2H36X

Structure of orf14 from sulfolobus islandicus filamentous virus (sifv)
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
108
structure length
108
Chain Sequence
KQDLEKIESDIINDWTEADDLDDALDFLFMEKVSEFKIKFKDPLKVTEEEYRELLGNYDSSNSVSSNGITIDQYTYDEDDDIMYKLEFTYRKEDNKIYIYEVQGWREK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hypothetical protein SIFV0014
publication title The crystal structure of ORF14 from Sulfolobus islandicus filamentous virus
pubmed doi rcsb
source organism Sulfolobus islandicus filamentous virus
molecule tags Unknown function
total genus 23
structure length 108
sequence length 108
ec nomenclature
pdb deposition date 2006-05-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
X PF07118 DUF1374 Protein of unknown function (DUF1374)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.300 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 2h36X00
3DJWA 3DF6A 2H36X
chains in the Genus database with same CATH superfamily
2LCEA 5IXMB 2EMIA 1YYKA 1L4SA 3BIDA 3VK6A 2EN4A 1DGCA 2YU8A 4LFAE 4LFBE 1EKZA 1X6EA 2YTQA 2WBSA 4J8ZA 5AC5A 1T4LB 2E1MA 5TSEA 1A1IA 4L5NC 2LTRA 2HGHA 2EPRA 5AC4A 2IHR1 2EM5A 4DV3E 2MKNA 1A1GA 2L6MA 2JYAA 2LUQA 1ZBQA 3MHSC 2L3CA 2YU5A 3ADGA 4DR7E 1TF6A 2YSPA 4F9BB 3HPSA 4F6NA 2VE7C 2HC5A 2DSYA 5LL6R 4GZNC 1P47A 4DV7E 4F2JC 4DV6E 2EM8A 4BS9A 2L2MA 4X65E 4DR4E 1BB8A 2KONA 1HNXE 3JAMC 1TN9A 2EORA 4BHBA 3P1XA 2L8TA 2CT1A 2EM0A 4JI2E 4GKJE 1MGTA 1X5WA 2EQ1A 1WRJA 2G7HA 3C4BA 2LVHA 3ADIA 2EL4A 1EH6A 4O24A 2EOMA 2M7QA 4R2RA 2LE2A 2EMKA 3L00A 5AE3A 2L2KB 4ZYDA 1FKAE 2EN2A 4NXME 2JP9A 2UXBE 1BBGA 2L33A 4DV5E 1X3CA 5A6AA 5T6JA 2YTDA 3DJWA 2A25A 2CPNA 4TUIA 5ADZA 4P78A 1BBOA 2YTGA 1X6FA 2B9DA 2ELZA 4WXCA 4LF7E 1T39A 2JPAA 2RS6A 4HEIA 2M1SA 4O43A 2LO3A 2UUBE 4R03A 2LUPB 5A6JA 4P7DA 4WYQB 4DMIA 1XMQE 1UHZA 3BBGA 4WXDA 1N34E 3IWDA 4ZYEA 2YRMA 1WHNA 2MC5A 3OMLA 2EE8A 5IWAE 4DR5E 2LJUA 4LF8E 2EOQA 4L8NA 4R2AA 1A1HA 2K7IA 2K4VA 2YTPA 2EOJA 2NUFA 5F3WA 2EWLA 2WZOA 2DMIA 2EP3A 4DR2E 4X66E 1B69A 2EPKX 4DV4E 2F4VE 2EPAA 4DUZE 5KL2A 1MEYC 1UBDC 2VQEE 2EOZA 1EH7A 1GZ6A 4M2ZA 2FTXB 4M9VC 4JI8E 2YZTA 3M99B 2MKDA 1PJSA 1IBME 3TQMA 2EOHA 3IWCA 2WCC3 4OOGC 5FLXC 4LTYA 2EMFA 2M4IA 2YTIA 2RPCA 1IBKE 4DV1E 4Q35B 1FJGE 2RTXA 2EM4A 4BCAA 5LMNE 3J7AG 3LMLA 3IWBA 3HXLA 2EPOA 2RSIA 1DQ3A 1GTKA 1PJQA 4K0KE 2EM2A 4DUYE 3VHTB 2GPIA 2LTSA 1ZU1A 4F9CB 1XNQE 2NA2A 2EQ3A 5IT9C 2EM3A 1YUIA 2EN1A 3F6GA 4FK5C 4WSGA 3DF6A 1RMDA 3ECRA 4DKKA 4WSPA 2NUGA 1DI2A 2VRDA 5DNYA 1WXRA 4DR3E 4LU9A 2EZ6A 1QU6A 2EMCA 4R8OA 2ODRC 5KL5A 4NZVA 2L92A 4GKKE 2EPUA 2EOEA 1NEIA 1YYOA 2V87A 2RS7A 1F2IG 4JI1E 2YRKA 2JY9A 2YTJA 1NCSA 4JI4E 5BR8E 1HNWE 4BC7A 2E72A 2EOYA 4HTGA 3BF2A 3F6HA 4F6MA 2YT4A 2EMGA 1A1KA 4LF5E 2ZM6E 2EM9A 3ADLA 2JR1A 1QNTA 4JI6E 3EPJA 1SFEA 4R2QA 1N32E 4ZYGA 2EL6A 4KZSA 2NABA 4MLVA 5A6BA 1XMOE 2FV4B 2YTNA 4ZYHA 2EMLA 4IS1C 2L3JA 2DMYA 2YTEA 4WPYA 4BMJA 2V8QB 2M9AA 4BHCA 4TUGA 2JXPA 3HTXA 2JOBA 4JYAE 2EPXA 1XNRE 2LV2A 2UXDE 2UXCE 2UUCE 1WJPA 4OX9E 5AE2A 3C4TA 4WFTA 5KL7A 3EPLA 2UU9E 4F54A 3T1YE 4M0VA 3HQ1A 4O5GA 2UUAE 2DLKA 2HJJA 2YTOA 5KL4A 3J80C 3HPZA 4BC9A 2EMYA 1AH5A 5A6KA 3KZYA 5AASA 2ENCA 1ZAAC 4RH8A 4BBYA 2DRPA 2EPPA 1X6HA 2D9HA 3AV0A 2LMZA 3QG5C 3ADJA 4DV2E 1YUJA 4JI3E 3EPHA 2EMXA 1T4OA 1YSAC 4X62E 3J7Yp 1I94E 2EPNA 1RC7A 2DLQA 2LRSA 2YWQA 1T38A 2FGGA 1J26A 2B7TA 3RMPA 2EN7A 2ADRA 1PJTA 5A2QC 2J7JA 2BBGA 3MSWA 1X47A 1IBLE 1EH8A 2RSMA 2EN6A 2EPZA 2KHXA 4KWYA 2EL5A 3H09A 4X8WA 2MDRA 3EPKA 1LLMC 3KWRA 2WBUA 2EOFA 4LF9E 2V88A 1ZBTA 1N36E 1TF3A 2EOXA 2ELYA 1YPNA 2F8BA 2ODRD 3VYYA 4IJDA 1ZR9A 2ENAA 2EOSA 3FIGA 2EMZA 2MC6A 1PDAA 2DB2A 2V89A 1SR9A 2EPCA 2EMBA 4DR1E 2VF1A 2EN3A 2JWOA 2PRTA 2EPMX 2LJHA 3LLHA 1WHQA 4LF6E 1IQOA 4WX9A 4B3TE 2JVAA 2R1FA 2JOXA 5A69A 5LLQA 3UK3C 4B3RE 1YFHA 5KL6A 4R2SA 4RHBB 2HHHE 4M30A 2LT7A 4MLQA 4JI7E 2RQLA 2MDGA 1Z1BA 1X49A 2EOIA 4GEQB 2I9IA 3AUZA 3JU0A 2N3HA 4LFCE 1GQEA 2V85A 1A1JA 4LF4E 2EQ0A 1UN6B 2YSOA 1T4NA 3THOB 2CTDA 4O4KA 2YPNA 3OTOE 1HNZE 2ENHA 4NHRA 1YYWA 3K6QA 4B3ME 1IMUA 3KZZA 3C6KA 2NUEA 2WBTA 5A6BD 1RQ0A 2LBSB 1UILA 2N8XA 2BB8A 2DIXA 5KL3A 3JTZA 2KOUA 2V83A 1PKPA 2B3TB 1G2FC 1G2DC 1X48A 4F9AB 4R2PA 2CSHA 4N4RB 1YZ9A 1AAYA 4KHPE 2EN8A 2EMAA 4JV5E 2B7VA 1IQSA 2DGCA 1N3GA 2EMWA 2YTFA 2VQFE 3C6MA 3VYXA 2V86A 2EPLX 4B3SE 2GLIA 4AQYE 4JI5E 5LMUE 2Q8UA 2R76A 3MHHC 2EMHA 1A1FA 3BGHA 3T1HE 1N33E 2GHFA 2L2NA 4X9JA 4JI0E 4NXNE 5AE1A 2EJ4A 1KYQA 4X64E 1JK2A 4R2DA 2EM6A 4R2CA 3J81C 2E5LE 4R2EA 3ZOQB 4YHHE 3THNA 5CFFE 1JK1A 2N3GA 3EQ1A 1HR0E 2YRHA 2EOOA 1J5EE 2EM7A 4DR6E 5IV8B 1STUA 1O0WA 1A1LA 4Q28A 4I8OA 1KJKA 2I13A 4DV0E 2H36X 4YY3E
chains in the Genus database with same CATH topology
4DV4E 1XMOE 1YYKA 2F4VE 2FV4B 4DUZE 3VK6A 2VQEE 2L3JA 4LFAE 4B3RE 2DMYA 4LFBE 4WPYA 4BMJA 1EKZA 1GZ6A 2HHHE 4M2ZA 4M30A 2FTXB 4JI8E 2V8QB 4J8ZA 2YZTA 4JI7E 4TUGA 1T4LB 2E1MA 3HTXA 2JOBA 4JYAE 1XNRE 1IBME 2UXDE 4L5NC 1X49A 4GEQB 2LTRA 2UXCE 4DV0E 2UUCE 3AUZA 4OX9E 5AE2A 3C4TA 3IWCA 2IHR1 4DV3E 4WFTA 3JU0A 2L6MA 2N3HA 4OOGC 5FLXC 2LUQA 1GQEA 1ZBQA 2V85A 2UU9E 4LTYA 4F54A 4LFCE 2M4IA 2L3CA 3T1YE 3ADGA 1IBKE 4DV1E 4M0VA 3HQ1A 4LF4E 4DR7E 4F9BB 1FJGE 2RTXA 4BCAA 5LMNE 2UUAE 3HPSA 3J7AG 2VE7C 3LMLA 3IWBA 3HXLA 1T4NA 2DSYA 5LL6R 2H36X 3J80C 4DV7E 3HPZA 4BC9A 1DQ3A 4DV6E 4K0KE 3OTOE 4BS9A 4DUYE 2L2MA 1HNZE 4X65E 4DR4E 2KONA 1HNXE 3JAMC 2LTSA 5AASA 1YYWA 3K6QA 3P1XA 4B3ME 2L8TA 4F9CB 4BBYA 1XNQE 2NA2A 4JI2E 2NUEA 4GKJE 1RQ0A 3AV0A 2LBSB 1UILA 2LMZA 3ADJA 4DV2E 4JI3E 5IT9C 2DIXA 1T4OA 3JTZA 2KOUA 4X62E 3J7Yp 2V83A 1PKPA 2B3TB 2G7HA 3C4BA 1I94E 3F6GA 3ADIA 1RC7A 1X48A 3DF6A 4F9AB 1YZ9A 2LRSA 4DKKA 4KHPE 4WSPA 2FGGA 2M7QA 2LE2A 1J26A 2B7TA 5AE3A 2L2KB 3RMPA 1FKAE 2NUGA 4JV5E 5A2QC 1DI2A 2B7VA 5DNYA 1WXRA 4DR3E 4LU9A 4NXME 2EZ6A 1QU6A 2UXBE 3MSWA 2VQFE 1X47A 1IBLE 2RSMA 3VYXA 2L33A 4R8OA 2ODRC 2V86A 2KHXA 4DV5E 4B3SE 3H09A 2L92A 5T6JA 4AQYE 4GKKE 4JI5E 5LMUE 1YYOA 2V87A 4X8WA 2MDRA 3DJWA 3KWRA 2CPNA 2RS7A 4TUIA 4LF9E 4JI1E 2V88A 1ZBTA 5ADZA 4P78A 1N36E 2JY9A 2B9DA 4LF7E 3T1HE 4JI4E 1N33E 5BR8E 2RS6A 2L2NA 4JI0E 2M1SA 4NXNE 1HNWE 4BC7A 5AE1A 2F8BA 2ODRD 2UUBE 4X64E 4R03A 3VYYA 2LUPB 3F6HA 3FIGA 2YT4A 4P7DA 2MC6A 4WYQB 4DMIA 1UHZA 1XMQE 1N34E 3J81C 3IWDA 2E5LE 1WHNA 3ZOQB 2MC5A 3OMLA 5IWAE 4YHHE 4DR5E 2DB2A 2V89A 1SR9A 5CFFE 2ZM6E 4LF5E 4LF8E 4L8NA 4DR1E 3ADLA 2JR1A 2N3GA 1HR0E 2VF1A 2JWOA 1J5EE 4JI6E 2K4VA 4DR6E 1N32E 1STUA 1O0WA 2LJHA 3LLHA 4Q28A 4I8OA 1WHQA 2NUFA 4LF6E 5F3WA 2EWLA 2WZOA 4B3TE 4KZSA 4DR2E 2JVAA 4X66E 2JOXA 4YY3E
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3DJW A;  3DF6 A;  2H36 X; 
#chains in the Genus database with same CATH topology
 2LCE A;  5IXM B;  2EMI A;  1YYK A;  1L4S A;  3BID A;  3VK6 A;  2EN4 A;  1DGC A;  2YU8 A;  4LFA E;  4LFB E;  1EKZ A;  1X6E A;  2YTQ A;  2WBS A;  4J8Z A;  5AC5 A;  1T4L B;  2E1M A;  5TSE A;  1A1I A;  4L5N C;  2LTR A;  2HGH A;  2EPR A;  5AC4 A;  2IHR 1;  2EM5 A;  4DV3 E;  2MKN A;  1A1G A;  2L6M A;  2JYA A;  2LUQ A;  1ZBQ A;  3MHS C;  2L3C A;  2YU5 A;  3ADG A;  4DR7 E;  1TF6 A;  2YSP A;  4F9B B;  3HPS A;  4F6N A;  2VE7 C;  2HC5 A;  2DSY A;  5LL6 R;  4GZN C;  1P47 A;  4DV7 E;  4F2J C;  4DV6 E;  2EM8 A;  4BS9 A;  2L2M A;  4X65 E;  4DR4 E;  1BB8 A;  2KON A;  1HNX E;  3JAM C;  1TN9 A;  2EOR A;  4BHB A;  3P1X A;  2L8T A;  2CT1 A;  2EM0 A;  4JI2 E;  4GKJ E;  1MGT A;  1X5W A;  2EQ1 A;  1WRJ A;  2G7H A;  3C4B A;  2LVH A;  3ADI A;  2EL4 A;  1EH6 A;  4O24 A;  2EOM A;  2M7Q A;  4R2R A;  2LE2 A;  2EMK A;  3L00 A;  5AE3 A;  2L2K B;  4ZYD A;  1FKA E;  2EN2 A;  4NXM E;  2JP9 A;  2UXB E;  1BBG A;  2L33 A;  4DV5 E;  1X3C A;  5A6A A;  5T6J A;  2YTD A;  3DJW A;  2A25 A;  2CPN A;  4TUI A;  5ADZ A;  4P78 A;  1BBO A;  2YTG A;  1X6F A;  2B9D A;  2ELZ A;  4WXC A;  4LF7 E;  1T39 A;  2JPA A;  2RS6 A;  4HEI A;  2M1S A;  4O43 A;  2LO3 A;  2UUB E;  4R03 A;  2LUP B;  5A6J A;  4P7D A;  4WYQ B;  4DMI A;  1XMQ E;  1UHZ A;  3BBG A;  4WXD A;  1N34 E;  3IWD A;  4ZYE A;  2YRM A;  1WHN A;  2MC5 A;  3OML A;  2EE8 A;  5IWA E;  4DR5 E;  2LJU A;  4LF8 E;  2EOQ A;  4L8N A;  4R2A A;  1A1H A;  2K7I A;  2K4V A;  2YTP A;  2EOJ A;  2NUF A;  5F3W A;  2EWL A;  2WZO A;  2DMI A;  2EP3 A;  4DR2 E;  4X66 E;  1B69 A;  2EPK X;  4DV4 E;  2F4V E;  2EPA A;  4DUZ E;  5KL2 A;  1MEY C;  1UBD C;  2VQE E;  2EOZ A;  1EH7 A;  1GZ6 A;  4M2Z A;  2FTX B;  4M9V C;  4JI8 E;  2YZT A;  3M99 B;  2MKD A;  1PJS A;  1IBM E;  3TQM A;  2EOH A;  3IWC A;  2WCC 3;  4OOG C;  5FLX C;  4LTY A;  2EMF A;  2M4I A;  2YTI A;  2RPC A;  1IBK E;  4DV1 E;  4Q35 B;  1FJG E;  2RTX A;  2EM4 A;  4BCA A;  5LMN E;  3J7A G;  3LML A;  3IWB A;  3HXL A;  2EPO A;  2RSI A;  1DQ3 A;  1GTK A;  1PJQ A;  4K0K E;  2EM2 A;  4DUY E;  3VHT B;  2GPI A;  2LTS A;  1ZU1 A;  4F9C B;  1XNQ E;  2NA2 A;  2EQ3 A;  5IT9 C;  2EM3 A;  1YUI A;  2EN1 A;  3F6G A;  4FK5 C;  4WSG A;  3DF6 A;  1RMD A;  3ECR A;  4DKK A;  4WSP A;  2NUG A;  1DI2 A;  2VRD A;  5DNY A;  1WXR A;  4DR3 E;  4LU9 A;  2EZ6 A;  1QU6 A;  2EMC A;  4R8O A;  2ODR C;  5KL5 A;  4NZV A;  2L92 A;  4GKK E;  2EPU A;  2EOE A;  1NEI A;  1YYO A;  2V87 A;  2RS7 A;  1F2I G;  4JI1 E;  2YRK A;  2JY9 A;  2YTJ A;  1NCS A;  4JI4 E;  5BR8 E;  1HNW E;  4BC7 A;  2E72 A;  2EOY A;  4HTG A;  3BF2 A;  3F6H A;  4F6M A;  2YT4 A;  2EMG A;  1A1K A;  4LF5 E;  2ZM6 E;  2EM9 A;  3ADL A;  2JR1 A;  1QNT A;  4JI6 E;  3EPJ A;  1SFE A;  4R2Q A;  1N32 E;  4ZYG A;  2EL6 A;  4KZS A;  2NAB A;  4MLV A;  5A6B A;  1XMO E;  2FV4 B;  2YTN A;  4ZYH A;  2EML A;  4IS1 C;  2L3J A;  2DMY A;  2YTE A;  4WPY A;  4BMJ A;  2V8Q B;  2M9A A;  4BHC A;  4TUG A;  2JXP A;  3HTX A;  2JOB A;  4JYA E;  2EPX A;  1XNR E;  2LV2 A;  2UXD E;  2UXC E;  2UUC E;  1WJP A;  4OX9 E;  5AE2 A;  3C4T A;  4WFT A;  5KL7 A;  3EPL A;  2UU9 E;  4F54 A;  3T1Y E;  4M0V A;  3HQ1 A;  4O5G A;  2UUA E;  2DLK A;  2HJJ A;  2YTO A;  5KL4 A;  3J80 C;  3HPZ A;  4BC9 A;  2EMY A;  1AH5 A;  5A6K A;  3KZY A;  5AAS A;  2ENC A;  1ZAA C;  4RH8 A;  4BBY A;  2DRP A;  2EPP A;  1X6H A;  2D9H A;  3AV0 A;  2LMZ A;  3QG5 C;  3ADJ A;  4DV2 E;  1YUJ A;  4JI3 E;  3EPH A;  2EMX A;  1T4O A;  1YSA C;  4X62 E;  3J7Y p;  1I94 E;  2EPN A;  1RC7 A;  2DLQ A;  2LRS A;  2YWQ A;  1T38 A;  2FGG A;  1J26 A;  2B7T A;  3RMP A;  2EN7 A;  2ADR A;  1PJT A;  5A2Q C;  2J7J A;  2BBG A;  3MSW A;  1X47 A;  1IBL E;  1EH8 A;  2RSM A;  2EN6 A;  2EPZ A;  2KHX A;  4KWY A;  2EL5 A;  3H09 A;  4X8W A;  2MDR A;  3EPK A;  1LLM C;  3KWR A;  2WBU A;  2EOF A;  4LF9 E;  2V88 A;  1ZBT A;  1N36 E;  1TF3 A;  2EOX A;  2ELY A;  1YPN A;  2F8B A;  2ODR D;  3VYY A;  4IJD A;  1ZR9 A;  2ENA A;  2EOS A;  3FIG A;  2EMZ A;  2MC6 A;  1PDA A;  2DB2 A;  2V89 A;  1SR9 A;  2EPC A;  2EMB A;  4DR1 E;  2VF1 A;  2EN3 A;  2JWO A;  2PRT A;  2EPM X;  2LJH A;  3LLH A;  1WHQ A;  4LF6 E;  1IQO A;  4WX9 A;  4B3T E;  2JVA A;  2R1F A;  2JOX A;  5A69 A;  5LLQ A;  3UK3 C;  4B3R E;  1YFH A;  5KL6 A;  4R2S A;  4RHB B;  2HHH E;  4M30 A;  2LT7 A;  4MLQ A;  4JI7 E;  2RQL A;  2MDG A;  1Z1B A;  1X49 A;  2EOI A;  4GEQ B;  2I9I A;  3AUZ A;  3JU0 A;  2N3H A;  4LFC E;  1GQE A;  2V85 A;  1A1J A;  4LF4 E;  2EQ0 A;  1UN6 B;  2YSO A;  1T4N A;  3THO B;  2CTD A;  4O4K A;  2YPN A;  3OTO E;  1HNZ E;  2ENH A;  4NHR A;  1YYW A;  3K6Q A;  4B3M E;  1IMU A;  3KZZ A;  3C6K A;  2NUE A;  2WBT A;  5A6B D;  1RQ0 A;  2LBS B;  1UIL A;  2N8X A;  2BB8 A;  2DIX A;  5KL3 A;  3JTZ A;  2KOU A;  2V83 A;  1PKP A;  2B3T B;  1G2F C;  1G2D C;  1X48 A;  4F9A B;  4R2P A;  2CSH A;  4N4R B;  1YZ9 A;  1AAY A;  4KHP E;  2EN8 A;  2EMA A;  4JV5 E;  2B7V A;  1IQS A;  2DGC A;  1N3G A;  2EMW A;  2YTF A;  2VQF E;  3C6M A;  3VYX A;  2V86 A;  2EPL X;  4B3S E;  2GLI A;  4AQY E;  4JI5 E;  5LMU E;  2Q8U A;  2R76 A;  3MHH C;  2EMH A;  1A1F A;  3BGH A;  3T1H E;  1N33 E;  2GHF A;  2L2N A;  4X9J A;  4JI0 E;  4NXN E;  5AE1 A;  2EJ4 A;  1KYQ A;  4X64 E;  1JK2 A;  4R2D A;  2EM6 A;  4R2C A;  3J81 C;  2E5L E;  4R2E A;  3ZOQ B;  4YHH E;  3THN A;  5CFF E;  1JK1 A;  2N3G A;  3EQ1 A;  1HR0 E;  2YRH A;  2EOO A;  1J5E E;  2EM7 A;  4DR6 E;  5IV8 B;  1STU A;  1O0W A;  1A1L A;  4Q28 A;  4I8O A;  1KJK A;  2I13 A;  4DV0 E;  2H36 X;  4YY3 E; 
#chains in the Genus database with same CATH homology
 4DV4 E;  1XMO E;  1YYK A;  2F4V E;  2FV4 B;  4DUZ E;  3VK6 A;  2VQE E;  2L3J A;  4LFA E;  4B3R E;  2DMY A;  4LFB E;  4WPY A;  4BMJ A;  1EKZ A;  1GZ6 A;  2HHH E;  4M2Z A;  4M30 A;  2FTX B;  4JI8 E;  2V8Q B;  4J8Z A;  2YZT A;  4JI7 E;  4TUG A;  1T4L B;  2E1M A;  3HTX A;  2JOB A;  4JYA E;  1XNR E;  1IBM E;  2UXD E;  4L5N C;  1X49 A;  4GEQ B;  2LTR A;  2UXC E;  4DV0 E;  2UUC E;  3AUZ A;  4OX9 E;  5AE2 A;  3C4T A;  3IWC A;  2IHR 1;  4DV3 E;  4WFT A;  3JU0 A;  2L6M A;  2N3H A;  4OOG C;  5FLX C;  2LUQ A;  1GQE A;  1ZBQ A;  2V85 A;  2UU9 E;  4LTY A;  4F54 A;  4LFC E;  2M4I A;  2L3C A;  3T1Y E;  3ADG A;  1IBK E;  4DV1 E;  4M0V A;  3HQ1 A;  4LF4 E;  4DR7 E;  4F9B B;  1FJG E;  2RTX A;  4BCA A;  5LMN E;  2UUA E;  3HPS A;  3J7A G;  2VE7 C;  3LML A;  3IWB A;  3HXL A;  1T4N A;  2DSY A;  5LL6 R;  2H36 X;  3J80 C;  4DV7 E;  3HPZ A;  4BC9 A;  1DQ3 A;  4DV6 E;  4K0K E;  3OTO E;  4BS9 A;  4DUY E;  2L2M A;  1HNZ E;  4X65 E;  4DR4 E;  2KON A;  1HNX E;  3JAM C;  2LTS A;  5AAS A;  1YYW A;  3K6Q A;  3P1X A;  4B3M E;  2L8T A;  4F9C B;  4BBY A;  1XNQ E;  2NA2 A;  4JI2 E;  2NUE A;  4GKJ E;  1RQ0 A;  3AV0 A;  2LBS B;  1UIL A;  2LMZ A;  3ADJ A;  4DV2 E;  4JI3 E;  5IT9 C;  2DIX A;  1T4O A;  3JTZ A;  2KOU A;  4X62 E;  3J7Y p;  2V83 A;  1PKP A;  2B3T B;  2G7H A;  3C4B A;  1I94 E;  3F6G A;  3ADI A;  1RC7 A;  1X48 A;  3DF6 A;  4F9A B;  1YZ9 A;  2LRS A;  4DKK A;  4KHP E;  4WSP A;  2FGG A;  2M7Q A;  2LE2 A;  1J26 A;  2B7T A;  5AE3 A;  2L2K B;  3RMP A;  1FKA E;  2NUG A;  4JV5 E;  5A2Q C;  1DI2 A;  2B7V A;  5DNY A;  1WXR A;  4DR3 E;  4LU9 A;  4NXM E;  2EZ6 A;  1QU6 A;  2UXB E;  3MSW A;  2VQF E;  1X47 A;  1IBL E;  2RSM A;  3VYX A;  2L33 A;  4R8O A;  2ODR C;  2V86 A;  2KHX A;  4DV5 E;  4B3S E;  3H09 A;  2L92 A;  5T6J A;  4AQY E;  4GKK E;  4JI5 E;  5LMU E;  1YYO A;  2V87 A;  4X8W A;  2MDR A;  3DJW A;  3KWR A;  2CPN A;  2RS7 A;  4TUI A;  4LF9 E;  4JI1 E;  2V88 A;  1ZBT A;  5ADZ A;  4P78 A;  1N36 E;  2JY9 A;  2B9D A;  4LF7 E;  3T1H E;  4JI4 E;  1N33 E;  5BR8 E;  2RS6 A;  2L2N A;  4JI0 E;  2M1S A;  4NXN E;  1HNW E;  4BC7 A;  5AE1 A;  2F8B A;  2ODR D;  2UUB E;  4X64 E;  4R03 A;  3VYY A;  2LUP B;  3F6H A;  3FIG A;  2YT4 A;  4P7D A;  2MC6 A;  4WYQ B;  4DMI A;  1UHZ A;  1XMQ E;  1N34 E;  3J81 C;  3IWD A;  2E5L E;  1WHN A;  3ZOQ B;  2MC5 A;  3OML A;  5IWA E;  4YHH E;  4DR5 E;  2DB2 A;  2V89 A;  1SR9 A;  5CFF E;  2ZM6 E;  4LF5 E;  4LF8 E;  4L8N A;  4DR1 E;  3ADL A;  2JR1 A;  2N3G A;  1HR0 E;  2VF1 A;  2JWO A;  1J5E E;  4JI6 E;  2K4V A;  4DR6 E;  1N32 E;  1STU A;  1O0W A;  2LJH A;  3LLH A;  4Q28 A;  4I8O A;  1WHQ A;  2NUF A;  4LF6 E;  5F3W A;  2EWL A;  2WZO A;  4B3T E;  4KZS A;  4DR2 E;  2JVA A;  4X66 E;  2JOX A;  4YY3 E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...