2H32B

Crystal structure of the pre-b cell receptor
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
117
structure length
117
Chain Sequence
SVTHVFGSGTQLTVLSQPKATPSVTLFPPSSEELQANKATLVCLMNDFYPGILTVTWKADGTPITQGVEMTTPSKQSNNKYAASSYLSLTPEQWRSRRSYSCQVMHEGSTVEKTVAP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Insight into Pre-B Cell Receptor Function
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
molecule keywords Immunoglobulin iota chain
total genus 16
structure length 117
sequence length 117
ec nomenclature
pdb deposition date 2006-05-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2h32B01
3T0ED 3MV9B 4PRIA 4TSAL 4JFYB 3HE7B 1MEXL 5LXGL 3CLEL 4X4ZA 1YEKL 4M48L 1WBZA 1JF6A 1WBXA 1IM9A 4FQ2H 4PG2C 5IKCB 4AIOA 2WINA 3Q3GA 3VW3H 3ZLQC 4PV9A 4I9WD 1XH3A 3FB5A 3PDGA 2GW5A 3K4DA 5JHLL 5I1DA 3G5YA 2ZG2A 4PJXF 3G5XA 3RWDB 3OR6A 1FZOB 5ESAB 4JQIL 3BSZL 1G84A 3W9DA 4UOJA 4OFDA 5CWSB 4WV1B 4L9LB 5DMGD 5ETUB 1IGYA 4LSRH 4PGZA 4S1QL 3IKCB 3FB8A 1KBGL 4KMLB 5CUSL 5DTFA 2X1PA 4MCYA 1J0IA 3MCLL 4Z5RB 3U1SH 3RI5K 1U6AL 4N0FB 2AKRA 3GI9L 2QQLL 5T1DL 1TJGH 2A73B 3QSKB 4JB9L 1YMMD 4UNVA 4MDIA 4PRHB 5DMIH 5IWLA 5D7JA 3HMWL 4CW1A 1T7XA 1J1OL 2XACC 4Y5XC 4Q0XL 1CR9H 1L7IH 4HJ0D 4PJ5D 4ODUB 4J3XA 3MV8D 5CD3A 1CXIA 2AQ2A 4KK6D 5DO2D 5A3IC 3MROB 1IVLA 4XHJD 3ZKND 1QFWM 1D6EA 2VQUA 4UINL 2P8PA 3AM8C 1I9IH 4QF1B 3KPLA 4CVXB 3MRJA 5HHMB 4QRTB 1NQBA 2SEBB 4GMTH 2AV1A 5E7BA 3WKMH 4JFFB 1F8TH 3AXLB 4PLKC 3HNVL 4U1GB 1S7XB 5F7YC 5GZOC 2FIRT 5ADPL 3QWOA 1OAXL 4NUGH 3CMGA 3L7FA 1FAIL 3U0TB 2VZOA 3TZVA 2DBLL 3SGKC 3QH3B 4X80H 3SGEI 2E9BA 5FYLL 3RVVC 3W0WE 4PGEA 4L8CB 1S3KL 4JZJA 3D25A 3U46B 1T20A 4U0QB 3MNVA 4RWYH 1NBZB 4D0CA 4U1NB 2WIIB 1AXIB 5IHZB 4GG8B 3B9KD 1EEZB 2CJUL 1EERB 5DI8B 2HVKA 5K93A 1I7ZB 2YBRB 4R7DA 4X98B 1BP3B 1EZVY 1T1ZB 1CGTA 3O6FC 4LDEB 2Y7QB 3KR3H 3P9MB 4FQHA 1C7TA 3QHZL 5I66A 3O6LH 3SJVA 3OAZH 5I9QC 1WCBA 1GGUA 1LO4L 2XIDA 4S2SA 3PWPD 4LF3A 3UJIH 1TVHB 1OSZB 4OZHA 1X5IA 1IQWH 2CO6B 3LB6D 4PREA 4KZEH 3UYRL 4Z5RA 5JORA 4D0CB 3IKKA 3IDUA 4JQVC 1FZKB 4YDJB 1T2JA 5JW3L 3GSXB 5T5NF 3KPQA 1UACL 4M8QA 3NPZB 3A67H 2IFGA 4Z0BL 3OZ9L 1D9KC 5C6TL 1F02I 2N7AA 1MWAB 3IGAB 1B6UA 3WNPA 1JHTB 3CJJA 3CU7A 3BP7A 1AFVL 5LQBL 3F7RA 5CBEA 5FOJA 4PRBB 4HEPG 4MJ6B 1MCPH 2ZG1A 1BD2E 1NSNH 4XNQB 2IPTL 5CD5D 5DSCB 4U4BA 1MCOL 1UQSB 3PXJA 1FIGL 1YEDB 3GBNH 4M7LL 4FQLL 1ZLUK 1I8MB 2GAZB 2FR4A 3BDBA 1P53A 2F58H 2E7LC 2F74A 5FA3B 4PJIA 2IBZX 3E6FA 1JNLL 4U0RB 4X5WB 4HT1L 1QRNB 1RURH 3HA0A 1PLGH 2OS7A 4PJ9B 2NY3D 1DUYB 1T0NA 2QHRH 5CS7A 4Z7VA 4IEFB 1OY3B 4MLIA 1EIBA 1OQOA 4D9QE 2DQTL 1FSKC 1KIPA 2QQKL 5KS9F 4B53A 1CGYA 4ZOBA 5L9DH 1LHZA 1WBYA 4X9FA 5GIRA 3VFNB 1NFDF 1XGPA 4YR6B 5IMMB 2HTKD 4Y7MA 3DGGA 3RHWF 4PG2A 5E5MB 1RZ7L 2EEAA 4XPTH 3VG9C 5CP7A 2VDMH 1T6VN 3MV9D 2CK2A 3SDXA 3F5WB 3X12A 5C07D 4K9EH 2R0ZH 1DVFD 2YN5A 4QRRB 5MP6L 3DUUA 3MRRB 4OTXH 5BMFL 1REIA 4JDTL 3QDJE 1DJSA 1FVDB 5GRXG 1MRDH 1NEZB 4O58L 4HH9A 3VJ6A 3VRIA 5FDWB 3MRCA 4PJIB 1N26A 4JM2B 5AZEL 1J1PL 1TVHA 1HCFX 3ULUC 2ATKB 5EO0A 2X70A 4G7YH 5C0RH 1IL1B 4OLEA 3S36X 3CSYB 1FZKA 5CINH 4F15C 3BPNB 4Q7DA 4TYUA 1EHXA 5C0BA 1ZLSL 3V0VB 2V7HA 3IDIA 3KPRB 2VLRA 3B5GA 1KXTB 3VI4E 4PJCF 3EBAA 2JCCA 4ZFOL 1A1OA 4P46B 1RK0A 1MCDA 4NQEE 3GJFH 3GIVB 5IBLD 3NIFE 4L4VD 1PW3A 5D6CA 5D7LE 2VNCA 4DUXA 4J6RL 3NPSC 1A1MB 5TF0A 5DJ2B 5T3XH 3PWVA 3BWUC 2DBLH 5FOBB 3GHEH 2H26B 2UYLB 4LRIA 4LVNC 4M6OH 5DEFB 3TN0B 2XWJA 5GGQL 5SWSA 1MI5D 4PRDA 1HIMH 5TDPA 3ULVC 1T5XA 3IDNA 1S9VB 2JLLA 3CAFA 5J11C 2NY4B 3B2VL 4OZGB 5FECA 3DYOA 1WICA 5I16B 4AIXA 5HVHB 3FONB 3VXOB 4NNYA 4AT6B 1FVCA 2H32B 3WO4B 2BCKB 5LBSH 4IMKA 2YPKA 3I50H 4AEEA 4TTGA 3T4YB 3QQ9D 2AEWA 5KVDL 2R0KH 4Y8DC 4R96A 4YDIH 1EMTL 1WAAE 2R23B 2R29L 3EDFA 3QI9C 5CP7B 1ETZA 2OMNA 3QO1A 3QXDA 1FZMA 4LGPB 5IGXH 2XWJB 1T83A 1A6UH 3IDXH 1DANT 1TTFA 3V4UL 5BRZE 4LSVH 2Q86A 2KL6A 4OD3L 4R97B 2P5WE 2BSTA 1A6VH 4U2ZA 4YE4L 4W68A 4PJ8A 3MLXH 2XI9A 2OR9L 1KPVB 2OTUA 1I1RA 4IHOB 2V5TA 3RUGE 3TO4A 4BUHA 1XCTA 2OZ4L 2NY2B 1EEYA 2WBJB 1BBDH 4GKNA 4M6MH 4NP4H 3SOBL 4CUCA 2NLJB 1HDMA 4YXHL 1N4XH 3MBEB 2RR3A 2OCFD 2A6IB 3EYOB 3WFEL 4K7PX 5ERWB 2PXYC 4NHCH 4UQ3A 5E8DL 2VIRA 4KY1H 4H8WH 4P2QD 5KVEL 2EIBA 3EJZC 4X7SH 3S7GA 1MHHB 4N0UB 4KDWA 2ICWJ 1IM3A 3T1WA 1BFOB 1JL8A 3HAEH 3KPTA 1JF1A 4MNQB 2NY1C 1MAMH 3QULA 1RULH 2BRRL 1HHGA 1I3RA 4PV9B 4PGBB 3F7PC 4I3RH 3WIFA 2DQHH 3L3HA 3SGEH 1A22B 1ZHNB 4MB4A 4CDHA 4J1UB 4MA3A 2VXTL 3KXFA 4P4KD 3STBA 1RZIA 4PRIB 1R6VA 1NCCH 5DQJA 4K3JH 4PLNC 1OD7A 1GGTA 3P11L 3QBTB 4XNYL 1FZMB 3BGFC 5EU5B 1OP5H 5F7HA 2IFFL 4YFLI 4NSKA 3LIZH 4KVNH 5HGGS 4NM8L 3JWDL 1MFBL 3KPNB 3SDYL 1BEYH 1NDGB 5IG7A 3VFSA 5J6GB 1MJUL 1R3HA 1UEMA 1XF3A 1RFDH 3FQTA 3I2CH 5BOZG 2AABL 2GCYB 4L3CB 1D5XA 4Y16D 5ESAA 5HXMA 4KK8D 2B39A 2ZCLH 3CFEA 5F72S 4B41A 4H26A 1JJUA 4KMTH 4JG0H 3D87B 1RSFA 2X89D 4AEIL 1L6XA 2KUTA 4CVXA 2PYEB 3IFLH 5JW3H 5HHOA 1OOAA 3L9RA 4YHYC 1JPSL 5DT1H 4NKIH 4R8WL 4QHNB 4MNHB 5F8QC 5HJ3A 1OL0A 2JJWA 2O61B 3RL1B 4RAUA 4CADA 4UNUA 1FO0L 3GMMA 5DQ9B 2MNUA 2YUZA 3QWRA 4YQXH 1NDGA 1NAMH 2XNAA 3MBED 3QHTC 3JWOC 4KV5F 4LEXL 2WW8A 5CINL 5I1CH 2L7UA 5E08H 1IAOB 4JG1H 3T4AA 3IAQA 5DRXB 4E0RB 4QTHB 3LSOA 4U1LB 1I1YB 1OTSD 3U48A 3UTQB 2DWDB 4LVHB 1FCGA 1P5VA 1DVFB 4MJ4A 1A6ZB 5EZJB 4H88H 2GKIA 5J12C 3ARFD 1I9RH 5LGKA 3TIDA 4ZNEE 1JHLH 2QV2A 1A7RH 1FLRH 3BH9B 3O4LB 4HS3B 2FJGA 5D1ZD 2AJVL 5FDYA 4P2OB 4ZXBA 3BT2L 4OZFG 5F7EL 3LEVL 2JF1A 3D3VB 1F6LL 2PKDA 1ZA3A 2R1YB 1T5WA 4HZLB 5D1XB 1KIRB 4DCQA 1CG9A 3WLBA 4GMTL 5I0ZA 3AREC 1DQJB 4PJEF 4JPWL 4G6FD 5D1QC 4AG4H 3WFBL 5HHOE 3OG4B 4PJBA 5JUEL 1IGCL 3RGVC 2VLJD 5IB3B 1EEZA 4NFCA 3T0EC 1MLBB 4OZIF 3NIGF 3IRZA 5CHNB 4OLVL 2ZCKH 4HBCL 4QHUA 1RZGB 1BD2B 4P2CG 3RNQA 3O4LA 5KVDH 3DWTA 1C5BH 4PJEA 3HZYB 2V5SA 4P3WA 3V4PH 5C0BD 1L7IL 3BHBA 3G6JB 4JPKL 2E7MA 1NBVL 1PYWA 2O5XH 1DBJL 5C0EA 1HYSC 1DBML 3CZJA 2DWDA 4I0PD 5T1DH 4ZSOE 1FFPA 4JB9H 2MCG1 3MRKA 1KN2L 5FO8A 4HXAL 4KH2A 4WHCA 3FAWA 2HVJB 1UJ3C 3EYQD 4LP5A 1CR9L 4ZO7A 1B9ZA 5JDJA 1ZHLB 1RIUH 1A6TA 1DN0B 3M07A 1U3HB 1G1CA 3MOAL 4RNRB 1P7HL 3L3OB 5C2UB 3PGFH 5EIIB 5F6HI 2XZQL 3EDEA 4XCEB 3WEXA 2C7UA 4ZFOB 3PL6D 4ZO6A 4ZOAA 5MEND 2F53A 2RQ8A 3QIBC 3KPSA 3L1OL 3QDJA 5C07A 4LAJH 1SBBA 1VESA 1AD0A 3N50A 1FSKB 3WFCH 3R0NA 4MJIB 3KNBB 4L3ED 5DSCA 5L7XH 4M5YH 3RVTC 1A7OH 1C16A 3PABB 5JMRA 2CRIA 3U0WL 1JYVA 3WBDA 2P8LA 2VR5A 3BW9A 1Q0YL 5TQ0H 4Y4FB 1HHIB 2Q3AA 4LCCA 2B2XL 3CLEH 5GSRA 4Z7WA 4PJBE 3EFDL 1KGCD 4Z0XB 5HPOA 2GY5A 2V5MA 5DWUH 4BSVA 1T3FA 5ALBH 5A16B 3CXDH 4PJCA 5DRWA 1ZHKA 3BDYH 4X80L 2AXGA 5C07B 3PDOA 4GAGL 2F5BL 3QXVA 4OIIL 3CDCA 3RIAK 4YO0B 5AYUL 1CBVH 2WUBH 1T0MA 3FN0H 1J11A 5CZKA 1S9KC 4OD2B 2ZCHH 5DYOB 2XKNB 25C8H 2UWEF 3LDBB 4HK3N 3BP6B 5SWZA 1ZT7A 1K85A 4I18C 3PUCA 5IW6B 3UTPE 4PJGA 1BOGA 1RPQA 3D39D 4UZGA 3UBXB 1QLFB 3IDGA 4CVWA 1T1YA 3QUXC 3MUJA 4YPGA 1XF5A 3SE4A 4JFDA 2G2RA 1WCQA 4X6EA 1CFQB 2XG4A 5D7LB 1GGBH 3CPLB 2XPGA 2Z31C 4CGTA 5CP3H 5I9QB 1LO0L 4NCDA 4WNQA 2NR6C 3SHSA 3VXNA 4Q0XH 2DTSA 3HE6C 1MRCL 3U6RA 3MRCB 3ZDYE 2AGJL 4C57C 5I1EH 1EJ6A 5BVPH 1FORH 3BAEL 3FOLB 3VXTB 3O11B 4PJGB 5DD5H 3PHOA 1IARB 5CILL 5CLTA 3ZDXF 4JFEA 3AM8A 3EDJA 4QOKA 3KLAB 5IHZA 2QADB 3STLA 2CD0A 3ZE1E 1UG9A 4X5XA 5EOQL 4H1LH 3WUWG 1CFQA 2GITA 1LD9A 3D0LB 5IEKA 3KLHD 1MCBA 3OKLB 1MWAL 3PXHA 5I1GH 4DN3L 1RZFH 2PN5A 4FQLH 5H2BB 1EAPB 1MCFA 2GJ6E 5MERB 3SKJH 3CVHL 1HH9A 3EOBB 4W4OC 4LQFH 3RWIB 3KYMA 4N8CL 2BRRH 3GRWL 2YPKB 3KPSD 5EB9A 1DLHA 1U8KA 2F53D 5MENA 3QXAA 3RL2B 3FT2B 4D94A 4Z76A 4TNWF 2XWBB 3NIDE 4HUWA 5C3TA 5AD0A 1Q8MA 2WUCL 1Z9LA 2NY0C 3ISWA 4OZGA 3TZVD 5FECB 2GY7B 3UO1L 1HEZB 3MJGX 4NO3B 5BJTB 3EZJB 3IJSB 5FYJD 4NNPL 3ESVF 5DK0B 3VDAA 4QYOB 5IOPA 5FA3A 1FFNA 3TFKD 2AVGA 4I0PA 5HPMA 3BOVA 3JUZA 5E1AA 4GG6B 2VLMD 1RZJC 1N3NA 1U8LA 1KJ2A 4Y4HB 2QTEA 5D2LA 3NFNB 1IC5H 2GSIB 5DJ8A 2DB8A 4MB5A 3UXFA 1DBKH 5I16A 2WM0A 2N4IA 4F9PA 1LWRA 4KI5D 4KMTL 2A9MH 3VFPB 3OGCB 1VFAB 1IKNC 1TZIA 4ISVA 4RRPG 1UCBL 2E8YA 3VXUE 2VLJA 3ARGC 3ALXA 2A6IA 2G9HA 4JY4B 3Q6GH 3LMJL 5D7JD 5MENE 2EKSB 1A9BB 3TYFB 4QWWD 1OVZA 1I1CA 1RVFH 1NUFA 1H3XA 3HZVA 5DEZA 4QHKI 4YXLL 4MAYA 5I1CL 3C6SB 5CEXA 4YHLH 2DQFB 1Z2KA 3BP4B 5L8JB 2X4RA 4YGAB 1MAKA 1NSNL 1BM3L 2CQVA 3O3BA 4QCIB 4QRRD 1SY6L 5ALCL 2ERJC 4JLRA 3WKML 4I77L 3IJYB 1MHEB 1OTUD 1TTGA 3QIWB 1F97A 2F58L 5I15H 1UM5H 1GGYA 3F58L 2GTWB 1EO8H 2AEIT 3VD7A 3D2UD 4QY8A 5CJ8A 2Q6WA 3SCMD 3ABZA 4NO3A 5LBSL 3MBEA 2E7BA 4CJ1A 2F15A 3QWRD 1CE6A 4JFXB 3KWWB 3C2AL 4J3WA 5AD0B 1I1FB 5E2VL 3O2DL 2XQBL 3WD5L 3F12B 2LQRA 5I1KL 2RGSA 1DLHB 1U8KB 4LCWB 1YEGH 2ICEB 4TVPD 2YA0A 1T22B 5FKPB 4QRQB 1VENA 5IB1B 1HXYB 3T0EA 1U9KA 2VTFA 2OLDA 1SM3L 1TJGL 2VDKL 4WIQA 3C6LD 1MI5E 3H8NA 1K5NA 3MBXL 4OFKA 3ULVD 3B3IB 2D31B 4PGDA 2R0ZL 1NCWH 5EZLB 1WFOA 3V0WH 1JWUA 5I1AB 1P5UA 5FCSH 4J23A 4L4TD 1EK3A 5EWIH 2J12B 4HXBL 1H15B 3Q1SH 2DQEL 4WW1B 5HTSA 1AP2B 5E56A 3TJEL 3ULSB 1N7MH 1K2DB 4YPJA 3SOBH 4M1DL 3VXUB 3KXFD 1IAIL 1T5XB 3RVUD 1HHHA 4NQEB 1XGQB 5B38G 3Q0HA 3QNXB 3S4SG 2DM2A 4TNWK 3Q6FB 3WNKA 1DR9A 4C56E 3QQ4A 3U7AA 1IQDA 2I26N 3VGBA 4UU9A 3MJ7A 4EQ3A 5EUOE 3QIUA 4EN3C 3EOTL 2XXMB 4JM2A 3AS3A 4IS6B 2UYLA 4JRYE 4WWKA 4XWGL 3QUYB 4F80A 1YNTA 3HPJA 2ZNWA 3QJFB 1YC7A 4Y1AA 4P2QA 2EH7L 4MAYB 3QUZA 2AQ3A 5JIIA 5JQ6H 2F53E 5EZOH 4U3HA 2NZIA 3FTGB 3VFGL 5IJVA 1XH3B 3FB5B 4YK4C 3MA9L 1F4WH 4MAYC 3T8XA 5E24E 4KUZL 4K71B 4MSWA 4KAQH 4U1JB 4PGCA 1MCJA 4PS4H 2CIKB 1Z3GH 4OM0L 4HIHA 4C56D 3QIUB 5B39A 3FO0L 2ATPB 1XGTA 4ZUSB 1HNGA 3FQNA 2FRGP 4R3SB 2AEQH 3MMEA 3LKQA 1HK6A 3G5ZA 3F7YA 1K8IB 3AB0C 4N1EA 2Q1EA 6FABH 3B2UD 1EVUA 4FMKA 3IDMA 3HB3D 3WJJA 1OAYL 2VDLH 4MMZC 4GRLB 2ZUWA 1NGYB 5F7LB 2PO6B 4HKXA 3QEGL 4PJDF 2VDNH 1KIRA 3JWDH 3WFBH 5E2TL 2VDOL 2NY3C 2BXYA 5IUSA 35C8L 1A7QH 1UZ6E 3LEXA 4J8RB 2YRZA 4GG6F 5IW1A 1JWUB 3V2AR 3MYJB 5E00B 3DLQR 4FFVD 3MRFA 5FB8B 3WFDH 4WU5A 3LAFA 3B8SA 3BQUB 1YYLH 1BJ8A 4QKXB 4YGVA 4KKCC 4EXKA 1IC4H 2BC4A 4Z7UB 1I1AB 5I1JH 2GEEA 4JPIA 3DROB 5CJOL 5FO9B 3GUTA 4ELMB 5GS0C 1GOGA 4OT1L 4UQ2A 4WW1A 5HGAA 1NGYA 4OQTL 1Q9LB 2BERA 2HFFB 1CLZL 3SDDC 3S4SA 1MI5A 4OIBA 5SWSD 3U4EB 4HCRA 4JQXA 1MRDL 4DGIL 3H3PL 4DK3A 2D4FA 1C08B 5FHBL 1CZ8L 1BQLH 2GK2A 2IJ0C 4L4VA 3I02B 1CK0L 4S1DC 1GC1L 3HNTH 3MV7D 5TH2A 1L6ZA 5INDB 1QSEA 3B43A 3RWGB 2AXFB 3IXAB 2GT9A 3CFCH 4JFQA 3UYOD 4X0KA 3BZDA 4LLDB 3TO2A 1QFWI 1WIPA 1X4ZA 3UPAA 1NDMB 1R5WB 2IQAA 3HE6A 2GYSA 4P2RE 5IW6A 1HNFA 1JPGB 3E6HB 1VSCA 1T21B 3RY6A 4HPYH 1FHGA 5C0EB 4FFZL 2PW2A 2DMCA 4B7LA 5BZDB 5B39B 4HUNB 4BKLA 2VDML 3CX5K 3I3DA 4YHNA 3ROLA 4JZOB 4M7KL 2W0KA 1Q9OA 3HRPA 1ZLVH 4UAOB 4XZUB 3SE4C 5FYKD 1Y6MR 5I6XB 4WTXA 3FRUB 3ARPA 3K74B 1QSVA 2J6EL 1RD6A 2X4PB 5IBLC 5I1IL 5D2NA 1ZLWK 4G8EB 2KPNA 1VADB 3HE7A 1DVFA 1MJUH 2G2RB 1R5IA 5A2FA 5HI4C 3AU1A 3GGWB 3NA9L 5DC0A 1PKOA 4QTHA 1BQUA 4MAUL 4ZAKA 2CO7B 2HN7B 3FB7B 2O5XL 3MLVL 1T2QH 4IRJC 3BKCH 3TVMC 3HTLX 1G7QA 4O02H 4M1GH 4UTAL 2ITDB 3IXAA 4YDVB 2Q76A 3QA3B 1A0QH 3GRWA 3B9VA 2VR4A 1Q72L 2NXZB 2F8XC 4ZUTB 2W0FA 2A2QT 5E2UL 5F1SA 1Q94A 3P0GB 4JFFD 4BM7A 2CMRH 2Q7NA 3CDYA 3PF2A 3RZCA 3OJDB 2P8PB 4Y2OA 1A6ZA 3SDXF 1JRHH 5IIEA 1VGKB 3GMPA 1G7JA 1NGQH 2Z31D 4DGVL 3BEVB 3NFSH 1N0XL 2DQGH 1U93B 4YHIB 5T3ZH 2V5YA 3GHBL 1S7QA 1YYMH 2VYRE 1NC2B 4ZAKB 5JXAH 3FT2A 1J12A 4NC1E 1HSBB 4UBDD 3VWKB 4D3CL 5DZLA 3GMMB 5C08E 3D1MC 2NZ9C 2X4OA 1OGTB 1QFPA 2YZ8A 5F88A 1J1XH 1PQZA 5IHUL 2R2CA 4MNGE 5DEGA 3BMVA 1G9NH 1L0XA 1UXSB 5I17B 1NL0H 3EJZD 1A7NL 1L7TL 1VGKA 2WANA 4MJ5A 4G9FB 5HGHB 5ALBL 3WUZA 3QXTA 1OSPH 4CNIB 1MFDH 1UB6A 4ZQKB 4TTDD 1I9EA 5D2NE 4RWYL 1KCUH 2YRLA 4NYLB 4UV7H 4C59B 3KPRA 4L8DA 1Y6KR 2IG2L 3MODH 1E28B 3QFJB 1QD0A 4ODHH 3TBSA 4ZDHA 5L2JB 4DCQB 3MA7A 2XOTA 1WZMA 5DXWA 3MLUL 3PWPA 3K2MC 1KPRA 4KI5C 1WT5A 4G3YH 4OLUL 4PP2B 1QA9A 3EOYG 1PGRB 1F4XH 4NKOB 2IAMB 1BEYL 5DD6B 5T3ZE 3RU8H 1B2WH 2VZTA 1X5XA 1CVRA 5GGRA 1GIGL 3STLB 3V0AC 5ILTH 1NGXA 1CU4H 2EE3A 4JRXE 2NTFA 5DD5L 2HH0L 3VFPA 5E5RB 3QPXH 4TPRL 2BK8A 1EHLH 5BO1H 5E8NB 1KPUA 4YLQT 1XR9B 4P4KC 2B4CC 5DJAA 4FQHB 3ZKXB 5C0GB 4ONHB 2PXYA 1E28A 2R1XA 4M1DH 5FGBA 1JPSH 5DT1L 2EYTB 4XXDB 1PBYA 4F33B 2E6PA 2EDTA 4L9DA 5I17A 3RWCA 3WS6C 1MREL 3O45A 1NJ9B 1G7LA 1MFAH 3NBNA 2EEBA 3JTSA 3T3ME 3TO4C 3NTCL 5KSAD 2MSPA 32C2B 2JELH 3OR7A 1INEL 1FGNL 4K07A 5A16A 3SJVB 2UZIL 4PJHE 4QT5B 3MRBA 3QDGD 1P7KB 4NOBA 3T04D 4Y4FC 3QRGH 1ZT7B 1KCSH 3C5ZB 2NNAA 4DKFL 1UWGL 4HKJB 4MA1B 3SO3B 1AD0B 4YUEL 2P1YA 4FQCL 5E1AB 3QISA 3TN0D 4JFZL 5ESVA 3P9LB 3RWJA 3CFDB 4KAQL 4WI5A 4K55A 1GSMA 1T83C 1C16B 2JIXA 3PABA 2PTUA 3I9GL 5EU6E 5IMKA 1CGUA 4F7EB 4NRYB 1BX2B 2VLLA 3SJVE 1ERNA 5E70A 5IESH 3ULUH 1RIHH 4MQ7B 4LKCA 4AL8H 3BWAB 4PJ5A 4U6YB 1E27A 1XGUB 4G8FA 3L5IA 2E5EA 3BXNA 4R96B 2DIBA 2E9IA 3SE8L 4X6CA 2J4WL 4FA8A 4QOKB 2FD6H 1R3KB 3ARFC 2J6EH 5H35B 2IPKA 2DTMH 3U83A 2R2EB 4V1DB 1FYTB 1DUYA 4TSBH 3T3PF 4EUPB 2X42A 3SE9L 2VXSL 2RIKA 3OKLA 5B8CC 4GW4B 4HGWA 4HIXH 4X5LA 3AROA 3O4OB 4Y4KA 1LEKA 1BQHA 3HPLB 2YPLE 5DO2C 3TJHD 3DXAE 4WRLA 4W70A 3DX7B 3QEHA 3O9WB 5AAMA 4HD9A 4WWKC 3CZFA 1H0DB 3OPZH 3GI9H 1HI6A 4L4TE 2Z91B 4JO3H 2VN7A 3H6JA 1H15A 2DD8L 4WTZG 1BREA 2X4SB 1I8IA 1MF2H 1JPFB 1ZVHA 4XTRD 1ZTXH 2BSTB 2MPAL 4QRSA 3F58H 2BVPB 5D7IA 4M5YL 3RFZC 5EH1A 4GQ9L 4BSWA 3MRDB 1J10A 3W0WD 3SPVA 1UKTA 4OCXH 2B1AH 3RBSA 1RIVL 5GGTL 1K4CB 2MQCA 4Y19B 4O2FB 1QBMH 3T1FB 1WISA 2QSVA 3W9EB 3B83A 1I7TB 4KK9D 1U3HD 4S11A 1VACB 1VA9A 3GMRA 1MPAL 5BV7C 4G8GE 3RL1A 5C08B 2NNAB 4RGOH 5IQ9B 1IGMH 4E5XB 3MPCA 5TF1L 4GRWE 5IF0A 4M7LT 4XBEL 3QFDB 1IEAB 3FQXB 4YC2B 2PTTB 3K1KC 1U8LB 7CGTA 3V6OA 3SDXB 5H35A 4OCLC 3GSUA 2DQIH 4OM1L 3QHFL 1S7SA 3ARDD 1F4WL 3MA9H 1GC1C 4XTRC 3RKDC 3HFML 1PVHA 3K81A 2VQ1B 4HCRL 4L3CA 1SJXA 4R7NA 5CZXD 2COQA 1N2RA 2VITA 3MLTB 4MA7L 2X9YA 4DN4H 1I1FA 1M71A 4IRJB 5HYJD 3MNZA 4OCRL 5AZ2H 2ZCHL 3QEQD 2NY0B 3QCVH 4HKZA 5SWSE 5FKPA 5D93C 4Z95L 2ZUYA 3AS2A 3T3MF 3G6JF 1X4XA 4NQDB 3V5DA 3V0VA 3LV3B 1AR1C 2H26A 4CL7A 1FL5A 5JOEA 3UYPA 5IT2H 3EO1B 3C60B 4YHPB 1EBAA 1AHWB 3DMMA 5BOPA 3O8XD 3T8XB 3WUWB 2P7TA 3M45A 5D7JC 3RHWK 3ARED 4LRIC 5D71H 4WI7A 3EYUH 1RK1A 5LG1A 1NGWB 2NW2B 3MREA 1B0GA 1MLCB 3T2OA 3RX7A 1PG7X 4QHLA 4OQTA 2DLHA 1CGSL 1ZE3C 3REWA 4MD0B 1EFXA 1MH5B 1NEZG 4HF5L 4U6XA 5F7DA 1R3LA 4LIQE 5C0AB 5FGCE 4DN3H 1WTLA 2DLGA 1S3KH 4HK0B 3D3VA 1CL7L 3C2SA 3CFBA 3KLDA 1G9NL 1MNUL 2ZOLA 3N1QC 4M62L 2WBJA 4HLZG 5TE4L 3BH9A 1CFNA 1G0DA 3C8HA 4ZSOB 1D9KD 1JGLH 1K6QL 3X3GL 1OAYH 2QR0B 4X6FA 3VMOA 2H9GA 1KEMH 3JV0A 1RZKC 1KJVB 3VD4A 1EZVX 1F2QA 2F8VA 2C1OA 2NY6D 3FQWA 5INCB 5T33H 3ARBA 1HYRC 2AEQL 3GMLB 3IU3A 1Y18A 4P5MA 4ALAH 1TQCC 2DIJA 3MNZB 4NGHL 4NO5B 4ZO9A 4G3YL 4OLUH 2FX9H 1JPTH 1UWEH 4HHAA 1DQDL 1I8LA 3O6KH 1M7DB 1GXEA 4JAMB 1EHAA 3LH2L 3ZT5A 5E8PB 5IB1A 1Z9OA 3BJLA 4RMTA 4KKLC 5I1EL 3QYCA 3KLHC 4Z7QE 4PJ9D 4JEGB 1KF9B 3VXPA 4EKXA 1X4YA 3PWPE 3PWLA 5FM5O 3ULUD 3QI9B 4AZ8A 1CICB 5D5MB 4WFFE 4XVJL 4CMHC 4PJEE 3Q6GL 2B0SL 1ULVA 4OF8A 3BIKB 1A8JH 4RBPH 3OKOB 1A4JA 1JV5B 1SJEA 2ORBL 3FB6B 1MCNA 5DHYA 3H9YA 4ORGA 3OPZL 4HJGB 4HDIB 4JHAH 2DWEB 2JB6B 3FO2B 1KJMA 2FGWH 4GLRI 1DUZA 3HI1B 1LK3L 2AK4B 4ZFOA 5E6IB 2JJUA 3NCBB 3OKYA 3S6CA 1ONQB 1G7QB 4JG1L 3KPSB 3OHXA 2FZ3A 4PJ8C 4ONGH 1X7QB 2XN9D 4F57H 1BFSA 5JW4M 1K3ZA 1IEHA 2HVJA 1UH3A 2OX5A 3CC5B 1P2CA 4OCYH 4LL9A 3TPUB 1YMHB 5CD5C 4NQDD 1UWGH 1TPXB 5FGCB 5DJ6A 4F3FA 3BQUC 3MYZA 3OF6D 2RFXA 4OUUA 5F7FA 4YDKH 1XGRB 4P2QB 1HH6A 4U7MA 1R5IB 4JR9L 1T0MB 3BVNA 3MO1A 4KKLD 3VMNA 5TF1H 2V9RA 3KVQA 2F54B 4WW2A 1ONQA 5D6DA 5ID0B 1A9EB 1H3GA 3EFFB 1A7PL 4J6RH 1AGCA 1WBXB 1LP9E 1EEQA 4I1NB 4XNMB 2Y7QA 4Q9BA 1MHPL 2CGRL 4X6EB 4OZ4B 5IBTL 1YNLL 4KKAD 4M1GL 3SDCD 4S10A 1OAUL 3IDJA 3EZ8A 1DFBH 4P0DA 1TCMA 2MCPL 1DBAL 2EDBA 1A7QL 1NCWL 1BF8A 3QWQB 4NZTH 3OHXB 4NKMB 5JIHA 1OGAE 3QI9D 2HP4A 3NA9H 2E6JA 4PLJD 4LMQI 4MS8C 4ZFZB 1XGYL 1NGQL 3L5HA 1IJ9A 2ARJB 4P5TD 1KGCE 5DHYB 2R39A 1EXUB 4UUJB 4P3CL 4ZUWB 1F6AB 2D03H 4IRSA 4PJDA 1A0QL 4NRZB 5E6IA 4Z7VB 5EU3A 3C5ZD 5HHQB 3MRGB 2FECL 1MCHA 4OUOA 3DRTB 4ORGB 4UMGA 1F3RB 4JRXD 4ZPVA 5T3XE 4LCWE 4EN3B 1I1AA 4RWHA 2M26A 3B6SB 4JN1L 3W82A 2QQNH 1I8KB 2GQHA 5SV4A 4ONFL 3KPLB 1A7NH 1L7TH 5CKGA 1HILA 2HG5A 5JPMB 4X99B 2OQJA 3PE9A 4PB9L 4CMHB 4GQPH 2ED9A 5D8JL 4F9LC 2K1MA 3KG5A 3VE0A 1QSZA 5I1KH 1GVIA 4HULB 3QP3A 5I76B 5J9PA 2UY6A 4J3TA 5IB3A 2MTPA 4R4FL 4O4YL 2DRUA 2R2BB 2R4SH 4JANA 4HPYL 3MLUH 2UY7A 2EH7H 4PBWD 1JZ7A 3X3FL 4PRPD 5FO7B 2ICWB 5FKAA 1P7KA 4XX1G 4HLZH 2A73A 2K9UA 4O5LH 3P4NA 4UBDC 3MRIA 2DLEA 2ZUQC 3CSBA 3M17A 4I18B 1CD1B 5GZOD 1XF5B 1NUGA 4PLKD 1RUQL 2OL3H 2R0WL 3T2NH 5I66B 1IGTB 4GBXC 2VDNL 2CRYA 2CIIA 1HZHH 4Y2DD 4AL8L 4K2UL 4ZFGL 2XKNA 5TDOB 2V9TA 3V6OE 4AEHL 4TVPL 3QPQD 1I7ZA 1KEGH 2EXYD 1CD9B 1JGVL 3THML 2VLRB 3IGAA 2GJ6D 3WFDL 3V52L 4EI5B 4EXPX 1QR1B 2ITCB 4M43L 3D2UB 1KTLA 2YUWA 3MRMA 3LIZL 2LU4A 1YJDL 2EKSA 1F90L 4M8QB 4XPGL 3WJJC 3QZWA 3DUSA 3E2HC 4HKBA 3TA3D 2VDOH 1JBJA 4RZCB 3MXWH 5JXEA 1INEH 1FGNH 3CCHB 1P4LA 2ZJSH 1WUNT 2AABH 2CDEB 1JWMB 4NWTL 4OZHB 3P0YH 4XBPB 4LRNL 3RDTC 4WI4A 3DETC 3BZEA 4JN2B 1AGBA 4L8CA 1RUML 3U79A 4OZIE 3VWJA 2X41A 2AJXH 5IQ9A 1KCVH 2IPTH 4LLMA 4HSQA 5JR1H 4HUVB 4ODWA 1G7IA 1QFHA 4M7LH 4MXQD 3ARGB 4MQSB 3UTTB 4PY7A 4R90L 3QUZC 5SX5H 2Q8AH 1TMCB 1NL0L 3WS3B 5D93B 2CKBB 1HXMB 1CZ8H 5SX4H 5JNYA 2GJZB 5BS0E 4X4MA 1YPZF 1J8KA 1SHMA 2GITB 4XNYH 5C92A 4OI8A 3QUXD 5C0CA 1QR4A 1FNSL 5BV7H 1RIHL 2IAMC 4XXCA 3GBML 3VDCA 5HBBA 5D7IE 4DUWA 2HFEB 3BSZH 3QCUH 4EOWH 4O2CA 5T1KA 5BXFB 4L5FH 4P3DA 2G5BB 4Y5XB 2XZAH 2J1KA 1YN6A 3MRNA 1S78D 4M93B 4KUCD 3ZDXE 1NCBH 1T6WA 1O7VA 1LD9B 3VXRA 5F7UA 5LWYL 5ERWA 1QKZH 3QDMB 2NYYD 1BBJB 4U1JA 2VXSH 4HUXB 4PJXA 2YS4A 1DSFL 1HWHB 4Z7UF 5FYJL 3TT3L 2HWZH 4X6DA 3TA3B 4PJGE 2W65B 5I18H 4U31A 1ZLVK 3STZB 4YHML 1AGDB 1BZ7B 2DYPD 2DLIA 5IB5A 5E4IA 1I85A 5DJ8B 4IHOA 1D5IH 4MD0A 3HMWH 3L3HB 3TCLB 4L9LC 1IEBA 2NTFB 1ZVSA 3RAJL 1MREH 1DBBL 1F3DJ 1DEEA 3K2UH 4Y8AA 3S3PA 4Q6IA 5HPMB 1G0YR 1RI8A 3WMSA 3I85A 5HI5C 1I3GH 4I9WE 1GYAA 2EE9A 4DAGL 3QQ4B 4BFGA 1MVUB 3DX6A 1YYML 2BNQB 1XAUA 1QBML 2E7HA 2VIRB 1OCWL 4HWBA 4RFNB 3IXTB 1FAIH 2V2TA 1CT8A 3F7QA 4N0YH 1N6QH 4JY4A 1FFOB 5JPNB 1V3LA 1KCSL 1HHHB 1MCEA 4NQEA 3O9WC 5BW7A 3J8F7 1RHHB 4GXVL 1WWBX 1EGJH 5AYQA 1AE6H 4F2MB 3O4OC 5IMLB 1KIQA 4NJ9L 2KZ1B 2P5WD 4O2EB 1W72B 2Y25A 3HFMH 4XPAL 1M71B 1C8PA 1J86A 1PG7L 4N8VG 3VGGA 4Y19D 4HF5H 1OSPL 4R4ND 4HBCH 2FEEI 1C5CL 4I3RL 2H45A 3TPKA 3QO1B 5EBLA 4HJJL 1S9WB 4JVPA 5DHVH 4PTTB 2AJUH 4S1RL 5M95B 3LPGA 3QHZH 1NBVH 3QNZB 1D6VL 4L8SC 3LEXB 4E0RA 4XRCB 4MD5A 3X14B 4BZYA 3GIVA 4YAQA 3QQ3A 3CFEB 5FUCE 3VRJB 1SVCP 3N1PC 1U58A 4K94H 4Z78B 2RAMA 3C5JA 2BHZA 1XCQA 3NMEA 5EBWB 3WIHL 2BVPA 5SWSB 1QNZH 3H9SD 4G8GA 2NXZC 3GSWB 2CUMA 4I48B 4N8VB 1UYWL 1I8IB 5FM5M 4XC3L 3KYKH 2FLRT 2WWMC 5GISH 4ZTPH 3QFJD 5F1IA 3GNML 2ADJA 4HAGA 3O3BB 1XR8A 1KV3A 4MCYB 3TV3L 3QFDA 1PFCA 1AC6A 4JLRB 2QL1A 3STZA 5C08A 5TFSH 3K0WA 4AJ0A 5DA4A 2RFXB 4YQXL 4YBQD 3HMXH 4R4BA 3W5NA 2MMXA 2EH8L 1KB9K 1FVEB 5C1MB 4CU8A 4P2RB 5DDHB 3BE1L 3RVUC 3TZVC 2G60L 2JKXA 2V2TB 2NYYC 4JGUA 5D72H 3C60A 5J0BA 1YDPB 4GRLD 3O6FA 4X9HA 1HQRA 3QRGL 5CZVH 1ZANH 4UQ3B 4XI5D 2DYPB 2QHRL 2FECI 3HNVH 2MKWA 3UMTA 1IGIH 1LO3L 2ZUXA 2XTJB 3HUJB 4EN3D 4OLXL 1WWAX 1IQDB 3HI1A 4XVSL 5CCKH 5CWSA 4IRJA 1FL6A 4U1MA 2XZZA 1KJ2H 5IVXA 2FHBA 3LPWA 3KYNA 3BPOC 3D3VE 3L3KA 3IAPA 4P99A 1JPTL 4ENEC 3KS0J 1CVSC 1HHJA 2GT9B 2GSGA 5SV3A 1CXFA 4A6YH 4HUKB 3CVHH 5MEQB 2FO4B 1RV6X 1AQKH 3SQBA 1J8HD 4X7TB 4RDQF 2VDRH 4UT6L 3T2NL 4Y5VC 3WN5C 2ICWI 2NY5C 4LSTH 3P4LA 3M8OL 5HVHC 1KUMA 5TPWH 4HJGA 5LVEA 1S7SB 2K3TA 2ARJQ 1KFAH 2FX7L 5D7SH 3U46A 1KEGL 1JWSB 4U6HB 1ROWA 3SQOL 5FO8B 1JGVH 1LNUA 1T66C 3JWDC 4MD5B 3KYNB 4HKXB 3W2DL 5CJQH 5JHDD 3EYSH 2ZPKL 4ELMA 3DTXA 3ZE2F 3ULUE 5C0RL 5I18L 1UZ6F 5F70A 3IFOB 1EXUA 5EOTA 4FTVD 1OAQH 3PP4L 1T80A 5CGYD 5CJOH 3F7YB 2PYEA 2DJSA 3QQNA 4XVJH 4YXHH 3GJFK 3FHAA 3MRJB 4XT1C 5AUMB 3MRFB 2GJJA 1L9MA 4JO1L 2I5YL 3BGAA 1E4WL 4HAFA 3BPLB 4Z0BH 3K1DA 3CFIC 3RDTA 2EDJA 3TH4T 5IHLB 2ESVB 5FF6B 4DKFH 3HN3A 1FJ1A 4QWWC 4S2SB 1HWGB 3GMLA 4HC1H 5EUOB 5H37G 2OP4L 3FQTB 1N8ZA 4ODTL 1A6TB 4YDVA 1A64A 2GSGB 4HFWA 4M48H 2CKNA 3I3EA 3JWOL 1D3CA 3DYMA 4OF7A 4Z7VF 2H9GB 1JK8B 3LZFL 4MQTB 4KRNA 3NN8A 4NN7C 5D7KD 5EUKA 4PJ7B 2Z92B 4H0IA 4FFYH 2HA1A 4NPYA 1IGFL 5INDA 2LTQC 2D7TH 4XCFL 3C9NA 3ZT7A 4XPHH 3RY5A 5DTFB 5JW5A 2VLJE 4NM8H 1F8TL 5KG9A 3HI5L 3GMNB 4K3GA 5GS1A 3PGCB 3IFOA 1JZ4A 2R9HC 2X05A 4X7SL 2FX8L 1LE9A 5KBNC 5D7LD 2OZ4A 3FL7A 4FABL 5JW4Q 2AJUL 1UJ3A 3HI6H 4GMSH 2AXFA 1MHPH 1X7QA 2CGRH 1JPGA 4OD3H 2R2BA 3UCRA 3RDTB 3VFUB 1D5ZB 2YZ1A 4L4VB 5E2VH 3GMQB 4LSDA 3OKKA 5H37H 5DD6A 3CC5A 1A7BA 3FO1A 3BP5A 1BOYA 5ADOH 2R8SL 4QRPE 2FJFA 1CFTA 1UCTA 3RX8A 3O3AB 4P23B 2HWZL 4XAKE 3J7HA 4HHAB 5EU7C 4LOUC 3UJJH 1R3JB 2XKUA 2W60B 4WEBH 4ZDHB 5L2JA 2Y23A 1ADQH 4MHHI 1I7UB 4M4PA 3KYMB 3DGGB 5DJYA 1FIEA 4MWFB 4ZS6C 2DJ4A 4BFBD 1MF2L 1AI1H 1Y0LB 4GAFB 4LCYA 5JLZB 3EYFB 5H2BA 4LLMB 5GS1C 2A74B 3R1GL 5D96C 3KR3L 4ODUA 5C0JA 3DVGA 2XWTA 4LSUH 2F54E 2Y6SD 3NACH 4HJ0C 1FH5L 1X5ZA 1N6UA 2CUHA 3GMQA 3U30B 3ORJA 3E6FB 5I71C 2YPVL 5F88B 2FBJH 4OCWH 4YDLB 2FWOB 3GMOA 5CLWA 4AMKL 2X4UA 2HN7A 3KPPB 3ZKMC 4ODWB 4HZAA 1UACH 3BUYB 5TGBA 3VGDA 3RWCB 1JZ6A 3MLZH 4HS8H 4N8PA 3QXAB 5ACMA 3RL2A 3MJ9H 5CSBA 2C3VA 2DQIL 4OM1H 4JN2A 3TIEA 1M05A 3ROOB 5D1ZB 3VXQB 4LLVA 3DX9B 1HINH 5KANI 1LE9B 4WO4A 3UJTH 1FYTD 5HD8C 4WW2C 2LAAA 4IOSD 4XGZB 3RVTD 4HIJA 4NQCA 3PP3K 3LD8B 3WE6B 2AK1L 4WY7H 2WUBL 5SWQA 4L4JA 2P24A 3HMXA 2HTLD 1CGXA 4NKOA 2C4XA 2YD8A 3OKMB 2EYSB 3QCVL 3O0RH 4Q9QL 4D9QD 1OSZA 3WDHA 3DECA 5KN5A 1FN4B 4R7DB 5J11B 1BD2D 3C60D 4HWNA 5J8OA 3Q5OA 4V1DA 1ZVSB 1N59A 4JRYA 1GIGH 1MSPA 4KKBD 5DD3L 4WNQB 1BQSA 4G6AC 3WLWD 1QHOA 4Y5VA 2W59A 2W65A 4HIJB 4GG6E 1WVZA 1UWEL 3HC0B 2IPUK 5IFAL 4HV8B 1NKOA 2YEZA 3GNMH 1MRCH 2W0PA 3MRLA 1HILB 2HG5B 5A2JH 4XCYB 1KCVL 4KJYB 2X4OB 3PHQA 3HCVB 5EPMB 4MXVE 3Q5TA 1DBMH 2QADD 4U05A 3V79C 2WQRA 2H2SD 3HUJE 4LCWD 4ZS7L 2H3NA 2A74A 4G6KL 1XF4B 1VCAA 5TGBB 4U7KA 3RWIA 4OCMC 1H3UA 3JVGC 4FXGB 4YHLL 2XT1B 5C09B 4Q97A 3V8CA 2AJVH 3DIFA 1YN7B 2DN7A 3DV6B 4OFPA 4U1NA 2HKFL 1QSFE 1IKFH 1B6DA 5C6WH 1ZGLP 1Z9MA 1EPFA 4YBHA 4JFOB 4H88L 1TJIL 4DKAA 5D1ZC 1KIQB 4DOHE 1ZLSH 1MEXH 1U42A 3OMZA 1OW0C 25C8L 5FM8A 1AY1L 2UVFA 1E4KA 3GMRB 4RFEB 3VXMB 2KZWA 4MJ6A 5IM7B 4YFDB 1BQHG 2DQDL 1G7MA 3VW3L 1TTUA 1IEAA 1NCBL 8FABB 5KAQF 5TDOA 5D2LE 1FNSH 2P4AB 4NN6C 3BI9X 4UIMB 2V7HB 3IDIB 1N64H 3LQZB 2B2XH 5EC2B 3ZKQD 1J18A 4WI3A 2FR4B 1CE6B 1J9CT 2Q3ZA 3GRWH 5DWUL 1DDHA 4KWUA 3BRDA 4XPBH 1QP1A 4LSPH 4G6JL 3WE6A 4QXWA 2VZUA 3ZKNC 2OR7A 4FFZH 5CMAA 5DRNB 5T1LB 3UO1H 1BVKB 1RFDL 1MY7A 3AAZB 2EXWC 2EIDA 5GRZA 2VXVL 4OLYH 3ULVL 4WWKB 3KPMB 3BKYH 2EDKA 2XTJD 5EWIL 3RJDA 4Q74A 3V5HA 4MX7B 3AGVA 5JZ7C 5LAXB 1MFNA 4MJ2A 5GRWA 4OD1L 4KXZI 2DYPA 4MQ7A 3OGCA 4LSQL 1A9BA 2GJZA 3V4UH 2P7TB 5DD0L 3DX7A 1GGBL 3ZT6A 1BVLB 1NBZA 2Y06L 2XZQH 3DJ9A 2Z4QB 5HYSG 5T1KB 2HFGL 1LO0H 3CXHJ 4HBQA 5LKNA 1DCLA 2MPAH 3LKSA 4L1DA 4YHZL 1SEBB 1U2HA 3O6MH 4JO2L 5HHXL 2CLRB 5I73C 4MNHA 3N1MC 1UA6H 3H42L 5I8OL 4WUUA 5J1AB 4IS6A 5C07E 5KSVB 2OJZH 4K23L 2XNAB 3A0OA 3O3EB 3KPOA 3UAJC 3GSUB 2G60H 4OF5A 4JFOA 4LCWA 3EO9H 3UTTA 2R69L 4K3DL 3QUXA 4G9DA 4I5BA 1YEFH 3L7EB 1JIBA 1IMHC 2WIMA 3MFGB 1OQXA 5FUOH 2X9WA 3NFPB 1Z5LA 1A6WL 2WMPA 4NT6B 2PO6A 4JY5L 2X9XA 3MUZ1 4W4OA 1K4CA 1QLEH 4JCMA 1EFQA 3LKOB 2BCKA 3SCMB 4YBLC 3O81A 4DW2H 5HVGB 3FJTA 2CJUH 5I1AA 1FL6B 4U1MB 1MFDL 1LEGA 5I75B 4U49A 4NQTA 5CSZB 4JAMA 3SDXE 4TNVF 1T7VA 2Z9TA 4Y2DC 1UQSA 4TN9A 2X09A 4CU7A 1U8PA 2DQJL 1IGJB 1YEGL 3MRHA 1BMGA 1YQVH 4ODHL 2ADGB 2NW3B 4HXBH 2GAZA 2ZOKB 5GRVL 5B22A 5JZ7D 3DHMA 1W72A 4YXLH 1KB5B 4KRPC 4JN1H 1PAMA 4D0DB 1RK0B 1U41A 4NP4L 5EO9A 5F44A 3V5KA 3KYKL 3MGTB 5GRUL 4XCCH 4WU7B 1YNKL 2BMKB 1TETH 3TA3A 5D6DC 3SCMC 3MOAH 4NQCD 2ICES 2VR9A 1KYOJ 4FNLL 5EU4A 4KDTA 3MUGA 1D5MA 1GHFL 4H20L 2PNDA 3NZ8B 5KSBA 3BRGC 1KULA 5ANMB 4WO4D 4UU9B 1A2YA 1J88A 1NH6A 1J1XL 2I9LA 1MQ8A 5EBMB 1S5IH 2ID5A 2J8HA 3EW3B 2AXHA 3D0VB 1RHFA 1GOHA 3SKJL 1SMOA 5CCKL 3IFLL 2BZDA 4GKZB 4XNZC 2F5AL 3GDBA 1KJ2L 4LAQH 5GRYA 1SJHB 2J8UE 5C0IB 3C5SA 5IMOA 3SE3A 3OX8B 4YX2L 4L8BA 2DQHL 1MWAH 1XCQB 1BZ9A 3ZSSA 4GXVH 5EUKB 3MGTA 4KK5C 4M62H 5GRVK 1XCTB 1NGWA 3MREB 5KVFL 4OUUB 4N0UA 1TJHL 1G6RL 3V7AG 3HR5B 3DRTA 2ZSWA 4PTUA 4PGDB 4XRCA 2VDRL 4NT6A 3ZL4L 4YEEA 3CU1A 4HFWB 1X5AA 1FPTL 2A6KA 3WDJA 3BPCB 1GGCH 4LHUG 4O9HL 5FUCC 5JXEC 2AJZA 3GSNB 3AFLA 3RU8L 5I15L 4XCEA 2VRAA 5EBWA 3MR9A 4IIQA 4R9HA 1JE6A 2A83A 4KZDH 1U8QB 5DUMH 4KRPD 2PYFB 3ZSTA 1KTDB 4NKMA 1O5DT 4BSVB 4FXLA 3VG0L 1U2CA 3BH8B 3MUY1 1KLGB 3DHJA 3C8KA 3G6DH 4YHIA 2C5DC 5BVJB 3FN3A 1KJVA 1R3HB 1XF3B 3QH3A 3TT1L 4OZFA 2AW2A 3ALPA 4LARL 2C7UB 1I1AD 3HUJA 2APWA 2W0FB 4JRXA 3D5OF 1J05B 1JNNL 3DURA 5DJ2A 4LEXH 4P23C 5HVWA 3RIAF 4F37K 1MCQA 3UROR 3WCYA 4QXTA 2CRZA 1R24B 5KZCD 5FYJE 5TDPB 4H0GA 2ORBH 2XZCH 5C0AA 3WHE0 3SY0B 4FRWA 4G6FB 1JI2A 3TT3H 4YZFE 2VDPL 1J1PH 1DE4A 3QR2A 1MQKH 5JA8B 5C2BL 3SEPA 1GOFA 2D0FA 1PZUB 3ARFB 5ANME 3OX8A 1OM3H 5IQ7H 3TJEH 4JFZH 5ELIA 2EDFA 4N0FA 4R3SA 5IFHL 1A3RL 1QOKA 4WCYL 1JN6A 4KPHH 3EHBC 3SDCA 2IMMA 4XGZA 4F7PB 2DM7A 4WDIB 1V7MH 4RFOH 3RWGA 3WHE1 3CGTA 4LLYB 1HE7A 4L8BB 4JREC 5IESL 5DMYA 3VU2A 4RZCA 3TIDB 4P5TC 3VFUA 2AK4A 3L3JB 4K9EC 1M05B 1PSKL 4TSAH 2HTLC 3UEZA 1T66D 5FHBH 4NYLA 4IRSC 1XF2B 1DE4B 4WGWB 4RGNE 4XMLH 3LSOB 1CG9B 4PBXA 3FFCA 3GJFB 1T5WB 4HZLA 5GGQH 3TBSB 3ZO0A 5I0DA 3SDAD 3HRZA 1JMZA 1FG2A 1WZLA 3H7BB 3WNOA 3OF6A 4XXCC 2XG5A 1NLBH 1G0XA 1XT5A 3LQMA 4X6CE 4FTVA 4CNIA 3CPLA 1CDCA 4EVNB 5I1DB 2C4FU 3VGHA 2HJLB 3VFTB 1PKQB 5JHDA 4I8DA 2WINB 3Q3GB 2G75B 2PF6A 1J1OH 1J05A 2N1KA 1HQ4A 1JK8A 2PR4H 4PJAA 5HYIA 1KOAA 2DMKA 2H32H 3SKMA 1NEZA 1II4E 5DJZB 1IAKA 3HG1D 4Y16C 2EDXA 3NPSB 4LGRB 4HFUH 5BVJA 3HZKA 4TPRH 5IIEB 5J13B 4M6AA 2DD8H 2F19L 1J8HA 3HNSL 3BDXA 4ONOA 3UBXG 3MLRH 4L3EE 4KGJA 1X5GA 4BH8B 5GRUH 1DN0A 2DQUL 32C2A 3QJHB 2DLFL 2VH5H 2W1NA 3EAKA 3H9ZA 3LN5A 5DD1H 3RTQB 2FH8A 1JHKL 4UUJA 1PQZB 3TH3T 3P77B 4MA3B 3C87A 3VXSA 4N9OB 3WEXB 2ZZUT 4IDJL 5EZOL 4ZUTA 5C6PB 4IRJD 4XNZB 5HYJB 3VA2C 3CDFA 1D6EB 4LSSH 1YUHA 1DQTA 5DK3A 5DJZA 5D6CB 1XFPA 4EN3A 3OSKA 5EU6A 4OQTH 3UJTL 1S7QB 5HYQB 5IB5B 3PHQB 2X2YA 4G7VH 2CLVA 5I1HL 4LLUA 5AYUH 4CMMB 3IDNB 4JFHE 3GI8L 3SN6N 1TDQA 1MJJB 2IQ9H 2VO5A 2BOCB 3OQ3B 2ZSVA 5HDQH 1G7HB 2M8XA 3MX0A 2H2SC 5MHSE 1Z9SA 2OXHA 4LGSB 4GKSA 5C08D 1P6AB 1LK2A 2I24N 3IYLW 2G5BA 4CVZB 3P0VL 1MNUH 35C8H 4KV5E 3HAEB 3QFJA 5FCUL 3SE8H 5FO7A 2VL5B 1RURL 3D3VD 3QDHA 3V5HB 4XP5H 5MEPB 2FYYA 5ENWB 5CEZL 5GS1B 3CMOH 5JO5B 5ESQA 1MCRA 2NXYC 1NMBH 1CLYL 4YHKH 3BUYA 5CEZD 1CTNA 4DTGL 1QRND 4AEHH 5F3HA 4MJ5B 4NHUA 1QFUH 3BIAX 2FWOA 3GMOB 1WF5A 1NFIA 4S1SL 3TT1H 2XY2A 1CCZA 2GJ6B 4EI5D 4BK5A 3M8OH 4RISL 3GSQA 1RZ7H 3RKDD 5IEHB 3QUMH 4JM2F 5F71A 3RX5A 3FN9A 3RY4A 4JANB 2OK0L 3SDAC 3FRPA 1EEYB 1T1WB 3RPKA 3S3SA 4Z77B 1CGSH 1UEYA 2MWCA 5AG9A 1EVTC 2FEEL 4E9LA 4GG6A 1HSAB 1FNEA 5DMGC 4WI2A 3KPOB 4UTAH 3QEQA 4JO3L 5DMJB 5L6YH 3LRGA 5GGSY 5HYJA 1QRNE 3QXDB 3IVKB 4AY0A 5I74C 4BQCA 3QCTH 4IDLA 4C58B 4DZ8B 3QUKB 5HI4D 1P6FA 3B3IA 3WXWL 4DQOL 4E41E 3N0PB 3E8UH 4N0CC 3OJ2C 1ZGLB 3GBNL 2X40A 5IMKB 3HB3C 3NGBC 5C9JB 1NLDH 4RAVB 2W0LA 1JHLL 5FA4A 5E2JA 1CLOH 2OP4H 2QQKH 4WI6A 3ARDA 1MJ7H 1YEKH 4OZIB 3DXAD 1F6FB 1TENA 3P4OA 3VWJC 4FQ2L 3ARQA 2EDLA 4TUKH 1IKNA 4I5BB 3LZFH 1OW0A 4XNXL 5I2IA 4LCUA 3OR7B 3AVEA 2YKLL 5CSGA 5EN2A 1C7SA 3OB0H 5IJVB 5D1QB 2D7TL 5CJ5A 4NM4H 2GIYA 1NPUA 1VPOH 5KVGL 4NHUB 4V2CB 1X5HA 2KBGA 3DUSB 3HPJB 4KHTL 1F4HA 2BRQA 1W0VA 2NY5H 3NFNA 4HIIA 5DD3H 1D9KB 1FE8H 3VI3F 4K8RC 12E8L 3RY6C 4L29A 3VXRD 3UJJL 3OKEA 4YHPA 1CFVH 4R2GC 3IRPX 4NUJB 3LVEA 4OGXL 1PX3A 1T7ZA 3PV6A 4J1UA 3DI2B 2CIKA 2EDWA 4GW4A 4HGWB 4K7PH 2AJYH 4CN4A 4P46C 3S98A 4K7FB 2EDRA 4YHZH 3IFPA 3QEUA 4I3SL 4XNUH 4FQXB 5ALCH 1NBYB 4I77H 4Y4KD 2QQLH 1KTRL 1BAFH 4UI2A 1NGPH 4Z76B 1ITCA 1N0XH 4DGYL 4KJQD 5DYOA 2XTLA 4Q2ZB 3AB0B 1S7WA 1LEIB 2XFXA 1IRAY 1Z5LB 4ZYKA 2HKFH 5J4MA 1GJIA 4HUUB 4FNLH 1WSST 2AI0L 1AR1D 3GSRB 5FYKL 4Y19E 4LFHG 1VEPA 5FB8A 4IOFC 3U4EA 1KT2A 1NFDA 4MQXC 3QG7L 3S37L 4N90D 1AY1H 2DICA 1OLZA 3P4OB 4NNYB 4AT6A 4M9OA 2I07A 3UZEA 3CXDL 3RWEB 3C8KB 1H3WM 4O2FA 2CLRA 5FA4B 3MV11 4Q2ZA 4GBXD 2BSSA 2HT3C 4G80A 5IV2B 4IIQC 4N5ED 3ULVF 1ZGLM 4Y88A 4QTIL 1WGOA 3TN0A 3WNMA 3GM8A 4DEPB 5FXCH 5L9DL 2R4SL 3IFPB 3HR6A 1IC7H 1PX4A 4Y89A 1TITA 3G6JA 1I4FA 4DW2L 1KNOB 2WZPD 3D39B 3ULUL 1LO2H 5GS0D 3LQAL 1DQQA 2Z91A 4NQVB 2CK0L 4JGMA 4GOSA 5BZDA 3BPCA 1UB5B 1RUPH 4R26H 5I8CA 3IF1B 4PGBA 1S9YA 2ESVE 5F6IC 4TUJA 1CXLA 2G5RA 4QCIA 4I0CC 3GMNA 1YY9D 3HE6B 1Y6NR 3LHPL 1W0VB 4HIEA 5T1MB 3JV4B 3MMEB 4HS6B 5F96L 4HG4K 4LKXA 4PJFE 5C7XH 4NO0A 3SE9H 1YA5A 1YECL 2EICA 1ZT4A 1NEUA 2KH2B 3MGAA 3NGBB 4IOIA 5DD1L 4JM4L 3SDCC 2A6JA 4Z8FL 1L0QA 4PRPA 1XZ0A 3L3JA 3Q6FA 4HK3J 3U7YL 1YJDH 3B5HA 4RGNB 1ACYL 3L5JA 4N1HB 5A3ID 2YD4A 5DRZA 3GK8H 3OKOA 5TE7L 2IWGA 1LE5A 3R4DA 5J06A 2YD3A 2FATL 4UOW1 4CU6A 3C8DA 1ORSB 2H1PL 2UZIH 1U8IA 4WU7A 2PUQT 3N9GH 5C09D 1FIGH 1U8MA 3BIBX 3FKUS 3QJFA 4R6UA 1ZMYA 1B0GB 5I8EA 4YNYA 3ILQD 1QPXA 5B4MD 4P4RA 4FZ8L 2VKXA 9CGTA 3V4VL 1X5JA 4H1LB 3QNZA 2JTDA 2WWKO 1EUUA 1JTOA 4WHTA 2ZUVA 3QRFM 4P2QE 1G9NC 2VLJB 1BGXL 8CGTA 4H5SB 2FIKB 3HE7C 4XBGB 3CIQA 4ODSH 1OPGH 3L95A 4QXUL 2E3VA 2BVEA 5J6HA 3WIIL 2YKLH 1AQKL 4IRSD 4TVPE 4XH2B 1LO5B 3TBYB 1CL7I 5E03A 3PWLB 3HC3L 5E5UB 3LQAC 1TVBB 1KTKE 4P5TA 4PD4J 1AGFA 2O61A 4NO2B 4LLWA 5DJCA 1F4YH 3KPNA 4NZRH 3QI9A 1Q94B 1I7UA 5FHAH 2I60L 4NZUL 4WHTB 1EJOL 2O93L 4OLYL 3G08B 4POZC 4N0UE 5CJQL 3MUHL 4OTXL 4HWBH 3MNWB 4OKVB 2C9AA 3QPXL 1UJ3B 1TCRA 2W9DL 3IU4L 5EBMA 1FBIH 4U1IA 2A9ML 4EVNA 3TNNA 2BNRD 1OM3L 5IQ7L 3RZCD 3HKFA 3FB8B 4LP4A 1P4BH 3EYFA 5EZIL 2DI8A 3D18A 1A3RH 5A1AA 3KYOB 2Y6SC 1CK0H 3BPNC 4NJAL 4X4XA 5HGDA 1LQSR 4NN7B 2XZCL 4GW1B 3P2TA 4R8WH 4UIKL 1S7TB 1T2QL 5IWLC 5LGJB 4ZUWA 1FO0H 3RGHA 5GGVL 3JTTB 1B0RB 4AQ1B 1XIWB 2VISA 1F11A 4F57L 4KMQA 3SGJA 3HE7D 4PRPB 3LRSB 3UZQA 3LCYA 2DQUH 2F54A 4WW2B 5ID0A 2PW2B 1JZ5A 2V2XB 5F9JA 4PGJA 4L9LA 3ES6A 3QAZB 1HDMB 1NLDL 2IBZY 4EBQH 4X98A 1QR1A 4U1LA 2BVQA 1XGRA 5ADPH 1QTYT 3MA7B 5K33A 1XR9A 1KG0A 3PGCA 1CIDA 4JFDE 3O3DA 4PJBB 1IBGH 2O5ZH 3F6LA 3MCKA 3DPBA 2DQCL 4U1KA 4AK1A 2CXKA 5AUMA 1UA6L 4QNPE 4MB3A 3TNNB 1UENA 4G43B 1UM6L 4OZFB 1BJMA 3MO1B 1WBYB 3RA7H 1U8HB 5CFHA 4HS3A 2EC9U 2JJSC 4HGMA 3DURB 5T5FL 5IBTH 3ZYOA 5HHME 3BUTA 3WN5B 1Q9LA 5DJ6B 2IPUG 4MNGA 3MV7A 5ACLA 1MJ8H 1KN2H 5E8EB 4B50A 4KJWC 1SQ2N 3O8XC 3R06B 2A38A 4J3VA 4P5KA 4G9FD 3VXMA 4HKJA 3GMPB 5FCUH 3VI4F 4RMRA 3OAYH 4QF1A 1S7VA 4WI8A 1H3TA 1IFHH 2BY0A 4KROB 2AV1B 3QA3A 1HOCB 1F4XL 1HEZA 2J2ZA 2ITDA 3MLXL 3T3PE 3ARBD 3K8MA 4HIHB 1KELL 2DQJH 4XCNA 3CXHK 3EO0B 1AXTL 3L3OA 4LSVL 3VD9A 5I74B 1JFQL 4EDWH 5J7CC 4LCYB 3R06A 1MAJA 2XA3A 3KJ4C 3LDBC 4Z7NE 3QWOB 1RJZA 3EJJX 4PJXE 5TQ0L 3CK0L 2FBJL 4OCWL 1AD9B 5E08L 3EFFA 1TETL 3MRQA 2G75A 5HDQL 5H8DA 2D9QB 5JHDB 4XVTH 3OKDA 3WXVH 2HJFA 2DL2A 1A7OL 4KJYA 4JHAL 5D96B 3OJDA 1YMME 5ICYA 2BSRB 3OWEA 3PWUA 5I1HH 4YHOH 1OAXH 4JGJA 4ONGL 1N4XL 4WV1A 4F7PA 1MRFL 4JFDB 3EFDH 5F3HB 3O3DB 4FQ1H 3TP4A 2OTWB 3DETD 4C56A 2R2EA 2BVQB 1E6OH 3AREA 2MQ3A 4HIIB 1DEEB 1P9MC 3I75A 1IGIL 2E9WA 2NY4D 4P2OA 1FVDA 4ETQA 4DUVA 2D9CA 5I1LA 4G5ZH 2WAHA 2XN9E 2W07A 3UP1A 1T1XA 3V6FB 1QEWB 5D1QA 5IGXL 3WLBB 3I3BA 5F97E 4XCNB 1DDHB 2IFFH 3QUZD 1T20B 4XB7A 4PP2A 2BY3A 4PJCB 3L3IB 4WWKD 2D03L 4NQCB 5I2IB 3X13A 3DX9A 5J1SC 4HQQL 3CH1A 4S1SH 4XP1L 4KI5E 1F90H 3H0TB 3TIEB 4TUOB 4QOKE 5CIPB 3NTCH 1MCIA 5DUPH 3PIQB 3VE0B 3BE1H 4FG6D 1KPVA 3TCXA 2K7PA 4GAYB 5D5MF 1M7IB 3U4BH 4X5WA 1DBBH 3NCYS 2MHAB 4QXGL 1KENH 3F65A 3MV7E 5J89A 2VMFA 3RWJB 3MLYL 4G6ML 1G7IB 2BDNL 4J3UA 5GIRB 1N5YH 1U95A 3G04B 2FCBA 1NBQA 4I2XE 2E27L 1U3HA 4K8RH 2FB4H 3K4AA 3MFFA 4WCYH 4ODBD 5KANG 4KPHL 3PHOB 5GQBA 1T1WA 3O2WH 4V2BA 3U9UA 3NCFB 3GB7B 3ARGA 3G5VA 3HCVA 4TUOA 5C0FA 4OCSH 3W0WA 4TOYH 3AU1B 3FO9A 4LU5H 1W0WB 3MRLB 3BD3A 1A4KB 2P5ED 4ZNCD 4B0MM 4WFGD 1JWMA 4YBQC 2UWEA 3FCTB 1ED3B 3TN0C 3JWOH 2J8UB 4XPAH 1WJ3A 4FQQB 2VAAA 4O2EA 3VWKC 3INUH 3P4MA 1OARH 2DKMA 4HJJH 3HC3H 4Y5VB 2AJSL 3S37X 3BT2H 5F7EH 1A1MA 3UTZA 5GHWH 4JZNB 4UT9H 4RX4A 3WL9A 3O2DA 3TYFA 4HMCA 1QO3B 1YNLH 4QRRA 3HAEA 4L8SA 2A6DA 3VD3A 1Z0NA 5F6HJ 4P3CH 5DS8B 4WHYH 2JCCB 2B7DT 3MLWH 3WIHA 3QO0A 3U7WL 2EDYA 1E4WH 1YN6B 5EA0L 2JJSA 1LEKB 5L8LB 5C70A 5IROA 1J5OH 2XQYK 8FABA 1JPFA 5EORL 3B5TA 1FO0A 2FEDD 2X4TA 3HG1B 1FQ9C 2ATKA 1CDJA 1RJCA 5K9QG 5C8JA 1W0WA 1TFHA 5E8OB 1DQML 4LDOB 2P44B 2CXGA 3DUUB 4N0RA 4ZQKA 1B4JH 1H0DA 4TRPH 5BXFA 1IM3B 1V8HA 4R4NC 5BVPL 1NUDA 1IE5A 2YD7A 1I3GL 3TGXA 3ARZA 1RMFL 4N9GB 4HWZB 3DRQA 3LKRB 4Z7WE 1SVZA 2JIXD 5EOCJ 1MELA 4PJ5B 3CX5J 1UVQA 4XMLL 2LTQB 1OP9A 3OJMB 5D9SA 5C0DA 3SDAB 1JV5A 1SJEB 3FB6A 5EOCH 5CGYC 4UIMA 3V6ZA 4U33A 5BV7L 3A6CH 5GSVB 4XH2A 5EC1B 1F58L 4CN6A 3NFPA 4Q6YA 4HMEA 4MA1C 3RIFK 3MRPA 2AJ3B 2EIZA 3X3FH 1SJHA 3KDMB 3S96B 1RJYA 1LO2L 2RB8A 1WQVT 1ZK9A 3KWWA 4FQXA 1RU9L 3LQAH 4O5LL 4FFWC 4CN1A 1LMKA 4IIQB 3BZFA 3PJSA 1U92A 1HINL 1JYWA 1ZT4B 4NUJA 1ZV5A 3LEYH 1S7WB 2W38A 2VDKH 1JGEA 4PRPE 3HNSH 2D2OA 1H3VA 2B20A 1J7VR 3UAJD 4QOKD 2QR0A 4XHJC 3V0WL 1ACZA 5LGHH 1J0ZA 1U8IB 4P23D 2YPLA 2KDGA 4U1SB 4XC3H 1ZSDB 3MRHB 5ID1B 1B4RA 2NQCA 2MQ0A 4PJ7A 5GXBB 1WAAF 1YDPA 1KELH 5K9JL 1GZQB 3T2QA 5CSZA 3WFCL 3KPRD 4PRNB 1NANI 2NLJA 4P2RA 1CDUA 4ZUUB 3CDGA 2ADIA 5AAWA 3H9SB 5F7MC 3KLSA 2MKLC 4DGYH 43C9B 2OI9B 3VXUA 1R3KA 1WIUA 4U1IB 4A2LA 4JFDD 2OTUB 3MACH 3MLPA 4KUZH 4KTEL 1FZJB 2BOBA 1C1EL 2FATH 2AGJH 3D39A 4WENB 1JGLL 1ZANL 5IROC 5BRZD 3MJ7B 4YGVB 1E4XI 4R0LC 4XPFL 5C0DB 1KEML 5SWZD 1N8ZB 4LLAA 4JJ5B 5JIKA 5I8CB 5BQ7A 4BZ1H 5GGVH 1VKXA 4AH2B 4U3CA 2NW3A 5GSRB 4X8XA 3KPRE 2A77L 5DJ0B 4HUUA 4LPUA 3LN5B 2V7NA 4FQ1L 1N6QL 5JLZA 4XP5L 1DUZB 4I13B 3CLFL 1WEJH 2Z31A 5C09E 5J6GA 3HS0A 3FQWB 3QUYC 4JFFA 3Q48A 3QAZC 3CUPB 4ZPVB 3C09C 3LN9A 1NCCL 5L2KB 4JQIH 3DTXB 5DK2B 1ND0B 1U8NB 4FABH 4HWBL 4F15B 1GRWA 1CICA 1QNZL 1JWSA 1OAZL 4MLSA 5DVMA 5GHWL 2YMXH 3OAUL 3KXFB 4XNXH 3K7UA 5CJXC 2A6KB 3ME0A 5IVZB 5ISZD 1X3DA 3L9RB 2KKQA 4M7ZB 3ZYIA 2VXQH 4NNXA 2ZPKH 2X5PA 3HC4H 1Q9WB 1EFXB 3SE3C 1UWXH 2R9HD 3OB0K 1FBIL 2Q7YA 3HMXL 1HHJB 2E9JA 4YHMH 1AGCB 4EUPH 3DSNA 1WWWX 1ORSA 2WNGA 1KB9J 2AKRB 5I73B 1P4BL 4PJEB 4XBGA 1A02N 4LHUD 4OT1H 5E2WL 2CH8A 4P59H 1OHQA 2H6PA 4GXUN 1WLHA 4EI6A 3MRMB 3PL6C 4FXKB 1OAQL 2FDBP 5ETUA 3BVNB 4LQFL 4JO1H 4WV1C 3N9GL 2ICWA 2YOCA 3VH8G 2DI7A 3ROOA 3EYQC 1AJ7L 4X4XB 2CUIA 3RWDA 1NGPL 3E6HA 4RMVA 4WFHE 1LE5B 1LVEA 5JMOC 1PY4A 1EGJL 2CKBL 3MNWA 4OKVA 4G6AD 1HYSD 2VSCA 1TIUA 3DBXB 1A5FH 2V17L 5HHXH 3RUGA 1KCRL 5F9OL 4RGOL 5DQDL 5EIQA 4GG8A 4ODSL 4OM0H 3S3JA 4QXTB 4WDIA 4PP1C 4OFYA 5CGMA 2XQBH 3WD5H 4GAJH 4DWHA 3ZYJA 2XKSA 3DVFA 2CSPA 4OGYH 5D1ZA 3SGDI 1HHKB 4JKMA 1T4KB 4GBXB 4NZTL 3RWFB 5L88H 1X5KA 4XMKL 3NCCB 4D9RE 3D9AH 3ARFA 4PUBL 5GJTH 4IMLB 3UTSA 1R5WA 2IQAB 1ZGLA 4UDTB 1F3JB 4HWEH 1U3JA 3FAXA 4NNXB 2NZ9D 5HHMD 1MIEL 5FV2A 1IAKB 5HYSA 3G6AB 4KQ4H 4LBEB 3FZUC 1WK0A 4B5EA 3ARDB 4N90E 5J3HC 2AJYL 3GSQB 4MGXA 3CSGA 3BZ4A 3U1SL 5SWZE 4NKQB 4PJFF 2VB5A 3HI6L 4GMSL 4I4WA 5FFLA 3D0LA 3VFNA 1LO4H 4Z7WB 3UJIL 1OGTA 4LASL 1X6NA 4J8RA 1OTTC 5TDNB 1DQMH 1JTPA 4U1KB 2DDQL 2W9EL 3ARBC 2V5RA 2RHEA 3MRGA 5CBEB 4OV5A 1RJLB 4LDLB 4PB9H 3NCEB 1S7XA 5INCA 3KNBA 4GRWF 2D4DA 4ZXBC 4F7MA 3B4NA 3TBTB 1G7PB 2DQGL 3U2SB 3SDDA 2YR3A 4EI6B 4M61A 4POZD 1NGXB 1MVFA 3BFOA 2PCPB 1RY7B 2GTZA 2NX5A 1LILA 5D7KE 4DEPC 3T65A 3QZWB 4NN5B 1MFAL 2VLKE 3H3BC 5FUOL 4FZ8H 1AE6L 1WCBB 1U8OA 4HC1L 4P4KA 1JHTA 2E27H 2Y36H 4G42B 4LPXA 3VGFA 1TPXC 3VXNB 1KCKA 4Y2DB 5AWNL 5IKCA 3GSXA 4ZOEA 3TYGL 1E6OL 3BHBB 4LVOB 3G5XB 2ENYA 4U6VH 4MA8L 5CMAB 2EYSA 4N5UA 2YC1A 3BESR 3U0PA 2FL5B 1EEUA 3W2DH 3VFMA 2VDLL 3ROLB 2ZSVB 4XPHL 4YHNB 4OKDA 4L4TA 1QYGH 4Y4FD 3S97C 3LQZA 1FYTE 3EUUA 4V1DE 3P9LA 1TZGH 3ARTA 2QEJA 4FN0A 4P9MH 2E6QA 2JJTA 4Z7OF 5BS0A 3H9HB 3G04A 1U95B 1MCWW 4HC1A 4YWGH 4PTTA 1GL4B 2NY1D 3TNMB 2X4UB 1I7RA 3C6LA 3TO4D 1OWWA 3MLVH 4KKCD 1ZAGA 5IFAH 2NCMA 4LPYA 4IOFD 4NQSB 1S5IL 2YK1L 4Q6IC 2L7JA 1FNEB 4WTWA 4NOFA 2OJEB 4JCLA 3WYRA 3TV3H 3OL2A 4PJHB 4XVUC 4BK4A 3U7WH 1XGQA 4OI7A 1Z0MA 2XY1A 2UUDK 1BJ1H 3C5JB 2Q87A 1RHHA 3WJLA 1SEBA 1XGPB 4YR6A 5IMMA 5EC1A 3SCMA 3D2UA 5IEHA 1C12A 3DV4A 4M9PA 5CIPA 4GFTB 1NFIB 3QG6B 3BEVA 2C26A 3U0PB 3GSVB 1W8OA 4QRTA 1X5FA 2O5YH 3VFWB 4XMPL 5EBLB 5DEFA 2EO1A 5JOFA 1QEWA 4FHBD 2VLKB 3L3IA 2P5EE 1P4IH 1MFEL 4RMUA 3TVMA 2ARJA 4KZDL 3O8XB 2A6JB 2EDOA 4OFYD 4MAYD 3PNWA 2HLFD 1UZ8B 4W81A 3ZHDA 3D39E 1NANH 1N0LA 2APFA 1DLFH 2OSLA 3WJLC 3C2AH 1TJIH 3OXSA 2Y5TB 2RCSL 1FP5A 5J56B 4HH8A 2GI7A 1F58H 4GS7C 2IG2H 1UB6B 3CSYA 1AGDA 3ELAT 4NC0B 4CBPA 2EEDA 1CXKA 3GIZL 1KLUB 2HJKA 4D8PB 4M02A 5L8KB 1PZ5B 1AHWC 2VLRD 4PRNA 5I1JL 1S78C 3HPLA 4YXKH 5DHXB 4Q6IB 1NLBL 4WFFD 5BRZB 2UWEE 1QBBA 4M5ZH 4LMQE 1A4KA 1QA9B 3V6OC 1XGYH 3MJ9A 2XV6B 5ECJE 3BQUD 4OZIA 5C0FB 2BY2A 4UV4L 4LHUA 4PYHA 2VQTA 4GRLC 4APQA 1UADC 2Q86B 5IVOA 4GRWH 4LSQH 3WS3A 2VXVH 1KENL 3N06B 2J8UA 1BAFL 1IFHL 5T3ZL 2R23A 3T0EB 1PJ9A 3OAYK 5DJDA 3OAZK 3GSRA 4D9LH 1Q0XH 1WC7A 3MV9A 3A6BL 3GSOB 4GH7B 4UTBL 4HKZB 4DZBB 3TO4B 2FSEB 5GGVY 3PQYB 2HFEA 4K71C 4B7IA 4M8VA 5JTWA 5D71L 3TLRA 5I8EB 2L4OA 1CICD 3BX7C 2HRLA 5IHUH 3MJ9L 4M7KH 4P48A 4PPTA 3T1FA 4M1CC 1EUTA 5K9OB 5IFJB 3B9KB 4BUGA 5J6HB 1CWVA 4XPBL 2ADFH 4JFED 1TNMA 3O9WD 5DJDB 2NXYD 5E99L 2OYPA 4LHUB 4QTIH 3DUHA 3IDJB 4BZ2L 2HTKC 5DMKA 4XWOC 4C4KT 3H7LA 3OKEB 4L3AA 3WIFB 3L3GA 2NPLX 3VRLE 4RGMC 3BKCL 5BRZA 3MC0A 3V5KB 2ADIB 2JB5L 4L3EB 4J2XA 1NMCB 1JYNA 4QO1A 1MHHA 4PJ5E 5EO1A 3MQIA 2XRAL 4A6YL 1TXKA 1UXWA 4Z6AT 2ADGA 2XA8L 3VXUD 4PRDB 4HIXL 3OZ9H 1GAFH 4G8GB 3NFSL 3L5XH 4KRMB 4LASH 5GRJL 5D5ME 3UBXI 1FLTX 1JNNH 1AI1L 4JG0L 4UT7H 1R5VB 3T0BA 2AERT 1CLYH 1I3RB 1VEOA 3QO0B 4YHKL 3CK0H 3MACL 2AJ3A 5KS9E 4KC3B 2I9LB 3MXWL 1U58B 1G6RB 1F3DH 3TBWA 1E0OB 4OF3A 3QUZB 3G6JE 1BFVH 2BSSB 4JO2H 4QXGH 3MUGB 5IV2A 3RIFF 4GW1A 4JO4L 3BMWA 2A1WH 4WFHD 1VHPA 5I71B 1T03L 3O9WA 2J6EA 2GK0A 1T21A 4BA8A 2BMKA 5HI5D 3DMMC 2OBGA 2OQJB 1N5YL 4YHOL 1P69B 4FFVC 3PJSB 3L3DB 3GK8L 4GLRH 4GRMA 1YPZB 2APTA 3ULVE 1I4FB 3ZHLA 3IF1A 2J5LB 2H1PH 4NWUH 1E4XH 1B0WA 5F1IB 1C1EH 1VFBB 5DK2A 2FJGB 3KDMA 4MD4A 5HGBB 5E8DH 4G7YL 3B9KA 1LDPH 2HKHL 2UVEA 5DJXB 1KCUL 4L3EA 2IH3A 4BZ1L 4JHWL 3GKWL 5DC4B 1HXYA 4M03A 4ESKA 3S5LG 3QDJD 2DLTA 4MCZB 5B3JE 1Z3GL 3C5ZC 5J57B 3PL6A 3WLWC 3CMOL 5HHOB 1AIFB 4WY7L 4JPWH 1HHKA 4JFPA 4FG6C 4KJPD 5DQ9A 2CKBH 5DVLA 3RZCC 4APQD 6FABL 2WSKA 3HUJF 2FIKA 4H5SA 4J4PC 1GZPB 2BJML 2NY2C 3GZKA 3BQUA 2AJZB 3GSNA 3IDYB 3TH2T 2BVYA 1VGEL 1DL7L 3EJYD 3MYJA 5E00A 43C9A 3QULB 2VC2H 2VKWA 3ETBF 4MCZA 4P57B 1CGWA 3W5MA 2HT4C 4C56B 3O4LD 5ITFB 3N1GC 1UFUA 1DSFH 5E2WH 5DZNA 4MDJB 4XBPA 3AUVA 5DJ0A 4OJFH 1T7WA 5FYLD 4KHTH 4ZMAT 1E6JL 4DJMA 2X4NB 2WLYA 1QUNA 1D5BB 2EKJA 4LLYA 2IEPA 4KKNA 2BFVL 1Q9OB 4P4RB 2P45B 1JHKH 4RFNC 3LN4B 3TBTA 3FB7A 4DGVH 4G6KH 1P7QB 2GK0B 3KYAA 3BGMA 1RUAH 2J3SA 3TPUA 1LP9A 3F7VB 4ZXBD 5KSAB 4OZHF 3TVMD 4WUKH 4MXWL 1BFTA 1FZOA 2JJTC 2FGZA 2I9TB 2FLBT 1F13A 1IKFL 5E4EB 4RX4D 3EO0A 1LGVA 5KSUA 4XMPH 3C6LC 1YMHA 2X6MA 3LS5L 1OTTD 1C08A 4GAJL 2DWEA 4NBZB 4OGYL 4PGEB 3I84A 5IVZA 4Y16B 1A1NB 1CLCA 4YIQB 3GSWA 4N8VA 4GSDH 4GUPA 5T3XL 2YD5A 2P8LB 3DIFB 2PCPA 4KXZH 4DVBB 4JZJB 3OKDB 2B1AL 4KDVA 3JV5A 5FYKH 3S8WA 4Y5XA 1OF2B 4OBSA 3TBVB 3ZE1F 5ICZA 5HHOD 2P5EA 4Z7NF 1TLKA 3P40A 4EIGB 4PRID 5EA0H 4DFHA 2OI9C 5T5FH 2X89A 2F53B 4LSPL 5HHQA 2PO6C 4MWFA 4JKLA 7FABH 1G7JB 2L0DA 3PWNB 1GPOL 5M7QA 4Y16A 2R2HA 4JM2C 4OZGE 1DFBL 5ACZB 5DHVB 1Y18B 5BS0D 3ARVA 4JDVB 5JNYB 2VXQL 5C0ND 3O6LL 1HSBA 5BW7C 4Y4FA 5ESQB 4OLWL 3ARWA 2VABB 2VZVA 3RP1A 3ARRA 3DXAB 3HRZB 4PRBA 1TZHB 4DN4L 3EOAB 5DLMH 1R0AL 4NRXA 2FNBA 1OP5K 4YK4B 1Q38A 4M00A 5EG6C 4POYA 1BLNB 2W9EH 4X9GA 1CE1L 3GO1H 2H2PC 2FJFB 3DBXA 4NHCL 5C9KA 4E42B 4LEOB 2DKUA 4DVBA 3WS6A 5DS8A 3IS1X 1YEDA 1U8HA 5KTEH 2BHYA 4UAOC 5I6XC 1NKRA 1P1ZB 5EU7E 5E9DE 1S7RA 1FDLH 3TC9A 2YWZA 1FG2B 2VDQL 5TE6L 4LLUB 4LNVA 5EOQH 4CMMA 4XVTL 4N1CA 4RMQA 3X11B 3ZL4H 3GKZA 2WBWB 5E7FA 2OTWA 2J8UF 5E8OA 3W11D 2NX5D 3KPMA 4U0RC 2J8OA 4M1CD 2IH1B 4U6VL 3GKWH 2H41A 1FNHA 1MIMH 2IADA 1DZBA 4KTEH 1WWCA 2DQFA 2Y72A 3SDDD 1I85C 5JR1L 3MLSL 5A43C 1N5AA 1PZ5A 5IOPB 4WO4B 5JPMA 3OV6A 3GSVA 3FMGL 2OMBA 3FZUD 1HH6B 1JZ2A 4P9ML 4K2UH 1URLA 4ZFGH 4X9IA 4L8SB 4L1HA 1MHCB 4PJ8D 4I18A 4NNPH 2XWBA 4HUWB 1KJ2B 1RJLA 4FQJH 4HPOH 4L8DB 3BD4A 3U82B 1HH9B 5HDBF 4A6YB 5HY9A 3E0GA 1U91A 4PR5B 3IJSA 1KC5L 5DRWB 2HH0H 1BHGA 4XP4H 2Z8RA 5HHPA 5CEZH 3K8KA 2VXUH 3GIZH 4XAWL 5ACZA 1QFWH 3LKPB 4IDJH 4JY6A 5HHNB 2JIXB 3UTSD 1AFVH 3ECBA 5LQBH 4QHMA 5MENB 4GKOA 3QEQB 3EOAA 4HWZA 4F7EA 1J0YA 4QRPA 4TSCH 3VCLA 4X7FC 5AZEH 5FYJH 4QRUB 2QSTA 4RFOL 2FGWL 3UTPD</