2H32B

Crystal structure of the pre-b cell receptor
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
117
structure length
117
Chain Sequence
SVTHVFGSGTQLTVLSQPKATPSVTLFPPSSEELQANKATLVCLMNDFYPGILTVTWKADGTPITQGVEMTTPSKQSNNKYAASSYLSLTPEQWRSRRSYSCQVMHEGSTVEKTVAP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Immunoglobulin iota chain
publication title Structural Insight into Pre-B Cell Receptor Function
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 16
structure length 117
sequence length 117
ec nomenclature
pdb deposition date 2006-05-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2h32B01
3QPQC 2ZNWA 4OGAD 3W2DH 2OL3B 1WF5A 2IMMA 3TCLB 5KSUA 5JDSA 3QQ9D 3WIFB 1IGJB 3ULVH 2XZCL 1JNLH 3EGSA 5BVJB 5I8EB 1SQ2N 3ULUL 3SKMB 1X5YA 5DRNB 2XOTA 3VFWA 4GMTH 1F4WH 3LVEA 2I26N 3R06A 4ONHA 1T6WA 3S3JA 3TZVC 4TRPH 4QTHB 1BJ8A 1A7OL 5C9JA 4IOFD 2YKLL 2FGWH 4ZFZB 5IWLA 5CP7A 1BZ9A 2D7MA 2CK0L 4ZFFB 1UB5A 2V7NA 4Z0XA 4ZTOL 1CDYA 1QG3A 1NBYA 3CLFL 4Y5VC 3VFVB 4ETYA 1J0HA 3QIBA 3GFUA 4M6OL 2APWA 1WCBA 4MNGE 4WWID 2P8LA 5DFWH 4PJDB 4N0YH 3QNYA 1FPTL 4OUUB 3LS4L 3TZVB 2ARWA 4PJ5A 4QHLB 5IT2L 4M1DL 4KTEH 4QRPD 1JHLL 4GW4A 5IBTL 4NZRH 3BFOA 4XMPL 3TN0A 4EUPH 4XGZB 4OIAA 1O0VA 5B3NA 4GKNA 3D39B 4Y5VB 4K3EL 2IH3B 2ICWJ 4G6AD 4XCNB 3EO9H 5KBNC 1BQUA 5BW7A 3UTOA 1TZHB 4JJHA 1Z3GH 3M07A 2WQ8A 5ACZA 4PRDB 1I9IL 3L7FA 4OJFH 2VL4A 3G9VA 3MRCA 1NCUA 1BBJB 1YJDL 3TEUA 5FA3A 3UP1A 3QH3B 5FGCE 5SWSA 3MLUL 1IM9D 4G6FD 3C08H 5K59E 3IDGA 3C2SA 4HPOH 4XPTL 4R2GC 1JCKA 2XTJC 1VACB 2BNRB 2JELH 4HIIA 1FFPA 3UBXI 5BQ7B 3W9DA 1VFBA 5L88H 1JZ3A 4RFOL 3KXFD 1T1WA 4ZS6D 4M62L 5HYJA 1GPOH 1DR9A 2CGRH 1AXIB 2NCMA 4NRXA 4QRQA 5DGRA 5ANMA 3WLWD 3HAEH 5EU3A 3HC4H 3GBLA 1KACB 2V17H 4GG8A 4KJYA 1G7LA 1N0XH 5GGVH 4NT6A 2J7LA 4Y0GA 4R2GB 4YZFE 3RVUD 2XTJB 1EVTC 1AO7B 3HMXA 5JHLL 2UWEF 2EC9T 3B9DA 1HOCA 3TWCL 1DUZB 2XQYG 3CVIH 4U1IB 1WZLA 2XYCA 4G8FB 2ZUYA 1KEML 4NQUA 3T1WA 4PG2A 3O81A 4DCQA 3QNXB 3SKJL 4DKFH 2VC2H 4G8GE 1II4E 1ZA6B 3QI9D 4JZNA 5AAMA 4PRHA 3HI5H 3FJTA 3OJDB 3VMNA 1BVZA 3TM6A 3DIFB 2C1PB 3NZHL 3QG6B 2X1WL 1FSKC 25C8L 1PG7W 2PN5A 3QXDA 4GLRI 2XZQL 2WWKO 2KL6A 2X4NA 4ALAH 3D2UD 2J6EL 2D3VA 1NLBH 1VFAB 3T4AA 3EOBA 3P30H 1RULL 2XA8L 4R4BB 4WFFD 3LQMA 1FSKB 5EU6B 3FQRA 4JAMA 3LS5H 1D9KA 1TETH 4S1QH 1XGUB 4KY1L 2YD6A 2OR9L 1FZMA 2YBRB 2EDNA 4L9DA 1AGDA 1CFVL 3VXSB 1JF1A 1CQKA 4NO5A 4Y88A 43CAA 5I0DA 4IDJL 2ZPKL 4LLQA 1BD2A 3ULUE 4Y4HD 3CX2A 5FYLD 1UXSB 1WLHA 3UJIL 5KANG 4Z7OF 1A7QH 3LSOB 3ZE1E 4I0PA 2EC8A 5EZOL 4D0DA 4GFTB 3TJHC 4ODVL 5DTFB 4M03A 2QSTA 4MJ5B 5E56A 2GUOB 1RI8A 2OR8A 5K9JL 4H26A 4UIMA 1CYGA 3DX8A 3QXWA 2WIIB 2LAGB 4KGLA 4WI4A 1BAFH 1RZIB 2C3GA 3SHSA 4XNQB 3E6FB 3Q6GL 1DN0B 2CKBL 5ICXA 4OLXL 4U1HB 1CE6B 2PF6A 1TJGL 4ZOCA 5J12C 4LGSB 5MERB 3KS0J 1WEJH 4DK6A 1IC4L 2FYYA 2OMNA 2W0FB 4KAQH 1MCLA 3QWOA 3WXVH 2NY0C 1V7NH 3WL9B 2GITA 2L7UA 3RTQC 1J8HD 5EN2B 3ARGA 5FOBB 4LLAA 1F8TH 3JUYA 3MROA 3MACL 3VRJB 4PD4K 5FYLL 2DQGL 3B5GA 3H3KA 5J12B 4HF5H 1C16B 1MH5B 4U1JB 1XIWA 4ZG1A 4MNGA 2JIXB 1HWGB 1NC4A 1IFHH 1E0OB 2NY0B 1IJ9A 2YZ1A 2WAHA 3OHXB 5EFIA 3RTQB 2RAMA 1E27A 1E4WH 4XAKD 5CFHA 3BZEB 1B9ZA 4KK8D 4IIQC 3RGVD 1LMKA 2H9GA 4A6YB 3S34H 1S5IH 3MREA 5C08A 4YGAB 4P99A 4J6RL 1UWGH 4CADB 1CFTB 2LU4A 3U2SB 5ESQB 1K5NA 4QRPE 4JY5H 5KJRL 1DANT 4OLYH 1SM3H 3KPSA 2PYFB 4GRWE 1S8DB 5DRWA 5IW1B 1VGEL 3I6GA 3P4OB 2Y1VA 3K0WA 1D5BB 3BWAA 4OSUL 5E5RB 2A6JA 4M7JL 3TV3L 4NHCL 4IRJD 3NTCL 1MFAH 2DQIL 2JJSA 4PJCE 2ADJA 4WHTA 2WQRA 4KHTH 4PJGB 1U8NA 1X5AA 4Y16A 2HLAA 2QL1A 1CI5A 4PGBB 3HZKA 5HD8C 3MTRA 4YLQT 4XCYB 1CD1A 3O3EA 5FM5O 4JFOB 4YHNA 3GJFB 4W70A 3MRFA 3NIFE 2NY7H 4TN9A 1E4XL 1BECA 1EV2E 1UWEL 3QFJD 3DX6B 3CC5B 3NIDF 3WIIL 4QXGL 1UZ8B 1OD7A 5J1AA 1EEYA 4ZXBA 1DQQA 1KCSH 1C7TA 3L3HB 5JXAH 5CINH 1JZ4A 3I02A 5MEQB 4N5EC 2OL3H 4NN7C 1AGBA 3FO0H 3QCVL 3QUYA 5T1KA 4FQXA 1H3PL 1EO5A 3H0TA 5INDA 1Q9WB 3C5SB 5F97E 1S7XA 3LQZB 5KOVC 4MXQD 4ODTH 4XVTL 2OK0L 1U92B 5D1XC 2VDNH 4I13B 5E5MA 5MEOA 1KF9B 5E8NB 4G8GA 3S35L 2Q8AH 2P8PA 1GGBH 2ESVA 1HNFA 2AJYH 3UTTA 5DD0L 1F3JA 5IW3A 4PJHA 2AI0L 1F4YH 1ZMYA 3VGGA 2BHZA 4NN7B 4RFNC 3MGTA 5AEAA 1AGCA 5HHPA 1UYWL 3WFHA 3ARDC 3TF7C 1JGLL 1Q72H 1BFTA 1EBPA 3GHEH 1UXWB 1UM4H 2Q3ZA 3QIWC 2QKIA 3LIZH 2LVEA 5D1XB 1UEMA 4QXTA 1HXYA 4E42B 5F7NC 3RPIA 3UPRA 5CD5D 1IC5L 4NN5C 3DHMA 1V3KA 4JCMA 2WINA 3ARFA 3MSPA 4Z7UF 3QO1B 4PP2B 4X6CB 2FSEB 1G0DA 5AG9A 3TJEH 4X9BA 3QDGD 4OF0A 3L3DA 4XH2B 3GSUA 1SY6A 1AJ7H 2X1OA 3IF1A 4MVBC 4N0FA 4OQTL 4RFNB 3TBWA 4Y19B 1B4JL 3V9FA 3JVGA 1P7KB 2NR6D 3IFNH 3KLHC 1GGTA 3ARDB 3BZFB 1ORQB 4GQPH 4ZAKC 4FQ1H 4QY8B 3K2UH 5EZLB 5TF1L 3QIWB 5JW3L 4HX1B 4MCZB 5JMOC 3QG7L 1AGEB 1DVFD 2G9HA 4WFFE 4NN5B 3GMOB 3U7WL 4HS6B 4CVXB 3HC3H 1JPSH 1NCBL 3VXRB 1EFXD 3KJ4C 4PG9B 4RGNC 4G8IA 1MRFH 4X6DE 3EFFA 4KRPD 3VRIA 4Z5RB 5ENWA 5CJ5A 3IFOA 4KZDL 1WTLA 5DWUL 1BQHA 1J1XH 1U8LB 4ZAKB 5I1GL 1JHKL 5FYLE 1FZKB 3LKRB 4P5TD 1GZPB 4WW2C 3DRTA 4Z18A 1X4XA 4BSWB 3LN4A 3KJ4B 4RGNB 1M7IB 1A6WH 5F96H 4L8DA 2P8MA 4TOYH 4UQ3A 4K7PX 1KT2B 2ADFL 1QFWH 1VFOA 4UAOC 4JM4L 3MODL 3PWPB 1P4LA 4BYHA 4PTUB 5D7SH 4XPHL 1MJ8H 4OBSA 2R0ZL 1RUPL 5I9QC 1QFOA 4I3RH 5DZOA 1UH2A 4FFYH 4UDUB 1HEZB 2BFVL 5JZ7D 3L3JA 4WW2B 1U8JA 1J9CT 1BWMA 5IB2A 1CFQA 1ITCA 4FFWD 4PRBB 5C7XL 4XMKH 1WC7B 3FAXA 5E6ID 4EXPX 3T0EA 2D03H 5F9JB 3UPAA 2DIAA 4NYLA 3G5ZB 4KH2A 1J8HE 2BJML 4L8BA 1UWXH 1EGJL 4XCEA 3EYQD 5E8DL 3N1MC 2H2SD 5I9QB 1KB9K 3DV4B 1FNLA 5C0ND 2J8UE 4JG0L 3GJEB 1XCQA 4NQEB 4JPIB 3WN5C 1HHKB 3HZMB 3KPLB 1P9MC 1DEEB 4NKDA 1Z6JT 1HHIA 5BJTA 5IFHL 1FQ9C 1KIPA 4ZUVB 2GJ6B 1LO0L 3H8NA 4P59L 3OJ2C 4FRWA 4LARH 2L0DA 1RUMH 5D8JH 1W0VB 3V4UL 2MKWA 2PW1A 3QQ4B 4LNVA 3RWEA 4LSUH 5D6CA 3VG9C 4UINH 4QRTB 3D9AH 3TNMA 2VXQH 3MNWA 3WN5B 3FQNA 3MJ6A 3W82A 4POUB 1TNNA 3KR3H 3RI5F 2B4CC 4H88L 4PGJA 2X4RB 3CUPB 1WISA 1U58A 1MCEA 4HV8B 4JFEB 2ITDB 4XRCB 2PO6C 4BZ2L 2J4WH 5EC2A 1I4FB 3KPMA 4HMCA 3U1SH 1QYGL 1FLRH 4ACPA 3WS3A 4AT6B 5HGHB 2Y07L 2VDOH 4LLDA 4RISH 4L3CB 2OMBA 3WMSA 2DMKA 5ADOH 3UC0H 3JV6B 5H35B 3EO0B 1AQDA 2VITB 2AJ3A 2M1KA 3CDGB 2PO6B 2MTPA 2X70B 1WAAE 4TPRL 5C0RH 3U30C 4HZLB 5GGTH 5I74C 2ED7A 1DE4A 3CK0L 3QFJE 5HHVL 5L2JA 3ZMRA 3LV3A 4R7NA 1A6AA 5JPNB 2Y6SD 2E9BA 5GJTH 3WIHH 2MSPA 5GJSL 2OQJB 4PRID 4JJ5B 3DROB 1BQHG 1S5HB 3VXTA 4NQDD 1G0XA 3ARVA 1F3DJ 1QA9A 3O4LD 1FYTB 4YDVA 4UILH 3BVNA 3VA2C 4QTIH 3OZ9H 2Q7YB 4D2NA 3U30B 3O3DA 5I74B 3W81A 3O9WA 5IVXE 3P73B 2FBJH 3PGDA 2FCBA 5I8CB 4LMQI 2XG4A 4PJ9A 5B8CA 1CLCA 5D71L 4ONFH 3HPJA 4J3XA 3BGAA 4APQC 5K59F 4UUJB 1MAKA 2JJUA 5TE6H 3TC9A 1U8KB 3CSGA 4NJAH 2I9TB 3JWNC 5GSVA 3IJYB 4NO2B 1A3RH 4OZGB 1MIEL 3GMQB 5FCUH 3VXUA 1NCWH 2YPVH 3N85H 2X4SA 1A22B 1HHHB 1XF3A 5F71A 3LOWA 4I2XE 2FX8H 4I3SH 4A6YH 1AD9B 3QZWG 5DMJB 4K9EC 1DQLH 5CJOH 2AKRA 4APQB 5E2VL 4PRPA 1HKFA 5E94A 3I2CH 1KELL 4U7MA 4LHUB 3PV6B 4YZFF 3QCUL 5IB4A 2MCPL 3QDGE 4U4BA 4OM0L 1MVFA 3QBTB 4Y5YC 4F7MB 2X41A 5JIPA 4X6DA 3FFCD 4BZ1H 2EDOA 1W0WA 1P1ZA 1CFNA 4BFBD 5IIEA 4AMKH 1P84K 3IAPA 2WBJD 3LKQB 1BGXL 1I1FB 5GS3A 3RHWF 3ALWA 4XBPA 1PSKH 1RIVL 2HKFL 4Z95H 2P7TB 1EIBA 2RHEA 2HRPL 2XIDA 4HKJB 4U49A 3OAUH 3QEQA 4Y5YB 5GQBA 4RAUB 1IAKB 3BRDA 3V7AE 2QHRL 4NZTL 3HZYB 1JHTA 4G6KL 5JHDA 3VXQA 3GJFH 5IMKA 4L29B 5CEZD 5E8PB 4UT9L 2FO4B 1BP3B 3GDBA 5I19H 2AXGA 4R7DB 1F3DH 4TSCL 7FABH 1G7MA 3QJFA 5IMLB 3C6SA 1TLKA 1G6RA 3OKEA 2R4SL 3U48A 1EAPB 4YPGA 2AEIT 2ORBH 1S7UB 2EEDA 3ISWA 3F58L 1CZ8L 3V5KB 3P9LA 4PR5A 4ISVA 1KN4H 3CVHL 1AR1D 3KPTA 4GAFB 3G08A 2BDNL 3ULUF 2J8UA 4ERSL 3RWFB 3ZE1F 4WW1A 4R8WH 1CE1H 2VQ1A 2EZ0C 2QQNH 3TA3D 3EOYG 1WFTA 5EOCL 1ADQA 3SGEH 3DVNA 3VFMA 3MLSL 5CEZL 3NMEA 3EBAA 3G04A 4XP9H 3BJLA 3C60A 1CQYA 3K8LA 3NA9L 2B8OT 4NOFA 2R69L 4YE4H 1HZHH 3FRUB 5C0BD 3ZKMD 5DURB 1J10A 5I8OL 5D72L 5JMRA 5DS8A 2GHWB 4K3JL 4R96B 5DJ0A 4BELD 3SDAD 3VWKC 4UBDC 4MNHA 3RKDD 1YEIL 3BP4B 5DGQA 1MJJA 1EXUB 3SOBH 3DTXA 5CWSB 3ZKNC 4P2OC 3PWJB 1JTTA 3M17B 4FXGB 3NZ8A 3I9GH 4M3JA 3UZEA 1ZXQA 4MD4B 3F7YA 3W11D 3IS1X 4QO1A 1KJ2B 3CMGA 4MDIA 1RZKL 1QFUH 4JO4L 1BFSA 3VWKB 4G6MH 3VXPB 1CS6A 5T1LB 1SEQH 5F8RC 2F54D 3DUHA 2VXUL 3VD4A 2Z4QA 3PV7A 4G5ZL 4P2OB 2X09A 3BEWA 5FGBA 3UTZA 2VDRH 5D7LA 3P4LA 1LNUA 1SMOA 1WBXA 4DAGL 4GKZA 1P7HL 3QUZD 3SE9H 4MNQA 4UMGA 3FQTB 5CZXD 3PWVA 3PWUB 1N59B 1J5OL 5DUMH 1R5VB 4JFXB 2H1PH 2X4OB 1DL7L 4OCSH 5FYJH 3MYJB 4L9LC 3WS6C 4GRWF 4LCWB 3CFKA 1CDUA 5CD3A 3R1GH 2F5AH 3WXWL 5IVXA 4M7KH 1PG7H 3QZWB 5FYJU 4QKXB 4PRIE 4PJXE 3KPOA 3T04D 4R6UA 5MENB 4NQDE 3O4LE 4PJCF 3SGKC 2BVOA 4L5FH 1VERA 4L8SA 4DN4L 3UZQA 5FUZL 4I77L 4BJLA 3BEVB 4HUWA 4WY7H 2UZYB 4Z9KB 4NRZA 4L9LB 3TVMD 1QQDA 3MUGB 4LCCA 2UZIH 3PL6D 4ZFGH 1RPQA 2DLTA 5KSVB 1MQKH 4I2XA 1LK2B 2B1AH 4X5LA 1IBGH 3MLWL 5DD3H 1ZHKB 3NIFF 4XWOD 3IKKA 2OTPA 2Z0BA 3ARTA 3MR9A 4ZUWB 1EO8L 2WNGA 3LHPL 3VD9A 3N9GL 2B39A 2IBZY 4LLMB 3X3GH 4NJ9H 3FO1B 5CIPA 5J1SC 3QDGA 3O2DL 1IZKA 3RVWD 1WK0A 2GCYB 2ADGA 1YNKL 2VZOA 3OGCA 1TZGH 1KLGB 4K94C 5ALBH 4O58H 3KPNA 1A6PA 5FV1L 3RX8A 2UUDK 2P43B 1X6LA 1PQZB 3STZA 4R9HA 5EOQH 5EU4B 3WSQH 1EFXA 2F8XC 4OLWL 3T4YA 4YK4C 1PBYA 3FFCE 1DEDA 4JFPA 1QVOB 4XXDB 1UG9A 3VFTB 5BVPL 3MCLL 4N9OB 3IT8D 4TULL 1OTSD 2YA1A 5L7XH 1OP9A 5C3TA 3D25B 1CTNA 3U82B 5DJ2A 2B4CH 2R2HB 5DJ8A 5KTEH 4S0TD 5DDHA 1XF5B 3MBXH 3JTSB 1RFDL 4P2RD 4HXBL 3HMWL 4WTZG 4O4YL 1AP2A 4MA3A 1OW0A 4YK4B 5ITBH 4Q0XL 2DQCL 3B2VH 3DXAD 3A6BL 1FIEA 1SBSH 1T22A 3NFSL 5CEZE 1ZVSB 4CNIB 2F58L 1CVRA 1JRHH 1FRGH 5ICZB 2DMCA 4OZHB 4OZIE 5AYUH 1YNLL 2AXHA 3B5TA 3MOBH 3RDTD 1MJ7L 5BZDA 4IM8A 4G7YL 1OARL 5JW5A 3QEGH 4V1DD 2QSCL 4PJEE 5HI3D 4LP5A 3C5ZA 4EN3A 3AS2A 4ZTPL 1BWWA 2AEQH 3O6FA 5LVEA 4X6DF 5GS1C 2HWZH 1MCIA 5KN5B 1BOYA 2ARJB 2F74B 5EO1A 5IEKA 2K9UA 3G6AB 4P23D 1S7RB 2I5YH 4UQ2A 2V9TA 1NGXB 4YR6B 4EI6B 1Q38A 4RDQF 5TPWL 2XQBH 1OAYL 3BH8A 4FP8L 3RUGB 4KKBD 3RZWA 1MRDL 1QFPA 5F7DA 5IB3B 3HB3D 1T21B 4MSWB 5GS1B 5DJZA 3GZKA 4P3DB 5DI8A 1D5XB 5T3ZD 1A2YB 2RJMA 2X4UB 4ELMB 4LSSH 3V4VL 4QGYA 1YECL 4YBLC 4LF3B 4KTYA 3BH9A 3OR6B 3VRLE 4HMDA 4DOHE 2PR4H 1OP5H 3UMTA 3SKOA 5C0BE 4HUUA 3ZYIA 2VH5H 3X12B 2YRLA 4F80A 3GMNA 1I1CA 4YUEH 4M9OA 4MWFB 5C07B 3S88L 4JN2B 2P24A 3DO3A 4FABH 5E2JA 4O51B 1X3DA 5DC9B 5EUOB 1QNZL 3CU1A 2UZXB 3RVXC 4DGVH 4N8CH 1D5ZA 4K9EH 5AWNH 4E41D 3QUMB 3WD5H 5DVMA 2NY5C 1H8NA 4YBLB 1M05B 2R2BB 3PHQB 4Z7WA 4NNXA 2K7PA 2AQ1A 2J8UF 4GW5A 5EIVA 3AREA 1MLCA 1NC2B 2NXZD 1F58H 4L4JA 5AYQA 1B2WH 2VDML 3FONB 2E7MA 3T0BA 2C1OB 5EC1B 2F54E 4KZEL 3B4NA 1F02I 4U1SB 5J06A 1BJ1H 4Z77A 2BC4B 2FECL 4QLRA 4QOKB 5T3ZL 3EZJB 4O02H 3IRPX 2VAAA 5C70A 2VAJA 1C08A 1RUKL 4X5XA 3LQAL 2GK2A 1R3HA 4FTVD 4JQXC 5T5FL 3BQUC 1WSST 1S9XA 4KK6D 1ZGLP 5C0GB 1T3FB 2PTTB 4E5XB 3NFNA 5GIRA 3G6DL 3JTTA 1OWRM 1S7TB 1T0NB 2YWZA 4PRIA 1UA6H 4FFVD 5HJ3A 4PD4J 1U3HC 1VADA 3BMWA 4NQDA 3HFML 2Y4SA 4U6XA 1LO5B 2SEBA 5BMFL 4X6EA 3TIDA 1CR9L 2A0LD 5JXEA 5GRUH 3BDYL 3O41A 4M43H 4HKZA 4ODWB 2FJFA 4C56B 4KVCH 3MMEB 5IKCB 2CIKB 2QR0A 1RV6X 3GHBL 4JRYD 3BQUB 1REIA 2VOTA 4MD5A 4WI8A 4S1DC 5ALCL 1AHWA 3KPPA 1B0RA 1YMMB 3ECBB 4LRIA 4X8JB 2WZPD 5GSRB 1OM3H 1EAJA 4N1EA 1FNEA 3R8BB 1U3HB 3MOQA 4UTBL 3GK8L 4N68A 3D0LA 4BQCA 3S35X 3WJLC 5FFLA 3S37X 1I7UB 1I9EA 2J88L 1ZWIA 2EDTA 2JB6A 3SJVD 1WAAF 4HW6A 1UVQA 3GSOA 1S7WA 4LLUB 1OF2B 3MRMB 4NRYB 2MPAL 1FNSH 5HGAB 5TJWK 2NTSP 3LPFA 1CDHA 5EZJA 1UJ3C 4PJ7A 1H0DA 4DN3L 3ZTNH 4QHNA 1FFOB 3BE1L 4RNRB 2KKQA 3PXJA 1K4DA 1YEFH 3KGRA 1MUJA 4FMKA 3CSYA 5K9QG 3ARPA 5IVXF 2Z91A 1KXTB 3ZL4H 2EDDA 2IBGA 4YWGH 3VXNA 2GJJA 1MREH 1RURH 1IQDB 1OP3K 3MLXL 4L8CB 1KJ2H 1UJ3B 2NXYD 3DVFA 4HCRL 3IU4H 1T83C 2XFXA 1ZTXH 1NAMB 1MVUA 2Y06H 4XNMB 2RFXB 1RUQL 3IXAB 5DQJB 1MFCL 2R2CA 4HC1H 1BF8A 1RK1B 1C8PA 4LRNH 1KJMA 3CFBA 4P2RE 5HHQA 4U6YB 3BPLB 5JNYB 1EEZB 3FTGB 4M61A 4QXUH 5A16A 4RGOL 3DXAE 4PRAB 4PJEA 4C54A 3PQYE 4NGHL 3FOLA 1HXMB 2GFBA 1Z5LB 4GAJH 1FVCB 5IESL 2DQUL 1DN2A 1A02N 3A0OA 4LVOC 4WEUD 3MX0A 3GRWL 2CRMA 5J8OA 3SPVA 3THML 1U8MB 1XF4A 4V1DE 4U6TA 5I1EH 3LRSA 1N5YL 3V5HB 2EKJA 2F8OA 1U8PB 4BKLB 4UTAH 2DQJL 4DZBB 4U1LB 2J5LC 2P5EB 1IL1B 2BSRB 1GAFH 3WKNA 2ZOLB 3S7GA 5DJDA 3NFPA 3G5VB 2H3NA 4HKBA 4PREB 4I18A 4LVOB 3NGBC 2FATL 1AI1H 2B0SH 5DUBA 5ID1B 1IGCL 2YC1A 3L3GA 1BQLH 1CGUA 4HZAA 3SE3A 1RJYA 1XGYL 3KDMA 4HWZB 1B90A 1XF2A 1SMAA 2QEJA 1KCUH 3NVQA 3ZKSD 2YZ8A 4HWUA 5I8KH 3B9KC 3W5MA 1TVBA 2YPLA 5C0BA 2CMRL 2GTZB 2AABH 2J5LB 3NCYP 5T3ZE 3FN3A 3LKSB 3L3IB 4PJAA 3X13A 4U1NB 4CBPA 3K1KC 5E2WH 3NGBB 4U1KA 3K7UA 1YY8B 2Y36H 5D70H 4H0IA 4KKAD 3RHWK 4LCUA 1INEL 5F7MC 3S6CA 5EORL 3FB5B 2AXFB 2P47B 3B9KB 2AEPH 4JANB 2Y7QA 5I1JH 1IVLA 2OJEA 3NCJH 4RQQA 5GISH 1F13A 1SVZA 4K94H 3G5YB 1AGFA 3K2MC 4LOUC 4R4ND 2BNQB 4E41E 3PABA 5DC0A 5E8OA 5DRXB 1F4XH 1MCKA 1EO7A 4KGJA 3C5JA 4U6HA 3SBWA 1JPGB 4KMTH 4XNUL 4HIHB 1WZMA 3K4ZA 2NYYD 4Y7MA 4JLRA 4NC0B 3T0VA 1NGYB 1H5BA 3QUZA 4RA3A 5I76A 3EUUA 2X05A 1WWCA 5JORB 2B7DT 5B21A 4Z6AT 5IFJB 4MAYA 1F45A 2ZSWB 3SDDA 1OAZL 4QRUA 1TENA 4D0BB 3QHZL 1CL7H 2XICA 1U91B 4FTVE 3CGTA 2R4RH 4I5BB 4UDTA 5CSZA 3L5HA 1AKJB 1NCCH 5DMGD 3FO2A 1UB6B 3ZDZE 5LJYH 1M7XA 2R56H 2VJXA 3BPCA 1KB9J 3B43A 4XVSH 1FVDA 3BAEL 1A1NA 5KVGH 5GZOD 1IEHA 4XC1L 1CT8B 4BZYA 5ECJE 3OKNA 3FRPG 1TXKA 3O3BA 1BQSA 3TVMA 2ZSVB 1A8JH 4R3SB 2HYMA 4JRYE 1KEGH 5IB1B 3PL6A 2XKNA 15C8L 3WCYA 3G5XA 1R3JA 5IG7A 3QDJD 2Q76B 1UFUA 4UIKL 5L2KD 2XPGA 4HIXH 4NHUB 3HNSH 3I85A 4YXLH 1CDIA 2IQAA 2CLVA 3IXTA 1UT9A 4KXZI 3WBDA 2DJUA 3EHBC 3MBEC 3FB7A 1LK3L 1E28A 4NQCB 3C8KA 1RY7B 2WW8A 5F6HI 2PKDA 3TLRA 2VDQH 3IDMB 2YD3A 4MLIA 4Y4FC 1E4KC 2GSGB 1ZA3A 4LSQH 32C2B 4OCRH 1NQBA 4GRLD 1CF8L 2YRPA 1RD6A 1RUAH 1NMAL 1JP5A 4TQEH 4PJXF 4RZCA 3Q6FB 3QUMH 3WNKA 4GXVL 3MBEB 4QRRB 3OXSB 4PS4H 4EI5D 5JOPD 5AZEH 1DLFL 3RVVD 1RK0A 3SGDI 4Y4FB 1ZSDA 1JN6A 2VLMD 3GGWA 4DVBA 4ZPTB 3B6SA 1TTGA 3KLAB 2EYRB 1LEKB 4OZFB 1EJOL 5HY9B 4FZEL 2EH8L 5K9OA 1D6EA 4P2RA 3GI8H 4P4KC 3HG1B 3GKWL 3MRRA 2NY5H 3DXAA 2NZ9D 5BOPA 5D1ZA 4JR9L 1ZVHA 3PQYA 4X6BA 3MV7A 5EOTA 4LEOA 3B83A 4L4TB 5K9KB 1BLNB 2OZ4H 1FV1B 1QRNB 3IDIB 5HHMB 1FVEB 4M7LH 2V5RA 1AD0B 4RRPG 4M00A 2COQA 4MX7A 2X9YA 1Q0YH 4YHOL 3MXVL 3BW9B 4P4KB 4FQ2H 4KHXH 4ODXA 1HSBB 2MWCA 4J8RB 3V4PL 1ES0B 4RMSA 2B1HL 3GO1L 4I3GA 3QUXA 1FZJB 1IAIM 4O2FA 1TIUA 1U2CA 4LQFL 4TSAH 4P23A 4U3XA 3AVEA 3CPLA 2ZJSH 5KSUB 4M8QA 4F57H 2ZKHL 1G7QB 2X7LB 3GSQA 4RMWA 3HR6A 4TUJB 5EBLA 2WIMA 4GG6A 1IEBA 1XZ0A 2A1WH 1MCQA 2WWKT 4OLVH 4Q9RH 1FG2A 5FAAA 1OVZA 1IKNA 2O5XL 4PJ8D 3FB6B 5FO8B 2J2ZA 1N0LA 4A2LA 1P5VA 5CP7B 1IC7L 1YPZB 4KK9C 1DBAL 4DKDC 1T7VA 4LSVL 2AJVH 4OZIF 1OLZA 4Z0XB 2DLFH 3TO4A 2GSIB 2BX5A 3NH7H 1T04A 4UT7L 3OWEA 1MAMH 1T89C 3LH2H 2EYTA 4PJEF 5EO9A 3BKYH 4DGIH 2ZOKB 1T2QH 3HE7A 3MV01 1RJCA 2IG2H 1MCBA 3QDMD 2V2XA 3U4BL 2F53B 4WDIA 2KQNA 5IF0A 3VFGH 5ERWA 3VU2A 2HFTA 3C6LD 1GC1L 2RBLA 3TN0B 1QSFB 3LZFL 5F1IA 1QEWB 4F33A 1IAIL 1C5DB 5FHBH 1DFBH 3W0WA 4GSDL 2CKNA 4NFBA 3FMGH 4PY7A 5C86A 4XTRD 1MI5A 5C0IA 4HUVA 3RNKA 1SYVA 5D7KD 1VB9A 4P2QD 1P69B 1BM3L 1X5FA 4DQOH 5DRZB 3FO9A 1AIFB 4NFCA 3BUTA 4JDTH 2VLKD 3BYYA 4F7EA 2NQCA 2ZG2A 2R0WL 1K9TA 1NGPL 2X4QB 2VZ1A 3HE6A 4AYFA 2EXYC 1IGML 2J3SA 5EO0A 5SWSB 4KDWA 2HA1A 1J18A 4YHML 3VRLF 1CGSH 1CD9B 1V5JA 1H15B 4OCWL 3L3KB 4C4KT 4X9GA 2PYEB 4DW2L 4Z7UB 1VFBB 3DVIA 3HZVB 2W9EL 4NZDA 1JNHB 3RVTC 1G9MC 3GSNL 1I1AD 5HDLA 3MJ9L 3RY4A 3FKUS 4YPJA 1CDGA 5GS2H 3VGBA 2EE9A 4BK5A 2I60H 4V2BA 4JFQB 4JRYA 4MJ6B 2IAMC 3ARBA 4LFHG 2QBWA 3RJQB 4HCRA 1OAUL 2XZZA 2BP3A 3TBTA 1JYVA 1G9NL 1A7RH 4OKVB 1NSNL 2DQEL 1OGAA 3I3EA 1ZLUK 5GHWH 3GM8A 3SDCD 4LBEB 4G42B 1K6QH 1D5MB 4XMLH 4P2CG 3UJJH 2CH8A 3BKJL 1YN7B 4LPWA 4QT5B 4FQLH 2MJWA 1E6OL 3EDDA 1AQKH 5ICYA 4FA8A 1CLZL 2VABA 5L2KE 3LEXA 5CAYB 3WNOA 3FOMB 2Y25A 5BCAA 4HWEL 2IAMB 1OCWH 3MQIA 1OB1B 1CDJA 2ICWI 2EO9A 4HS8L 4YXHH 1MWAL 3TFKC 1BFVL 5LCVH 3DX9A 4HS3B 3KJ6L 2CIIB 1P4IL 3FT2A 3OMZA 1DLHA 1ETZB 5BS0D 1FL6A 1JE6A 1QLFA 3MRIA 2OTUB 5JLZA 1MFEL 2YD7A 3EYFA 5GS0D 4Y2DC 3W39A 2H8PB 4XVJL 2A9NH 4NPYB 1YQ2A 3V6OA 1KIRA 1NH6A 4TVPH 4NOBA 5HHOB 1T5XB 2DAVA 4ZO8A 1N6VA 1IKFL 5JOPE 3LEYL 3EYVB 3OKOA 5A2IH 2APTA 2A77L 2PCPA 4K3DL 2VLME 3K8MA 3O2VL 3KAAA 4Z78A 2EICA 2OSLB 5JW4N 1I8MB 3QA3B 2JJTA 3CCHA 2E8YA 4Y2DB 1QBBA 1CLOL 4WU5B 3SCMC 3WO3B 4YEEA 1LE9B 2Q20A 5D2LA 1IM3A 3GMMA 4WNQB 1Q0XH 4X9HA 4O9HL 4HGMA 2BVTA 1F4WL 5GXBB 3EJZC 1XGRB 4U2YA 3UDWA 3VJ6A 5JUEH 4W6WB 2O61A 3A6CH 4ENEC 1S3KL 4YAQB 1D3CA 1R3KB 5JIIA 4KKLC 4CU7A 4M1GL 5CMAA 3HI6H 1FGVL 5F88A 1QR1B 3SCMB 1NBZB 2D7TH 3IJSB 3ZDXE 4HPYH 2J1KA 4OT1H 4N0UA 2FYYB 1BVKA 2E6QA 3P0GB 3T77B 1FL5B 4NZRL 2QV2A 4S1SH 2B20A 4KJQD 1JGVH 3Q1SH 1GGIH 3KPRA 3BT2L 4TNVK 2XRAL 2FEDD 5GGUA 1F97A 2P45B 4WIQA 4ZQKB 2Z8WC 1F6AA 1CG9A 2MQ3A 4MNGB 1CLYH 2PXYC 1R3LB 3V8OA 2P4AB 4G9FA 3MZTA 4HJ0D 3UJTH 1U3YA 3RZCA 1KFAL 5DJYA 4DUXA 4F37F 2IFGA 1T66C 1K8IA 5IM7A 2AGJL 4JPWH 3JWDH 3DRQA 3VI3E 2ZCLH 5I15L 5SWZA 4EDXB 3RWHB 3KNBA 3QDME 5IJKC 3L95B 1EHLL 3F8UB 2PXYB 3H9SD 1TTUA 4KU1A 4FOMA 3DVGB 2BVQB 4IHOA 1KJ3L 4P48A 4JGMA 4OZFH 1LWRA 4F3FB 3BRGC 3VH8G 1JGUH 4H8WC 4WENB 3B9VA 5L8KB 1I8KA 5D7KE 3T1FB 4P2QE 1T80A 2A6JB 4X7TA 1JV5B 5EBMB 5F9OH 5FGCB 1N0XL 2Y9RT 1QHPA 3E6HA 5E9DA 4OD2A 5DYOB 2H6PA 3S4SG 4XP6H 3PNWA 4PTTB 4L1HA 4WHTB 1O7SA 2A74B 4PUBH 1MLBA 5BRZD 4ONOA 4F2MA 1U8NB 2VLKE 1WBYA 3MJGX 2BOCB 3FZUC 3REWA 4QXWA 2AV7A 2HLAB 5HDQH 4WUKL 2YEZB 3QUYC 2JCCA 4J4PC 2E27H 5EULV 4UNTA 4F7PA 5FM5M 2E9JA 3DBXA 4DKFL 5GRJH 5TFSH 2VC2L 4NZUL 4QHMB 2EYSB 5CP3A 3C8DA 3BD4A 3P4MA 4MHHG 4R4FH 4R97C 3GSXB 1C12A 1YMHB 4L3EA 4Y1AB 1XGPB 1A6VH 4M8VA 2XWBA 1DQQB 3F6LA 5LWYL 4LU5L 4FG6C 2CDFB 4DJMA 1AGBB 4CJ1A 3QUYB 1PGRB 2AXJA 4I48A 4FZ8H 4JFFD 5EDXA 2UUDH 1HH6B 4JQIH 4NKMB 4QRSB 1B3JA 1NEUA 4MJIA 5L2KA 2MOVA 4R97B 3FHQA 2BXYA 5EU7E 4YDLC 1JGEB 1VPOL 3EDJA 3EYOA 1TDQA 1VENA 3LB6D 4WWKA 2EDQA 5HHPB 5CJQH 4LVEA 4OF5A 4JQVA 3WLBA 3BGMB 5TDNA 3OX8A 5KG9A 3T2QA 1S7QA 4EIGB 2X89A 4NUGL 5DJAA 4GRLA 2AK4B 4QXTB 3ZDZF 1JWUB 3AAZB 3N50A 5TH2B 3QO0A 3S36L 2FIRT 1NGZA 4WCYL 3ULUC 4YDLB 4JHWH 5BS0E 5DMYA 2FZ3A 2X1QA 1GJIA 4ORGB 3O3AB 3V79C 3RU8L 2YUVA 4N5UA 1FFNB 1FIGH 3DYMA 3QQ3B 5FV2A 1IGYA 5DJXA 4KQ4L 5DEGA 4KJWC 1F11A 1HSAB 4F8QA 2AERT 4KDTA 5DT1H 4RAVB 1TFHA 1M4KA 4WO4A 2IPTL 3OL2A 5GGSY 3P0YH 4LASH 1QBMH 3IDNB 4XPAL 4JEGB 5F21B 5DD6A 1I3RB 1S9YA 1S78D 2JB5H 1T1XA 4DTGH 5F89A 4X0KB 4CVWA 4EVNB 2NX5B 2D4DA 5DK0B 4JO1L 3D3VA 4M4PA 4OGAC 2DWDA 3QQ9C 4GW1A 4MB4A 1BZQK 3JV0A 3WEXA 3P77A 4O2CA 2O5ZH 4Z7VE 4ZPVB 2BRRL 2CPCA 1OQXA 1FO0L 2VQTA 1DBJL 1T20B 1JWSA 4NBYB 3V0VA 4NQSA 3MXWL 3WFBH 2VLJD 4PGCB 4F9PA 2EIZB 1JJUA 1FC2D 1I3GL 4JKKA 3CFCL 1GGCH 5J89A 4RFEB 3S5LA 1JNNL 3GUTA 1YJDC 4NWTL 1VKXA 3RWDA 6CGTA 5C0AB 2EKSB 4KJPC 5CEYA 3MA9H 1FE8H 3PWLA 2HG5B 2DKUA 1U8OA 1G9MH 1UWGL 5E8EA 3U7YH 2C5DC 2XNAA 1JNJA 2H26A 1Q9OA 4JY5L 4EDWH 4JM2A 2RB8A 1A1OB 4D3CH 1MNUH 4G43B 3VH8B 4AM0B 1D5IH 4G6AC 2M26A 1HQRB 2VR4A 1FNGB 3U9UB 4YFLI 2K7QA 3VGEA 3OKKA 1MFAL 2CDGA 3RL2B 5M7QA 2ATPB 1U93A 3MJ8B 5ILTH 1U3ZA 1HYSC 5H2BA 1X5IA 2HH0H 3QPQD 4QRPB 5D5ME 1W72A 1UEYA 3C6LA 1YN6B 2QJDA 5DHYA 5J6GA 3O6LH 4GRWB 2E7BA 4LPYA 2IFFH 3LKPA 1YUHB 3UBXG 1RZ7H 1G7JA 1J1OH 2BOBB 3H9SE 4WI3A 3ZTJG 4PJCB 5B38A 5INCB 35C8L 4ZS6C 5IMOA 5JXAL 5CINL 3PDOB 2W0LA 2VLKA 5EC2B 2E5EA 4BFIA 4L4VD 5BZWA 1W0YT 4UV4L 3WLWC 2D0GA 3D39D 3FB8A 4X98A 4NNPH 1NUDA 3WS3B 1NL0H 2XWJA 3TYGL 1IM9B 3U36A 5JPMB 5E00A 2IAND 1ZHLB 4G6FB 3PWNB 1LVEA 3T2NL 3VWJD 3AUVA 5BRZE 3RVUC 1E6JL 2YSSB 3REVB 4ZODA 3ARQA 4Y4KA 5HI4D 3ILQC 3TCXA 1F4YL 1WVZA 2VZTA 4HFWA 2HVKA 3KXFB 4Y2OA 3LKOB 4H20H 2ZCKH 1B0WA 3L1OL 5FK9B 1Q94A 1KTDA 1PKOA 4QCIB 3P9WB 3GHEL 2WUBL 1CICC 1NEZA 4Z76A 3CZFA 2VKWA 3QI9C 4HUXA 1SEBB 4EXKA 2ZCHH 4JDZA 1I7TB 3U7AA 4WEBH 4KVNL 1JF5A 4NCC2 5TE7H 4WGVB 3ARRA 3VFNB 1NBVH 5JOFA 3AS0A 4P5KB 2DLEA 3RX5A 1QFWM 2XACC 1R5WB 2Z93B 2Y5TA 3JZ7A 2DYPA 4GUPB 4XZUB 3IFNL 1KCRH 2OXGA 1FORH 4JFFE 2AW2A 2GK0B 2VL5B 4GRMB 3O45B 4N0CD 1CICB 4YHLH 2Z8VC 3QI9B 4R2GD 3OTTA 1OP3H 4OD3L 3T0WA 1N8ZB 1S9WB 4X80H 7CGTA 3T2PA 2FWOB 4DKEL 5D7JA 5HYSG 3SDXB 1FCCA 3HUJF 1NFDE 1OTTD 3RY6A 4G6JL 4OD1H 4PV8A 1N64L 4JFZH 2VQUA 3MNZB 2AV1A 2Y23A 4P3CL 4YGVB 1U8HA 5GZND 5IBLD 1ORSA 1F90H 1JUFA 1QLRB 3D2UB 2CKBB 4WRLA 4AIZA 4Y4HC 3MLRH 4J7RA 4K71C 4JCLA 4OAWB 4AEHL 1UC6A 1JK8A 3AY4A 2IGFH 5I1AB 1JPTH 4YQXH 5J3HD 3D0VA 1QFWL 4P46D 1NDGB 3FFDB 2V5SA 1MJ8L 1OL0A 4WHDA 2Q6WB 4I3RL 5TE4H 5HXMA 4EUPA 5KVFH 2KH2B 1G7IA 1LGVA 1KV3A 4Y4HB 4POYA 4LLVB 1YQVH 3R0NA 4K71B 3LN5B 1WUNT 3E1F1 5EU6D 3RRQA 2X1PA 43C9B 2GT9A 3QWQB 3LY6A 3V52L 4FN0A 2HVJB 3D5OF 4Z7VA 4H8WH 4ZDHB 5L6YH 3EOAB 1ZGLM 2RGSA 4X99A 5DUPL 3O0RL 5IJVB 2AXGB 4LGRB 2LE9A 1MHCA 4XPFL 3HCVB 4IRZH 1C1EL 2XA3A 3DUUA 4YPGB 4HWNA 4JY6B 1LDPL 2VLJE 4CRPA 3BUYB 1EEUA 3QCTL 2NNAA 2CR3A 4OIIH 4KUCD 2R29H 4ISVB 1J8HB 2DKSA 4XNYL 1RIUL 3S3PA 1T7ZA 4PGEA 3HAEA 1X5KA 3QWRD 1ZEAH 4KK8C 1RZ8B 4ZD3L 3RGVC 3DV6A 3I6LD 4B5EA 3UBXB 5TQ2L 5F93C 1T5WA 1QR4A 3ILPA 3KR3L 5CEXA 4HWBH 5KANI 4F8TA 1MCHA 3FQXB 3CFEB 3X3FH 1BIIA 4PJIB 5KS9E 5SWQB 4UV7L 3DVNB 2VNCA 3DARA 5IHZB 1YEDB 1FLTX 2J4WL 5J6HB 2R2EB 3RIFK 5KZCB 3QDAA 1XR8A 4CVZB 4U1MA 5ESVA 2XV6B 2QHLA 3RGVB 3DMMD 5GRXG 2JK5A 2BK8A 2G75A 3ZDXF 1A3LH 1T0PB 2J8HA 5F3BB 2JIXD 2R0KH 4IRJC 4X6FA 1QRKA 1EVUA 2NY0D 3QXAA 4AEIL 1N5AB 5B39G 2XN9D 1MJJB 1UQSB 4HFUL 2JF1A 2GTWA 3H3PH 4X7CC 3VE0B 3UTSD 1UH3A 1FHGA 1MCCA 3ULUH 4AZ8A 1M7DA 4IRJB 4OCXH 5GJTL 1WWBX 5GRVL 3HR5B 2LQRA 1Y0LA 2Q7NA 1A7OH 4P57B 4PJFE 4Q2ZB 1R5IA 4QYOA 3RL1B 3L9RA 4R0LC 4M5YH 5F9AC 4L4VE 4NCC1 3CFJB 3B2UC 4CMMB 3OZ9L 5HHNA 3D39E 4M1CD 1YEHH 1B0GA 1V3LA 2FBJL 3CLFH 1DQML 2IANE 3O8XA 5GRYA 3VI3F 1INQA 4M6OH 1U6AL 1E4JA 4OFVA 1GGYA 3I6KB 4TUOA 1LO2L 1WICA 3QFJB 3VXMD 2VIRA 1VGKA 3V6ZA 3NABL 1T1ZB 4MDJB 5F7KC 4M1DH 1A3RL 3VG0L 5HYSB 4R0LB 5IMMB 2VN4A 2IPKA 3OAZK 1QSEA 4XMPH 4PRNA 4Y5XC 4EUPG 1T0MA 3N85L 3KYOB 2A73B 4K3EH 4A6YL 5HGBA 4NO3A 5IVXB 1NANH 1JBJA 1KPVB 2WK2A 5CJOL 3VXOA 2W59A 2G2RA 2HFEB 2XG5A 3MCKB 2CSPA 4HMEA 5FF6B 5BXFA 1XH3B 3SEPA 4HT1L 1I9IH 5EZIL 4M9PA 2ITCB 3PDDA 2L7JA 3QIUA 4ELKB 1YJDH 4W6YB 4F37K 2NR6C 3MLUH 1TVHB 4LCCB 5DFVC 1YEGL 5FO7A 4I2XB 2A9ML 2C4XA 3ES6A 3LD8C 1CGWA 4XPTH 4K7PY 2NY6D 2PTVA 5F72S 5C0FA 1PSKL 3GMLB 1DVFC 5I66A 3MRKA 4V2CB 4M6NL 3SE8L 4RFOH 3HI1A 4M62H 4DZ8B 2YR3A 5ISZA 3OAUL 1ZANH 4KRPC 2DL9A 3OGCB 3NCCB 5GPRA 4ZYKB 5L8JB 4GRWH 3QIBD 3PXHA 1MF2L 5ITFA 2HN7A 4FQHA 5ID0B 2APBA 3TO2B 5C0EA 3M1BB 2V6HA 5HPOA 4ZO7A 1UKQA 3LD8B 2DLHA 4P5TC 5E2TL 5JHLH 4JZOB 1DVFB 5I19L 4PJ5D 1I85A 4PLKC 3MA7A 3TWCH 1UWXK 3F12A 3DURB 3AB0C 4M6AA 4MA7H 1EFXB 2HJLB 3VMPA 1KEMH 4KRPB 2CO6B 3ARDD 1KC5L 1S9KC 3SKJH 3EZ8A 3BIKA 3QNZB 3MRPA 1GHFL 1I8LA 3KWWA 4ODUA 5FECB 5I2IB 4RMVA 2HTLC 2WM0A 1PFCA 5JZ7C 1PKQE 4P5TB 3BKMH 3O11A 5IBUG 1ULVA 4U6VH 5EU6E 3TBYA 3NZHH 3VXRD 4FFWC 1ZT1A 25C8H 3AB0B 2BHUA 3ARXA 5E6IC 2Z31A 4P5MA 4R90H 1CE1L 2QQNL 4EQ3A 2FB4L 3KLHD 1S7SA 3SO3B 2OTWB 4FQQA 3V0WL 2XZQH 1R24B 3EYQC 4U2ZA 2H2SC 4JY4B 1L0YA 3WFEH 4XP9L 2J6EH 2P1YA 1KLFA 3U46A 2EXWD 1IGTA 2DJSA 1RHHA 1RULH 2XA8H 1XCTB 2H32B 5HYJD 4PLOB 4YE4L 3L3OA 1JWMB 3G6JA 4BQ8A 2A83B 5IHBA 2OYPA 5E1AA 1DQDH 5E6IB 4PFEA 1M71B 3Q3GA 5EBWB 3GBML 2DICA 2VRAA 4DFHA 4KY1H 2OR9H 4QGTA 2DN7A 5ESAA 3VFUB 2FEEI 3TBVB 5B39B 2BY3A 1CFVH 5FYJD 2OL3A 3TCLA 5LBSH 4IDJH 4P9ML 2ZPKH 4XX1G 3MRBB 3I6LE 3UJIH 5C71A 2E3VA 5BVJA 5I8EA 3IRZA 3SKMA 5DRNA 5EZOH 5JQHC 3NCFB 1VFMA 2DBLL 3JSSA 3P9MB 4ODVH 4LLWB 1DBKL 4QTHA 4Z7VF 3ROLB 5K9JH 4YHKL 4G6ML 1KJVB 2VLLB 3MRHB 4ZFZA 1SEQL 4PRHD 4MZ3A 3DGCR 1EK3A 2HJKB 5D93C 3OF6A 4ZFFA 3Q6GH 5I1LB 2CKBH 3ZE2E 5HPMB 3JV4B 3RWGB 4OLXH 3VFVA 3UTQB 5FGSA 5C1MB 3O6ML 2X4PB 4JRXB 1AXSB 1TJGH 3HS0B 5KSBB 3MLZL 2I25N 1IC4H 4M4RA 2GJ6D 4PJDA 2EDFA 2GEEA 4OUUA 1JTOA 1V7ML 2XN9E 4KKCD 3TZVA 4QHLA 1HQ4B 4G3YL 2G5BB 4I1NB 1N4XH 1Z0NA 4OCSL 4XGZA 5D93B 5FYJL 3UTSE 4EBQL 4GXUM 2F5BH 1BMGA 3HMXL 3MACH 1LP9E 3PP4H 2JTDA 3D39A 4Y5VA 3OG4B 2IH3A 3IB4A 4XCNA 3U0WL 1JYNA 4G8EB 5E6YA 1TZHA 1MCPH 3OGOE 1D9KD 1JPFB 1QKZH 2Y6SC 3IFLL 4Q6YA 2IMNA 5IGXH 5JO5B 1G84A 4H1LB 4PRDA 5AD0B 5KAQF 5C9KA 2UY7A 2VAAB 3AGVA 1BD2D 1BBJA 3KPQA 5D5MF 4FHBD 3IVKB 3STLB 1C08B 3QH3A 4IJ3C 4X5XB 4I0PD 4K7PL 3H6JA 2UZIL 1Q9LB 4G9DB 3VXME 1VACA 2BNRA 3FT3B 2VDLH 1MPAL 1ONQB 4PJXB 5KJRH 2PO6D 4NQDB 3O4LB 5TF0A 1RZJL 4K07A 4J3UA 4NJ9L 1FBIH 4I9WD 1L0QA 3MV8B 1S7VB 1VGEH 3WUWG 3RA7L 2HKHL 2V2TB 1F5WA 4IJ3B 4PB0H 3W9EB 2UVFA 1KB5L 4WJ5B 3NN8B 5C2UB 3TV3H 4NHCH 2MQ0A 3NTCH 2DQIH 2CD0A 2N7AA 1AO7A 5F1KC 1DUZA 4LKCB 5HGDB 1FYTD 3GJFK 4HBQA 4U1IA 3WSQL 4G8FA 5CBEB 4ODHL 3ARGD 4CVUA 2C3VB 1KBGH 1UVQB 3QNXA 1JGDB 1AFVL 5IROC 1BBDL 4YFEA 1ZA6A 3SGJC 2WBJC 3BJ91 4K7FB 5IR1B 4NUJB 1UWEH 5I1HL 1XIWD 3OJDA 3J8F7 4UI2A 3STBA 5MI0C 1NC4D 2B4CL 2VLRB 3JWOC 4QXGH 3WIIH 1OOAA 3U4EB 2EC9U 5KTEL 4I0CC 3DIFA 4HGKC 1T03L 2C1PA 3QG6A 1UM5L 1H0DB 3OQ3B 4LVHC 4MLSA 1A7NL 3QCVH 1H3PH 3C9NB 4WUUB 3LCYA 2E7LC 3OKDB 5CHNA 1QTYT 5C08D 3FFCB 2YPKB 4XVTH 2OK0H 1MCRA 3NCBB 2WBJB 5AYUL 2EDRA 4APQD 3CVHB 4PJ5E 2D2OA 4X6CE 4MCYB 2BERA 5MI0B 5ETUB 3NCEB 4B53A 2YUXA 4K8RD 4R4BA 4CJ0A 1PKQA 4KROC 3KPSD 3RJDA 2AI0H 12E8L 1PDKA 1O5DT 4GLRH 4LVHB 5EU6A 1I3VA 2OJZL 1FN4B 2AEQL 5A2LH 1NFDF 1UYWH 1JGLH 4HDIB 1XGUA 2HWZL 1GZQB 3UYRH 1J1PL 3ESVF 2YBRA 3VDAA 3EW3B 3VXSA 4M48L 1EHXA 4YHPB 4EEEA 2P49B 4YDKL 3VXRE 1UXSA 4OZIB 3LSOA 3X11B 8FABA 2JJWA 3BP7B 4KROB 3KYNB 4Y16D 2FEEL 5DTFA 4PJEB 4RWYL 3QHFL 4OGXL 4OQTH 2GUOA 2DS4A 2GFBB 3TA3C 4LAQL 4YX2L 1PZ5B 3ABZA 3MNVB 1I9RL 2WIIA 5TF1H 3A67L 5JW3H 2BHYA 4XNQA 5GGTA 1BVLB 4ZSOB 1DN0A 2DD8L 1KG0B 4ZXBD 5HYJE 3AM8C 1CE6A 5ANME 4IOIB 4K8RL 1NCBH 3QEHA 5MERA 1ACZA 3ZKMC 2DJ4A 2W0FA 4FQXD 4KI5D 5T1KD 2YOCA 5EH1A 3WIHA 3SDAC 3TA3B 3L6FB 4KZDH 5DWUH 3WL9A 4OZ4B 5FYJE 2PW2A 2YK1H 3PIQB 4DGVL 4N8CL 1JHKH 3MO1B 5EN2A 1MY7A 1WCQA 2ARJQ 3VFPB 2ESVD 3DECA 4TTGA 4HLJA 3UTTD 3VRJA 4IMKC 3BPNC 5F1NB 3DX7B 5CIPH 5C0BB 1C16A 1MH5A 4U1JA 2JIXA 3W11C 2X10A 3BD5A 5FO9A 2ADFH 2YD2A 3SDAB 4PRHE 4JM4H 2CLRB 3MODH 2EE2A 5GRWA 1WT5C 3OHXA 2XN9A 2XY1A 2R0ZH 1RUPH 2F19L 3NACL 3RTQA 4X4YB 1OGTB 4ONGH 4RAHA 3UAJC 4ZOEA 1RMFL 2BFVH 5IVOA 5HGGS 3BZEA 3MLYL 3L5XH 3ARFD 1ZT4B 2UY6A 3O6KL 1VDGA 3ROOB 3BPNB 4A6YA 5C7XH 5IK3B 1DUYB 1N6QL 2GJ6E 5A3IC 2Z8SA 5EPMB 4UU9A 5DVNA 4JN1H 4CADA 1CFTA 3U2SA 5ESQA 3RWCB 1L9MA 2PTUA 4AH2B 5CZXC 1SJHB 2BJMH 1RJLA 4D8PB 1EGJH 3VI4E 5E8DH 2PYFA 1QOKA 3PABB 1S8DA 1LD9A 5IW1A 5KS9F 2F54B 2D7PA 5IEHB 3P4OA 4JG0H 3WUWB 1D5BA 4K2UL 4IIQA 1XT5A 4NC2B 5D96C 2CDEB 1ZLSL 1Q9KB 3QULB 5IFHH 4Y89A 1CGXA 4PJGA 4P59H 3VWKD 3HRZB 1MHHB 1OM3L 2DM7A 4NIKB 4WTXA 2EH7L 5D4QA 1BD2E 2ADIB 1OSPL 4PGBA 3GMRB 4NM8L 4XCYA 1A0QL 4JFOA 2H32H 3KYKL 2NY2C 5D96B 1OAXL 1FNSL 4O2EB 1A21A 3DX6A 3CC5A 1SY6L 2E7CA 1UZ8A 4LPVA 4XWOC 3OXRB 4OGZA 3D18B 2EDJA 4I9WE 4PJFF 4TSBH 2VDPL 5MEQA 3RVWC 4LCWD 1CU4L 3O3BB 1Q9WA 3C5SA 3M8OL 1QYGH 2BRQA 3LQZA 4YNYB 5I75C 2Y07H 1U92A 1G7HB 2NY2B 5EIIB 3T0ED 1MREL 2NZIA 3CD4A 5E8NA 3L5WA 2IJ0C 4CW1B 1FYTE 3IU4L 3AROA 1MCWM 4JHBA 4LGPB 2HT2D 3EO1B 1MCNA 1UH4A 4TPRH 4H25B 5BV7C 1SHMA 1MFNA 1GXEA 3C8KB 3IKCB 2YD5A 4K3GA 3CK0H 3VFSA 1OTSC 5F7EH 5I75B 1UXWA 1IT9L 5DVOA 5HHVH 4FQPA 5D1XA 5LAXB 3MV11 3OR7B 2Q87A 5L0QC 4OZGE 5GJSH 1HWHB 1X5XA 3QO1A 4PP2A 3D48R 2FSEA 1NMCC 4X6CA 4IEFB 1DQJB 1SJEB 4XH2A 5BV7B 5C08E 4Y19A 1P7KA 1I75A 3ARDA 3BZFA 4JGUA 2X42A 1ORQA 3CSPA 4B7LA 4PJBB 3HNTL 1GOFA 4QY8A 5EZLA 5D71H 3QIWA 5LGJB 3VFRA 4HX1A 4MCZA 3RDTC 1AGEA 1DBBL 1MIML 5L0QB 4BH7B 2DM3A 2G60L 3GMOA 3KPSE 3IJHB 3BN3B 1G6VK 4H1LH 4DK3A 4CVXA 4UTAL 1NMCB 3VXRA 3QR2A 4P2RB 4PG9A 3V2AR 5J0BA 3QYCA 3GEWB 4JFDB 4Z5RA 4M7LT 1GAFL 3WNPA 1OP5K 5I1DB 1U8LA 4ZAKA 3H9HA 1AI1L 4HHAB 2B0SL 2EDYA 1FZKA 1Y6NR 3LKRA 1GZPA 3RDTB 4HK0B 2ENSA 2MCPH 3QCUH 4V1DB 2FJHB 4KKBC 1KCUL 4OM0H 4BSWA 5I8KL 3P11L 4ETQB 2RCSL 1DCLA 1M7IA 5IUSA 5KVDL 4KTDL 2X44D 3HB3C 2AABL 3OPZL 1KT2A 1ZVYA 3PWPA 4AY0A 4PTUA 1U95B 4OCLC 4UDUA 1HEZA 5DMKB 5D70L 4YFLF 3IGAA 1RIVH 2HKFH 3K80A 4WW2A 3LQAC 4NKQB 3WJJC 1E4XI 3P4NB 3MRGB 3GSQB 4PRBA 4KI5E 1FZOB 5I1JL 3IYLW 3O9WD 5F9JA 4XCCL 2QHRH 3G5ZA 4JKPL 4PJ9D 2DL2A 4CN1A 4YBQC 5DK3A 2ESVE 4UT9H 3UTTE 3OKMB 1WIPA 4OLUL 4PJHE 4NQEA 4PV9B 4HJGA 1HHKA 3HZMA 3KPLA 1Q1JL 4TSCH 4KMTL 1DEEA 3VXUD 2P5WB 2R4SH 2NXZC 1QPXA 1LEGB 2YN5A 3QT2A 4ZUVA 1QBLL 2GJ6A 1LE5B 3F58H 1CZ8H 1QO3B 1W0VA 1BZ7B 2DQHL 4KUCF 4DKAA 3QQ4A 4E41B 3CVHH 4PRPD 4QRTA 3JWOH 1CL7L 3MV9D 3WN5A 1WIOA 3AU1B 2BDNH 4ERSH 1P9MA 1KB5A 5C07D 2NXZB 4KK6C 4OF8A 2DWEB 2R56L 1UZ6E 2HFGL 4XVSL 3QJHB 2X4RA 3CUPA 1GOGA 5FDWB 5EOCH 4HV8A 4FFVC 5DMIL 4JFEA 4XRCA 1DP0A 5CEZH 2ICEB 5D6DC 3ARSA 2A0LC 3NA9H 1U8IA 2R69H 4HKXA 5HGHA 1MCFA 2RR3A 3ZE2F 3QEQD 4FTVB 1NGWA 1YEEL 5I8OH 4L3CA 5D72H 3U6RB 3BDXA 4K3JH 2FX7L 5JHDD 1NLDH 3JV6A 5H35A 3EO0A 4FFZL 1TCRB 2VITA 1YEIH 5D1QC 3RVXD 3CDGA 3PHOB 4PP1D 2PO6A 4NP4L 2X70A 4HZLA 1ZKAA 1XGTB 2BSSA 4YIQB 4PIRF 2RIKA 1EUTA 1LP9F 3O4OC 4NNYB 4OF6A 5I16A 4JRYB 1RUAL 1HILB 3AC0A 4TQEL 1RZKH 2OQJA 4JO4H 3KYMB 4JJ5A 4Z0BH 4U3CA 1S5HA 5TQ0L 5D1QB 1FYTA 2GAZB 3BPOC 4LCWE 3JV5A 4C4KO 3QUML 1MCDA 2VXUH 3P73A 4IOSD 4X7DC 3SJVB 5I8CA 3BXNB 4YDIL 2W07A 5FA4B 3BYTA 2PETA 3T0EE 2ZG1A 4JHAH 1YYML 3BQUD 4DAGH 3O4OB 2VABB 1PZUB 4UUJA 1NUGA 4EOWH 1U8KA 2NXYC 2I9TA 3EYUL 1KENL 4NO2A 4OZGA 1J5OH 3GMQA 1RVFL 4FXKB 2EE6A 3BPOB 3CXDL 3RIAF 1DLHB 1N26A 4HJJL 3R8QA 1HHHA 3C60D 3ZYJA 4NO0B 5A43C 3WXWH 1AD9A 1FC1A 3QXTA 2WWMD 1G6RL 1CK0L 1D6VL 3INUL 4K23L 4APQA 1HYRC 1KOAA 4M7LL 4LHUA 3PV6A 2NXYB 3E3QE 5T33L 4DN4H 1FP5A 4F7MA 4DUWA 3V5DA 5FUZH 4I77H 1BX2A 4HIEB 5DHVB 1CFSA 4AIXA 2CJUH 4J23A 2EDLA 3IU3B 3LKQA 3IDUA 1I1FA 3MLWH 2ZJSL 3O2WL 1J0YA 2P7TA 2ZUVA 2OBGA 3HC0B 1VA9A 1EO8H 1ADQL 3LHPH 4HKJA 4OM1L 4IS6B 4Y5YA 3O2DH 1NCDH 2BY2A 4RAUA 1IAKA 3WHE0 1MCSA 5D7LD 3HZYA 2DRUA 2VISB 4L29A 4WU7B 5E8PA 2FO4A 4MNQD 3T65B 1JZ7A 4YO0B 4R7DA 4X6CF 5I6XC 5IMLA 1EDQA 3NH7L 5AUMB 1WZ1H 4OLWH 3LH2L 1EAPA 3MGOB 3KHOA 3I75B 1T2QL 5BVPH 1S7UA 3F5WB 1JF6A 3MCLH 2IG2L 1KXVC 3V5KA 1IGFL 5E6ZA 4W4OA 3VFGL 3UO1L 4X4XB 5HBBA 1FG9C 3DWTA 3S37L 4KKAC 1OAQL 1N3NB 5FHBL 5I6XB 1RFDH 4HXBH 1UADC 5GGUB 4Y8AA 1NAML 3HMWH 4O4YH 3RWFA 4PB9H 3T3PE 1A7PL 4Q0XH 2DQCH 3NFSH 2KUTA 2L4OA 4R4NC 1RZFH 5T1DL 3VGAC 5KW9L 3NCMA 4GAGL 1TZIB 1YNLH 4JDTL 1ND0A 2EO1A 3DUSB 4G7YH 3H7BB 1OARH 4XBEH 3VXUE 2FL5B 4YHZL 2QSCH 2NYYC 3FRUA 2GJZB 4OI8A 4ZTPH 5BV7H 2ATKB 4R96A 1LEIB 3CU7A 4N8PA 4BUGA 3TNNB 1ZHBB 4PRPE 5T5NG 3OAZH 3VGAB 3UCRA 1EXUA 3MV9E 5CWSA 1NAKL 1VHPA 4Q6IC 4X4MA 4F58L 5TPWH 3PWJA 5C07E 4FP8H 3M17A 4FXGA 1MRDH 3B9KD 4MD4A 5DMGC 2UVEA 3BN9D 4LDOB 5F7FA 4AQ1B 4RMUA 1H8OA 1KJ2A 1QLEL 1H9VA 4I4WB 2BNQD 3VWKA 3VXPA 1HK6A 1PG7X 5T1LA 3W5NA 2FGZA 2VO5A 5TGBA 3V4VH 3S9DB 1YECH 1YYLH 3HUJB 4FQCL 5CCKH 4J1UB 4Q6IB 4P2OA 4LHUG 3QEQE 3DYOA 4HC1A 4JE4B 3S88H 5JHDE 2K3TA 4XI5D 4LLYB 1MOEA 4KUZL 1A1MB 1N59A 1R5VA 4JFXA 3CFDB 2X4OA 1W8NA 1JYWA 3VI4F 3MYJA 2CRIA 1LHZA 4LCWA 3U0PB 3DI2B 2VSCA 3BZ4B 3C5ZD 1M6OB 3QZWA 2A6DB 2BXZA 4EN3D 4J3WA 5HHXL 1YA5A 3QDJB 3O6FD 5SV4A 5MENA 5L2KB 1IEAB 2Z8RA 1LO4L 4YDJB 1GCFA 1ACYL 5T3ZH 3VD3A 3MUJA 3EYOB 4NC1C 3BEVA 4C56E 4L9LA 1C7SA 3WS6A 4EI5C 1TCMA 4JPVL 3MUGA 3LQAH 3RVVC 2QQLH 1A64A 5KSVA 4LSDA 4HIJB 1S7QB 1LK2A 3HLAB 4TNWF 1ZHKA 5HTSA 1EA9C 3LPWA 1P2CB 3BO8B 1WFUA 3FQWB 3NAAH 3SGKA 4ZUWA 4LLMA 2VE6B 4YHYC 1UM6L 3FO1A 1Q0XL 4PGZA 2GCYA 3HFMH 1KIUA 4PGDB 3ETBF 5I17A 5C6TL 1KLGA 3N1PC 3BDYH 2NZ9C 4EI5B 3A6CL 3WDJA 2JE8A 3LDBB 3GHBH 3PG2A 4RCAA 3GBNL 1Y18B 5ALCH 4P4RB 1A14L 5KSAC 5EB9A 5EU4A 4UTBH 5FYKD 3CMOL 1IAOA 3GK8H 4YHYB 4OT1L 2J88H 1S9YB 4XXDA 3VFOB 3VFTA 3MLTB 2DTML 5HI5D 1KCVL 2LABA 3ARED 1TJIL 1IC1A 5F3HB 3D25A 2H41A 1GC1C 4S1SL 2KPNA 1JGVL 3IETB 2R2HA 3GSWB 2HTKD 1GGIL 4MD0B 1K8DB 5KSAB 1KTLB 3ULSA 4GW1B 1XF5A 3H42L 4OZGF 2GKIA 3JTSA 4LHQB 4DN3H 1HN1A 3HG1D 4IBLT 1I1YB 1OHQA 1TVDA 2AQ3A 4N8VG 5D7LE 4N9GA 1HI6B 4MS8C 2XWTB 2AJXL 3MRJA 3BKCL 1ZVSA 4ZO6A 1IARB 1FCGA 4CNIA 4PJ8C 1AY1L 5ICZA 1A9EB 3UJTL 4OZHA 4F15C 4MNQE 3IFPB 3MLXH 3GUTB 3BP5B 2W9DL 4UB0L 4M6ML 1T4KB 4DEPC 1KIQB 5IOPB 4P4KD 3SQOH 5FYKL 2WSKA 1PX4A 2ZUWA 5JXED 1T2XA 3BMVA 3WHE1 5KN5A 1RUQH 1KTKE 1MFCH 2ARJA 2F74A 4PJ8B 4F15B 3G6AA 3CSBA 5DC4B 1NGXA 4GH7B 4YR6A 4EI6A 5IB5A 1JGUL 3RUGA 1TITA 4DEPB 5C8JB 2P5EE 4LAJH 4RGOH 2Y72A 4XTRC 4XB8A 4NGHH 4QHUA 1LQSR 4XP6L 1T21A 2A6IB 4MSWA 5GS1A 5IESH 4P3DA 3QDMB 1D5XA 1A2YA 2X4UA 2NW2B 4ELMA 4IMLA 3GRWH 1O7VA 1ODAA 1X5ZA 2W60B 3THMH 3GSNB 4LF3A 3OR6A 3TT3L 1BEYL 1N5YH 4NKOB 5F7HA 2E27L 3MV9A 5HDOA 1YZZA 3SKNB 2AVGA 1SYSB 3X12A 2DQJH 5T3XD 1A9BB 5C07A 2VZUA 1PYWB 1S9VB 5DHVH 4JN2A 4KI5F 4P2QB 2R1WA 4O51A 3IDJB 5EUOA 2V7HA 4IRSC 1IMHC 1FAIH 1U2HA 3BGFC 2FATH 1U8QB 3QUMA 4AENB 1IGCH 1I1AC 1M05A 2AK1L 1XGYH 1MQ8A 2R2BA 3PHQA 3NBNA 5DSCB 4LDEB 2HLFD 3FB8B 4PJHF 1NC2A 2JJVA 4JO3L 3K4DA 1VCAA 2BNQE 2N56A 3FCTB 3FONA 2KDGA 4ZNEA 3ELAT 1MWAB 2C1OA 5EC1A 4U1SA 1A4KB 4IRSB 2BC4A 4QOKA 5EU7C 4HBCH 3BGFB 2BCKB 2VXVL 3WE6B 4JO2L 3SDCC 5GGQH 1I1AB 2V2WB 4ZUTB 3DOSA 5EORH 1J0JA 1KTDB 5GGRA 5I1CL 5I1IL 5T1MB 1G7PB 3QFDB 5T3XL 4B7IA 2OZ4A 5C0GA 1T3FA 2PTTA 4AL8L 4E5XA 1S7TA 4U7SA 2PYED 1T0NA 1U9KA 1UZ6F 4N90D 3FT4B 3TIEB 2A6KA 5MP6H 5JOFB 3VW3L 2QADC 5ADPL 1A6TB 4OFYD 1T7YA 3SDCB 2Y5TB 2DQFB 4XNUH 2AQ2A 4C56A 4Q9QL 5CBAB 3MMEA 5IKCA 2CIKA 4JQXA 3BQUA 1P53A 2X5PA 3BSZL 5GS0C 2UYLB 4P9HL 1YMMA 4R26L 3WKML 4X8JA 5GSRA 2C3WA 4MJ4A 3BHBB 1U3HA 4LASL 4NKIH 2QADB 1I7UA 4PV8B 5BS0B 4LLUA 1OF2A 3MRMA 2NY1D 2YPLD 5HGAA 1R0AH 3I50L 1U8HB 5C0CD 2HJFB 4GBXC 3BAEH 3T8XB 5D9SB 1OAKH 2D4FA 1EHAA 3BESR 4NCDA 4QHKI 4WVRA 4WTZA 1FFOA 4XC1H 4NQVB 4N8VB 4RNRA 3WJLA 1KNOB 5IFAL 2DDQL 5FB8B 2IH1A 3PE9A 4XPBL 4HULB 4OLZL 4DFIA 2BSTB 2MCG1 15C8H 4OKDA 3K8KA 1ZE3C 4HH9B 1IQDA 3H2WA 1GGCL 4UIKH 2IQ9L 4GBXB 4L8CA 2AJZB 1UJ3A 5FYKE 1CTOA 5HHOD 5E95B 1PEZA 1NAMA 3KYAA 1OSZB 3QHTC 1AH1A 4Z7WE 4CKVX 4XNMA 5DEFB 1LK3H 2RFXA 1G9ML 1KXQE 1NGQH 1WZKA 1MCOH 3JBG7 5E03A 3IXAA 5DQJA 5IHUL 3GIZL 1RK1A 4IDLA 1CF8H 2E8ZA 3F62A 4KJQC 5CP3H 1NMAH 3V7MA 3HG1E 1T83A 4U6YA 4MAYD 3RWIB 5JNYA 2FEDC 1EEZA 3FTGA 3SDDD 5DD1L 5L9DL 3QSKB 5C2BL 4PRAA 1N2RB 4GXVH 1HXMA 3E8UL 1Z5LA 2GQHA 1FVCA 4KC3B 2FECI 5ILTL 1CVSC 1DLFH 4RGMC 2I27N 5FKPA 3ZT6A 4HJ0C 4GQ9L 2Z92B 1FJ1B 1U8MA 4LL9A 4MAUL 1QPPA 1T1YB 3V5HA 4XWGH 3NOIA 3SCMD 2VERN 2EDXA 4FZEH 1U8PA 4BKLA 5EU5B 2EH8H 4DZBA 3GKWH 2IEPA 4U1LA 3D69B 3GIVB 2P5EA 1IL1A 1J1OL 2BSRA 3B9AA 2VXSL 2Z35B 2ZOLA 3EJZD 4RX4D 4JR9H 3G5VA 5EIQA 4RGMB 4PREA 4XC3L 4KKLD 1HKLH 4XNZC 5ID1A 3OKLB 2ICES 4LIQL 4WEMB 4WI2A 5D5MB 4HWZA 2X6MA 3VCLB 4XXCC 1ZT7B 1JMXA 3MXVH 2I07B 3GNML 1WBZB 2GTZA 1KPRB 1AC0A 3V4PH 3OBAA 3ARUA 1YPZE 2EDKA 1W8OA 1FL3B 3LKSA 2B1HH 3GO1H 4ZUUB 3L3IA 5SV3A 2IBBA 3P3YA 4U1NA 3H9SB 3B8YA 4PJ7E 4XNZB 4HG4K 1YY8A 3SE4C 4YBHA 2FD6L 3FB5A 4OF7A 5T3XE 2ICWB 2AXFA 4XPGL 1YEKL 2BVUA 4HUMB 5DK2B 3B9KA 4JANA 4U0QB 4HD9A 4JHZA 3GI9L 3T3PF 5JQ6H 3G5YA 2R0LL 2BNQA 2O5XH 3NIGE 1R5IB 5BRZB 4OFDA 5F6HJ 1IC7H 1Q8MA 5DRXA 1K3ZA 1T66D 1NCAL 4LSVH 5CSGA 2DBJA 1JPGA 1KCRL 2NW3B 3EYSL 3ORJA 1WFOA 3CH8A 4YHLL 2WP3O 4MXWL 1GSMA 4I0KA 5D1ZD 3PQYD 4O5LL 1BF2A 4X80L 3OSKA 5JORA 3MV7D 4HEME 2ZUUA 5IVZB 1VEPA 1R3IL 4E9LA 2ZSWA 1BJ1J 1GC1H 3CX5K 4D0BA 5F6IB 3LB6C 3LZFH 4OD1L 2Q86B 4OCNC 3X14B 9CGTA 4JFZL 4I5BA 3AFLA 1AKJA 1AC6A 1A6ZB 3PGFL 1UB6A 1I7ZB 4JFFB 2PYEE 5D7IB 4N90E 1BM3H 2IADB 4Y1AD 4FNLL 1JFQL 3H9ZA 3QUXD 2VZ3A 2WUCL 5BXFB 5LQBL 5E0QA 3TH3T 3FZUD 4XP4L 5DR5L 5J7CC 2R0WH 1NGPH 1IGMH 1LO3H 1NFDB 2ZSVA 4R3SA 5CJXC 3MCG1 4YHMH 5IB1A 4GOSA 5CJBA 3S96B 4KRLB 2Q76A 1P7QD 4OCWH 3V6FB 4NHUA 5FUCE 4D9LH 4DW2H 2LTQC 1YQVL 4FQIH 2W9EH 3PJSB 3MRNB 3EOTH 4FG6D 4Q9CA 3GSNH 1NDMB 4NQCA 3MJ9H 4F7TB 1AE6L 2XTLA 3TO4D 1FO0B 1S78C 2YPLE 3WHXA 4RIRB 2GSGA 5E08L 4M5ZL 5C0CE 5ITFB 4GO6B 4CU8A 1I7RA 2YD1A 2AK4D 3HE7D 4KXZH 4PJAE 3MRLB 1OAUH 5IP4A 5B3JE 2B2XL 4HUNB 1Z2KA 5FOJA 2LTQB 1K2DB 3Q6FA 2FIKB 4GKOA 2AJUL 1NSNH 2DQEH 2H2PD 1TMCB 3HPLB 3MBEA 4QRRA 3OXSA 5CILL 4D9RD 3RBSA 3BKJH 3SY0B 3W0WD 5FUOL 4QF1B 1E4KA 1MI5D 1G0YR 5LKNA 4BSVB 3MRPB 4ZPTA 1CN4A 1MFBL 3KLAA 4OZFA 1LEKA 4WFED 5HHOE 4D94A 5LXGL 1HIML 3F7PC 5HY9A 1IQWL 1MWAH 5J9PB 3CDYA 3HG1A 3KJ6H 1P4IH 4FQJL 3SGDH 1QSVA 1I9JL 2BNUA 3HE6D 4P5MB 4HWBL 4BH8B 2NX5D 4EQ2A 4LIQE 3GSRB 1MFEH 2HFFB 5I1KL 4L4TA 2VLJB 5K9KA 1YY9D 1BLNA 2BMKB 4ZUSB 3SQBA 1FV1A 3P40A 4XVJH 1N7ML 1FVEA 4JZJC 3ZSSA 1AD0A 4ZS7L 5HYQB 4NN6C 1JZ5A 4NFDA 3BW9A 4ZFOB 1NJ9A 4P4KA 1IKFH 3LEYH 1HSBA 5E1AB 1OD9A 4J8RA 1ES0A 2A77H 4K3DH 4DGYL 2XT1B 1ERNA 3O2VH 4XCFL 1FZJA 2O5YL 2Q8BL 3ARBD 4J3OC 5KS9B 4TNWK 4YHIB 1C5CL 4JZJB 1CLOH 3H3PL 4ODBD 1G7QA 5C0AD 2X7LA 4YC2C 4NN6B 1BOGB 4TUJA 3TYFB 2NTFB 1OGAD 2BVPB 4O9HH 4Q9BA 3AS3A 4XAWL 4OCXL 1HINL 2X2YA 5FO8A 3FB6A 4J3SA 4Z8FH 2VDKL 5J4MA 1S3KH 4M5YL 1YPZA 4OGYH 3S8WA 4M1GH 5GS0H 3RI5K 4H0GA 1FGVH 3VDCA 3GB7B 1YEHL 2GSIA 2FJGB 4KJPD 4YC2B 1OTUD 1KN2H 2APFA 1EZVY 3DSFL 2ZOKA 1ED3B 3AMLA 3VWJC 1K4CB 2F53A 1B6UA 3PGCB 1CD0A 5HI4C 3CLEL 4WTWA 2GW5A 4PJFB 2RQ8A 1QSFA 1QEWA 1C5DA 3BT2H 2M8XA 4L4VB 3BPLC 4E0RB 2XRAH 3LKNB 3HNVL 3UROR 1T89A 5K33A 2IANB 4S2SB 5GGSB 3CZJA 3VWJB 4XVUC 5DRZA 4XBGA 1VEOA 1HYSD 2CLZB 5DXWA 1AIFA 3T08A 1INDL 5C0JB 1KFAH 3FRPA 2X4QA 3KPQB 2AGJH 4GKSB 1BFOB 3V95A 2XXMB 5I15H 4LSTH 4N0CC 2WLYA 1EH9A 3MFFB 5I30L 1EHLH 4JB9L 2IWGA 3MV7E 1H15A 4XNXH 1R6VA 2DF3A 3L3KA 1XGQB 2PYEA 2N4IA 1RJZB 1OLLA 4Z7UA 3HZVA 5EUKA 4NQXB 4ORZC 4P2YA 5J1TC 1JNHA 1J0ZA 1KJ3H 3P0VL 1ZANL 2NLJB 1OTTC 3F7VB 4OZFG 4OFYA 4KPHL 2AJSH 1ZS8B 2X1XR 4U1GC 5CGYD 5IBLC 5GZNC 4JFQA 4MJ6A 4Y1AE 5A2KH 4MA8H 1QP1A 3ZHDA 3TBSB 4DVRL 1FH5H 2X4TB 1CIDA 3MJ7B 4OKVA 3ILQD 3DO7B 4MQXD 2R9HC 1GIGL 4MA7L 3KPRD 5B4MC 3CH1B 4LBEA 4WUKH 5E5UB 4G42A 1D5MA 1XR9B 4WV1C 1YN7A 4GMSL 1Z9LA 2OLDA 5J3HC 2EEBA 1U42A 4QT5A 4GG6E 4P46C 5E2UL 2YD4A 1CICD 1ITBB 4NZUH 4U1GB 4C83B 3FOMA 5C0CA 3C2AL 5J57B 3MC0A 2IAMA 1HE7A 1I8IB 1OB1A 1HH9B 3FQUB 2EIDA 1WTGT 2VXTL 3RY5A 1H3UA 3BKML 1JL8A 4G9FD 4HUKB 3EJJX 2C7UB 4U6VL 2XKSA 4HS3A 5LWYH 3RZCD 2CIIA 4LU5H 1ETZA 4R90L 4WV1B 1A4JA 5CHNB 5SWZD 2AK4E 2OTUA 3OJMB 2X40A 4P46B 2BY1A 3MRQB 4MB5A 3WFEL 3D85B 2H8PA 1NCNA 4RRPA 4NPYA 4C58B 4PBVC 2UWEB 1GVIA 5HHOA 1PKQB 1T5XA 1VPOH 3LEVL 4D9RE 1EPFA 3RWJB 3EYVA 5E4EC 3W0WE 1DQDL 4RMTA 1MI5E 3C8HA 2OSLA 1I8MA 4NUGH 4WFEE 3QA3A 1IAII 5E9DD 4Y2DA 1NMBL 2FDBP 5LBSL 2FR4B 1F6FB 1I3UA 4WU5A 3S36H 2ZNXA 1LE9A 2HT4D 4WCYH 8FABB 3DYPA 1ZGLB 5D2NC 5DQ9B 4WNQA 4OB5L 1FNFA 4G80B 3RU8H 2NX5E 5E4EB 1L7TL 1XGRA 2C3HA 3TPUA 2YRZA 3HA0A 3GMPB 4KQ4H 5FM8A 4YAQA 1R3KA 3AXLB 4U31A 1ZHNB 4L3ED 1QR1A 3SCMA 2IPTH 1FGNL 1NBZA 3RNQB 4PLJC 2W0PA 3IJSA 5TDPB 3DMMC 2XY2A 5F7YC 5D2NB 4XPAH 2D31B 3QEHB 1RSFA 4Z7WF 1KPUB 4RX4A 4LCIL 5DQDL 1DDHB 2DMBA 3T77A 2PW2B 4OV5B 1FL5A 2DQDL 1HNGA 4JO1H 3TH2T 1EMTL 1N4XL 4MJID 5C0AE 4EZMA 5DJ6B 3JWDC 3U9PL 2F5BL 3QRGL 5ELIA 1OGAE 3PP4L 4F9LC 3DMMB 2I9LB 4ZQKA 4WWKD 3EJYC 2BRRH 1CXKA 1MCPL 3QUKB 4HGWB 1FO0H 1DBJH 1QKZL 3ET9F 5IGXL 5FO9B 1MHEB 1R3LA 1V8HA 3MXWH 2ZUQC 2X89D 5BO1L 4AJ0A 4HXAL 1J0KA 2XN9B 1I3GH 5F9WC 3CFCH 4XT1C 5I18L 1JNNH 3GSVB 1RZGA 5KZCD 4NWTH 2Q3AA 4M1CC 5HVFB 5GRZA 2CQVA 3L7EB 4JKWA 1YEJH 2OP4L 2IALB 3UTSB 4EDXA 3RWHA 1LP9B 5KVEL 2FX9L 3Q5YA 4UU9B 3L95A 4LP4A 4PY8I 4XP5L 4EIZC 1HDMB 3B3IB 3MRDA 4LNRB 1KLUB 2PXYA 2VDLL 3FN0H 3SDYH 4JFYB 5F1SA 3N1FC 2ZUQB 5DJCB 1RJLB 5FHAL 4LEXL 3DVGA 2BVQA 1J05B 4X5WB 4XHQA 1CBVL 4NDMB 1A6UL 5F9WB 3U0TB 3V6OE 1LD9B 4CAGA 1FBIL 4OFKA 4F3FA 4WO4D 4IIQB 3T1FA 4PB0L 5FKAB 5SX5K 3BI9X 5EBMA 1JV5A 2R1YB 1P6AB 4OCYL 3DETD 5DYOA 4X7SL 5IJKA 4PTTA 5IV2B 3VXMB 2A74A 5TDOB 3MUHL 5ACLA 4H5SB 2FH8A 4KQ3H 2BOCA 1YPZF 4KV5E 1JZ6A 2Y5EA 3D3VD 3OV6A 4MQ7B 2YEZA 4KMQA 4PJ7F 5D2LE 1J8KA 1KBGL 4U33A 3KS0H 2W65B 5LGHL 4QHMA 2EYSA 4S1RL 2NY6C 5IQ7L 5DD5H 3GSXA 3CDFA 3WFDL 1BHGA 1HHGB 1U0QA 1YMHA 2P48B 4UT6H 1XGPA 4Y1AA 4D0CB 3KXFE 5IWLC 5CZKA 5JR1L 35C8H 3NIGF 3B2UD 2CDFA 5JDSB 4UV4H 4J4PA 4N0UE 3EGSB 3F7RA 3QIBC 1UACL 3TYGH 5HVGB 3VFWB 3T2NH 1HH6A 4NKMA 1P7QA 4QRSA 2NY6B 3R06B 1E6JH 3L5WB 4ONHB 1RIHL 4TTDD 4WFGD 1X7QA 5C9JB 1JGEA 4JM2D 1BZ9B 3KPRE 3EIFA 3TN0C 1UB5B 4HWBA 1QSZA 2V5MA 2V7NB 3EFDL 1NBYB 1ZK9A 3L1OH 3UYRL 3BGMA 3VFSB 1ROWA 2WUBH 3QIBB 3PUCA 1P84J 1WCBB 5BW7C 2AK4A 2P8LB 1WIUA 4G9FE 4KVNH 4KK5C 3QNYB 1FNHA 1JWUA 2FHFA 3AAZA 3SDXE 5TH2A 3UZVB 4PJ5B 1MRCL 4LSRL 1FDLL 4GW4B 3CJJA 4NWUL 2DKMA 4ORGA 3O3AA 2DI7A 5SWZE 1FFNA 3WNLA 3QQ3A 3UX9B 4GKNB 4TUKL 5DFVD 1MJUH 1HSAA 4OD3H 3VFRB 4RAVA 3OAYK 1HCFX 2EXWC 4DKEH 5ACZB 4HK3J 1NKRA 3L7FB 3IDNA 3PP3H 3CXHK 4G7VL 1I3RA 4G6JH 3MRCB 1N64H 1P4BL 5FA3B 4NM4L 4X0KA 1IGIL 1M1SA 2NX5A 4EVNA 4JKLA 5E9DE 4P3CH 2YK1L 5DK0A 3IDGB 3H9HB 2HT3D 5K93A 4XB7A 1EX0A 5DLML 4HIIB 4PLKD 1FFPB 4PJAF 4Y4KD 5FEBA 3W9DB 5B3JF 1T1WB 2JCCE 5HYJB 4LKXA 4AEHH 1W72L 2EDHA 3QXUA 4AK1A 4ZPVA 1TJHL 5ANMB 4QRQB 4NRXB 4PG2C 5IQ9A 2CXKA