2H31A

Crystal structure of human paics, a bifunctional carboxylase and synthetase in purine biosynthesis
Total Genus 105
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
105
sequence length
419
structure length
386
Chain Sequence
LNIGKKLYEGKTKEVYELLDSPGKVLLQSKGKAAISNKITSCIFQLLQEAGIKTAFTRKCGETAFIAPQCEMIPIEWVCRRIATGSFLKRNPGVKEGYKFYPPKVELFFKDDANNDPQWSEEQLIAAKFCFAGLLIGQTEVDIMSHATQAIFEILEKSWLPQNCTLVDMKIEFGVDVTTKEIVLADVIDNDSWRLWPSGPEGLQMVKKNFEWVAERVELLLKSESQCRVVVLMGSTSDLGHCEKIKKACGNFGIPCELRVTSAHKGPDETLRIKAEYEGDGIPTVFVAVAGRSNGLGPVMSGNTAYPVISCPPLTPDWGVQDVWSSLRLPSGLGCSTVLSPEGSAQFAAQIFGLSNHLVWSKLRASILNTWISLKQADKKIRECNL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Multifunctional protein ADE2
publication title Octameric structure of the human bifunctional enzyme PAICS in purine biosynthesis.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Ligase, lyase
total genus 105
structure length 386
sequence length 419
ec nomenclature ec 4.1.1.21: Phosphoribosylaminoimidazole carboxylase.
pdb deposition date 2006-05-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00731 AIRC AIR carboxylase
A PF01259 SAICAR_synt SAICAR synthetase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.7700 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold PurE domain 2h31A02
3LP6A 5CLHA 4YCBA 5CVTA 1U11A 4Z7JA 1O4VA 2ATEA 4AY4A 2NSHA 2FWAA 5CTJA 3RGGA 4YCCA 2FW8A 5CLJA 2FWPA 3KUUA 4YCJA 5BOSA 2FWJA 1D7AA 2FW9A 3OOWA 5CLFA 2FWIA 4ZJYA 2NSJA 3RG8A 2FW6A 1XMPA 2FWBA 5BOSB 1QCZA 5CLIA 2FW1A 2NSLA 4ZK2A 4GRDA 4B4KA 4YCDA 4ZMBA 2YWXA 2FW7A 3OPQA 3ORSA 5C5DA 5BORA 3TRHA 2H31A 4ZC8A 4AY3A 5CLGA 4JA0A
chains in the Genus database with same CATH superfamily
3I34X 1YNOA 2G70A 3TCKA 1H8ED 2REQB 3ICWA 3CVVA 5DM70 1Z4NA 3DNPA 2Z2ZA 4M86A 1K06A 1HZJA 5EZSA 2CC2A 3HNPA 4FEAA 4KMSA 3ESDA 3G88A 1IQ0A 1FMJA 3D6HA 5KINB 4RDHA 3CLRD 1YO6A 1U2RA 2C5GA 2NO4A 4U1RA 2MJLA 5D1HA 3F5DA 2O3SA 2G3YA 1SR8A 2ATXA 3K0AA 2VT7A 4ZP1A 2DTXA 3H2YA 2G1PA 2VDMB 4D6XA 1J2JA 1AGPA 4DUGA 3WKCA 1EK2A 2H9YA 1VJ1A 4QU8A 4LMRA 5JNLA 1TK2A 3E61A 4CQJA 4HATA 5AIAA 1QHEA 4OI4A 4KMOA 3BZUA 4CL3A 2I65A 3PXGA 2EKLA 1SK9A 2UZ1A 1CEXA 4J1QA 5DOVA 3UWSA 4DLBA 1EVYA 3H6KA 4FR5A 4BE9A 2YTZA 1CJBA 2P78A 5B6PA 5KOHB 3E3MA 4R8SA 4NJEB 3D2LA 4HLUC 1EDBA 2X42A 3A06A 1G8HA 3KO8A 2C9MA 4Q6WA 3COJA 3BD9A 4WD3A 1YU9A 3NNSA 3NTVA 4PZZA 2FFAA 2BGWA 3SIRA 3O0DA 2R8EA 5BR1A 5FF9A 2FW9A 1V4VA 2ZSAA 1OFIA 3ESCA 4X54A 3HB9A 2Z04A 2Z1MA 4EJ0A 3FPFA 4ZOBA 1YIAA 3KOXA 3IXLA 2JGEA 2R87A 3VYSB 2JIBA 3D3NA 1P75A 2BDUA 4R8MA 4AURA 4G5SA 1N7IA 3BXXA 5SZIA 2GETA 4KO4S 1PWXA 1VSVA 3U56A 1Q3TA 2BLLA 4EYKA 4LG1A 3GDGA 1UKVY 3DD1A 2FN9A 1PJRA 1W36B 4EW1A 5JAZA 4DR1B 5IVKA 4O8CA 5CH5A 1R37A 2JGFA 4OREX 1TYAE 2OXFA 4FOOA 4E31A 5K09A 4I55B 2R85A 4OHPA 1V3QE 3DFIA 2DBYA 3PJEA 1VFPA 4UJ3A 1QORA 2VR1A 4WOPA 3KIPA 4YNBA 2FQXA 5HCNA 2REQA 1QVWA 1RP7A 1CUIA 3DDZX 4Q47A 4BU1A 4EGJA 2O8BA 1IRIA 3OO0A 1UBNA 2D1TA 1SWVA 2O2GA 1WUTA 2X1LA 2XB9A 2FGJA 1FXSA 2IT1A 3AYZB 3G68A 3LVQE 4UCXA 4W6QA 2ALJA 5FV7A 4E08A 3LCUA 1HDXA 2ICAA 4FX5A 1KRWA 1FFWA 1QZUA 2G77B 2P1DA 2AXNA 3VZQA 4DLSA 3OECA 4N47A 3KVYA 3NORA 3QMMA 1N32B 5EJ7A 2YZKA 2CHUA 2GD0A 4FDMA 3SJ7A 2B3TA 1O96A 2JGKA 2KBEA 2QAGB 3WJ7A 1JBQA 4FM9A 1PV4A 4EKDA 1PTJA 4QODA 3LQ1A 4IMPA 1VBFA 4MLCA 3ZGXA 1G5FA 2LBPA 2OSVA 3LF1A 4TXHA 3TPCA 4BKUA 3AVOA 1NP6A 2BEUB 2O2ZA 4M98A 2D8AA 1T4CA 3VMFA 5KOHA 2QMOA 5DNDA 2PZKA 5KCMA 4RABA 3R2JA 1OX6A 2D2XA 3ND9A 2GPTA 3CT6A 4KP7A 4O4HA 4KPEC 4D46A 3HB0A 4IMJB 2Q5OA 2DBQA 4PWZA 4N0DA 3A6DA 1UJMA 4FFBA 4J3JA 4KXFB 4ZQCB 3TUZC 4MMYB 2CNKA 4RW0A 2BT4A 4AJHA 1SM4A 1S2OA 3QMPA 4Y7CA 3UQYS 2LWIA 3N7AA 4GFDA 4GZ6A 1JFLA 1QK4A 3OCCA 4DZTA 5IXJA 4NP6A 4PIVA 1PJTA 4X66B 4YFYA 5C51B 1DP4A 1GGJA 4PXAA 5J5AA 1E3WA 1BN6A 2VEOA 2BKUA 4BKRA 3FRIA 2OZEA 5LP1A 3O7MA 3K2QA 5IM5A 2XUOA 1CS0A 1E5QA 5B3JA 4D44A 5DBIA 3W6PA 1M2WA 2QPTA 1E2UA 1VXOA 3MB5A 2FR8C 5KTKA 1HYEA 2GN8A 4U3JB 5EJ2A 3AJEA 3P97A 4V3CA 3WJ2A 2V65A 4LXTA 4RE6A 3AUFA 4LYGA 4UPEA 2J0QA 1T1JA 1ZK4A 2AUNA 4WDQA 4B6FA 2DH6A 4YK7A 3KVVA 3NBMA 4B09A 2QY6A 3C5HA 2HFJA 3DMFA 3CPEA 3PRKE 4BNKA 4CM1A 3LT5A 4KZPA 5LR6A 1S89A 5BSGA 2DR2A 2JGAA 3DC2A 3FB4A 2ZSBA 4HDNB 1ZVVA 4H17A 1SCUA 2H8GA 1J1IA 3MBOA 4FFVA 3KOWA 4HI0E 1K2VN 5FPYA 2ZVQX 1JKJB 1IJKA 4UNRA 1QGUA 2J59A 2UYOA 1HYBA 2VKQA 3TD9A 1EGMB 3O9VA 4TLCA 3N0TA 5BO5A 5HQTA 2CHEA 3DBVO 3PGVA 1I4WA 2AXQA 2BM0A 2IC5A 1YFZA 1ZYUA 5A4JA 2OHXA 7AT1A 3A6GA 2QAGA 3ZGZA 3FNBA 1CEQA 2ZWIA 2A88A 1EPUA 3MJDA 1W73A 3N59A 4EFDA 3V1MA 2VYCA 1XDWA 4PC6A 2JF0A 1CF9A 1M5TA 2IXAA 4UUQA 1E2JA 3K70B 1ZK0A 1IQRA 1NF8A 3PXCX 4RGBA 4GBJA 4WJLA 4ZZIA 4ZVUA 2E4XA 5IF9A 3KEMA 1MEJA 3AOEA 1WO8A 3L8MA 1TPZA 4X97A 4G8BA 1JJIA 1R50A 4G0YA 4F8JA 1KRXA 4CEIB 3ANYB 3G6KA 3DEYX 3IODA 5CH8A 3VDNB 1MRSA 3PGLA 4N6NA 4Q7KA 1T5DX 1R6XA 4ID3A 4TUYB 3WISA 2YICA 4A2QA 3GLIB 3MQ2A 2PKYX 5TY0A 5FBHA 1WX1A 3PXDA 4Z4QA 1ZP6A 1ILWA 1NMEA 4CDMA 5M2QA 2V5VA 1K1EA 2GA9A 3BXEA 1Y4SA 4PN3A 4ZEXA 3GD7A 4I46A 3L7MA 4U2EA 3HFGA 1NVAA 1U5BA 2WZCA 3ABZA 4B5LA 3TKAA 3AVTA 3H42B 1OXMA 1ZCFA 4PQGA 2XE8A 1N4AA 5JBIA 4TQAA 1OIVA 1J8MF 2I2WA 4C29A 1OTHA 4X8LA 5COQA 1WXHA 1BO6A 3B78A 3ILXA 5CBPB 3UJ6A 3J7AC 1RBYA 3P9PA 1JVSA 4DSOA 2WT4A 5AKKA 5AXDA 3RU7A 3INYA 1C4XA 3A28A 1G21B 3KV1A 1R88A 2FLWA 4D4JA 1ZM2A 3MB8A 4US0R 2WWVD 5EZ5A 1G20E 1HGXA 5B64A 5I9IA 1FTGA 1QP7A 3TR6A 3RG2A 3GVCA 4S1WA 2VHYA 4NARA 4Y0NA 3I5UA 3QKRB 3L6UA 1QOPB 2BUBA 3F4KA 1L4HA 2G5TA 3TRIA 3NYQA 4W5RA 1J1UA 3U17A 1K2WA 3I9MA 1KYQA 1D5CA 1EP1B 2ZE6A 4ITUA 4LE0A 4OMDA 5D85A 5HMMA 2V54A 2XCTB 4PRLA 1ZMXA 4TQ9A 4W82A 5ENVA 4BWVA 2I8CA 2KJQA 3D4IA 3CSDA 1M8KA 4GLLA 4XYEA 3V7YA 3K4QA 4Z4FA 2E48A 1CVRA 1BWSA 3L49A 2CXSA 3GJ3A 4FFSA 5JCJA 3ZOZA 1TX4B 1XCGB 3GL9A 4G5RA 1C0IA 1I1NA 3ZLJA 4AY3A 3GA5A 4BEJA 1IAQA 3D6MA 1MG5A 2WJ4A 3A1UA 4EATA 4ZDKA 3QHQA 4F1KA 5CDFE 3DEHA 1DO2A 3GN2A 1NOKA 5J43A 3ANSA 1QHHB 4QECA 1BDIA 4P2BA 1QG2A 4BV9A 1PV1A 5KSWB 4HYTA 4OKNA 1NSFA 1U8UA 3NTUA 4DIMA 3QEBZ 2BTEA 2YMPA 2JLZA 1P19A 1B23P 4DIOA 4EKIA 3NHRA 4EA9A 2ECOA 1D4AA 5F73A 1FUEA 1NXXA 1VSQA 1WKVA 3KKNA 4H2DA 4HUQB 4DUZB 4ZCPA 4ND8B 3RUHA 4O02B 3O8BA 1LSSA 5FPTA 4BLVA 4A2PA 3BMQB 5JS7A 2XT6A 2CHVA 4I1SA 2EX4A 4IFIA 1U0BB 1XD2B 1Y9EA 5GJVC 3SJZA 2DQZA 3SC2B 2UXDB 3II6X 4PFQA 4IXMA 5H81A 4U2KA 3RVMA 4BLPA 5EZYB 5MGNA 1WHSA 2DM6A 2EFJA 3OHMA 5KVVA 1K7YA 2Q6KA 2ZB4A 3K7EA 1GA6A 2AV6A 4RTPA 3F96A 4BMSA 1P9RA 4H0FA 3UK7A 1UPAA 1C3JA 1K7SN 2XYPA 1X0XA 2VDQB 3QU4A 4R6XA 4XWYA 4HL6A 4PQYA 3WHIA 2V7PA 4CV1A 4X1OA 1JJBA 3UANA 4BTVA 4ZWNA 2ISQA 5D3QA 1V9CA 4HNRA 3GB9A 1G21A 5G1OA 4A0SA 4NZYA 3KTAB 2DFVA 2PWBA 3DOIA 4D80A 2O0HA 1UJ4A 1LZKA 4R7GA 3MWYW 2WKRA 3C15C 2FTKE 3IFSA 3OA0A 2HL6A 2ZQZA 3CEJA 3LY8A 4IX9A 3QFTA 2YFQA 5SV2A 2O54A 4HYYA 1E5DA 4L9SA 2VDNB 1Q7RA 2QJOA 2VK2A 3JPYA 1M9NA 3S6JA 2IPAB 5C52B 2KYRA 2WU1A 1LQUA 1E1RA 1P4HA 3TECE 2N1BA 1CFJA 1OH7A 3FMFA 4LHYA 4L8YA 5KYUB 3GLUA 2VHQA 4EO7A 5C53B 2OCBA 5K8VA 3DVAB 3K31A 3FIJA 2P9EA 2QMZA 4INZA 4CIXA 1LF0A 2B3DA 1BWPA 1HEIA 1JSZA 3W9SA 3ECAA 4FSXA 3TMYA 2XKAA 5AVRA 2TSYB 4DV3B 3K09C 3A1WA 2UUBB 1VLZA 1T1IA 2QA5A 4P3YA 3TMKA 4O4HF 2FUCA 2PZGA 1ITZA 1C9JA 1ZBQA 3OT5A 1P3JA 4DCSA 5LL6P 1LBEA 3T3NA 1FQWA 1SCQA 2M2IA 2D0IA 1MB3A 3EEIA 5FUVA 2IA5A 3RAPR 4P0QB 1QC5B 5J4LA 1E4OA 3OQVA 4UTNA 1GXSB 4AUKA 5LPNA 3A36A 3U3DA 2D7DA 1D0IA 1U8FO 3FGPA 3H17A 3LE8A 2BGGA 3BD7A 2G4LA 3Q8WA 4WNIA 4H7DA 1AUOA 3OTWA 1I4DD 4ND8A 4CM8A 5JSZB 3NFYA 5ILGA 3CTMA 1QS0B 2PGJA 2ZIAA 5FBWB 2XYVA 4E2ZA 5K4HA 3TIXB 1TJNA 3WL4A 1JTVA 5CNJA 3EIUA 3PUYA 2OKGA 1D2HA 1N0UA 1LS1A 1TIPA 2XAAA 3G0HA 2Q45A 4JLOA 3VOTA 5FOSA 3N87A 1T91A 2JIQA 4HWGA 4O59O 1A8SA 3O4IA 5DNWA 2MMCA 3ECCA 4L8WB 2NMVA 1QF9A 3F4LA 2IHTA 4E0BA 2G80A 2LPMA 1P6XA 3EZ6A 1W36C 4TTIA 3LWNA 3E23A 1T43A 2CLOB 1RWQA 1WDMA 4CM9D 1DRJA 1B43A 3EYWA 2RIPA 5E9JA 2ZJ5A 2G1AA 3PQ6A 4AG5A 1PJLA 3BJIC 1JHVA 2D2IA 5BNIA 5FYDA 4JUIA 3M81A 5FBKA 3KXPA 4ZVQA 5CFZA 2WWGA 1P62B 1Y6QA 4D57A 2HFKA 4F8YA 4Q7QA 1MIHA 2Z2YA 2IGTA 2IIVA 2K2WA 4OMFG 4NZMA 2ZRLA 2POQX 3BCUA 3KQOA 3DEFA 5LUAA 1YR8A 2JB9A 1OV6A 4MIKA 1H94A 2B0CA 3HZRA 3X1MA 1J0AA 1RLOA 4HS9A 4QUHA 3VAZA 3DVAA 4HGRA 2AX3A 3X44A 4U7GA 4YPOA 1JEYB 3MGAA 3PEUA 3I5YA 3GJXC 4EB0A 3NUGA 1QWOA 1Y4ZA 3FWKA 4N7JA 3N07A 1E3EA 1U1DA 3VHLB 1JAHA 4RQUA 2XZLA 2EQ5A 1N25A 3CLKA 4RY0A 5H3HA 3QVWA 2RCNA 1JEDA 3HBJA 4M4SA 4MRPA 4QLAA 4OB8A 3V9PA 3WHLA 1A8UA 1XCLA 2NO5A 4CKWA 3OKPA 3R76A 4H1TA 5F4ZA 4R8RA 3Q3CA 1YR2A 3AUXA 3GDOA 3AYXB 1PR6A 4UULA 5IRCD 2VPIA 1GXSA 3OX4A 1DI0A 5LBUA 2OQ2A 1K7XB 3JWJA 2UUAB 3BWYA 2EBUA 2PKQP 3KXIA 1W0KD 4Y1RB 1ZJWA 1E2PA 1I5EA 1RXCA 5JSZA 2AHOA 3ZDAA 2YJ4A 2EYUA 4WA8A 4LVNA 2EERA 1AQLA 3W7VA 1AA9A 2AR0A 2GYWA 2QEQA 2XA9A 2ZCVA 4RE5A 1I2ZA 3BGSA 4RD6A 1PT6A 2GXSA 2JH3A 4B84A 1XZNA 3GVXA 4L73A 1F0KA 4GEGA 4O08A 1JHUA 2JAQA 1NYQA 4ALNA 1KZGB 5JRJA 1KRHA 3RAFC 3SQMA 3CN9A 4UU0A 4BFUA 4EUHA 5EMMA 1ODLA 3SKXA 3JQ8A 3K0BA 4B2LA 2EZTA 1EP2B 1NRXA 2FW1A 4OMUA 4UW9A 5WRFA 3U39A 2QLMA 3HVIA 3SFTA 1KOLA 3LZ6A 3L7IA 4D4GA 3RBVA 3SE0A 5KS2A 1NQXA 3PYLA 4J29A 4KO8A 1GZHB 3KQHA 5L45A 1KQFA 5AJZA 3TJMA 2X5KO 2X0JA 2NAPA 4ODIA 1L7DA 621PA 1D6JA 4LUCA 5LDDC 3QE2A 4ZD6A 5AW4A 1ZCJA 4A8JA 1FX0B 4PG7A 4TL6A 1W30A 1GTMA 3LLSA 5BYBA 5CFOA 3A7EA 3NDPA 5FQNA 3GDWA 2BJWA 2BFCA 2BM8A 3A6KA 1SKAA 3I30X 1JYEA 3T12A 4AK9A 1L5OA 1KDVA 4JX8A 2IU0A 1KQNA 4YT5A 1RAFA 4BV3A 1LB1B 1V5FA 3B5IA 4RKFA 1OR8A 2XJ4A 4U8HA 3PHCA 4MR8B 1F8YA 1SY7A 2IYZA 2X1VA 1EK1A 5E0KB 3HC7A 5JMWA 2A1TR 2XB4A 2Z9DA 1N7JA 5C37A 5B1DA 2Z83A 4NK4A 1RZUA 1B3RA 1JLRA 1ZGGA 1KSFX 2CB0A 2J48A 1PZXA 2GPJA 5BV8A 2PR7A 1CFZA 2W2MA 3NWEA 3OWXA 1Z45A 1E63A 1OLOA 2YCLA 4FXPA 4J7CA 4NYJQ 1NJSA 2XCQA 2PRIA 1E1QA 5F7XA 4FWTA 4NIMA 2OESA 1ST2A 2ZE7A 3L4KA 4I1IA 2IX9A 2PWZA 2VRCA 1DE0A 2WKWA 3DMHA 3SI7A 5L9AA 1U7TA 2C7RA 3SX0A 1T24A 1I7DA 3QX9A 5DM1A 4LDJA 5K2OA 4LF5B 3CG4A 1WW2A 4S12A 1DAPA 2ZBVA 4XOIA 3U16A 4TT3D 1VLMA 1GIAA 3KZCA 3F8TA 3R7NA 1UOEA 3K8QA 3VX4A 4FJ2A 4KIJA 2HLNA 1WPXA 2AOTB 2IZ5A 1ZLXA 2G71A 4I1VA 4QM7A 3WE7A 2RFLA 3NEAA 3GA0A 4RMIA 3T5TA 3MW8A 3PG5A 3AH8A 2QN1A 3RI3A 2OXCA 1IVNA 2JGIA 5JZVA 1UKZA 4IYJA 1QXSA 1N2XA 2C95A 3A9SA 3OETA 4B2IA 4D3DA 5KQRA 2OLJA 1RABA 1Q77A 2IBMA 1L1FA 5T6MA 2PUAA 1X2BA 3HJNA 4RO0A 4B9AA 1BVRA 1YJXA 2OSBA 3AU8A 4J91A 3KSDO 4JJ7A 4KH0A 4NAHA 6ADHA 1VB5A 1FC0A 4GL4A 3BEDA 1UMBB 1P17A 1ST3A 1TVCA 1ZHHA 4GWLA 4HXFB 3ZHXA 4DQUA 5DGTA 2GA8A 4MV9A 3CKMA 3U80A 1E8DA 3OY7A 1X19A 3OEED 4ZICA 2HX1A 1G5PA 2VFAA 1FX0A 2P0AA 3JQ7B 4O3FA 3AY7A 4N65A 3ST7A 4BNXA 3SSOA 3GP8A 1U0JA 3LFTA 1AKVA 4OKIA 3AHJA 4MQ5A 4MYUA 4OJMX 5LUBA 4B6PA 4D4HA 4OQYA 1T5TA 2J5XA 4PAWA 5GTDA 3EUFA 3CZ5A 1YJ5A 3GX1A 3ZGOA 4ENWA 1X1TA 1YVRA 3VAYA 1J6UA 1EDEA 2CFSA 4DV0B 1XTIA 3LXXA 3HKBB 3QVKA 5AJUA 1RYEA 4F12A 5AVYA 5E7JA 2J3DA 1X3LA 3LBFA 5KREA 1SVUA 1GZ6A 2UZIR 5JXIA 2DHEA 1VKJA 3KJQA 4DAEA 4L5BA 3OTGA 1BJKA 2OHJA 4UARA 4YDSA 3L8YA 4WNAB 1ODFA 2W8BB 3RTDA 1JHZA 4ZPXA 4CTOA 5CLJA 4ZEOA 3UK2A 1OD6A 4DBZA 2C00A 4FZ3A 5EXTA 5FNVB 2VN8A 3Q8XB 4UXIA 1HPLA 3ZIAD 4DL9A 1IN6A 4RACA 2ATEA 3QEAZ 4RPCA 5TC4A 2FWMX 1JAZA 2R68A 3DUWA 3EVTA 3MTGA 4PAGA 5JNVA 3EGDA 4JLNA 3K2EA 4KGXA 2NQTA 5H70A 3OKCA 2ORVA 3EEOA 2X1MA 2BH9A 1GUZA 1UCFA 2FWIA 4L8FA 2X7HA 2A9FA 2Q7DA 4M1ZA 2PNJA 1OFVA 3ZXXA 1SGWA 3ZDZB 4DUYB 1SCKA 4OOEA 1QFMA 4Q7EA 2PAAA 2WU3A 4RCZA 3PT5A 3S40A 3GGDA 4OHBA 1P2GA 1X1RA 3BK1A 4BMXA 1U8AA 2CEKA 2CUNA 4U2GA 1UXGA 2BMWA 2FPIB 1HYGA 5P21A 2QRNA 1SBIA 2DTDA 1H6CA 1PGQA 1N2JA 1U3UA 1T2UA 1TIBA 4RSHA 4BBAA 4C2UA 1AZSC 4FZJA 4UXHA 5CHYA 4IEFB 4BNYA 3C0KA 2ABWA 4TL9A 2C82A 4P3NA 4Q4AB 3UZUA 1UBCA 1JG1A 3UKJA 5CRIA 4JJIA 1NUPA 4D0NA 3AHHA 3V6MA 3ELBA 3P0FA 1X13A 3WGZA 3D8BA 3FRHA 4E22A 5HOQA 4HCJA 4EMSA 4E15A 1I1HA 1DINA 2JLRA 5A3RA 4DIFA 1RCUA 1CCWA 2DPGA 1BGXT 3REGA 4DNPA 2YVAA 3IPYA 2E6UX 3NH9A 3SEFA 3CVYA 1MEOA 3IUYA 5LB2A 5H8WA 1QLHA 3RIEA 3URKA 4II7A 3RROA 1E0DA 4AB1A 3EFHA 1UANA 2EFHB 3IV6A 2BEWB 1DKNA 2ZT6A 3JALA 3JARB 2CLDX 1W581 4DG8A 5KOJB 5IWAB 4OHYA 4H7IA 4N5MA 2R0QC 4NXNB 2R6CA 1TZKA 2A5JA 2QLLA 1YQ9A 4NE7A 4JYBA 2PIAA 3NAMA 1S1CA 1IM5A 4H31A 4I1YA 4XVQA 3W6UA 2W8BA 1O03A 1LXCA 4DLNA 1S9DA 3G1UA 3Q85A 3DCIA 5JZ9A 3W79A 3AFMA 3CR8A 4M1MA 1EUZA 4Y1FA 5LYJA 4TMYA 4B6RA 2A5FA 1KAQA 3WGGA 1ADYA 1GSOA 2B36A 1THTA 2F8LA 2XDAA 1SNYA 3O90A 4G9BA 1KDYA 5CFMA 1OA1A 3INNA 1LJ8A 1AN0A 1WXGA 3GGOA 4JL5A 3N8KA 3ZGVA 4XM2A 2Z30A 3ZUPA 2HMSA 5C80A 3NDJA 1X38A 4H3VA 1GZUA 3VOBA 1GOTA 4AJ2A 1PT8A 5CUQA 4ARSA 1FFYA 2E4AA 8LDHA 1VBNA 3HPQA 3QITA 1T29A 3DGFC 1G19A 3LH5A 4QNNA 4CLOA 2AXPA 1JU4A 3BHMA 2NZXA 2FN7A 3BTVA 1YDFA 3OICA 4JEMA 5M29A 4Z53A 1ESZA 1B8NA 1NXPA 1AKUA 2DHRA 2MYPA 4MO9A 4DW8A 2OTCA 3UB4A 2IXGA 3BB3A 3IUPA 1H3FA 3B2NA 3W04A 4Q1CA 4KGZA 5ESXA 5BW8A 3CGWA 2IYOA 1R5OA 3IBGA 2RBEA 3NAQA 2ILTA 2VJMB 4NV0A 2E18A 2XQIA 4GI5A 3KT6A 4TMZA 2O19A 1ZH0A 3F98A 4URYR 4PZEA 3RHFA 1L8AA 2A9PA 4YRSA 2WM9B 2WQ7A 3DZGA 1QH8A 1CE8B 4M9RA 4BLUA 4UU8A 4KKVA 2UXCB 1VBMA 2VT2A 4NG5A 1PLKA 3ETLA 3NBFA 5F64A 5FD8A 3VUFA 1AMOA 4AY2A 1ETHA 3MD9A 1FFDA 1JR3E 1ELOA 1U1GA 2GSDA 4BFTA 4BQEA 5HZKA 2W4QA 1PNRA 3HA5A 3LP8A 3UW3A 4XVUA 4EA7A 2LKDA 2V7BA 3N5CA 1ZIDA 4KX5A 1D04A 1BS9A 2WVHA 4PPNA 4S3MA 5CLLA 4HYQA 5EP1A 3V80A 1QIJA 1W76A 4C30A 1EXDA 1CUCA 2RAFA 1CUFA 2I2BA 2Y0EA 3FVRA 5G3YA 5KOJA 1GITA 1Z22A 1RWNA 1TCUA 2RKWA 5ADWA 4UUPA 2GAAA 3EVNA 3NBZC 4D79A 5MN5A 2OORA 2MR6A 1ZW1A 3MGGA 2RGRA 4NYMR 3C8MA 4G5GA 1SVSA 3RFUA 3VDMA 3RVJA 5IM4A 2YWHA 4BCDA 3CJTA 3IIJA 3L1UA 3HMQA 3QVGA 4JLWA 4WEQA 2WDPA 2FDXA 1XSEA 3I32A 2I7XA 3VKVA 1F20A 3E2PA 3TUIC 2DBRA 2PH1A 3PQ2A 4UE3S 5AKGA 2H0RA 2PMDA 4OUDA 5ESWA 4CFSA 3SVTA 3M3DA 4MPPA 4DCJA 5LZ9A 1TZCA 3QG1A 3P5SA 3THXB 4LYHA 3S2EA 3F7NA 1DUIA 3UMBA 1YRLA 2IUTA 3FSGD 3T9BA 4XYLA 5AVWA 4DVGA 5HF5A 2NVWA 1G7RA 3OHPA 2PXAA 5LOVB 1PSDA 3EFOA 1DQYA 2AG1A 3HV0A 1E5VA 1XZMA 1ZIXA 3HKDB 4RMGA 3P52A 4C6RA 4MX8A 1G8GA 1FSZA 3N2KB 2IUSA 1GPWB 4Q6BA 4R16A 1CUJA 1U2PA 5DO9A 5AK5A 5K3DA 4J3NA 4A91A 3H5OA 4AS3A 2HK8A 5FT9A 4O25A 1EVQA 1ZC4A 5A4FS 4GC5A 1XT6A 3RB8A 2BH2A 3AW8A 1RWMA 4L76A 2B8WA 1LDBA 2I87A 4QOEA 4G6ZA 4PLVA 1YACA 2O2CA 2VJMA 1JDNA 1ZD3A 1EKXA 3V2UA 1CJUC 2H1VA 1N7GA 2WSYB 3M1LA 4M9SA 1NMQA 4P3PA 4AJNA 3BFKA 3GRPA 4C0JA 4MW4A 5K4GA 4QDKA 1YZVA 2QX9A 1XYVA 1LDYA 1HDZA 1E5TA 1R6VA 2QZSA 2ACKA 3DM5A 1KBOA 4QPPA 4F3TA 4YJGB 5CYGA 2EF0A 1B6SA 3ZE6A 1EFTA 2W00A 3VH4A 1V1MB 3L06A 1HNWB 1GZ5A 1XAHA 2FMUA 2FUG6 4K6CA 5HDBB 1NQOA 1Z4QA 3LS2A 4BUJA 3V4OA 5LLDA 5BN4B 2B94A 4QXPA 3Q8MA 3K9BA 1Y5LA 2XE7A 5JLJA 2WLTA 4BY9E 3AQIA 2RDMA 2NPIA 1PT7A 1IZ7A 1D7OA 2A67A 2Q3BA 2V9ZA 2V74B 4LOLA 3M6WA 4A1FA 1IPFA 2G7ZA 3O9ZA 4PHFA 3TI9A 3KSMA 5LQKA 5JNUA 3KKQA 2JCYA 2Z8YM 2W6OA 2YW9A 1V16B 3BWCA 3KYIB 1MT0A 4DNQA 1HI9A 4ZT4A 1PUJA 2A5LA 5BR8B 5DIFA 1LI4A 4JROA 1FP4B 5DTJA 1D3AA 2QLJA 1FDIA 4TKZA 1C9KA 2W4IA 5T41A 5HPYB 2A3RA 1F14A 3ZCVA 1AZWA 1DC4A 3O4VA 4QDXA 3HEMA 4AO8A 4BJ3A 5KQPA 2HJSA 4BXOA 3PA8A 5HTKA 3TEMA 3W2FA 4A6DA 1S7GA 2X4IA 3FX2A 2IXFA 1DAEA 2PS3A 3QU5A 5A5FA 1NF3A 2ZPAA 4BIIA 5BT8A 4RZXA 4C4XA 3GOQA 2WYHA 4OQNA 2AUTA 2ZPTX 4HQKA 1VRCA 2VHUA 3IVXA 4P80A 5BQ5A 4ZCSA 1ANKA 3E22A 4YJFB 3H9BA 4HGPA 5J58A 3CH6A 5LOVA 4QAQA 3P71T 1O95D 4DHWA 2WWHA 1FTSA 3G2IA 4QTZA 1ISMA 4AJKA 1AGRA 3F71A 3VH2A 5BW6B 2H92A 3OU2A 3N2KA 4PLTA 1MX9A 1X9GA 2DETA 3K72B 5JFGA 3A3KA 1DX4A 1WXFA 2OCYC 1C0LA 4HTFA 5HRUA 1NKSA 3INGA 3IEXA 2NXJA 2F43B 3NVDA 3OZIA 4I08A 3RTCA 4KR9A 2FZGA 2VDLB 2LZ0A 1IYZA 1L3IA 3FUTA 5TGDA 1V8FA 4RY2A 3L8EA 4TLMB 1NW6A 3BSFA 4ZAGA 5BSEA 1HFEL 5IHXA 2Q3MA 3O03A 1N1DA 4HN2A 1JTFA 4ZA2A 5B5SA 3KWLA 3FPSA 3NV9A 4YJGA 1M67A 2XIJA 1B2LA 4ZV9A 1G66A 1KDOA 1PK7A 2V7QD 3BHIA 2V58A 4WVFA 3BXOA 3FPKA 1Z37A 2C4HA 3K9QO 3PP8A 5LMCA 1P1BA 1YI1A 1K8ZB 3L0IB 3TRHA 3FHLA 4F86A 1O57A 4KDCA 1J21A 3Q98A 4CDGA 1C1XA 3FG9A 4JLVA 4O4IF 3LW8A 4QTUB 1AOXA 3OPNA 4AS1A 3TPFA 1WCIB 1HSZA 1OWMA 4GSYA 1GPAA 1L7MA 3A11A 3SKVA 4PLFA 3STHA 2COUA 3ZDXB 4CG1A 3LO8A 2J7PA 4KQ2A 3UGKA 1SUFA 3HJRA 3DFMA 4GM4A 3WWZA 2A35A 1EX9A 5FUMA 3O2SB 4LDAA 2EJUA 4H7JA 4WCDA 1G291 2A0FA 2J4FA 4FE7A 5G1NA 3GIWA 4O1MA 3IILA 5IBRA 4HH1A 4IGFA 5LYJF 3NWOA 1RYFA 1VDMA 1BHO1 1Y3BE 2E4YA 4X64B 5DM60 2Q5IA 5AMXA 3U1VA 5KNLA 3FDZB 4U0KA 3B52X 4UTXA 3UKOA 1PS9A 3NHUA 3SBOA 2AKEA 1TAHA 5EKTA 2WJHA 3UFBA 1RI5A 4CCYB 2RK6A 3OCJA 2Q2NA 2YH2A 3FGOA 2NW6A 4Q19A 5KJFA 2DU8A 2EFCB 4TM8A 3GPCA 2OVFA 4KRGA 4UTPA 1ODJA 1ZD1A 3ROQA 1FNNA 3G2PA 1D4OA 3A2LA 2RHGB 2VHTA 1RADA 4YJFA 1A5BB 4D9JA 1XJWA 4GG1A 3KB2A 4PZPA 4MVJM 2RGGA 1KK0A 2FWPA 3ND7A 5FV4A 2JI6A 3MCTA 1K4YA 4HJRA 4PBRA 4ZTUB 1EUCB 1BJTA 1YQXA 2XECA 2XQJA 3K32A 2OEPA 3MJVA 4D4MA 5IDYA 3MG9A 3PWZA 1PEKE 1XQVA 5DHQA 1QQTA 4PYKA 4XI9A 2VHZA 2PZ8A 2QNIA 3KU1A 2QM7A 2Q5EA 2QROA 3I01M 2L0XA 4RHFA 1U5AA 3KHSA 1DT5A 1ZRHA 3OEHD 1Y89A 3JQEA 4EJMA 1J5PA 1TAGA 3P9IA 3KQVA 3NBYC 1WV0A 4I4NA 1PAUA 1EEHA 4Q00A 2CVFA 1CR6A 1Y0BA 2HV9A 4RH0A 5JJBA 2WHEA 1SH7A 4DIDA 1Q1QA 5D5QA 3KHKA 5JH7F 1D2EA 2CVPA 4C43A 4F4IA 2HTEA 3E48A 4XX0B 1QTQA 1NY5A 3FZEA 3HVHA 5HBGA 3N6VA 4ITRC 3V3KA 3QE9Y 3AR3A 1ZK2A 4JEHA 4WFIA 5FFNA 1N3LA 3Q2IA 1GZVA 2FPPB 3E5MA 3IOMA 4Z1MA 2QYHA 2M32A 4FFWA 2ZUFA 2EP7A 1MC8A 2FZKA 5L3ZA 1PE0A 2ADFA 1JDTA 2EKBA 3KX2A 1FYEA 5FOWA 1CZLA 4OJYA 1YA6A 1O6FA 1WCIA 1XDSA 3BJRA 1NOJA 4V0NA 2O2DA 3PUZA 3H8JA 5EXXA 5G4KB 4YV2A 1P6UA 3ZIDA 4NFHA 2CLSA 4PTZA 2EV9A 1TYCA 5IM4F 3DOJA 1BC5A 1W25A 2D0PB 2WG2A 3IOYA 4IR7A 1QAMA 1UWLA 4FYVA 4L3WA 1ZSNA 3O4FA 2O50A 2OOSA 3AIOA 3U3MA 1QJ4A 2J6HA 3DMDA 3VJRA 5F35A 3K6SA 2QUZA 1CUEA 2AN9A 5JAQA 4EI9A 5AKEA 2EHJA 4F2PA 1FFXA 3HG7A 4RU1A 1TIKA 4RANA 4V2UA 3LQRA 4GS5A 4NNOA 2JA1A 2FX3A 1TMGE 4Q3CA 4CCYA 4D6YA 3HBFA 4QJ4A 1ZZGA 4C7OB 4X20B 4R2WA 1KC1A 2NTEA 3CUUA 2QVCA 1NM5A 1AZTA 2D5AA 4II3A 2ODQA 3GNLA 4CEJA 3OZBA 2GZMA 5FWYA 1DRUA 1JKFA 1VCNA 3EZ7A 3ITEA 1P3DA 4ALJA 1G7CA 4BFSA 4EFNA 1TFUA 3WWOA 3E9YA 3KQTA 3N8HA 4ZT5A 4PF1A 2JL1A 5BV7A 4IW3B 3PKZA 3UVEA 2OFXA 4L8VA 1IWBB 3G5AA 3L0DA 3DL2A 4NV3A 1HTBA 2VHWA 3ZNPA 5JCOC 1FFHA 4M21A 4YQFA 1J9ZA 1KWKA 3WOHA 1X1AA 1KDZA 4R2IA 2IOHA 2YWGA 5HE9A 2G82A 2HJRA 1ODSA 2JHAA 3OT1A 1EJ0A 1O08A 2E89A 4LDRA 4ZAXA 1LX6A 1IDN1 3G2NA 3OVMA 4P4NA 3AJRA 3DVSX 5EEHA 3TQFA 2VF4X 4BMOB 2X9QA 3QIVA 4LYAA 1MP0A 3TD2A 2FZWA 3E9CA 2OZPA 3AEKB 1A2KC 3AR8A 3GDFA 2JLWA 4L7QA 2ODNA 1Q0TA 3G0BA 4ZYXA 2RSLA 1ZMTA 3NHAA 2X22A 2X9VA 3BICA 3L0OA 3KXKA 4B75A 5ALVA 3QW2A 5CAEA 1QDEA 2RGEA 3AFHA 1SQFA 1N8KA 3D6UA 3CZAA 2NYRA 3D8NA 1FU8A 1XR3A 3K0FB 4WX2B 1L4FA 3OQBA 5G4KA 1OWLA 3TDKA 4EHKA 5IABA 3VPBA 2X40A 4B3CA 1M1NB 3LCMA 4F45A 4NBWA 1SAYA 1NQWA 4B81A 4BV8A 5L95A 3TM5A 4ETIA 4X00A 3JV7A 3MHTA 4E4TA 5ESRA 3VPAA 4JL6A 1SVKA 1GG9A 4RZIA 3LFHA 2VQDA 3RS3A 3IJPA 4K9KA 4OL9A 1XZ8A 1NBWB 2ACWA 3BZWA 1JKIA 5A5VA 4LRUA 5IVDA 1UK7A 3IPXA 2R8YA 4Y6RA 4BBZA 5FBLB 4X20A 4YUXA 2F3TA 3L6EA 5HF6A 3HO6A 1E66A 2G1KA 1QRAA 1RMTA 1Z7WA 2A30A 4LQ4A 1R0SA 4DSNA 2WYVA 3IDAA 3SICE 1VL1A 1B41A 2O1XA 4BQOA 1UMKA 2NXCA 1OLUA 5ECWA 1T8SA 5DIZA 5AQ1A 4BMCA 4Q7MB 4HXEB 1BGWA 1YOVB 5IYZB 5F9FA 4C7MA 1ZN7A 1ZNWA 2IY8A 2JCVA 1CRPA 3SKYA 2JVJA 1QHYA 1RM5A 2P4EA 3S55A 3ZDYB 4X7RA 3AVWA 4TYQA 4MA0A 4H1HA 1YJ8A 2PD6A 2NU6B 5CVUA 1NUQA 1NY6A 2B82A 4LV5B 4WLUA 2OBBA 3F7OA 3MJHA 4EPTA 3BD6A 1BW9B 2BGMA 1GCGA 2HWXA 4TLEA 3MJCA 4EPWA 5EFZA 3VRHA 1SO8A 1QQ5A 3MUEA 1DAIA 1DBRA 4ZCLA 1XHEA 2DVMA 3MCUA 2BRUC 3KJGA 1KJYA 3QF4A 3OOSA 3TBKA 2XTNA 5L3SA 1WP9A 3JRXA 1H2WA 1NOIA 4FGLA 4GPZA 2J3HA 4E5UA 5IJWA 2JBWA 1ZL0A 3SP1A 5EJIA 2VXOA 2VAMA 3PEEA 3WJ1A 1EB8A 1WG8A 5EVJA 1W75A 5HQ3B 3LHIA 3S4YA 2BHNA 4B71A 5E6SA 3IP5A 1BAPA 3P4UA 4U7PB 4A73A 2J3IA 3KB8A 3P1JA 1ZLYA 5ECDA 1QO9A 1T4GA 2IS2A 2Z2IA 1QHGA 3KKKA 4JJ4A 3M0EA 5FWXB 2FEMA 4EY6A 5IEJA 4I9FA 3AF6A 5CX1B 2XLBA 4Q4HA 5KQGA 1R8SA 4TV8A 4B79A 5G0SA 2C04A 1A95A 4OH7A 1AXEA 1GPMA 2FMFA 2YXDA 3SQOA 1JR2A 1M8JA 5DCYA 1VHQA 3WIEA 5IBCA 5JCJD 2HYDA 1RAHA 4DPMA 1PYDA 3DBRA 3O26A 3FKQA 5IFKA 1BSVA 2HLDA 4IUYA 1HOXA 2DF8A 3VR5H 4AAYA 1ORWA 4CLRA 4CEHA 2H7CA 4JT4A 5JUWA 5FLYA 2D7JA 3RSSA 5AVZA 3EGIA 3VYTB 3CMCO 2PJDA 3D8HA 3K6JA 3MM4A 4IDOA 4O1IA 1ISGA 2P6OA 1L8QA 3OIYA 2FEPA 2HA5A 3I4FA 3MF4A 2HGSA 3UA4A 1YOVA 1H0SA 2XY4A 2R8ZA 4FDUA 4LWOA 4TV9F 3OIWA 4R41A 1IB6A 1MO6A 4LYEA 3VJMA 3L7LA 5ITSA 3O94A 5KB3A 3N2NA 3BXPA 1P7CA 4YRJA 2JJ2A 2HC9A 2YIVX 1GFIA 1P5FA 1PG2A 4NONA 5DWVA 2X8AA 3O5AA 3HR4A 4TT8A 3TLGB 1BX0A 3Q7RA 4BFXA 5DP2A 1JNXX 3HWX1 2NU6A 1CP3A 3DDOA 5F5NA 2B7BA 2YR0A 3D4NA 3DPIA 3ANMA 3M6IA 2WINI 1J22A 3LPDA 1M1YE 3M8KA 3VU3A 3PVCA 4I7EA 4B74A 1BW9A 1DG3A 4GD3Q 4EARA 1QX3A 2XTZA 4W1QA 1E64A 2E3JA 2YWEA 3COWA 4HNHA 4QEDA 3O84A 3IC5A 4WKCA 5JBQA 1GN8A 4FS8A 3PFBA 2H0QA 4BNDB 5UKDA 2FYTA 2HMAA 1VJDA 3IMGA 4MSUA 4CTMA 1JQJC 1Z8NA 1CY6A 2VDOB 4BUCA 3OZCA 4ZT7A 3ORFA 3LX4A 4HUJA 2YWDA 1E9SA 1U65A 1JV2B 1KF0A 1KH2A 1U7WA 3T7CA 4G0NA 3TTXA 5KKCA 3DHWC 3B6ZA 1OLXB 4X1YA 3TB6A 5HQ3A 4WNYA 2Q1WA 4M0FA 4CJXA 2QJTA 5EJ8A 4RY9A 1J2EA 2Q5FA 5H7XA 3L1JA 3PDUA 3EQ7A 4U9HS 3RUAA 5FR2A 2W2LA 3ZHVA 3K94A 3NVAA 4N8EA 3H9EO 5FWXA 4OHFA 4X7MA 5IG2A 4QFCA 1BQ4A 2I9PA 3RAEC 1KEKA 2BUAA 2O8DA 4Q1VA 2OFOA 2WILA 1RDFA 3OZFA 3GJ8A 5HJ2A 3RO7A 3V97A 4B17A 4WBNF 4MRRA 2YUIA 1MA0A 3GFOA 2XNDA 4K6HA 4ZU3A 5TT1A 2YIDA 4D97A 1XK6A 1JHMA 2X0RA 2IZOA 2DC1A 2O2HA 4RHUA 1LBQA 1S0UA 5ICFA 4D9CA 5LXTB 1OH8A 4ZAFA 4CKXA 1WW8A 1TJYA 3AERB 2BKLA 5DB4A 3GPLA 4LY0A 3I5AA 1EGAA 2XCRB 3LIPA 2HZBA 4ZGBA 1EUYA 4F72A 1BVHA 5DYTA 3X0DA 1AK1A 3BGIA 3R3XA 5CD9A 1EE2A 1TJPB 3L8GA 4I4TF 4Z99A 1AKTA 4KNVA 4L50A 4ZOEA 3FBTA 1NM5C 5T3UA 5IXYA 3UHJA 2VHCA 2C7OA 1Z4OA 1D4ZA 3M6FA 5HZHA 3L6CA 4IAOA 1TO1E 4DNXA 1JYSA 1AF4A 3K5HA 2PXCA 2CUTA 2AVDA 3B8HA 2UKDA 1SCBA 3I2YX 3LKDA 3O95A 4G0QA 3LHKA 3STXA 3G2MA 2AD1A 3GEMA 4A0FA 4GT1A 1YDWA 3WWDA 3MN1A 1UZLA 1Z29A 1AQYA 3SCZA 1JB1A 3V1LA 1ZCZA 3K1ZA 3QJYA 1CB0A 2D2EA 4R2KA 1UM8A 4NENB 4OXQA 4RS4A 1ND6A 1R74A 2XZOA 4IP0A 5H3LA 2WWFA 4GMFA 1XDZA 2IPLA 4JASB 1VHWA 4PE5B 4CMEA 3AL0C 4LCEA 5CT4A 5LBTA 5IJ9A 1AMUA 1ZONA 2ET6A 1T2CA 1Y5NA 1ONNA 2PJUA 3CF4G 4X6XA 3GJ0A 5BQXA 1B14A 3PYXA 3C3YA 5DN9A 2NSHA 2VHXA 3MT7A 3P0IA 1RQRA 4KH1A 4LTMA 4BFVA 4BLSA 3L02A 1DFIA 4YA6A 1HQCA 5TQ0B 2XSZD 1T4MA 3MLEA 1XMOB 2BKVA 3UXEA 3B3JA 2CLHB 3QLUC 5T4EA 4ZHQA 1D07A 4V1CB 3IH5A 3GLIE 2ESRA 1JRLA 1E32A 3KJIA 2HQRA 1EINA 3FLAA 4YUVA 3IR6A 3LV8A 4HVTA 3I37X 2NIPA 5DGHA 4Y9RA 3SYNA 3UAOA 1EWYA 1SXHA 4XIYA 1GPDG 4LWZA 4IKEA 5B58C 4KIWA 2P0EA 1WRBA 5C32A 4F7DA 3K8YA 4J0FA 1GRRA 4DQDA 2PWYA 5TQ2A 4KXWA 4QT0A 3P94A 3NKLA 1SCIA 1YMVA 1CUZA 4R1LA 5LXTA 1X0VA 3KTOA 2XUFA 1R6BX 3P9XA 1NRJB 3AERA 3VV2A 2Q1XA 5DNYB 3SWWA 1QQ7A 2X5OA 4L5AA 1YCGA 3PFWO 1AT1A 4PQRA 3TQSA 3CWZA 4ZCMA 3M9LA 1M6VB 4LCBA 4GI1A 2H1WA 3HCBA 3G8AA 4Q3KA 2W2KB 2OMEA 4K46A 4CI9A 3FGZA 1R0RE 4CZ2A 4MRMB 4IWNA 4FGSA 2AEFA 3WB0A 4R5MA 3B38A 5TMDA 3S7ZA 4EAQA 2HW8A 1A82A 2IF2A 3FKSA 4XLZA 3TVYA 2EJWA 3V8MA 1RHUA 2RH4A 1TCBA 1Z3CA 3COYA 4EKGA 1US8A 2X3YA 1EA7A 3KZNA 3PJGA 2OO5C 3BGDA 2I4TA 1ZM3A 4P4SA 3OJEA 3DQZA 4DRYA 1ZN2A 5ICGA 4KR7A 1M2GA 1ML3A 1ABEA 1RXUA 5JALA 3TZBA 5DF1A 1Q7CA 2J3KA 3CEHA 2CXUA 3GEDA 4KQWA 4KLRA 1EH5A 2AGVA 3TGWA 3AOGA 1LNQA 3I2KA 5JDCA 3TO5A 2EIHA 4ZC1A 4C6SA 5JSQA 3ZQ6A 2Z6AA 4W1SA 1XL0A 4N01A 3OSZA 5KVCA 2W98A 3C7KA 4KI0A 1FUYB 1KS9A 5TQ0A 4DR7B 2QQGA 3HDQA 5IK2A 3P27A 4R1QA 4AWAA 4CL0A 2R6GA 4EEKA 3DUFB 3OZTA 5JAUA 4V1CA 1BOFA 1R0YA 5JSUA 4YRAA 2YDYA 3UJCA 3CF4A 4C7BA 4FSHA 1KO5A 2PD4A 1FYXA 1NSYA 5EIBC 5BSUA 3ZWMA 1Z4MA 1RXVA 1UPUA 2PVCA 1D1PA 1XHFA 3RANA 4HNQA 2ZVDA 4NF2A 4WNCA 2H1IA 2PGIA 4LXXA 4X44A 4UOZA 4O2AB 1FNSA 2CXTA 4MP3A 2UYYA 4KO2S 3DOCA 1ORRA 3H9GA 4PPYA 3ZCPA 2BMEA 1H1DA 4CKCB 3FZGA 4P58A 1LW7A 1O97C 3DKPA 2PMEA 4AKIA 1OKKA 1P2UA 2GYVA 3IQZA 4RK4A 2I7VA 3ZYCA 1JPNA 4O4LF 3C8ZA 5C5IA 1NVDA 2F1KA 2H2HA 1L4EA 2XRFA 1A5SB 3E5NA 3PNYA 1E1QD 1JIKA 3CH5A 4B31A 5IUNC 4NPHA 1UPCA 4BECA 3P9RA 2O3TA 1MB0A 1JSCA 1XDBA 3QPDA 5L6MB 2HSGA 1DCMA 3CO5A 1M6VA 2VRCD 2VDVE 5J5CA 3B5EA 3ZZUA 1R6DA 2X9GA 4QOFA 3HMKA 5DDIP 1VKNA 4UPVA 4LF8B 2JAHA 1SKUA 1SHUX 3MNFA 5JDIA 2WICA 2CL6X 5D7NA 5F2EA 3U2QA 1OT5A 4ZN6A 3F8SA 3IDSA 3WBBA 2PEYA 4FILA 3PDIB 1ECLA 3FPBA 4XDZA 2Y66A 3QVSA 2F8MA 1QRTA 1Z17A 4RD4A 1JWAB 2PUWA 3F47A 1IVYA 1GQSA 5A0FA 3RD5A 4BC0A 1OROA 3I8XA 2W37A 3P0RA 5A5GA 2QSZA 3BG5A 2JLUA 1V11B 4KR0A 4QWMA 5EC8A 1RAGA 3W05A 5F1OA 4EHNA 1NE2A 2XRMA 3HZHA 4PGFA 1XLWA 1AQJA 4KR2A 2AB0A 3KOYA 2G8LA 4ZT6A 2ZRBA 1IY9A 1I2CA 2JFFA 1E69A 1REQB 2Q07A 3DZCA 3MK31 4I6EA 4QJBA 1MAVA 2FRVA 2OCDA 4C0XA 1W6UA 4CM5A 1F7UA 3A4YA 5H82A 4G63A 2ONCA 3L0CA 5HXAA 1PZFA 2XVZA 4XB6B 3E1GA 2C5FA 4OATA 4B3BA 3AL3A 2CV2A 1A7JA 1BRMA 4NMWA 1AKWA 1Z82A 4JNCA 3EF3A 3GGPA 1UBOS 1W93A 2Q6TA 4GX5A 3NTXA 1A9XA 4BMNA 3MPOA 1NW7A 3ETDA 1YZUA 3QPAA 4BO3A 4RTQA 3FNGA 3IAFA 4Y1EA 5HF9A 4ESHA 4ISBA 2C4MA 1E77A 1ISHA 2I6TA 2WB4A 4J9VA 5T4BA 1TEVA 1WB9A 3HY3A 3P9ZA 4X63A 5A71A 3UMYA 3E8SA 4O2AA 4COKA 4Y6QA 1Z5PA 3CW2A 2ZR8A 4L4SA 4G5HA 3B3AA 1Q7TA 1PDOA 2JGNA 4KQGA 4QPCA 2J87A 1T0HB 2XI4A 2D59A 3QVUA 1KAEA 1BXZA 4Q4JA 1QH1B 1XD8A 3VR6H 4Q1FA 3FF1A 3NBUA 4CDNA 1UWCA 4BLOA 5CEFA 5DLPA 1ETUA 5F2NA 4PPGA 2CNBA 4XR9A 1H5NA 1NFQA 2MIIA 3JASB 1TW2A 2X77A 2VBGA 1M2HA 2W0SA 1NC1A 2VL7A 2XUZA 5CFLA 2GLXA 4UMFA 3TZQA 3O2JA 4LOHA 1Z56C 4N8SA 4UU7A 4C20A 4F4JA 1J25A 1MNQA 1XLTC 4DC0A 3MWDA 3PNVA 1KZ1A 1Z62A 1ZUHA 3HDYA 2Z3WA 3PDIA 4D8WA 4HWTA 2VJAA 3KU4A 3UXMA 4C5AA 4KREA 2C5LA 1AQUA 4LOJA 3SX4A 1B3BA 3KZVA 4DCUA 2ZFUA 3BGVA 1E60A 1YC5A 2BF4A 3BH0A 4ZRMA 3EGOA 1XMPA 1V11A 4E30A 2QD1A 4KE8A 1XXLA 3L7YA 1IOVA 3U7QB 2YV4A 2QS9A 1VI5A 3K0CA 2WP8J 4C0HA 3IDQA 5D01A 1JFFB 4DG5A 3DHVA 1NJ2A 1UFRA 2MSLA 3R3YA 3T4UA 4OYRA 3VISA 1MHTA 3OPYI 5CPBA 1AC5A 2RHCA 2HF7A 5JVDB 3T95A 4EDFA 1CKEA 1X70A 4XEUA 4GYYA 3U4IA 1L7RA 1OXSC 1Q11A 1C8VB 3X1DA 5IAEA 5BNTA 1C0PA 3OQJA 1AF7A 2C8JA 4RHEA 2V3WA 4J6EA 1XEXB 2ID7A 3D3JA 3HV2A 2YS6A 2IKQA 3SFZA 1WMAA 4PSUA 3RJTA 2PKWA 1EFAA 4IRMA 1XRQA 3EVFA 4KYUA 4UMEA 1WLYA 4OI2A 1ZGCA 5CK4A 2F8SA 3PENA 3DHNA 2HQSA 1U0GA 4O4JA 4R8KA 4NJOA 4UE2A 2JCBA 1EFKA 4D3XA 3O74A 1VTKA 4N0QA 4PO8A 2BL4A 1TE2A 3A6EA 3O91A 4D99A 1Z35A 1OFUA 3ONNA 3OLZA 3UY4A 3ZWQA 2WJAA 2C77A 2ORIA 4B33A 2Z6QA 3HA2A 4LFBB 2WT9A 2DT8A 1FTQA 2V9CA 3LT2A 4KXMA 4OBXA 4W5TA 3UBTA 3NVKI 2Y4NA 4JOSA 2O7RA 1JQ5A 2DWOA 1UBEA 5A6VA 1CD5A 4AZ0A 2VZ8A 1C0KA 1LW6E 1ENYA 1NT4A 2H7VA 4EYSA 3IKTA 1HXHA 1PK8A 3JASA 1M72A 3M89A 3V42A 1W6RA 5EYPA 2H18A 2J1LA 3M2PA 3PL1A 3UV7A 1DIGA 3IB3A 3JYPA 2H5JA 3ZWKA 4S04A 1DL5A 1K3UB 2NUPB 2PZEA 1TOAA 2GEBA 4GRAA 4AT1A 1UAAA 1GNLA 3UTDA 4EB8A 1DNPA 2J3MA 1Y98A 4IV5A 4I9HA 5AJVB 5E2AA 1QIFA 3SLRA 4BWGA 2REXB 5AUQA 5B1SA 1HQDA 1VKHA 3HJCA 4MVWA 1NT2A 5EWLB 2P2ZA 4ZO7A 4JVOA 5K3CA 1VFNA 3ASVA 1PEDA 4RVFA 1Y3FE 5F98A 3B1ZA 1Z5UA 4HVLA 5E6UB 3PU6A 3EE6A 1SCNE 2JGJA 2VKTA 3LKVA 4C89A 3U3JA 2ATCA 2DQSA 3ED1A 2MDTA 3R5SA 4JDPA 4DWWA 1ZCBA 3AIMA 4MWSA 4MCAA 4KVAA 3QFSA 5CEEA 4PSKA 1HFWA 1OAOC 5L3RA 4C78A 2FEKA 1O7JA 3I6BA 4GRDA 5B1HA 3L01A 2PHZA 2ZI5A 4EYQA 4F38A 1RQLA 4RF3A 5EKUA 1ZM4A 2V96A 3JAWA 1SOVA 5KJ6A 2H51A 1TVKB 1R9GA 1N5JA 1RQNA 4MMZB 3EX7C 5GOTA 1SKMA 1X3SA 1PR9A 3DR3A 3JSAA 2QUBA 5FAKA 1BJRE 3Q6MA 3G8DA 2BFEB 3LBIA 5EHGA 5AFSA 4AMYA 3ICOA 3JX9A 4PS0A 3EDMA 4LZNA 1ND5A 4MJ3A 1EDOA 2EF1A 2PUVA 2HCFA 1UC5B 1PG0A 4WH0A 4X3CA 4TPKA 2ZUDA 4FLEA 1KOFA 3Q88A 1EFPB 1WOYA 1VLLA 1KBZA 4M7PA 3ZHYA 4E3ZA 3PHLA 4C2TA 4E2WA 1W35A 5EWJA 2PAFA 3WLTA 1EAMA 4BFYA 1LZLA 1P81A 3W9BA 4CKBA 2VAVA 3GRFA 1G3UA 3QBEA 1NW3A 1CEYA 3PUKA 2CLMB 2GB4A 7MHTA 3FYUC 1E0SA 4BEWA 3E2MA 1L5FA 5FP0A 1PBTA 3E6AA 2I7TA 5H68A 3DKKA 3OFJA 4KQ9A 5KNCH 4A16A 4UEOA 3JQGB 4UFNA 3HE3A 3LHDA 1FLNA 4D82A 2DE0X 3ELWA 4Q3EA 4GZ5A 3WIUA 1ENPA 1Z06A 1QYWA 1XVIA 2CB9A 1YKFA 1V9LA 2O0MA 4Q9NA 1QV7A 3O73A 3TIFA 1KYTA 1T36B 4HDCA 1YZQA 4HSGA 2C96A 4MW1A 1K63A 3FDIA 1HE8B 3M9WA 1GSHA 3FNFA 1SXJB 3QZUA 4QBHA 4Q4LA 4QYMA 3WNDA 4C7KA 3N2EA 1IY0A 1FY2A 2F00A 4Q5IA 4TMFA 4W1PA 2C83A 4KQKA 4D92A 2I6SA 1XE3A 2X7JA 4JBYA 4ZPJA 3S28A 1DCTA 4J0JA 3QRWA 4CT0A 2OHFA 3CSUA 2XMZA 5ICEA 4OA8A 5EWLA 4NABA 2GZRA 2JEZA 2VP4A 4FKBA 1PG5A 4HLDA 5A03A 2HIGA 1UZNA 4D74A 3MMNA 3C7CB 3K6RA 3VSAA 1WETA 3AY3A 4Y0VA 3VBEA 3HSKA 4IIJA 5BSRA 3ICEA 2O7NA 3A6FA 4DT1A 3TLKA 3HRKA 5E4JA 1U11A 4J0IA 4L74A 5AVXA 1GVHA 1MCZA 1Z0UA 1A9RA 1K88A 3BH6A 1M5UA 3EVGA 4G3XA 4P38A 2ZW9A 3I45A 5YASA 5CLQA 1GSIA 1F0YA 2YS7A 3I9NA 1KE2A 4EG8A 1CULC 1DKRA 1FVXA 1T8PA 2GZ2A 2KHZA 2QVXX 3QBTA 4QVGA 1F6DA 2V6JA 3CBGA 2EGGA 3UBMA 4DYDA 2VDRB 1QCYA 4UBKA 4G1UC 2GOYA 3OBBA 4BKQA 2UZ4A 2D1QA 1F60A 1U0TA 3LWDA 4C7VA 5CG2A 3AEUA 1P1IA 3R0QA 5DASA 4ZV7A 4IYRA 1SBTA 1A8PA 4DMHA 5JTTA 1WPRA 3ENNA 2IV2X 5FB3A 3ZWBA 2HA7A 2QTBA 1XQ6A 4FGJA 4KW7A 5HS6A 1WXIA 3QWHA 1FRZA 3TQIA 5K0JA 1TKAA 1UWVA 1UT6A 4K7JA 4RD2A 4UCFA 4HQRA 3RTGA 3V7WA 3VGPA 4CFYA 4MAMA 4H1UA 3UHOA 1QFZA 3P19A 2GRJA 2CXRA 5K45A 5KPJA 3UF0A 2VUTA 4KE9A 3G7UA 3D0KA 3HBAA 4C3UA 5BWCA 1FW6A 1K8QA 2V9PA 1Z5WA 1Q74A 2ZLBA 5IASA 1IXSB 3TFOA 1WKCA 1TD1A 1E3SA 5HJ7A 4R6WA 4JQCA 5IDVA 1H6DA 5K0BA 4JFAA 4PPFA 2NSJA 5FTWA 4YRBA 5K6AA 3A9TA 4DV7B 1X1DA 1KHHA 2XMDA 3MIZA 4WCVA 2JZOA 5TF4A 2H4XA 3UUWA 3VVMA 1T36A 1LWNA 1SQSA 4OMCA 3PLRA 4DQXA 2GNOA 4RTRA 4GXNA 2X41A 4JJ8A 2NZYA 3I58A 4LYYA 4MHSA 3SIXA 1SXJA 3CLSC 1D9ZA 1R5NA 2EEPA 2GDJA 5EXSA 5TJHA 4D41A 1HFJA 2Q3FA 3ULKA 3CRVA 1E6LA 3HY4A 3KQQA 3VZBA 2OBMA 2PMBA 3GMDA 4J1NA 4JK3A 4TN5A 3F9RA 1CDOA 1MV5A 1QKKA 2JEYA 2KB0A 3FW1A 1OWOA 2DFTA 2Y99A 5IN5A 4YRMA 1IEXA 2J46A 4Z5XA 3RR2A 5JI3E 3FOFC 1TVMA 1PQ4A 1RM0A 1R64A 1D09A 1E0AA 2ZI4A 4I50A 2JLXA 4ON9A 2GEJA 3P2KA 2EQAA 3VPGA 2H3HA 3VNQA 3OPQA 3C1TA 4C4ZA 1M2JA 3PVSA 4LCJA 5IP5A 2ZRFA 4GF5A 4KZKA 2P9YA 4WUVA 2D1SA 4HGYA 2H2AA 4WY5A 3ZBTA 3J81A 3T6KA 3HCNA 4DE5A 1HEUA 3VR4H 1J0DA 4X61A 5AI5A 4JXZA 1NA5A 1SXGA 3RIYA 3IAAA 4MUJA 2JGLA 1E4VA 2PUJA 5HTOA 3W9YA 2R8XA 4Q16A 4IIYA 5F76A 3GPBA 3WMXA 1U3FA 2Q2VA 4L4UA 3HGQA 2P3QA 1QMPA 1QIDA 2EKQA 3EXAA 3QEJA 4O4JF 4RPGA 5HIJA 3W5IA 1TLLA 1BA2A 1H23A 1O6CA 2GBPA 3LQQA 5TEWA 1T0IA 3RQSA 4TROA 4BGDA 1P0QA 1WL8A 2FMXA 3EGEA 4KXVA 5B37A 5JS2A 2ANCA 2YNMC 4HLQB 2J09A 2QW8A 1RXWA 4NOJA 5ALSA 3MPUA 1UFKA 4PVDA 4HRAA 4RMNA 3VR5D 3TN7A 4G01B 4RESA 4GDMA 1WE2A 4J2TA 3LDUA 5GZ6A 4GQIA 4F3RA 2CBXA 5JXWA 3GLFE 1NX6A 4Y2GA 4ITVA 2EP8A 4EP1A 2J7PD 3C4VA 2NLOA 4RTSA 2BHTA 4ALKA 1DIHA 4OA5A 4M9UA 2NT3A 3ER6A 4MAAA 2B8EA 2G9VA 2VJCA 5KTYA 1L4LA 5DCUA 3RM3A 4GOLD 3V8BA 1NRIA 3ELUA 3GCZA 5C4MA 1KFEB 5IULC 5A3JA 4UUBA 1FXWF 2I03A 2WWTA 5EOVA 1XD9A 2X2FA 2AOVA 2IW3A 3NT5A 4R7ZA 2KSQA 1ES9A 2PT7A 2HBZA 1OI2A 3I92A 4V38A 4OQ4A 1TCCA 3TLXA 2H4WA 3MJEA 2CVHA 3ZE1B 4IJMA 2YWJA 4LNUA 4BZWA 2W0MA 3ZC3A 4DA7A 1NURA 1M6NA 3SQDA 4L9AA 2IFTA 1KP9A 5DFAA 3PQCA 2FSVA 3D7LA 5BRAA 5JNTA 3NIDB 2PUCA 3C6ZA 1X7WA 3SHVA 2ANBA 2G40A 3DOOA 3IT1A 3KE8A 4G8CA 5LN1A 1AH2A 3RYHB 3FCAA 1RP1A 2I4NA 3OUZA 4RKYA 5B30A 1I2MA 1EBUA 4B3XA 2E5LB 2ZM6B 2O8FA 3RRYA 2VLIA 1VJ5A 1NP3A 2QNBA 1Z26A 2XNHA 4DQ0A 2GBGA 4PNZA 4B2YA 1E2BA 1RT9A 2LIVA 2A0YA 2XW6A 2QGNA 3OPVA 1RW4A 2P5UA 3IRVA 5DX1A 1IY2A 2FB9A 3I73A 3RLIA 3TJZA 3X1WA 5BMVB 4MJ7A 2EJTA 2PE5A 1XPOA 3WX0A 4PWYA 5DHPA 2XWSA 1E1YA 2OGWA 2ZP1A 1T1EA 2QF7A 4IQ8A 4JEIA 5ALPA 5AXBA 2P2CA 1R8YA 2NZJA 5C46F 3SHFA 3W4JA 4IDNA 3TSYA 1WM1A 5BRNA 3NIWA 521PA 2A0WA 2BOVA 4YRNA 4Z1MD 2HB6A 1P0CA 2YXPX 3H19A 4I2VA 3T4PA 2VOJA 3JATA 4PC1A 2IS6A 1CQJA 2OHHA 5JJIA 1HOTA 2D06A 3ZVMA 1JR3D 1ULHA 4YJ3A 4CR6A 1JKXA 1O87A 2DRIA 3OZXA 5H9VA 3V5NA 1TM2A 2QD5A 3CV3A 3GEIA 5EZYF 3MGCA 3UT6A 3EG9A 2HHHB 3EUWA 3KOMA 1SPXA 5AVVA 2VBCA 3Q4GA 4NV1A 3TTUA 1U5CA 1Y34E 4IHKA 3KFVA 4FEEA 4PX9A 3R7FA 4DYHA 3LCRA 1VBKA 1U9IA 3ONWA 4OGFA 2VDKB 3TMAA 4CMGA 3U4HA 1HSOA 2CDRA 1SOWA 1OW3B 4PANA 3QHAA 3W1EA 4I9UA 5CDUA 1H0KA 3SNHA 1X8XA 3T41A 1AUQA 4NC9A 3H8SA 1KKLA 3AY6A 4FGZA 1BD3A 1IB0A 3QUCA 5L3QB 1T35A 3ROXA 1YBFA 4PLGA 1RPZA 1ZA2A 3OQPA 1EAYA 2DR0A 4JUCA 1HWYA 4P33A 4RELA 3WQRA 4U2DA 2BV3A 1GGKA 2I71A 3Q8KA 1ZUIA 5B4UA 4IJVA 1KAOA 5B1IA 2VTBA 3ADCA 4K86A 5FWNA 3PUXA 1UAGA 1SIUA 1T9GS 4HNAA 5HJEA 4ED9A 4K9SA 1I9CA 3ZV7A 2CDAA 4NWIA 2B69A 2ECKA 1IOWA 3R74A 3MWFA 4YN3A 6CHYA 1T8UA 3NYRA 3IRUA 5FQOA 3KC2A 5JSKA 3ZU4A 1VCOA 1XGKA 2CNLA 1C8LA 1XZHA 2X7XA 3H2JA 3PB3A 5HCIA 2WPDA 2N3ZA 1EBBA 4QE3A 1AQ6A 3IS3A 1SC4A 3OFNA 5FWAA 3QWIA 1QP4A 1PVVA 2CXPA 1DUVG 4QYIB 3PDWA 4X6YA 1ULUA 3OUUA 3NRBA 1N2ZA 2XV1A 5TPWA 3U4CA 1OZGA 3WL5A 4EJSC 9LDBA 3AJ8A 3LBNA 1UADA 3VNRA 4A15A 1YL6A 2FFQA 2P6NA 3VNAA 4URHA 3WSWA 5B7QA 1L7XA 5CXUA 2E1RA 4L0MA 2YJ5A 3U44B 4LC9A 3QOWA 3QNMA 5DYYA 4ZAZA 1BFUA 1AO0A 1F0PA 5H16A 3AP1A 2IHUA 4WVLA 3RH0A 3A2KA 1H3EA 2I22A 4EVSA 3FROA 1LX7A 1YQQA 2ZXFA 1HQYE 1V4NA 2GBLC 3AWIA 3QELA 3WB9A 1FTYA 1NSTA 2ECPA 2B1RA 2H1SA 1T3ZA 3OC0A 4WFKA 3DOHA 3PXBA 2ZBPA 5ITZB 1YFLA 1Z9BA 1YBVA 4E46A 1CK4A 3WTBA 1EQAA 2EZ8A 5B2EA 1KI7A 2M6RA 3EQZA 2A58A 3BTUA 1AHHA 2AJ8A 2CFCA 4GP7A 3PGMA 5AICA 1KOGA 3MJFA 3HXMA 3PFFA 3PXXA 5TXGA 1CWUA 3N9IA 3OOYA 1EXVA 3L7KA 5KYXB 3L8DA 1DIOB 1LLDA 1J20A 3UWPA 2CKMA 1QHIA 5IAOA 1PLJA 3LC7O 1ZH2A 4QAJA 5A2QA 2WSMA 1R7RA 3TRFA 5G4LA 4AXBA 1HRDA 4PX3A 3DWIA 1V25A 2FLKA 2OXTA 4MV8A 3UHFA 1YS1X 3ZJUA 3QM1A 2OQIA 2F9FA 2O2SA 3KR1A 4HP8A 3U3RA 4AZSA 4DDHA 5DK6A 3G9TA 1SG9A 3D59A 5BOVA 7GPBA 1KORA 2GLTA 3E82A 3QXGA 2NAFA 4RFSB 4YQYA 3SSNA 1WY7A 2WM2A 1X87A 1NPYA 3GCXA 4HDRA 4HQLA 5HKLA 4A7PA 5FI3A 4B0OA 2DMRA 1V96A 1ZU5A 3JQFC 1D2AA 4ASUD 1DKMA 2ETXA 3ITKA 3G1WA 4XD2A 4K8RB 4Z4EA 1AUPA 2PD3A 3Q11A 4QYIA 2FEWB 2AJTA 3N8DA 2A6PA 4ZVNA 5CVCA 4BP8A 5K8IA 4D7AA 3NGLA 3DLIA 1NR7A 1D4FA 4BAUA 1BMTA 1GYQA 2PZJA 2QLBA 2VRBA 3CRQA 3T5MA 2EHDA 2ZE5A 3VM6A 3CSSA 5JHHB 3U44A 2FDCA 1JQAA 3SE7A 1ONBA 2YZNA 3ZWNA 4YDRA 4G4IA 5KSYA 2RJOA 4QU5A 1JFSA 1K5HA 1FS5A 1I3MA 1N9KA 3DC7A 1A4XA 1AKMA 3T7SA 3LDFA 4HG2A 2E49A 4CQMD 5BMOA 4UC0A 3FMPB 3RRNA 2YHBA 1G5TA 5HFJA 1Y6RA 5ITZA 2A3NA 1U2GC 2HRZA 2IOYA 4MW9A 6PFKA 1QDUA 3FCEA 4UHEA 3TIVA 4P54A 2QRMA 3IPRA 5AKLA 3SSAA 3E1KA 3OQNA 4MUEA 1C30A 2V3CC 2GEFA 1WOMA 3OTHA 5EP3A 1NI4B 2J4CA 4QEZA 4H35A 3E8XA 1F2VA 3H3JA 4HADA 5K2MA 1C7IA 3AI3A 1RACA 4D8YA 2VUIB 4KE6A 2W2OA 5EE1A 4KLCA 2QMYA 3EXFA 4MV1A 1H66A 1Z47A 3VHXA 4EMUA 2AMFA 1RRKA 1P1JA 1FDWA 4BO1A 4TQUS 1ARZA 4JLAA 1EGHA 2C4TA 2XMSA 2WFLB 5HE8A 1BKYA 2OV1A 3OFSA 1M10A 5EXEA 1XKQA 3GT4A 3SSMA 4V0SA 3E05A 2QU7A 4QICA 3SG0A 1XK7A 2X5NA 4HR7A 4ARZB 1X8KA 2OK7A 4W63A 3TXXA 4B44A 1AS2A 4H4EA 1E2DA 1GQYA 2C42A 2EWWA 2IYNA 4X9XA 2JIRA 1RKVA 4LWQA 1P0MA 2ECFA 3LPNA 2Q5HA 4YRGA 3H3XA 2GEVA 1IOZA 2VWGA 2WJYA 2CJFA 3RFXA 3STVA 3CUVA 2CDBA 5TMEA 5CB4F 2XR1A 4DJAA 1MFZA 4B0PA 1LPSA 2TECE 5JJLA 1UK8A 4PYQA 1M2EA 1ENOA 1YMUA 5IJXA 1ZAKA 1UDCA 3FI0A 1NYTA 5DP1A 1L7BA 3C6MA 4E3WA 3EVDA 1K6XA 4C2BA 5KBYA 1JXAA 2IUYA 3EA5A 2KI5A 4RWZA 1VZ3A 1KSJA 2DQ4A 1M8GA 2P5YA 1A7KA 5E3JA 3WDKA 4DTIA 3HUEA 2M6KA 4E6PA 2QZZA 1O6BA 3GEHA 5JPDA 3VR6D 2WABA 1L6RA 5DWDA 2O5RA 3OIVA 4ZK2A 1GGHA 4YRZA 3FNIA 4BVGA 4GIBA 2P4SA 4N82A 3BVPA 2R7LA 1C7QA 1I0ZA 3KJHA 3MXTA 4R3WA 3GJTA 2A1UB 3BJEA 3AFOA 1DPFA 3FUCA 3NHBA 5I9SA 3AXTA 4QC2A 2XNDD 3IQEA 3EXEB 2AR7A 3O1LA 2UUCB 1XIVA 2ZRGA 3UT0A 1NZDA 4Q02A 3WL8A 1AGNA 1NI4A 1U4NA 1X7XB 4BMVA 2OGUA 4IZHA 4XPIA 4K9LA 3DHEA 3J7TA 3DBLA 3HCFA 2W2XA 4M9QA 4F4CA 4AXXA 4ACAA 1Q0ZA 3TKYA 1Z16A 3VFDA 2DUNA 3TTSA 5FIUA 3R5XA 1A5ZA 1DO0A 5DBEX 4K0RA 4OGKA 1RPJA 5CYOA 5ALRA 1WVIA 2CK3D 2O8EB 1Q0UA 4IF6A 4UD2A 1Z73A 1UC8A 4ZDWA 3MBKA 5FUXA 2WFLA 3JYQA 2YHSA 1JH9A 4EUEA 1MC4A 1KJ8A 2I34A 2Z3ZA 2CSXA 4ISCA 1DQZA 4F3YA 3BT7A 1GT91 1L4YA 1ONOA 2V0CA 1Y5RA 2XNKA 3DMRA 5EQTA 3SC4A 2AFIE 3TAHA 4BRUA 2QP9X 4OJKA 3FJ1A 1ZD9A 1JG4A 3O4HA 3L7CA 4PEVA 1P80A 4M54A 5HUJA 4Q05A 1XMIA 1ZCAA 2E4WA 1XRLA 1CTQA 2PGNA 3AF2A 3DFFA 3EWNA 3GC6A 1Q0PA 3RRZA 4B4OA 1PL0A 1CXZA 1LBIA 5EHNA 3AEQB 2RH5A 3BIXA 1KZ4A 4OUKX 4YMGA 3ONFA 5JROA 2DPXA 5J47A 3QYPA 5AOAA 5DSTA 3A1FA 2LIPA 5JADA 3L79A 4JJFA 4EENA 2WIKA 4OQQA 5EJAA 3JQ9A 1GUFA 2JK0A 2P65A 4M88A 5D00A 3T4EA 5LA6B 4ALIA 3UMCA 3F1KA 4DJTA 4BB5A 1OCEA 1J8DA 1X7DA 3B6JA 1V8OA 1WB6A 3CRW1 3RVDA 4YVFA 3I0MA 3ZTYA 1NX9A 1FRNA 4GSKA 5LDGA 2NSYA 3P20A 5CIQA 2FJ0A 1ZO8A 4KBGA 2EQBA 4HB2A 1G59A 1NNUA 1IEWA 1ACJA 1U8TA 1W29A 1Y1SA 3E3OA 3KJZA 3O4JA 4R8VA 5KNDH 2XYHA 5CD1A 2VRWA 5CFPA 3ESAA 1RJ9B 2I5PO 2ZSUA 4PCVA 2SICE 4DA9A 1W8DA 4OJTA 1SQ0A 4R0MA 3I2IA 5JY1A 1OX4A 1VL0A 2Y93A 4M87A 3KSAC 3ICPA 1AHIA 2R65A 2PY6A 1T5SA 2WU0A 4C21A 2OV4A 2JIOA 3EVEA 3O8QB 4BO5A 1RHRA 9MHTA 2JKZA 4OAPA 1MXFA 2E5WA 1NVMB 2PCJA 1IZZA 3RADC 5IVHA 3NB0A 1E9FA 1U1FA 1Y81A 4GLBA 4Y2SA 3MLAA 3HVRA 3FAZA 1U94A 4BNJA 4Y8VA 3U31A 4YPVA 3LF2A 4J9UE 4BCBA 3H99A 3NM6B 1H3NA 2IYTA 4Q3DA 3M33A 4QOGA 3MWLA 2VSXA 2WKSA 3T0IA 1BXRB 1X9HA 1E1LA 1NBIA 1W46A 2DULA 2SKCA 3B2QA 4RTLA 1OREA 5I9NA 3GJSA 1UEIA 1YB2A 3T1QA 1T2VA 2JJQA 3E4DA 4LJYA 1L5SA 4DREA 1PJCA 3PPIA 1GA4A 2H9AA 2IVZA 2H5EA 3JQAA 2W6NA 3FDJA 4ZAWA 3FKSD 2A5YB 3SBDA 4NESA 3BILA 1TC1A 1LFAA 2ZYRA 2XTAA 4TYMA 5EP4A 3CF2A 1PFGA 1DIAA 4WXYB 4CVNA 2BUCA 2Q4DA 3QUQA 5CLGA 4OFBA 1OH6A 7YASA 1DBVO 2FHPA 1L4BA 3LLVA 1ICIA 1FW8A 2O48X 4RIHA 3WAKA 4G37A 2CBGA 1RNLA 3IV7A 1R0LA 5C8YB 2QDXA 2ZJ1A 3IUBA 2G8NA 4QEKA 5DW0A 1IPHA 3BDIA 3K20A 4HYEA 5IVIA 2ZE8A 4EECA 3FF4A 3AUTA 4BQRA 3PWSA 1E2QA 5GPBA 4YIHA 3KUKA 5JCZA 5CBKA 1VYUA 4L1KA 4AF7A 1C3OB 5EIAA 1Q6ZA 1L9KA 2QRJA 4GX2A 1KNQA 3WGOA 2REOA 3P2YA 1QMGA 1X7ZB 3CVOA 2LTAA 1IEVA 1JDSA 1FRQA 4IM7A 1VPWA 5AW5A 3ANTA 3PF8A 5IK2D 2EX0A 2PX6A 4LC0A 1KGDA 3UJ9A 4HGZA 1IK6A 4W9NA 4F3CA 2O5EA 3EWIA 4LRTB 3U9SA 2C3YA 3T15A 1L9XA 1IY1A 4IIDA 1RJ9A 2JFPA 4UVGA 3TNFA 5GIPE 2W6PA 1PTKA 2QVGA 4OSPA 5A2GA 1N57A 2Y0PA 1NJGA 1XU7A 1UJBA 1YHNA 2E4ZA 3L8ZA 4J16A 3S3TA 3O8QA 3OU7A 4KBFA 1F8FA 1F9AA 4HNGA 3DXZA 4UM5A 1E59A 4JI3B 4BO6A 5KTPA 4WBSA 4ZQHA 1GQRA 2WBLC 3V33A 2Q49A 5JR3A 1P1CA 3DTYA 3A3YA 3S0JA 1CUSA 2VJYA 3LWBA 1QTIA 4F5WA 3CVUA 2O5CA 1SA0B 3ZY2A 3NO4A 4TTJA 3S29A 3TWOA 2C5HA 1ICEA 4ZMBA 1SBNE 1JJ7A 1XROA 1VP9A 4JVLA 3G0OA 2DUWA 3SQWA 4D9HA 4G25A 4GPEA 1CQZA 1KS2A 1JA1A 1V7ZA 1H42A 1BXRA 1W9MA 2AS0A 2HHAA 3GBVA 3TLEA 4EHLA 3I52A 1QTNA 5K3FB 2EP5A 2IHNA 1YZTA 4REOA 4PO9A 1E7WA 4A2CA 3QWBA 2ZVPX 2VTBB 3WLFA 1N6IA 2B4QA 3I6QA 5DNAA 2XOKA 5EUQB 4Q34A 3LUJA 2V7EA 2CD7A 3WY9A 1UKAA 4BNMA 5HFAA 4ID9A 2RAPA 3BMOB 3H5WA 4H4DA 4BQSA 2YYAA 1N9GA 1ZM7A 2Q4EA 3OP4A 1R6UA 1XWFA 1NW9B 3NNDA 2NNWB 4D5EA 1GGFA 5A0VA 1T3SA 3H9UA 4YP7A 1DARA 4MJLA 2G76A 2OR3A 3HK2A 3ZNOA 3VPFA 3FAKA 5C8YA 2OENG 1KYVA 5AT1A 2QV0A 3N2GA 3CEAA 3UWKA 1JLHA 3WYAA 4OLHA 1IDOA 5IEBA 1MRNA 3KKPA 4RQTA 3RS5A 4IIUA 4A0HA 1ULBA 4MYSA 1QOQB 3F3SA 2XDWA 3EULA 4M9CA 4ES6A 1QDLB 3OE5A 1F5SA 2NXNA 5D6NA 1X7ZA 3W2GA 3RC7A 4PN7A 3LQ4A 2C2MA 4PTLA 5AHWA 4F2HA 3UHAA 3SDZA 3A9WA 1G2OA 2OV2A 3QBDA 4DLUA 5DBOA 3GUYA 4PZYA 1T8TA 2QOEA 4RLHA 4W7HA 3MQFA 3JWIA 2IZ6A 3HEAA 5F1KA 4MUHA 2AF4C 2VT3A 1T10A 1F38A 3B3FA 2C2HA 1DG9A 1SOUA 4I2NA 4CLHA 1KPHA 2O0KA 4HEA6 3NPMA 3TBHA 4N49A 4QL3A 4J2OA 4FYIA 2ENUA 4RSMA 3ZG6A 3GYGA 2DB3A 3B8EA 2IJGX 1J07A 4GZ3A 3SLGA 4YMVA 1HF3A 3MAAC 4XJTA 1LPMA 1RIIA 2CUZA 3GXBA 1OV4A 2FSGA 4IDDA 4KFTA 3ADKA 4P9NA 4K0KB 3SLKA 1ZUNA 4QULA 1B0PA 1JIUA 3VPXA 4EGFA 2EDCA 1GZDA 2JLYA 1L1EA 2PMFA 2ZTSA 3OJXA 4YP0A 1IMJA 4MVYA 3FCSB 4HXYA 4LVUA 2FU5C 4PG5A 3IA7A 1XPJA 2XB2A 4MRSA 1BMDA 3IHKA 5K3FA 4M6WB 3NKFA 3U7RA 1FIUA 1DTWB 4ONEA 1F4VA 2G6BA 2HCJB 1TA0A 4OCZA 1X42A 5GIOE 1PS0A 3VSDA 1XPRA 1G7SA 3BMOA 4DMRA 1LV7A 4Z9BA 4OI1A 3VR4D 2ZI9A 2ZBFA 1W85A 4LHVA 5FPKA 1GG2A 2AFIA 3IOCA 3C3AA 2IPMA 3BE4A 4R9VA 3OSUA 1ZD5A 3I2HA 4ECAA 1YJBA 1GRCA 2D1YA 3ERCA 4RF5A 1E6KA 1QCZA 2D2FA 3ZNQA 3V4PB 1VIVA 2VPQA 5BVHA 4M0KA 2O20A 1EFRD 2X1HA 1YFKA 1JHAA 5SYNA 3LBAA 1JAYA 4WECA 4LF6B 3JQ9C 4Z9FA 4EMBA 1PJQA 1PUXA 1UXHA 3CBQA 3ZWOA 1I3KA 1MOPA 3PFHA 1YASA 3TE7A 1KMNA 3SEQA 1B6TA 2C61A 1CIJA 3EHEA 2EZUA 3F6PA 3QOYA 3NASA 1ZQ1A 5EINA 2QORA 5LQUA 1YFJA 3SM9A 2WJ3A 4MULA 1VHDA 2PN1A 3HB1A 3ZY6A 3CLHA 4TSFA 3QKIA 3WV5A 3AP3A 1V7PC 4Y2XA 3IP7A 3GAFA 3VSBA 1I32A 1NV9A 4MPJA 1XTQA 4Q7JB 4RIFA 4DDKA 3IKMB 2YC2C 4MUMA 1P73A 4O5AA 1GTJ1 3EZFA 3R9KA 1M7BA 2DLDA 2AW3A 4R0NA 3C4QA 3EXHB 4DRZA 1KYYA 1T0JB 3ASYA 3HGMA 4F21A 1G3IA 2D3WA 3GRUA 2C5EA 3O8DA 1N36B 1KOJA 4YY3B 2IOQA 3RS9A 3V8EA 4XWAA 3UMMA 3CIFA 2GEDA 3K0SA 1T15A 2Q1TA 1SCDA 4CNBA 2C4WA 3DBHB 3QQPA 3TQHA 1RM3A 3KELA 1YMQA 2BZ0A 3H4VA 1KJ9A 1KI6A 3TM4A 2SNIE 3QI7A 5D5HA 1B8UA 2P9FA 3UH0A 3WMGA 4A8PA 5EMHA 2UUPA 2PU5A 1PGNA 2YIMA 4R9SA 4DGSA 1KMCA 4M6WA 2G4VA 4QO7A 4REMA 1LC0A 2PV0A 4AROA 1TVEA 4AIIA 1IBKB 1MAHA 4NZ9A 3EPLA 5D86A 2IEIA 4ENVA 4CM8B 3UK1A 3NWPA 1V7QA 4A36A 1YI8A 1L7OA 2BFDA 2PR2A 4NYMQ 1QG4A 1SBCA 4UUAA 1R3DA 3QFRA 1C8BA 3ZCTA 4YP5A 2RK3A 1KGSA 2ZULA 3DFZA 2J0UB 3LZCA 3NEYA 4JHXA 5L7TA 3LUCA 2QN3A 3C39A 2XGOA 4ACBA 2HM7A 3QNWA 4GI7A 2IXEA 2WEKA 3A9RA 4KU4A 2VHVA 5TMPA 3ON5A 1KPGA 3GPDG 4TLDA 2KBFA 3AHFA 2QD2A 1BMQA 2OY0A 2ODPA 5TEVA 5TGTA 5C7YA 2Y3IA 1DTSA 2VZ0A 3DYIA 3GI1A 1NC3A 4XWOA 1A8IA 1CF4A 1N6LA 4JLSA 4W7IA 3CURA 3PC3A 3PIIA 2NO6A 4CQLA 3GUCA 4FR0A 4G2TA 4XIIA 2AKAB 1XAIA 2FE1A 5EUCA 1O1YA 2Z09A 4NR0A 4PINA 4MRNA 4RZQA 1ZGJA 1JQLB 2QYSA 3O83A 4B76A 4IMIB 1JFRA 1L7QA 4Z3OA 2P9CA 1RBQA 1JQKA 2YXBA 1N3YA 3TSAA 5BN3A 4Q3AA 4N41A 4L2IB 5B1EA 3MFQA 3AVYA 4FMBB 1XRRA 2C5AA 5E7MA 2DOKA 3ZHZA 1YS9A 3GT0A 3IP8A 1OYWA 5A7GA 1OZHA 1N3BA 5AM3A 3WXMA 5BSKA 3IEKA 3KNZA 3DT9A 5BWLA 3WA7A 3F4BA 1MX5A 3G5TA 4P0PB 1K7EB 3GQVA 3NJ4A 3LQ2A