;  4MDC A;  1KEB A;  1TK5 B;  3CXG A;  3VUR A;  2X8G A;  1B48 A;  4K8M A;  1V57 A;  4I2T A;  3N5O A;  3FR6 A;  2IJY A;  1WOU A;  3U6V A;  3IRA A;  2YJ7 A;  5IPG A;  3IDV A;  2FA8 A;  2AB6 A;  4YQV A;  4X1U A;  1A24 A;  2N5B A;  4ZBB A;  4EDZ A;  2JSY A;  2LRT A;  1FG4 A;  5J4U A;  1OAZ A;  1K3L A;  4G19 A;  3UJ1 A;  1AAZ A;  1GUL A;  1TDI A;  2IIY A;  4D73 B;  4NAX A;  1VGL A;  5IMA A;  2HSH A;  3HVS A;  4ACS A;  5B6M A;  1LBK A;  4K7I A;  1GP1 A;  4JU5 A;  3EWL A;  2GDR A;  5G1K A;  1FO5 A;  1JZD A;  4J57 E;  2R37 A;  3IBH A;  3F0I A;  5DQY A;  2B5X A;  3F8U A;  4KB3 A;  3HZ4 A;  2P5Q A;  2C4J A;  2B5E A;  4EXJ A;  2H1A A;  4DSS A;  4HQZ A;  1MDJ A;  3G7J A;  3DVW A;  2ZUP A;  3GL5 A;  1U3I A;  4ECB A;  4O32 A;  3FW2 A;  3LYK A;  1FVK A;  1F3A A;  3FZ9 A;  4TN8 A;  2C8U A;  2V1M A;  2YN1 A;  1VF2 A;  3KMO A;  2DMM A;  4MJB A;  2RM6 A;  1SL2 B;  4J2F A;  5D8I A;  1MDI A;  2ZNM A;  1O6J A;  5CRE A;  3F3R A;  3D4T A;  3GX0 A;  3A5W A;  1CQG A;  2WGR A;  1VF3 A;  3M3M A;  5FT3 A;  3G7I A;  2VD1 A;  2CT6 A;  2QSI A;  1ERV A;  4ECI A;  3H4K A;  2GZZ A;  3QFB C;  4MPG A;  2CVD A;  4MJA A;  4OFN A;  1XZO A;  1UA5 A;  2XBI A;  4FYU A;  1PX6 A;  4HS1 A;  1HYU A;  3I69 A;  5H5R A;  1BJX A;  3GN3 A;  3F4S A;  5LD0 A;  3MSZ A;  1PGT A;  2PVQ A;  2FHE A;  3LWA A;  4ILF A;  5B8A A;  2H70 A;  2PWJ A;  4Q5N A;  2LNS A;  3A2W A;  1PKZ A;  3DXB A;  3PR8 A;  1U88 A;  4EDY A;  1E6B A;  9GSS A;  2H0I A;  1SEN A;  5CYY A;  1SKW B;  3TKP A;  4IHU A;  4K7O A;  3E0U A;  2B1L A;  5ID2 A;  1SD8 A;  2CV4 A;  3ISO A;  4KX4 A;  4FYC A;  4JE1 A;  4OO4 A;  5IMD A;  4EUY A;  5ECM B;  2HZE A;  4KSM A;  2LJA A;  3RPN A;  3UEM A;  1OC3 A;  1U3A A;  2VIM A;  3GUS A;  2H66 A;  1J0F A;  4ML6 A;  4GLT A;  2L57 A;  1V98 A;  2H1D A;  1TRV A;  3ZZX A;  4AGS A;  1I5G A;  4ECJ A;  4TRX A;  2MBT A;  3VK9 A;  3HA9 A;  3HCZ A;  5D96 A;  2V32 A;  5IO0 A;  3WYW A;  1K3Y A;  1MEK A;  2H1B A;  2MMZ A;  1NHY A;  2JZR A;  2H6Y A;  3NOF A;  3EU3 A;  1V58 A;  4I6X A;  5G30 A;  1WMJ A;  2PN8 A;  4OWY A;  3UAP A;  3J7Y b;  1XPV A;  3TJJ A;  4NPB A;  2JU5 A;  1GSF A;  2PU9 C;  1M0U A;  2WJU A;  1N8J A;  2YV7 A;  3KD0 A;  3V1W A;  5F8B A;  2EC4 A;  3H93 A;  2H75 A;  1M2B A;  1YKC A;  5B8B A;  3US3 A;  4BWS A;  1RK4 A;  5J9C A;  1GLQ A;  2M72 A;  2H1G A;  1ST9 A;  4E8E A;  2VL9 A;  5ECS A;  1Z6N A;  1GSD A;  3KGK A;  3IC4 A;  5EY6 A;  3FRC A;  2H76 A;  1F6M C;  1W4V A;  1M2A A;  2JSZ A;  8GSS A;  2AAW A;  1XBS A;  1AIU A;  1YKA A;  4LMW A;  4N0V A;  4D73 A;  4KCA A;  1XIY A;  1JLV A;  1THO A;  1XVQ A;  4POM A;  1GTU A;  4AJ8 A;  4TXO A;  3APQ A;  4K2D A;  2LRC A;  3IOS A;  3L0H A;  4JR6 A;  4K0N A;  4NMU A;  1B4P A;  4Z7X A;  3VI5 A;  1EEM A;  3C7M A;  2YJH A;  2CZ3 A;  4MPF A;  1F37 A;  5D93 A;  2DIZ A;  4WR4 A;  1GSE A;  3GHA A;  3JCM L;  1SK2 A;  2FWG A;  1XFL A;  1WE0 A;  2VCQ A;  2OJL A;  1QUW A;  5D9T A;  4IQ1 A;  3IK9 A;  1JHB A;  1AC1 A;  4TKY A;  4HOJ A;  3LYP A;  5G31 A;  1YZX A;  3UVH A;  4F0B A;  3EMP A;  1MD4 A;  2HYX A;  1A0F A;  4TOP A;  2YV9 A;  2LTK A;  1QXH A;  5CRG A;  1TRS A;  2B3S A;  5D9W A;  4BVX A;  4CDO A;  4IVF A;  2M46 A;  3IAS 2;  5IMF A;  4HEA 2;  3CRT A;  1JZW A;  1R5P A;  1FVJ A;  5COH A;  4HZ4 A;  6GSX A;  2BJX A;  3WGD A;  1HQO A;  3ERW A;  3KP9 A;  1XXU A;  2X64 A;  5IMC A;  2DJ2 A;  1X5C A;  3RAZ A;  3GNJ A;  4WR5 A;  3DIE A;  3SBC A;  1G0T A;  4JRR A;  3UMA A;  1EGO A;  5HR2 A;  3R2Q A;  4KDY A;  2Z9S A;  1V2A A;  4TR4 A;  1PA3 A;  3FHK A;  2PMT A;  1DSB A;  1ZOF A;  3GFK A;  4XTS A;  4PNG A;  3VWX A;  2H71 A;  1X5D A;  2CVB A;  1K0C A;  1O8X A;  2IL3 A;  3GH6 A;  3UIW A;  5J41 A;  4XRA A;  6GSV A;  4KH7 A;  3ZTL A;  1XWK A;  4RI6 A;  2NVL A;  4PQ1 A;  1N2A A;  3WGE A;  1O73 A;  3D22 A;  2GSQ A;  1T4Y A;  4NHW A;  3EE2 A;  5E59 A;  5IO2 A;  2VCX A;  2VCT A;  4WBR D;  22GS A;  3F9U A;  3FR9 A;  3W6G A;  2R3X A;  3FKF A;  3MAK A;  1EOH A;  5INY A;  3TRX A;  1YF1 A;  3HHV A;  4NWY A;  4ZIL A;  4DSQ A;  4HU7 A;  4KDU A;  4KGI A;  2LKU A;  5HFI A;  3P7X A;  2H6X A;  1MDK A;  4ML1 A;  3QR6 A;  1X0R A;  5GAP D;  2VL2 C;  5HFG A;  6GSS A;  4JR4 A;  2CA8 A;  3D0Z A;  1FB6 A;  3ZRD A;  3CYN A;  1K3O A;  1XW5 A;  3CTF A;  4GSS A;  1JLW A;  6GSW A;  2JL4 A;  2B1K A;  4MA9 A;  1LU4 A;  5KN2 A;  2AV4 A;  5HR1 A;  4OFT A;  1GNE A;  5CRH A;  1ILO A;  2IMK A;  4N30 A;  1XVW A;  4XS4 B;  5D9V A;  1A2J A;  3TGZ A;  3ZL5 A;  2MYG A;  2CVK A;  1J08 A;  3HZ8 A;  2PBJ A;  1ON4 A;  3E3E A;  3ED3 A;  1H4O A;  5AGY A;  16GS A;  1EGR A;  2E0Q A;  2GT5 A;  4IGJ A;  5GSS A;  2LV3 A;  4XIH A;  1V9W A;  1K0O A;  4F2I A;  3L4N A;  3O6T A;  2FGX A;  1GTI A;  2X8C A;  1A8L A;  2G2Q A;  1KTE A;  1GTA A;  2FCH A;  2LS5 A;  4WET A;  3ZIT A;  1WWJ A;  1TRU A;  1JZR A;  3DKS A;  4G2E A;  5KN3 A;  2C0E A;  2JZS A;  2PER A;  3MNG A;  4GXZ A;  2QKE A;  2QC7 A;  1M2D A;  5ELA A;  3K8N A;  4MJC A;  1Z5Y E;  2C0D A;  5DBQ A;  1YDK A;  1W89 A;  4OCF A;  3OR5 A;  3GV1 A;  3S9F A;  2LEG A;  4P3Y B;  3TKS E;  2PUK C;  1GSS A;  20GS A;  3U5R E;  5H5Q A;  2EIR A;  1T00 A;  4DVC A;  1ERT A;  3ME7 A;  2F3M A;  1HNC A;  1YY7 A;  2LQQ A;  2TRC P;  1R26 A;  2YWO A;  3WD6 A;  2MMO A;  2YOI A;  1GSQ A;  1UVZ A;  5A5K A;  1O7U A;  1Z7R A;  3GKN A;  2GZY A;  4IQA A;  2LST A;  2RII A;  1BG5 A;  3LXZ A;  4ZB6 A;  4TXO B;  2VL2 A;  3TB2 A;  5AIS A;  1WRY A;  2RLI A;  4NV5 A;  2KP1 A;  1QQ2 A;  4K9Z A;  1I9D A;  3M8N A;  2X99 A;  3UBL A;  3TRP A;  2YWN A;  1J9B A;  1JFU A;  3L78 A;  2VLV A;  4L5L A;  5G5E A;  3HVX A;  6GSU A;  2PPT A;  3ERF A;  3LXT A;  5HR3 A;  5HR0 A;  1FOV A;  1KNG A;  2GT6 A;  2IFQ B;  2LNT A;  5F0G A;  1SL0 B;  3ERG A;  3G7Y A;  2R6K A;  1RQM A;  5JCU A;  3GKM A;  2OAC A;  2PVO C;  1K0M A;  4LL4 B;  2C3T A;  4OFM A;  3E9J B;  2LJR A;  3QPM A;  5DCH A;  3I43 A;  4TXV A;  1XWB A;  3LJR A;  1DE2 A;  3FYG A;  2XC2 A;  2N5F A;  1BED A;  1GUM A;  1E2Y A;  2FUG 2;  2AJQ B;  2YAN A;  1SJZ A;  1SKR B;  3L9U A;  1SK1 A;  4F0C A;  1XWC A;  4PQI A;  5ENU A;  2GQM A;  4KW6 A;  1OC8 A;  3VFI A;  4F82 A;  4ZL9 A;  2OAD A;  4TR1 B;  1SL1 B;  2R5G A;  2FLS A;  3HDC A;  3VWV A;  3AY8 A;  5G2Z A;  3FK8 A;  3N9J A;  3WT2 A;  2ES7 A;  3GIX A;  5D9X A;  2KP2 A;  4ISD A;  4I2U A;  3ZLP A;  2K8V A;  2VCZ A;  4MH3 A;  5KEJ A;  3LOR A;  5AIX A;  1QK8 A;  4EVM A;  2C1Y A;  4KDX A;  13GS A;  1T1V A;  4X43 A;  3GTU B;  4GCI A;  4BVY A;  1SK0 A;  3EVI A;  4XS4 A;  4DSR A;  3L9V A;  1GWC A;  2O8V B;  1ZYE A;  3GH9 A;  2GZP A;  1WPI A;  3EUR A;  4ZL7 A;  2H30 A;  2MBS A;  1SKS B;  2DC5 A;  3KZQ A;  3TKQ A;  2YP6 A;  2OBI A;  1OVN A;  2KUC A;  5IM9 A;  4LL1 B;  2WS2 A;  3TJG A;  1EWX A;  2WDU A;  3GKX A;  4MCU A;  4O7H A;  3QAG A;  1WIK A;  3RBT A;  1ZYQ B;  4L8E A;  3CTG A;  1ZCP A;  1HNA A;  4POK A;  3HVV A;  3TJF A;  1R5A A;  4HUA A;  3Q18 A;  2CAI A;  3O3T A;  2HRN A;  1T3B A;  4EL1 A;  2DJ3 A;  1ZZY A;  4AF2 A;  2IMF A;  4HI7 A;  2I81 A;  4ZB9 A;  2OE1 A;  1NW2 A;  3IPZ A;  2L4Q A;  3KTB A;  2E2G A;  3QFA C;  1MD3 A;  2R2J A;  2K8S A;  3MDK A;  5DAL B;  4I97 A;  3QCP A;  2MZC A;  1YJ6 A;  3ZFB A;  4WEY A;  3L9S A;  3QMX A;  2DIY A;  3DGQ A;  2L6C A;  2H73 A;  1AXD A;  3QDN A;  4YQU A;  3IV4 A;  3GYK A;  2KOK A;  4Q5Q A;  4MF5 A;  3W8J A;  2VAF A;  1IYI A;  2DJJ A;  1WP0 A;  1A2M A;  5EVO A;  3TRQ A;  2PGT A;  3D5J A;  3UAR A;  2IME A;  4NXI A;  1EV9 A;  4IJ3 A;  4IS0 A;  3M9J A;  4V2N A;  14GS A;  5IPH A;  4MP4 A;  2DJK A;  1BYE A;  2O89 A;  5J9B A;  4XRD A;  4KUN A;  2CX3 A;  3BCI A;  1ZGN A;  3DML A;  5ECN B;  4ZL8 A;  2CX4 A;  2V2G A;  3QAV A;  3D6I A;  1V40 A;  3VWU A;  4IKH A;  4MZC A;  3H8Q A;  2REM A;  1KBN A;  2LJK A;  2IFQ A;  2L5L A;  3KP8 A;  3ZYW A;  1OKT A;  4AJ7 A;  2MMN A;  4KE3 A;  3IK7 A;  1EV4 A;  1Y6E A;  3NIV A;  3DEX A;  3KJY A;  5A4V A;  1OC9 B;  1S3C A;  4LA1 A;  2P31 A;  1ABA A;  2F8F A;  2YWM A;  2FWH A;  2YNX A;  2GVP A;  2A2S A;  3F63 A;  4K0G A;  1TP9 A;  4TR1 A;  3TDG A;  2P0G A;  1SD9 A;  2K9F A;  2E7P A;  4Q5F A;  1K0D A;  4GF0 A;  4MMM A;  3KMN A;  2HNL A;  2BMX A;  2OE3 A;  3C8E A;  2WB9 A;  2F8A A;  3GL3 A;  4AJ6 A;  1F9M A;  5L71 A;  4XS6 A;  1WJK A;  1B8X A;  1QFN A;  4IJI A;  1UC7 A;  2BTO T;  2FWF A;  1TK0 B;  3GTU A;  5IOW A;  2H72 A;  2H01 A;  2RM5 A;  4WKW A;  1M9B A;  2B5Y A;  10GS A;  3KH7 A;  3TJK A;  4KCE A;  4ZB8 A;  3BJ5 A;  4FIW A;  3H1N A;  1TW9 A;  4KA0 A;  5C00 A;  4XHM A;  3APS A;  1LJR A;  1ML6 A;  2OKA A;  4JED A;  4PNF A;  4Q5R A;  3Q19 A;  3DRN A;  1K0N A;  3Q6O A;  1X9M B;  2WZ9 A;  1G6Y A;  3TKS C;  3A3T A;  5DJL A;  3BBY A;  3TOT A;  3WT1 A;  1A8Y A;  4EC0 A;  4F9Z A;  3PH9 A;  4I5Q A;  5ELG A;  4ZBD A;  1OYJ A;  5ECP B;  1GLP A;  1BAY A;  3M1G A;  4OCE A;  2O85 A;  2GQL A;  1XW6 A;  4PQH A;  2VM2 A;  4O5R A;  4GWR A;  4HQS A;  1EP8 A;  2X8H A;  5DAL A;  2H19 A;  1MTC A;  2M80 A;  1PL2 A;  4YQM A;  1T4Z A;  1Q4J A;  4LLR A;  1BX9 A;  1XOA A;  3HD5 A;  3PGT A;  4BA7 A;  3GMF A;  3VLN A;  4OMV A;  4WBJ A;  3DVX A;  3D21 A;  3I6A A;  1U87 A;  1X5E A;  1AUC A;  5A4W A;  2VUP A;  1ERU A;  5C04 A;  4FH8 A;  1Z9H A;  2IMI A;  1TU8 A;  5CRW A;  4BPY A;  5DVB A;  1S3A A;  2NBS A;  3SWL A;  1TI1 A;  3TKR A;  4JBB A;  3IXR A;  3C1R A;  2YCD A;  2YZH A;  4OO5 A;  3EMX A;  2I1U A;  4BL7 A;  3RDW A;  1XW9 A;  5F07 A;  5B7C A;  1TOF A;  3IE3 A;  4MH2 A;  1TTZ A;  2NPB A;  1M99 A;  3EC3 A;  4WF5 A;  3GUR A;  4PUR A;  1ZMA A;  4MAB A;  1YEP A;  1TKD B;  3GST A;  1EEJ A;  5CAX A;  1YF0 A;  4IN0 A;  3HXS A;  1T7P B;  3UL3 A;  3RHB A;  3BCK A;  2G0F A;  1O81 A;  3TKS A;  5ECR B;  5GZZ B;  1A0R P;  1PD2 1;  4POB A;  4QL9 A;  2V41 A;  1ZL9 A;  3KH9 A;  1A23 A;  4EE0 A;  5IMZ A;  1OC9 A;  1K0A A;  2QGV A;  2F51 A;  1THX A;  3CRU A;  2GLR A;  4POL A;  3FZ5 A;  2DML A;  1OKD A;  2I9H A;  1OE7 A;  1R4W A;  3A2X A;  4G10 A;  2J23 A;  3GA4 A;  3QAW A;  1TRW A;  4LMV A;  4EO3 A;  2HE3 A;  5LNK e;  5G1L A;  1ERW A;  5J3R A;  4N0Z A;  4KAE A;  3KTL A;  2VOC A;  2YPM A;  5ABR A;  3P2A A;  2C3N A;  4ZIJ A;  4KND A;  2VCW A;  3F6D A;  4V1A p;  3F4R A;  3HYP A;  2GSR A;  2I4A A;  2JAC A;  5LCZ A;  3PIN A;  3FZA A;  3C1S A;  1Y25 A;  4GTU A;  3ZVJ D;  3UOM A;  1PMT A;  1C72 A;  2VLU A;  3Q74 A;  5B6N A;  2WFC A;  3H79 A;  2GS3 A;  3QD9 A;  2ON5 A;  5F06 A;  5ECL B;  3C73 A;  12GS A;  2EIO A;  1X9W B;  4V2M A;  2RUE A;  1SJ6 A;  5IMV A;  2DJ0 A;  3KIJ A;  1PSQ A;  2OE0 A;  3CMI A;  1PL1 A;  4F03 A;  2ZCT A;  4I8B A;  3KCM A;  3J7Y k;  4GSN A;  3P8W A;  4XCS A;  2L4C A;  3M9K A;  3QOU A;  1NM3 A;  1H75 A;  3LG6 A;  2HSY A;  3VPQ A;  1SJI A;  4MJE A;  1SU9 A;  1U6T A;  2AHE A;  1QMV A;  3LFL A;  3KXO A;  3FY7 A;  1VF4 A;  4K6X A;  5J5N A;  4HJ2 A;  4PGT A;  3HJM A;  2NDO A;  2A4V A;  2H0H A;  2H0G A;  4JZQ A;  3F6F A;  4RQX A;  2AUV A;  3FR3 A;  4EKZ A;  2HI7 A;  5AN1 A;  4PUA A;  3UBK A;  3CSI A;  1YQ1 A;  5FHI A;  5DAK B;  5ECO B;  4IEL A;  4YAV A;  1EZK A;  1NSW A;  5IQY A;  3GX8 A;  2RUF A;  3GSS A;  4N10 A;  4HZ2 A;  2HZF A;  3DYR A;  3FZ4 A;  3F4T A;  5CP1 A;  2TIR A;  3KEB A;  4RQR A;  2B7K A;  2GGT A;  2R4V A;  4CW9 A;  3GKK A;  2A2R A;  4MF6 A;  2FNO A;  4KSO A;  2CAQ A;  3DD3 A;  4ID0 A;  3LEF A;  4E8H A;  1R7H A;  1XWA A;  2GSS A;  4MLY A;  2GST A;  3HKR A;  3CSJ A;  3CBU A;  3NZN A;  5AIV A;  4NV2 A;  3ZML A;  1O8W A;  4L0U A;  5GST A;  1GUH A;  3APO A;  1M7T A;  3LSZ A;  5F05 A;  2XHF A;  3IA1 A;  4CHS A;  2L5O A;  4OD7 A;  1VRS D;  2N5A A;  5JWR B; 
#chains in the Genus database with same CATH topology
 1PRX A;  2ON7 A;  2WUL A;  3LGC A;  2IWT A;  5CO3 A;  5HFK A;  2VL3 A;  1RW1 A;  3ZMK A;  5JCW A;  2H74 A;  3ZVJ A;  5JWO B;  4G9H A;  4HJM A;  6GSY A;  5DJM A;  1OE8 A;  4BWQ A;  4FO5 A;  5DCG A;  5CNW A;  2I3Y A;  4K7N A;  5G5F A;  5EPF A;  3C71 A;  1B9Y C;  4GRF A;  2JAD A;  2DSA A;  4HDE A;  19GS A;  11GS A;  3ZIV A;  2VCV A;  5HQP A;  5IIZ A;  5GAN D;  3EYT A;  1FB0 A;  1YEX A;  2HLS A;  4YH2 A;  5DDL A;  4J56 E;  1XOB A;  4WXT A;  4IP1 A;  2IPA A;  1SYX A;  5IOX A;  4O92 A;  5E4W A;  17GS A;  1AQW A;  1T8E B;  18GS A;  3W8S A;  1GRX A;  3I9V 2;  4DEJ A;  1A2L A;  2NTO A;  3G9B A;  4GST A;  4MK3 A;  4FYB A;  2CZ2 A;  1FAA A;  3RPP A;  1NHO A;  1XWG A;  1Q98 A;  5KN0 A;  4IP6 A;  3F3Q A;  5ECK B;  1HNB A;  2IN3 A;  2FY6 A;  5ECQ B;  2XPE A;  2C80 A;  4QL7 A;  4ECC A;  2HRF A;  4H86 A;  4L0W A;  4RI7 A;  3RHC A;  2K18 A;  3P90 A;  1GSU A;  5KN1 A;  1F3B A;  3TUE A;  5A4U A;  3UVT A;  4HU9 A;  4TW5 A;  5H5S A;  1FW1 A;  3TOU A;  4GQC A;  1DUG A;  2DJ1 A;  3BD2 A;  3VI7 A;  1CQH A;  4O5Q A;  2AYT A;  4X0X A;  2XBQ A;  2OA7 A;  2VD0 A;  2HFD A;  3VWW A;  3ZIJ A;  2K6V A;  2MMA A;  1X9S B;  1G7E A;  2F9S A;  5ECH B;  2VLT A;  2L6D A;  3HJP A;  1GNW A;  2C0F A;  2GTU A;  4MF7 A;  4ZBA A;  2FWE A;  1DBY A;  2V6O A;  1TI3 A;  4PUF C;  3O76 A;  4DSS B;  1TU7 A;  2HRK A;  1GL8 A;  5DAK A;  4TR3 A;  1PKW A;  7GSS A;  3GRX A;  4TR0 A;  3EIN A;  1BQ7 A;  3HJO A;  5EL8 A;  3EU4 A;  2WCI A;  3IAM 2;  1GTB A;  4IBP A;  2WRT A;  2GQK A;  2C0G A;  2EIQ A;  1JZO A;  4QQ7 A;  3HY2 A;  2O7K A;  1TJD A;  2B7J A;  3FMW A;  4V2L A;  3LQ7 A;  2LQO A;  1ACV A;  3D4M A;  6GST A;  3IR4 A;  1PN9 A;  3ME8 A;  1XCC A;  1Z7P A;  4L5O A;  1F2E A;  1FHE A;  2ALB A;  2H8L A;  1B9X C;  1Z3E A;  1GUK A;  4IW9 A;  4N11 A;  2VO4 A;  2XPD A;  5FWG A;  1O85 A;  2OBK A;  2VM1 A;  3DWV A;  1SYR A;  2IMD A;  1Z6M A;  2YWI A;  4EF0 A;  1USB A;  2O87 A;  3CSH A;  2KLX A;  3WGX A;  4NHZ A;  1IYH A;  5BRT A;  2FA4 A;  1AQX A;  4GQF A;  4MZW A;  3IHQ A;  4WF4 A;  2H6Z A;  5DQS A;  1PX7 A;  5D73 A;  2L59 A;  1DE1 A;  4K1F A;  1K0B A;  4PX1 A;  5JWQ B;  2TRX A;  2FD3 A;  1AW9 A;  1M3I A;  5CRD A;  1TXX A;  1S3D A;  3LW9 A;  1EOG A;  3ZFL A;  2B6M A;  2C3Q A;  1TK8 B;  1QGV A;  2LUS A;  5KOX A;  2D2Z A;  1GSY A;  1VF1 A;  2KHP A;  5ID2 B;  1G6W A;  1B4Q A;  1UN2 A;  3ZRE A;  2V6K A;  4V1A g;  3TCO A;  5JCG A;  2HZE B;  3MWH A;  3M0F A;  3KM6 A;  2CQ9 A;  4ULX A;  3FEU A;  1PQN A;  5ECI B;  2YZU A;  1EP7 A;  4RUV A;  1M9A A;  3TJB A;  1GH2 A;  2E2M A;  4XS1 A;  4TVE A;  2HT9 A;  2DBC A;  3A2V A;  1AQV A;  3VPT A;  3BOA A;  2LRN A;  1URM A;  1G7O A;  4HSC X;  1HD2 A;  2P5R A;  2JZT A;  4YAP A;  4MZB A;  4PXO A;  2DLX A;  4ZXG A;  2J9H A;  2HXK A;  4MDC A;  1KEB A;  3R3E A;  1TK5 B;  3CXG A;  3VUR A;  2X8G A;  1B48 A;  4K8M A;  1V57 A;  4I2T A;  3N5O A;  3FR6 A;  2IJY A;  1WOU A;  3U6V A;  3IRA A;  2YJ7 A;  5IPG A;  3IDV A;  2FA8 A;  2AB6 A;  4YQV A;  4X1U A;  1A24 A;  2N5B A;  4ZBB A;  4EDZ A;  2JSY A;  2LRT A;  1FG4 A;  5J4U A;  1OAZ A;  1K3L A;  4G19 A;  3UJ1 A;  1AAZ A;  1GUL A;  3MIX A;  1TDI A;  2IIY A;  4D73 B;  4NAX A;  1VGL A;  5IMA A;  2HSH A;  3HVS A;  4ACS A;  5B6M A;  1LBK A;  4K7I A;  1GP1 A;  4JU5 A;  3EWL A;  2GDR A;  5G1K A;  1FO5 A;  1JZD A;  4J57 E;  2R37 A;  3IBH A;  3F0I A;  5DQY A;  2B5X A;  3F8U A;  4KB3 A;  3HZ4 A;  2P5Q A;  2C4J A;  2B5E A;  4EXJ A;  2H1A A;  4DSS A;  4HQZ A;  4K2X A;  1MDJ A;  3G7J A;  3DVW A;  2ZUP A;  3GL5 A;  1U3I A;  4ECB A;  4O32 A;  3FW2 A;  3LYK A;  1FVK A;  1F3A A;  3FZ9 A;  4TN8 A;  2C8U A;  2V1M A;  2YN1 A;  1VF2 A;  3KMO A;  2DMM A;  4MJB A;  2RM6 A;  1SL2 B;  4J2F A;  5D8I A;  1MDI A;  2ZNM A;  1O6J A;  4BVX B;  5CRE A;  3F3R A;  3D4T A;  3GX0 A;  3A5W A;  3IC8 A;  1CQG A;  2WGR A;  1VF3 A;  3M3M A;  2HSM A;  5FT3 A;  3G7I A;  2VD1 A;  2DKI A;  2CT6 A;  2QSI A;  4CY6 A;  1ERV A;  4ECI A;  3H4K A;  2GZZ A;  3QFB C;  4MPG A;  2CVD A;  4MJA A;  4OFN A;  1XZO A;  1UA5 A;  2XBI A;  4FYU A;  1PX6 A;  4HS1 A;  1HYU A;  3I69 A;  5H5R A;  4G0I A;  4EIP A;  1BJX A;  3GN3 A;  3F4S A;  5LD0 A;  3MSZ A;  1PGT A;  2PVQ A;  2FHE A;  3LWA A;  4ILF A;  5B8A A;  2H70 A;  2PWJ A;  4Q5N A;  2LNS A;  3A2W A;  1PKZ A;  3DXB A;  3PR8 A;  1U88 A;  4EDY A;  1E6B A;  9GSS A;  2H0I A;  1SEN A;  5CYY A;  1SKW B;  3TKP A;  4IHU A;  4K7O A;  3E0U A;  2B1L A;  5ID2 A;  1SD8 A;  2CV4 A;  3ISO A;  4KX4 A;  4FYC A;  4Z2U A;  4JE1 A;  4OO4 A;  5IMD A;  4EUY A;  5ECM B;  2HZE A;  4KSM A;  2LJA A;  3RPN A;  3UEM A;  1OC3 A;  1U3A A;  2VIM A;  3GUS A;  4CY8 A;  2H66 A;  1J0F A;  4ML6 A;  4GLT A;  2L57 A;  1V98 A;  2H1D A;  1TRV A;  3ZZX A;  4PTS A;  4AGS A;  1I5G A;  4ECJ A;  4TRX A;  2MBT A;  3VK9 A;  3HA9 A;  3HCZ A;  5D96 A;  2V32 A;  5IO0 A;  3WYW A;  1K3Y A;  1MEK A;  2A2P A;  2H1B A;  1NHY A;  2MMZ A;  2JZR A;  2H6Y A;  3NOF A;  3EU3 A;  2R0G A;  1V58 A;  4I6X A;  5G30 A;  3EPT A;  1WMJ A;  2PN8 A;  4OWY A;  3UAP A;  3J7Y b;  1XPV A;  3TJJ A;  4NPB A;  2JU5 A;  1GSF A;  2PU9 C;  1M0U A;  2WJU A;  1N8J A;  2YV7 A;  3KD0 A;  3V1W A;  5F8B A;  2EC4 A;  3H93 A;  2A4H A;  2H75 A;  1M2B A;  1YKC A;  5B8B A;  3US3 A;  4BWS A;  1RK4 A;  5J9C A;  1GLQ A;  2M72 A;  2H1G A;  1ST9 A;  4E8E A;  2VL9 A;  5ECS A;  1Z6N A;  1GSD A;  3KGK A;  3IC4 A;  5EY6 A;  3FRC A;  2H76 A;  1F6M C;  1W4V A;  1M2A A;  2JSZ A;  8GSS A;  2AAW A;  1XBS A;  1AIU A;  1YKA A;  4LMW A;  4N0V A;  4D73 A;  4KCA A;  1XIY A;  2R0P A;  1JLV A;  1THO A;  1XVQ A;  4POM A;  1GTU A;  4AJ8 A;  4TXO A;  3APQ A;  4K2D A;  2LRC A;  3IOS A;  3L0H A;  4JR6 A;  4K0N A;  4NMU A;  1B4P A;  4Z7X A;  3VI5 A;  1EEM A;  3C7M A;  2YJH A;  2CZ3 A;  4MPF A;  1S3R A;  1F37 A;  5D93 A;  2DIZ A;  4WR4 A;  1GSE A;  3GHA A;  3JCM L;  1SK2 A;  2FWG A;  1XFL A;  1WE0 A;  2VCQ A;  2OJL A;  1QUW A;  5D9T A;  4IQ1 A;  3IK9 A;  1JHB A;  1AC1 A;  4TKY A;  4HOJ A;  3LYP A;  5G31 A;  1YZX A;  3UVH A;  4F0B A;  3EMP A;  1MD4 A;  2HYX A;  1A0F A;  4TOP A;  2YV9 A;  2LTK A;  1QXH A;  5CRG A;  1TRS A;  2B3S A;  5D9W A;  4BVX A;  4CDO A;  4IVF A;  2M46 A;  3IAS 2;  5IMF A;  4HEA 2;  3CRT A;  1JZW A;  1R5P A;  1FVJ A;  5COH A;  4HZ4 A;  6GSX A;  2BJX A;  3WGD A;  1HQO A;  3ERW A;  3KP9 A;  1XXU A;  2X64 A;  5IMC A;  2DJ2 A;  4FQU A;  1X5C A;  3RAZ A;  3GNJ A;  4WR5 A;  3DIE A;  3SBC A;  1G0T A;  4JRR A;  3UMA A;  1EGO A;  5HR2 A;  3R2Q A;  4KDY A;  2Z9S A;  1V2A A;  4TR4 A;  1PA3 A;  3FHK A;  2PMT A;  1DSB A;  1ZOF A;  3GFK A;  4XTS A;  4PNG A;  3VWX A;  2H71 A;  1X5D A;  2CVB A;  1K0C A;  1O8X A;  2IL3 A;  3GH6 A;  3UIW A;  5J41 A;  4XRA A;  6GSV A;  4KH7 A;  3ZTL A;  1XWK A;  4RI6 A;  2NVL A;  4PQ1 A;  1N2A A;  3WGE A;  1O73 A;  3D22 A;  2GSQ A;  1T4Y A;  3CQF A;  4NHW A;  3EE2 A;  5E59 A;  5IO2 A;  1FOH A;  2VCX A;  2VCT A;  4WBR D;  22GS A;  3F9U A;  3FR9 A;  3W6G A;  2R3X A;  3FKF A;  3MAK A;  1EOH A;  5INY A;  3TRX A;  1YF1 A;  3HHV A;  4NWY A;  4ZIL A;  4DSQ A;  4HU7 A;  4KDU A;  4KGI A;  2LKU A;  5HFI A;  3P7X A;  2H6X A;  4K5R A;  1MDK A;  4ML1 A;  3QR6 A;  1X0R A;  5GAP D;  2VL2 C;  5HFG A;  6GSS A;  4JR4 A;  2CA8 A;  1ZYN A;  1PN0 A;  3D0Z A;  1FB6 A;  3ZRD A;  3CYN A;  1K3O A;  1XW5 A;  3CTF A;  4GSS A;  1JLW A;  6GSW A;  2JL4 A;  2B1K A;  4MA9 A;  1LU4 A;  5KN2 A;  2AV4 A;  5HR1 A;  4OFT A;  1GNE A;  5CRH A;  1ILO A;  2IMK A;  4N30 A;  1XVW A;  4XS4 B;  5D9V A;  1A2J A;  3TGZ A;  3ZL5 A;  2MYG A;  2CVK A;  1J08 A;  3HZ8 A;  2PBJ A;  1ON4 A;  3E3E A;  3ED3 A;  1H4O A;  5AGY A;  16GS A;  1EGR A;  2E0Q A;  4ICY A;  2GT5 A;  4IGJ A;  5GSS A;  2LV3 A;  4XIH A;  1V9W A;  1K0O A;  4F2I A;  3L4N A;  3O6T A;  2FGX A;  1GTI A;  2X8C A;  1A8L A;  2G2Q A;  1KTE A;  1GTA A;  2FCH A;  2LS5 A;  4WET A;  3ZIT A;  1WWJ A;  1TRU A;  1JZR A;  2X49 A;  3DKS A;  4G2E A;  5KN3 A;  2C0E A;  2JZS A;  2PER A;  3MNG A;  4GXZ A;  2QKE A;  2QC7 A;  1M2D A;  5ELA A;  3K8N A;  4MJC A;  1Z5Y E;  2C0D A;  5DBQ A;  1YDK A;  1W89 A;  4G0L A;  4OCF A;  3OR5 A;  3GV1 A;  3S9F A;  2LEG A;  4P3Y B;  3TKS E;  2PUK C;  1GSS A;  20GS A;  3U5R E;  5H5Q A;  2EIR A;  1T00 A;  4DVC A;  1ERT A;  3ME7 A;  2F3M A;  1HNC A;  1YY7 A;  2LQQ A;  2TRC P;  1R26 A;  2YWO A;  3WD6 A;  2MMO A;  2YOI A;  1GSQ A;  1UVZ A;  5A5K A;  1O7U A;  1Z7R A;  3GKN A;  2GZY A;  4IQA A;  2LST A;  2RII A;  1BG5 A;  3LXZ A;  4ZB6 A;  4TXO B;  2VL2 A;  3TB2 A;  5AIS A;  1WRY A;  2RLI A;  4NV5 A;  2KP1 A;  1QQ2 A;  4K9Z A;  1I9D A;  3M8N A;  2X99 A;  3UBL A;  3TRP A;  2YWN A;  1J9B A;  1JFU A;  3L78 A;  2VLV A;  4L5L A;  5G5E A;  3HVX A;  6GSU A;  2PPT A;  3ERF A;  3LXT A;  5HR3 A;  1PFO A;  5HR0 A;  1FOV A;  1KNG A;  2GT6 A;  2IFQ B;  2LNT A;  5F0G A;  1SL0 B;  3ERG A;  5BMU A;  3G7Y A;  2R6K A;  1RQM A;  5JCU A;  2DKH A;  3GKM A;  2OAC A;  2PVO C;  1K0M A;  4LL4 B;  2C3T A;  4OFM A;  3E9J B;  2LJR A;  3QPM A;  5DCH A;  3I43 A;  4TXV A;  1XWB A;  3LJR A;  1DE2 A;  3FYG A;  2XC2 A;  2HRA A;  2N5F A;  1BED A;  1GUM A;  1E2Y A;  2FUG 2;  2AJQ B;  2YAN A;  1SJZ A;  1SKR B;  3L9U A;  1SK1 A;  4F0C A;  1XWC A;  4PQI A;  5ENU A;  2GQM A;  4KW6 A;  1OC8 A;  3VFI A;  4F82 A;  4ZL9 A;  2OAD A;  4TR1 B;  1SL1 B;  2R5G A;  2FLS A;  3HDC A;  3VWV A;  3AY8 A;  5G2Z A;  3FK8 A;  3N9J A;  1ZYP A;  4EIQ A;  3WT2 A;  2ES7 A;  3GIX A;  5D9X A;  2KP2 A;  2UZ8 A;  4ISD A;  4I2U A;  3ZLP A;  2K8V A;  2VCZ A;  4MH3 A;  5KEJ A;  3LOR A;  5AIX A;  1QK8 A;  4EVM A;  2C1Y A;  4KDX A;  13GS A;  1T1V A;  4X43 A;  3GTU B;  3MYD A;  4GCI A;  4BVY A;  1SK0 A;  3EVI A;  4XS4 A;  4DSR A;  3L9V A;  1GWC A;  2O8V B;  1ZYE A;  3GH9 A;  2GZP A;  1WPI A;  3A5I A;  3EUR A;  4ZL7 A;  2H30 A;  2MBS A;  1SKS B;  2DC5 A;  3KZQ A;  3TKQ A;  2YP6 A;  2OBI A;  1OVN A;  2KUC A;  5IM9 A;  4LL1 B;  2WS2 A;  3TJG A;  1EWX A;  2WDU A;  3GKX A;  4MCU A;  4O7H A;  3QAG A;  1WIK A;  3RBT A;  1ZYQ B;  4L8E A;  3CTG A;  1ZCP A;  1HNA A;  4POK A;  3HVV A;  3TJF A;  1R5A A;  4HUA A;  3Q18 A;  2CAI A;  3O3T A;  2HRN A;  1T3B A;  4EL1 A;  2DJ3 A;  1ZZY A;  4AF2 A;  2IMF A;  4HI7 A;  2I81 A;  4ZB9 A;  2OE1 A;  1NW2 A;  3IPZ A;  2L4Q A;  3KTB A;  2E2G A;  3QFA C;  1MD3 A;  2R2J A;  2K8S A;  3MDK A;  5DAL B;  4I97 A;  3QCP A;  2MZC A;  1YJ6 A;  3ZFB A;  4WEY A;  3L9S A;  3QMX A;  2DIY A;  3DGQ A;  2L6C A;  2H73 A;  1AXD A;  3QDN A;  4YQU A;  3IV4 A;  3GYK A;  2KOK A;  4Q5Q A;  4MF5 A;  3W8J A;  2VAF A;  1IYI A;  2DJJ A;  1WP0 A;  1A2M A;  5EVO A;  3TRQ A;  2PGT A;  3D5J A;  3UAR A;  2IME A;  4NXI A;  1EV9 A;  4IJ3 A;  4IS0 A;  3M9J A;  4V2N A;  14GS A;  5IPH A;  4MP4 A;  2DJK A;  1BYE A;  2O89 A;  4X4J A;  5J9B A;  4XRD A;  4KUN A;  2CX3 A;  3BCI A;  1ZGN A;  3DML A;  5ECN B;  4ZL8 A;  2CX4 A;  2V2G A;  3QAV A;  3D6I A;  4BL7 B;  1V40 A;  3VWU A;  4IKH A;  4MZC A;  3H8Q A;  2REM A;  1KBN A;  2LJK A;  2IFQ A;  2L5L A;  3KP8 A;  4MNN A;  3ZYW A;  1OKT A;  4AJ7 A;  2MMN A;  4KE3 A;  3IK7 A;  1EV4 A;  1Y6E A;  3NIV A;  3DEX A;  3KJY A;  5A4V A;  3HVN A;  1OC9 B;  4G0K A;  1S3C A;  4LA1 A;  2P31 A;  1ABA A;  2F8F A;  2YWM A;  2FWH A;  2YNX A;  2GVP A;  2A2S A;  3F63 A;  4K0G A;  1TP9 A;  4TR1 A;  3TDG A;  2P0G A;  1SD9 A;  2K9F A;  2E7P A;  4Q5F A;  1K0D A;  4GF0 A;  4MMM A;  3KMN A;  2HNL A;  2BMX A;  2OE3 A;  3C8E A;  2WB9 A;  2F8A A;  3GL3 A;  4AJ6 A;  1F9M A;  5L71 A;  4XS6 A;  1WJK A;  1B8X A;  1QFN A;  4IJI A;  1UC7 A;  2BTO T;  2FWF A;  1TK0 B;  3GTU A;  5IOW A;  2H72 A;  2H01 A;  2RM5 A;  4WKW A;  1M9B A;  2B5Y A;  10GS A;  3KH7 A;  3TJK A;  4KCE A;  4ZB8 A;  3BJ5 A;  4FIW A;  3H1N A;  1TW9 A;  4K5S A;  4KA0 A;  5C00 A;  4XHM A;  3APS A;  4Z2R A;  1LJR A;  1ML6 A;  2OKA A;  4JED A;  4PNF A;  4Q5R A;  3Q19 A;  3DRN A;  1K0N A;  3Q6O A;  1X9M B;  2WZ9 A;  4USS A;  1G6Y A;  3TKS C;  3A3T A;  5DJL A;  3BBY A;  3TOT A;  3WT1 A;  1A8Y A;  4EC0 A;  4F9Z A;  3PH9 A;  4I5Q A;  5ELG A;  1M3J A;  4ZBD A;  1OYJ A;  5ECP B;  1GLP A;  1BAY A;  3M1G A;  4OCE A;  2O85 A;  2GQL A;  1XW6 A;  4PQH A;  2VM2 A;  4O5R A;  4GWR A;  4HQS A;  1EP8 A;  2X8H A;  5DAL A;  2H19 A;  1MTC A;  2M80 A;  1PL2 A;  4YQM A;  1T4Z A;  1Q4J A;  4LLR A;  1BX9 A;  1XOA A;  3HD5 A;  4BVY B;  3PGT A;  4BIK A;  4BA7 A;  3GMF A;  3VLN A;  4OMV A;  4WBJ A;  3DVX A;  3D21 A;  3I6A A;  1U87 A;  1X5E A;  1AUC A;  5A4W A;  2VUP A;  1ERU A;  5C04 A;  4FH8 A;  1Z9H A;  2IMI A;  1TU8 A;  5CRW A;  4BPY A;  5DVB A;  1S3A A;  4KF9 A;  2NBS A;  3SWL A;  1TI1 A;  3TKR A;  4JBB A;  3IXR A;  3C1R A;  2YCD A;  2YZH A;  4OO5 A;  3EMX A;  2I1U A;  4BL7 A;  3RDW A;  1XW9 A;  5F07 A;  5B7C A;  1TOF A;  3IE3 A;  4MH2 A;  1TTZ A;  2NPB A;  1M99 A;  3EC3 A;  4WF5 A;  3GUR A;  4PUR A;  1ZMA A;  4MAB A;  1YEP A;  1TKD B;  3GST A;  1EEJ A;  5CAX A;  1YF0 A;  4IN0 A;  3HXS A;  1T7P B;  3UL3 A;  3RHB A;  3BCK A;  2G0F A;  1O81 A;  3TKS A;  5ECR B;  5GZZ B;  1A0R P;  1PD2 1;  4POB A;  4QL9 A;  2V41 A;  1ZL9 A;  3KH9 A;  1A23 A;  4EE0 A;  5IMZ A;  1OC9 A;  1K0A A;  2QGV A;  2F51 A;  1THX A;  3CRU A;  2GLR A;  4POL A;  3FZ5 A;  2DML A;  1OKD A;  2I9H A;  1OE7 A;  1R4W A;  3A2X A;  4G10 A;  2J23 A;  3GA4 A;  3QAW A;  1TRW A;  4LMV A;  4EO3 A;  2HE3 A;  5LNK e;  5G1L A;  1ERW A;  5J3R A;  4N0Z A;  4KAE A;  3KTL A;  2VOC A;  2YPM A;  5ABR A;  3P2A A;  2C3N A;  4ZIJ A;  4KND A;  2VCW A;  3F6D A;  4V1A p;  3F4R A;  3HYP A;  4O5U A;  2GSR A;  2I4A A;  2JAC A;  5LCZ A;  3PIN A;  3FZA A;  3C1S A;  1XG8 A;  1Y25 A;  4GTU A;  3ZVJ D;  3UOM A;  1PMT A;  1C72 A;  2VLU A;  3Q74 A;  5B6N A;  2WFC A;  3H79 A;  2GS3 A;  3QD9 A;  3PPU A;  2ON5 A;  5F06 A;  5ECL B;  3C73 A;  12GS A;  2EIO A;  1X9W B;  4V2M A;  2RUE A;  1SJ6 A;  5IMV A;  2DJ0 A;  3KIJ A;  2QA2 A;  4A5P A;  1PSQ A;  2OE0 A;  3CMI A;  1PL1 A;  4F03 A;  2ZCT A;  4I8B A;  3KCM A;  3J7Y k;  4GSN A;  3P8W A;  4XCS A;  2R0C A;  2L4C A;  3M9K A;  5KOW A;  3QOU A;  1NM3 A;  1H75 A;  3LG6 A;  2HSY A;  3VPQ A;  1SJI A;  2X4A A;  4MJE A;  1SU9 A;  1U6T A;  2AHE A;  1QMV A;  3LFL A;  3KXO A;  3FY7 A;  1VF4 A;  4K6X A;  5J5N A;  4HJ2 A;  4PGT A;  3HJM A;  2NDO A;  2A4V A;  2H0H A;  2H0G A;  4JZQ A;  4Z2T A;  3F6F A;  3IHG A;  2AUV A;  3FR3 A;  4RQX A;  4EKZ A;  2HI7 A;  5AN1 A;  4PUA A;  3UBK A;  3CSI A;  1YQ1 A;  5FHI A;  5DAK B;  5ECO B;  4IEL A;  4YAV A;  1EZK A;  1NSW A;  4YKG A;  5IQY A;  3GX8 A;  2RUF A;  3GSS A;  4N10 A;  4HZ2 A;  2HZF A;  3DYR A;  3FZ4 A;  3F4T A;  5CP1 A;  2TIR A;  3KEB A;  4RQR A;  2B7K A;  2GGT A;  2R4V A;  4CW9 A;  3GKK A;  2A2R A;  4MF6 A;  2FNO A;  4KSO A;  2CAQ A;  3DD3 A;  4YKF A;  4ID0 A;  3LEF A;  4E8H A;  1R7H A;  1XWA A;  2GSS A;  4MLY A;  2GST A;  3HKR A;  3CSJ A;  3CBU A;  3NZN A;  5AIV A;  4NV2 A;  3ZML A;  1O8W A;  4L0U A;  5GST A;  1GUH A;  3APO A;  1M7T A;  3LSZ A;  5F05 A;  2XHF A;  2QA1 A;  3IA1 A;  4CHS A;  2L5O A;  4OD7 A;  1VRS D;  2N5A A;  5JWR B; 
#chains in the Genus database with same CATH homology
 1PRX A;  2ON7 A;  2WUL A;  3LGC A;  2IWT A;  5CO3 A;  5HFK A;  2VL3 A;  1RW1 A;  3ZMK A;  5JCW A;  2H74 A;  3ZVJ A;  5JWO B;  4G9H A;  4HJM A;  6GSY A;  5DJM A;  1OE8 A;  4BWQ A;  4FO5 A;  5DCG A;  5CNW A;  2I3Y A;  4K7N A;  5G5F A;  5EPF A;  3C71 A;  1B9Y C;  4GRF A;  2JAD A;  2DSA A;  4HDE A;  19GS A;  11GS A;  3ZIV A;  2VCV A;  5HQP A;  5IIZ A;  5GAN D;  3EYT A;  1FB0 A;  1YEX A;  2HLS A;  4YH2 A;  5DDL A;  4J56 E;  1XOB A;  4WXT A;  4IP1 A;  2IPA A;  1SYX A;  5IOX A;  4O92 A;  5E4W A;  17GS A;  1AQW A;  1T8E B;  18GS A;  3W8S A;  1GRX A;  3I9V 2;  4DEJ A;  1A2L A;  2NTO A;  3G9B A;  4GST A;  4MK3 A;  4FYB A;  2CZ2 A;  1FAA A;  3RPP A;  1NHO A;  1XWG A;  1Q98 A;  5KN0 A;  4IP6 A;  3F3Q A;  5ECK B;  1HNB A;  2IN3 A;  2FY6 A;  5ECQ B;  2XPE A;  2C80 A;  4QL7 A;  4ECC A;  2HRF A;  4H86 A;  4L0W A;  4RI7 A;  3RHC A;  2K18 A;  3P90 A;  1GSU A;  5KN1 A;  1F3B A;  3TUE A;  5A4U A;  3UVT A;  4HU9 A;  4TW5 A;  5H5S A;  1FW1 A;  3TOU A;  4GQC A;  1DUG A;  2DJ1 A;  3BD2 A;  3VI7 A;  1CQH A;  4O5Q A;  2AYT A;  4X0X A;  2XBQ A;  2OA7 A;  2VD0 A;  2HFD A;  3VWW A;  3ZIJ A;  2K6V A;  2MMA A;  1X9S B;  1G7E A;  2F9S A;  5ECH B;  2VLT A;  2L6D A;  3HJP A;  1GNW A;  2C0F A;  2GTU A;  4MF7 A;  4ZBA A;  2FWE A;  1DBY A;  2V6O A;  1TI3 A;  4PUF C;  3O76 A;  4DSS B;  1TU7 A;  2HRK A;  1GL8 A;  5DAK A;  4TR3 A;  1PKW A;  7GSS A;  3GRX A;  4TR0 A;  3EIN A;  1BQ7 A;  3HJO A;  5EL8 A;  3EU4 A;  2WCI A;  3IAM 2;  1GTB A;  4IBP A;  2WRT A;  2GQK A;  2C0G A;  2EIQ A;  1JZO A;  4QQ7 A;  3HY2 A;  2O7K A;  1TJD A;  2B7J A;  3FMW A;  4V2L A;  3LQ7 A;  2LQO A;  1ACV A;  3D4M A;  6GST A;  3IR4 A;  1PN9 A;  3ME8 A;  1XCC A;  1Z7P A;  4L5O A;  1F2E A;  1FHE A;  2ALB A;  2H8L A;  1B9X C;  1Z3E A;  1GUK A;  4IW9 A;  4N11 A;  2VO4 A;  2XPD A;  5FWG A;  1O85 A;  2OBK A;  2VM1 A;  3DWV A;  1SYR A;  2IMD A;  1Z6M A;  2YWI A;  4EF0 A;  1USB A;  2O87 A;  3CSH A;  2KLX A;  3WGX A;  4NHZ A;  1IYH A;  5BRT A;  2FA4 A;  1AQX A;  4GQF A;  4MZW A;  3IHQ A;  4WF4 A;  2H6Z A;  5DQS A;  1PX7 A;  5D73 A;  2L59 A;  1DE1 A;  4K1F A;  1K0B A;  4PX1 A;  5JWQ B;  2TRX A;  2FD3 A;  1AW9 A;  5CRD A;  1TXX A;  1S3D A;  3LW9 A;  1EOG A;  3ZFL A;  2B6M A;  2C3Q A;  1TK8 B;  1QGV A;  2LUS A;  5KOX A;  2D2Z A;  1GSY A;  1VF1 A;  2KHP A;  5ID2 B;  1G6W A;  1B4Q A;  1UN2 A;  3ZRE A;  2V6K A;  4V1A g;  3TCO A;  5JCG A;  2HZE B;  3MWH A;  3M0F A;  3KM6 A;  2CQ9 A;  4ULX A;  3FEU A;  1PQN A;  5ECI B;  2YZU A;  1EP7 A;  4RUV A;  1M9A A;  3TJB A;  1GH2 A;  2E2M A;  4XS1 A;  4TVE A;  2HT9 A;  2DBC A;  3A2V A;  1AQV A;  3VPT A;  3BOA A;  2LRN A;  1URM A;  1G7O A;  1HD2 A;  2P5R A;  2JZT A;  4YAP A;  4MZB A;  4PXO A;  2DLX A;  4ZXG A;  2J9H A;  2HXK A;  4MDC A;  1KEB A;  3R3E A;  1TK5 B;  3CXG A;  3VUR A;  2X8G A;  1B48 A;  4K8M A;  1V57 A;  4I2T A;  3N5O A;  3FR6 A;  2IJY A;  1WOU A;  3U6V A;  3IRA A;  2YJ7 A;  5IPG A;  3IDV A;  2FA8 A;  2AB6 A;  4YQV A;  4X1U A;  1A24 A;  2N5B A;  4ZBB A;  4EDZ A;  2JSY A;  2LRT A;  1FG4 A;  5J4U A;  1OAZ A;  1K3L A;  4G19 A;  3UJ1 A;  1AAZ A;  1GUL A;  3MIX A;  1TDI A;  2IIY A;  4D73 B;  4NAX A;  1VGL A;  5IMA A;  2HSH A;  3HVS A;  4ACS A;  5B6M A;  1LBK A;  4K7I A;  1GP1 A;  4JU5 A;  3EWL A;  2GDR A;  5G1K A;  1FO5 A;  1JZD A;  4J57 E;  2R37 A;  3IBH A;  3F0I A;  5DQY A;  2B5X A;  3F8U A;  4KB3 A;  3HZ4 A;  2P5Q A;  2C4J A;  2B5E A;  4EXJ A;  2H1A A;  4DSS A;  4HQZ A;  4K2X A;  1MDJ A;  3G7J A;  3DVW A;  2ZUP A;  3GL5 A;  1U3I A;  4ECB A;  4O32 A;  3FW2 A;  3LYK A;  1FVK A;  1F3A A;  3FZ9 A;  4TN8 A;  2C8U A;  2V1M A;  2YN1 A;  1VF2 A;  3KMO A;  2DMM A;  4MJB A;  2RM6 A;  1SL2 B;  4J2F A;  5D8I A;  1MDI A;  2ZNM A;  1O6J A;  4BVX B;  5CRE A;  3F3R A;  3D4T A;  3GX0 A;  3A5W A;  3IC8 A;  1CQG A;  2WGR A;  1VF3 A;  3M3M A;  2HSM A;  5FT3 A;  3G7I A;  2VD1 A;  2DKI A;  2CT6 A;  2QSI A;  4CY6 A;  1ERV A;  4ECI A;  3H4K A;  2GZZ A;  3QFB C;  4MPG A;  2CVD A;  4MJA A;  4OFN A;  1XZO A;  1UA5 A;  2XBI A;  4FYU A;  1PX6 A;  4HS1 A;  1HYU A;  3I69 A;  5H5R A;  4G0I A;  4EIP A;  1BJX A;  3GN3 A;  3F4S A;  5LD0 A;  3MSZ A;  1PGT A;  2PVQ A;  2FHE A;  3LWA A;  4ILF A;  5B8A A;  2H70 A;  2PWJ A;  4Q5N A;  2LNS A;  3A2W A;  1PKZ A;  3DXB A;  3PR8 A;  1U88 A;  4EDY A;  1E6B A;  9GSS A;  2H0I A;  1SEN A;  5CYY A;  1SKW B;  3TKP A;  4IHU A;  4K7O A;  3E0U A;  2B1L A;  5ID2 A;  1SD8 A;  2CV4 A;  3ISO A;  4KX4 A;  4FYC A;  4Z2U A;  4JE1 A;  4OO4 A;  5IMD A;  4EUY A;  5ECM B;  2HZE A;  4KSM A;  2LJA A;  3RPN A;  3UEM A;  1OC3 A;  1U3A A;  2VIM A;  3GUS A;  4CY8 A;  2H66 A;  1J0F A;  4ML6 A;  4GLT A;  2L57 A;  1V98 A;  2H1D A;  1TRV A;  3ZZX A;  4PTS A;  4AGS A;  1I5G A;  4ECJ A;  4TRX A;  2MBT A;  3VK9 A;  3HA9 A;  3HCZ A;  5D96 A;  2V32 A;  5IO0 A;  3WYW A;  1K3Y A;  1MEK A;  2A2P A;  2H1B A;  1NHY A;  2MMZ A;  2JZR A;  2H6Y A;  3NOF A;  3EU3 A;  2R0G A;  1V58 A;  4I6X A;  5G30 A;  3EPT A;  1WMJ A;  2PN8 A;  4OWY A;  3UAP A;  3J7Y b;  1XPV A;  3TJJ A;  4NPB A;  2JU5 A;  1GSF A;  2PU9 C;  1M0U A;  2WJU A;  1N8J A;  2YV7 A;  3KD0 A;  3V1W A;  5F8B A;  2EC4 A;  3H93 A;  2A4H A;  2H75 A;  1M2B A;  1YKC A;  5B8B A;  3US3 A;  4BWS A;  1RK4 A;  5J9C A;  1GLQ A;  2M72 A;  2H1G A;  1ST9 A;  4E8E A;  2VL9 A;  5ECS A;  1Z6N A;  1GSD A;  3KGK A;  3IC4 A;  5EY6 A;  3FRC A;  2H76 A;  1F6M C;  1W4V A;  1M2A A;  2JSZ A;  8GSS A;  2AAW A;  1XBS A;  1AIU A;  1YKA A;  4LMW A;  4N0V A;  4D73 A;  4KCA A;  1XIY A;  2R0P A;  1JLV A;  1THO A;  1XVQ A;  4POM A;  1GTU A;  4AJ8 A;  4TXO A;  3APQ A;  4K2D A;  2LRC A;  3IOS A;  3L0H A;  4JR6 A;  4K0N A;  4NMU A;  1B4P A;  4Z7X A;  3VI5 A;  1EEM A;  3C7M A;  2YJH A;  2CZ3 A;  4MPF A;  1F37 A;  5D93 A;  2DIZ A;  4WR4 A;  1GSE A;  3GHA A;  3JCM L;  1SK2 A;  2FWG A;  1XFL A;  1WE0 A;  2VCQ A;  2OJL A;  1QUW A;  5D9T A;  4IQ1 A;  3IK9 A;  1JHB A;  1AC1 A;  4TKY A;  4HOJ A;  3LYP A;  5G31 A;  1YZX A;  3UVH A;  4F0B A;  3EMP A;  1MD4 A;  2HYX A;  1A0F A;  4TOP A;  2YV9 A;  2LTK A;  1QXH A;  5CRG A;  1TRS A;  2B3S A;  5D9W A;  4BVX A;  4CDO A;  4IVF A;  2M46 A;  3IAS 2;  5IMF A;  4HEA 2;  3CRT A;  1JZW A;  1R5P A;  1FVJ A;  5COH A;  4HZ4 A;  6GSX A;  2BJX A;  3WGD A;  1HQO A;  3ERW A;  3KP9 A;  1XXU A;  2X64 A;  5IMC A;  2DJ2 A;  4FQU A;  1X5C A;  3RAZ A;  3GNJ A;  4WR5 A;  3DIE A;  3SBC A;  1G0T A;  4JRR A;  3UMA A;  1EGO A;  5HR2 A;  3R2Q A;  4KDY A;  2Z9S A;  1V2A A;  4TR4 A;  1PA3 A;  3FHK A;  2PMT A;  1DSB A;  1ZOF A;  3GFK A;  4XTS A;  4PNG A;  3VWX A;  2H71 A;  1X5D A;  2CVB A;  1K0C A;  1O8X A;  2IL3 A;  3GH6 A;  3UIW A;  5J41 A;  4XRA A;  6GSV A;  4KH7 A;  3ZTL A;  1XWK A;  4RI6 A;  2NVL A;  4PQ1 A;  1N2A A;  3WGE A;  1O73 A;  3D22 A;  2GSQ A;  1T4Y A;  4NHW A;  3EE2 A;  5E59 A;  5IO2 A;  1FOH A;  2VCX A;  2VCT A;  4WBR D;  22GS A;  3F9U A;  3FR9 A;  3W6G A;  2R3X A;  3FKF A;  3MAK A;  1EOH A;  5INY A;  3TRX A;  1YF1 A;  3HHV A;  4NWY A;  4ZIL A;  4DSQ A;  4HU7 A;  4KDU A;  4KGI A;  2LKU A;  5HFI A;  3P7X A;  2H6X A;  4K5R A;  1MDK A;  4ML1 A;  3QR6 A;  1X0R A;  5GAP D;  2VL2 C;  5HFG A;  6GSS A;  4JR4 A;  2CA8 A;  1ZYN A;  1PN0 A;  3D0Z A;  1FB6 A;  3ZRD A;  3CYN A;  1K3O A;  1XW5 A;  3CTF A;  4GSS A;  1JLW A;  6GSW A;  2JL4 A;  2B1K A;  4MA9 A;  1LU4 A;  5KN2 A;  2AV4 A;  5HR1 A;  4OFT A;  1GNE A;  5CRH A;  1ILO A;  2IMK A;  4N30 A;  1XVW A;  4XS4 B;  5D9V A;  1A2J A;  3TGZ A;  3ZL5 A;  2MYG A;  2CVK A;  1J08 A;  3HZ8 A;  2PBJ A;  1ON4 A;  3E3E A;  3ED3 A;  1H4O A;  5AGY A;  16GS A;  1EGR A;  2E0Q A;  4ICY A;  2GT5 A;  4IGJ A;  5GSS A;  2LV3 A;  4XIH A;  1V9W A;  1K0O A;  4F2I A;  3L4N A;  3O6T A;  2FGX A;  1GTI A;  2X8C A;  1A8L A;  2G2Q A;  1KTE A;  1GTA A;  2FCH A;  2LS5 A;  4WET A;  3ZIT A;  1WWJ A;  1TRU A;  1JZR A;  2X49 A;  3DKS A;  4G2E A;  5KN3 A;  2C0E A;  2JZS A;  2PER A;  3MNG A;  4GXZ A;  2QKE A;  2QC7 A;  1M2D A;  5ELA A;  3K8N A;  4MJC A;  1Z5Y E;  2C0D A;  5DBQ A;  1YDK A;  1W89 A;  4G0L A;  4OCF A;  3OR5 A;  3GV1 A;  3S9F A;  2LEG A;  4P3Y B;  3TKS E;  2PUK C;  1GSS A;  20GS A;  3U5R E;  5H5Q A;  2EIR A;  1T00 A;  4DVC A;  1ERT A;  3ME7 A;  2F3M A;  1HNC A;  1YY7 A;  2LQQ A;  2TRC P;  1R26 A;  2YWO A;  3WD6 A;  2MMO A;  2YOI A;  1GSQ A;  1UVZ A;  5A5K A;  1O7U A;  1Z7R A;  3GKN A;  2GZY A;  4IQA A;  2LST A;  2RII A;  1BG5 A;  3LXZ A;  4ZB6 A;  4TXO B;  2VL2 A;  3TB2 A;  5AIS A;  1WRY A;  2RLI A;  4NV5 A;  2KP1 A;  1QQ2 A;  4K9Z A;  1I9D A;  3M8N A;  2X99 A;  3UBL A;  3TRP A;  2YWN A;  1J9B A;  1JFU A;  3L78 A;  2VLV A;  4L5L A;  5G5E A;  3HVX A;  6GSU A;  2PPT A;  3ERF A;  3LXT A;  5HR3 A;  5HR0 A;  1FOV A;  1KNG A;  2GT6 A;  2IFQ B;  2LNT A;  5F0G A;  1SL0 B;  3ERG A;  5BMU A;  3G7Y A;  2R6K A;  1RQM A;  5JCU A;  2DKH A;  3GKM A;  2OAC A;  2PVO C;  1K0M A;  4LL4 B;  2C3T A;  4OFM A;  3E9J B;  2LJR A;  3QPM A;  5DCH A;  3I43 A;  4TXV A;  1XWB A;  3LJR A;  1DE2 A;  3FYG A;  2XC2 A;  2HRA A;  2N5F A;  1BED A;  1GUM A;  1E2Y A;  2FUG 2;  2AJQ B;  2YAN A;  1SJZ A;  1SKR B;  3L9U A;  1SK1 A;  4F0C A;  1XWC A;  4PQI A;  5ENU A;  2GQM A;  4KW6 A;  1OC8 A;  3VFI A;  4F82 A;  4ZL9 A;  2OAD A;  4TR1 B;  1SL1 B;  2R5G A;  2FLS A;  3HDC A;  3VWV A;  3AY8 A;  5G2Z A;  3FK8 A;  3N9J A;  1ZYP A;  4EIQ A;  3WT2 A;  2ES7 A;  3GIX A;  5D9X A;  2KP2 A;  2UZ8 A;  4ISD A;  4I2U A;  3ZLP A;  2K8V A;  2VCZ A;  4MH3 A;  5KEJ A;  3LOR A;  5AIX A;  1QK8 A;  4EVM A;  2C1Y A;  4KDX A;  13GS A;  1T1V A;  4X43 A;  3GTU B;  3MYD A;  4GCI A;  4BVY A;  1SK0 A;  3EVI A;  4XS4 A;  4DSR A;  3L9V A;  1GWC A;  2O8V B;  1ZYE A;  3GH9 A;  2GZP A;  1WPI A;  3A5I A;  3EUR A;  4ZL7 A;  2H30 A;  2MBS A;  1SKS B;  2DC5 A;  3KZQ A;  3TKQ A;  2YP6 A;  2OBI A;  1OVN A;  2KUC A;  5IM9 A;  4LL1 B;  2WS2 A;  3TJG A;  1EWX A;  2WDU A;  3GKX A;  4MCU A;  4O7H A;  3QAG A;  1WIK A;  3RBT A;  1ZYQ B;  4L8E A;  3CTG A;  1ZCP A;  1HNA A;  4POK A;  3HVV A;  3TJF A;  1R5A A;  4HUA A;  3Q18 A;  2CAI A;  3O3T A;  2HRN A;  1T3B A;  4EL1 A;  2DJ3 A;  1ZZY A;  4AF2 A;  2IMF A;  4HI7 A;  2I81 A;  4ZB9 A;  2OE1 A;  1NW2 A;  3IPZ A;  2L4Q A;  3KTB A;  2E2G A;  3QFA C;  1MD3 A;  2R2J A;  2K8S A;  3MDK A;  5DAL B;  4I97 A;  3QCP A;  2MZC A;  1YJ6 A;  3ZFB A;  4WEY A;  3L9S A;  3QMX A;  2DIY A;  3DGQ A;  2L6C A;  2H73 A;  1AXD A;  3QDN A;  4YQU A;  3IV4 A;  3GYK A;  2KOK A;  4Q5Q A;  4MF5 A;  3W8J A;  2VAF A;  1IYI A;  2DJJ A;  1WP0 A;  1A2M A;  5EVO A;  3TRQ A;  2PGT A;  3D5J A;  3UAR A;  2IME A;  4NXI A;  1EV9 A;  4IJ3 A;  4IS0 A;  3M9J A;  4V2N A;  14GS A;  5IPH A;  4MP4 A;  2DJK A;  1BYE A;  2O89 A;  4X4J A;  5J9B A;  4XRD A;  4KUN A;  2CX3 A;  3BCI A;  1ZGN A;  3DML A;  5ECN B;  4ZL8 A;  2CX4 A;  2V2G A;  3QAV A;  3D6I A;  4BL7 B;  1V40 A;  3VWU A;  4IKH A;  4MZC A;  3H8Q A;  2REM A;  1KBN A;  2LJK A;  2IFQ A;  2L5L A;  3KP8 A;  4MNN A;  3ZYW A;  1OKT A;  4AJ7 A;  2MMN A;  4KE3 A;  3IK7 A;  1EV4 A;  1Y6E A;  3NIV A;  3DEX A;  3KJY A;  5A4V A;  1OC9 B;  4G0K A;  1S3C A;  4LA1 A;  2P31 A;  1ABA A;  2F8F A;  2YWM A;  2FWH A;  2YNX A;  2GVP A;  2A2S A;  3F63 A;  4K0G A;  1TP9 A;  4TR1 A;  3TDG A;  2P0G A;  1SD9 A;  2K9F A;  2E7P A;  4Q5F A;  1K0D A;  4GF0 A;  4MMM A;  3KMN A;  2HNL A;  2BMX A;  2OE3 A;  3C8E A;  2WB9 A;  2F8A A;  3GL3 A;  4AJ6 A;  1F9M A;  5L71 A;  4XS6 A;  1WJK A;  1B8X A;  1QFN A;  4IJI A;  1UC7 A;  2BTO T;  2FWF A;  1TK0 B;  3GTU A;  5IOW A;  2H72 A;  2H01 A;  2RM5 A;  4WKW A;  1M9B A;  2B5Y A;  10GS A;  3KH7 A;  3TJK A;  4KCE A;  4ZB8 A;  3BJ5 A;  4FIW A;  3H1N A;  1TW9 A;  4K5S A;  4KA0 A;  5C00 A;  4XHM A;  3APS A;  4Z2R A;  1LJR A;  1ML6 A;  2OKA A;  4JED A;  4PNF A;  4Q5R A;  3Q19 A;  3DRN A;  1K0N A;  3Q6O A;  1X9M B;  2WZ9 A;  4USS A;  1G6Y A;  3TKS C;  3A3T A;  5DJL A;  3BBY A;  3TOT A;  3WT1 A;  1A8Y A;  4EC0 A;  4F9Z A;  3PH9 A;  4I5Q A;  5ELG A;  4ZBD A;  1OYJ A;  5ECP B;  1GLP A;  1BAY A;  3M1G A;  4OCE A;  2O85 A;  2GQL A;  1XW6 A;  4PQH A;  2VM2 A;  4O5R A;  4GWR A;  4HQS A;  1EP8 A;  2X8H A;  5DAL A;  2H19 A;  1MTC A;  2M80 A;  1PL2 A;  4YQM A;  1T4Z A;  1Q4J A;  4LLR A;  1BX9 A;  1XOA A;  3HD5 A;  4BVY B;  3PGT A;  4BA7 A;  3GMF A;  3VLN A;  4OMV A;  4WBJ A;  3DVX A;  3D21 A;  3I6A A;  1U87 A;  1X5E A;  1AUC A;  5A4W A;  2VUP A;  1ERU A;  5C04 A;  4FH8 A;  1Z9H A;  2IMI A;  1TU8 A;  5CRW A;  4BPY A;  5DVB A;  1S3A A;  4KF9 A;  2NBS A;  3SWL A;  1TI1 A;  3TKR A;  4JBB A;  3IXR A;  3C1R A;  2YCD A;  2YZH A;  4OO5 A;  3EMX A;  2I1U A;  4BL7 A;  3RDW A;  1XW9 A;  5F07 A;  5B7C A;  1TOF A;  3IE3 A;  4MH2 A;  1TTZ A;  2NPB A;  1M99 A;  3EC3 A;  4WF5 A;  3GUR A;  4PUR A;  1ZMA A;  4MAB A;  1YEP A;  1TKD B;  3GST A;  1EEJ A;  5CAX A;  1YF0 A;  4IN0 A;  3HXS A;  1T7P B;  3UL3 A;  3RHB A;  3BCK A;  2G0F A;  1O81 A;  3TKS A;  5ECR B;  5GZZ B;  1A0R P;  1PD2 1;  4POB A;  4QL9 A;  2V41 A;  1ZL9 A;  3KH9 A;  1A23 A;  4EE0 A;  5IMZ A;  1OC9 A;  1K0A A;  2QGV A;  2F51 A;  1THX A;  3CRU A;  2GLR A;  4POL A;  3FZ5 A;  2DML A;  1OKD A;  2I9H A;  1OE7 A;  1R4W A;  3A2X A;  4G10 A;  2J23 A;  3GA4 A;  3QAW A;  1TRW A;  4LMV A;  4EO3 A;  2HE3 A;  5LNK e;  5G1L A;  1ERW A;  5J3R A;  4N0Z A;  4KAE A;  3KTL A;  2VOC A;  2YPM A;  5ABR A;  3P2A A;  2C3N A;  4ZIJ A;  4KND A;  2VCW A;  3F6D A;  4V1A p;  3F4R A;  3HYP A;  4O5U A;  2GSR A;  2I4A A;  2JAC A;  5LCZ A;  3PIN A;  3FZA A;  3C1S A;  1Y25 A;  4GTU A;  3ZVJ D;  3UOM A;  1PMT A;  1C72 A;  2VLU A;  3Q74 A;  5B6N A;  2WFC A;  3H79 A;  2GS3 A;  3QD9 A;  3PPU A;  2ON5 A;  5F06 A;  5ECL B;  3C73 A;  12GS A;  2EIO A;  1X9W B;  4V2M A;  2RUE A;  1SJ6 A;  5IMV A;  2DJ0 A;  3KIJ A;  2QA2 A;  4A5P A;  1PSQ A;  2OE0 A;  3CMI A;  1PL1 A;  4F03 A;  2ZCT A;  4I8B A;  3KCM A;  3J7Y k;  4GSN A;  3P8W A;  4XCS A;  2R0C A;  2L4C A;  3M9K A;  5KOW A;  3QOU A;  1NM3 A;  1H75 A;  3LG6 A;  2HSY A;  3VPQ A;  1SJI A;  2X4A A;  4MJE A;  1SU9 A;  1U6T A;  2AHE A;  1QMV A;  3LFL A;  3KXO A;  3FY7 A;  1VF4 A;  4K6X A;  5J5N A;  4HJ2 A;  4PGT A;  3HJM A;  2NDO A;  2A4V A;  2H0H A;  2H0G A;  4JZQ A;  4Z2T A;  3F6F A;  3IHG A;  2AUV A;  3FR3 A;  4RQX A;  4EKZ A;  2HI7 A;  5AN1 A;  4PUA A;  3UBK A;  3CSI A;  1YQ1 A;  5FHI A;  5DAK B;  5ECO B;  4IEL A;  4YAV A;  1EZK A;  1NSW A;  4YKG A;  5IQY A;  3GX8 A;  2RUF A;  3GSS A;  4N10 A;  4HZ2 A;  2HZF A;  3DYR A;  3FZ4 A;  3F4T A;  5CP1 A;  2TIR A;  3KEB A;  4RQR A;  2B7K A;  2GGT A;  2R4V A;  4CW9 A;  3GKK A;  2A2R A;  4MF6 A;  2FNO A;  4KSO A;  2CAQ A;  3DD3 A;  4YKF A;  4ID0 A;  3LEF A;  4E8H A;  1R7H A;  1XWA A;  2GSS A;  4MLY A;  2GST A;  3HKR A;  3CSJ A;  3CBU A;  3NZN A;  5AIV A;  4NV2 A;  3ZML A;  1O8W A;  4L0U A;  5GST A;  1GUH A;  3APO A;  1M7T A;  3LSZ A;  5F05 A;  2XHF A;  2QA1 A;  3IA1 A;  4CHS A;  2L5O A;  4OD7 A;  1VRS D;  2N5A A;  5JWR B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...