2H3GX

Structure of the type iii pantothenate kinase (coax) from bacillus anthracis
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
254
structure length
247
Chain Sequence
MIFVLDVGNTNAVLGVFEEGELRQHWRMETDRHKTEDEYGMLVKQLLEHEGLSFEDVKGIIVSSVVPPIMFALERMCEKYFKIKPLVVGPGIKTGLNIKYENPREVGADRIVNAVAGIHLYGSPLIIVDFGTATTYCYINEEKHYMGGVITPGIMISAEALYSIEITKPSSVVGKNTVSAMQSGILYGYVGQVEGIVKRMKEEAKQEPKVIATGGLAKLISEESNVIDVVDPFLTLKGLYMLYERNA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords BIOSYNTHETIC PROTEIN
publication title Structure of the Type III Pantothenate Kinase from Bacillus anthracis at 2.0 A Resolution: Implications for Coenzyme A-Dependent Redox Biology.
pubmed doi rcsb
source organism Bacillus anthracis str.
molecule tags Biosynthetic protein
total genus 74
structure length 247
sequence length 254
ec nomenclature ec 2.7.1.33: Pantothenate kinase.
pdb deposition date 2006-05-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
X PF03309 Pan_kinase Type III pantothenate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.40 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 2h3gX02
3.30.420.40 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 2h3gX01
1NGDA 4FWSA 4GY2B 3UKUB 1ESVA 4I6MB 1SZ2A 1U6ZA 3ZETB 3L4IA 4H0OA 3VGLA 5ADXA 3QDKA 3HM8A 5EY4A 5AQVA 5AZIA 2D4WA 4CD3A 1XQSC 1OKJA 5E26A 3AAQA 1WOQA 3DWLA 4BRNA 3FZKA 4CZKA 3GE1A 4CBWA 3W0LA 4K41A 3LDNA 5AQIA 3AAPA 3CIPA 1HJOA 1QZ6A 4BG8A 3RSEA 5ADXH 4PL8A 4BQZA 2AP1A 2W40A 1GLJO 2FF3B 2GWJA 4XH5A 3VEWA 4F9OA 2EWSA 4BGBA 1NGGA 3DXKA 2I7NA 4BRLA 1R59O 2ZWHA 4H0XB 5AQJA 5F2RA 2V52B 5BN9A 3VEVA 3GBTA 4B1ZA 3O6WA 1E4GT 4H0TB 1MWKA 3GL1A 4EAHD 2IVOA 1GLEG 1MA9B 4WQ5A 4CJ7A 1RFQA 4IJNA 1BU6O 1SQKA 4WQ4A 1NGCA 2P9SA 5KQ8A 3A0IX 4JHDA 4FPAA 3AARA 4LC9B 3ATUA 2FSNA 4I6MA 1ATSA 4FWRA 2VYPA 5AQRA 2F9WA 4CBUA 4YDUA 4BR4A 3EN9A 3WQUA 4BROA 1NMDA 3D2FA 2QWRA 5AQPA 3CJ7A 5FPMA 5JMVA 4WQ5C 2A42A 5AR0A 5AQXA 4WQ4C 4EHUA 1IJJA 3F9MA 3D2EB 3IFRA 4CZEA 1MWMA 3U4LA 5I9EB 1U2VB 5TKYA 4BRGA 3A5OC 5KPRA 1X9JA 4YDUC 4H5NA 3UE5A 1GLDG 1BUPA 4CZFA 2CGJA 2Q97A 1HX1A 2HMPA 3FGUA 1KXPA 3CJCA 3FZLA 3C7NA 3BEXA 1BG3A 1QZ5A 2YHYA 2IIRA 5E84A 2FF6A 1EQYA 3DXMA 1DEJA 5AZJB 2ASMA 4EHTA 3H3NO 4EIAA 4FL9A 1V4SA 1TUUA 3VESA 3SMPA 3VEYA 4BVOA 2E2NA 3FZMA 4XH4A 5FPNA 2PAVA 2OANA 3JXUA 2W41A 4CZIA 2I7PA 1HKBA 1IG8A 3M6GA 5ELZA 4BRAA 1K8KB 4B9QA 4ISFA 1NGIA 3WEEA 2V7ZA 4K25A 1LOTB 5AQZA 4FO0A 5AQHA 1BDGA 4JD2A 3FFKB 3WXKA 5BRHA 1QQNA 4GNIA 2GEMA 1TYQB 4XEIA 3UB5A 2F9TA 3MCPA 4BVPA 3CETA 2P9PB 2E20A 4FSVA 4FPBA 1X3NA 3VEOA 3CHWA 2Q36A 5BPNA 3VEZA 2UYTA 1BWFO 2HF4A 3IUCA 3ATVA 5AQFA 3WXJA 4BRFA 1T6CA 3ZX2A 3VF6A 1GLLO 1HKGA 2DPNA 3LM9A 5AQTA 3ULEA 1KAZA 5AZJA 1DGKN 1KAYA 2PBDA 3WXIA 3C0BA 5AQOA 3KHYA 5EXWA 1X3MA 3WT0A 4BC2A 1BO5O 4BC5A 3O1WA 2FXUA 3O8MA 3CJBA 2CH5A 2V7YA 3HSCA 3FE1A 2ITMA 2A3ZA 2FSJA 4CZMA 4CZLA 2P9KB 1Z05A 3A5MC 1MDUB 1XC3A 4BC4A 2YJFA 3W3DA 3OHRA 2P9UB 1GLCG 2QWLA 4CZGA 1ZXOA 3BF1A 3QMLA 1NBWA 2FLOA 4H0VB 2A41A 4RWTA 2H3GX 2IVPA 2QWMA 4DQ8A 3MDQA 3G25A 4ISEA 2YI1A 2ZGZA 1XUPO 4NO7A 2E8AA 1SAZA 4EFHA 4JAXA 4XH1A 2CH6A 2J4RA 2Q2RA 1T6DA 3UKUA 3ZX0A 1BA0A 4PKGA 3VENA 3ZETA 1QQMA 2A40A 2Q0UA 3EZWA 1NGHA 3O80A 2E1ZA 4DHYA 3FZHA 3CERA 1HUXA 4BRCA 5EX5A 4MLHA 3L6QA 3GG4A 4WYBA 2E2OA 2E2PA 3A8YA 3CI5A 4BR0A 2HOEA 2KHOA 3IDHA 4ISGA 3SLCA 4BRIA 3O4WA 5AQSA 3VGMA 3IMXA 4CZHA 1TUYA 3EKSA 5BN8A 1S22A 2D0PA 5BPMA 2HF3A 2D0OA 2P9UA 3KZBA 5AQKA 1QQOA 5AQLA 4CI6A 3MK6A 2P9NB 3LL3A 3QBWA 5EVZA 3DJCA 3VGKA 5BREA 2BUPA 3QB0A 1YUWA 4H03B 5JLHA 1NGEA 3H46O 1NGAA 4M7YA 4JN4A 4DCHA 3H1QA 3CQYA 1RDWX 5LJVA 4IZ9A 1GLAG 3HBTA 1T44A 1HKCA 3EO3A 3MN6A 2NLXA 3LDQA 2YCHA 3VF2A 1DKGD 2QM1A 4B1WB 4FWPA 3VERA 4BR7A 1D4XA 3A5NC 4MO5A 3H1VX 5KPTA 4BRHA 5AZIB 4HTLA 3ZEUB 3H3OB 4PL7A 4JNEA 3D2EA 3CJAA 5AQQA 3VETA 2P9LB 1U2VA 4Y0WA 4FWMA 1NGJA 2A5XA 3O08A 3UKRB 4RCHA 4FWOA 3WQTA 1YXQA 2P9NA 4RTFD 3RSEB 3TPQA 4B1UB 5F0XA 4H0YB 3QICA 4IXCA 3U8XA 2Q31A 1ATNA 3DXKB 4B1XB 1J6ZA 3J8AA 3ID8A 3CJ9A 4J8FA 1Q18A 4Z94A 5BR9A 2FSKA 4H5WA 3CJ1A 4IJAA 2E1YA 3FZFA 3TU5A 3U9ZA 4BGAA 5AQYA 5KPZA 4KBOA 2CGKA 3DAWA 1HLUA 4A2BA 2GWKA 5AFUA 1KAXA 3O1BA 1K8KA 1ZBSA 3MN5A 2AA4A 4FWQA 3ZX3A 4B1VA 5FPEA 2QWNA 2YJEA 3S41A 3EL2A 3WUHA 3LM2A 2QWPA 4IO8A 4C23A 2VWBA 3VF4A 3D2FB 5KQDA 3I33A 4H5VA 3BUZB 5LJWA 1GLFO 4QS7A 3ZEUA 1TYQA 1JCFA 3ENOA 4FWNA 2NZTA 1E4FT 1RGIA 4O8KA 2P9PA 2P9LA 3L0QA 5BRDA 5BPLA 4BG9A 5AFUH 2Q0RA 3UKRA 5JICA 1ATRA 1S3XA 2ASPA 3SK3A 1LCUA 4BRMA 4L3QA 5AQNA 3MN7A 2GUPA 3R6MA 3MN9A 3KVGA 2QW9A 1JCGA 2CGLA 4FWKA 3LDPA 1NGBA 1NM1A 3B8AX 2Q1NA 3C7NB 1BA1A 1HPMA 4AM7A 3DXMB 3H45C 3VPZA 1Z6RA 5CE3A 1V4TA 4BR9A 1ZC6A 2V51B 2QXLA 3A5LC 4PKIA 4CZJA 2E88A 1H1VA 4QS8A 1NLVA 4FWLA 5BRFA 1YVNA 2GELA 3LDOA 3U9DA 4MO4A 3ENHA 3O5BA 4H5TA 4HWIA 4A62A 1GLBG 3GOIA 1CZAN 2E2QA 2P9KA 5AQGA 2WUSA 2IVNA 4BQLA 4IWVA 5AQUA 4AM6A 4BR5A 1BOTO 3SMSA 4CD1A 4CBXA 4K43A 1WUAA 3WEEB 4BRKA 5LY3A 4PKHA 4MLEA 4BREA 1YAGA 2VCPA 4JD2B 4M7XA 5EOYA 4QS9A 3FR0A 4O5FA 2YHXA 1NGFA 3R8EA 3FLCO 2ASOA 2P9IB 1G99A 4M63C 1C0GA 3EKUA 5AQWA 3QBXA 3MMVA 2A6AA 4A61A 4K42A 3QFUA 4FOEA 2ZF5O 3H6EA 1NWKA 3VOVA 4E1JA 5B8HA 3JS6A 1C0FA 4BR2A 3M3ZA 3ULEB 3M1FA 5AQMA 3WXLA 4H5RA 4A2AA 3GDQA 2BTFA 1QHAA 5FPDA 1JCEA 4NB4A 5F1XA 3P4IA 3HTVA 5JLFA 2ZGYA 3I8BA 2QWOA 3CQXA 4BRQA 1P8ZA 3LDLA 4BC3A 1Y64A 3BF3A 3AY9A 2YHWA 2QWQA 4H0PA 4DB3A 4B1YB 4BRDA 2D1KA 3HI0A 4FOIA 3VEXA 2GTDA 2P9IA 4BRPA 3R9PA 3BP8A 3QFPA 3SJHA 3D7EO 2P9SB 3HZ6A 2NRHA 4JHDB
chains in the Genus database with same CATH superfamily
5DK5A 1ESVA 3JAMO 3VQ8A 2XY5A 3QLHA 4ELTA 3MX2A 1CXUA 2GBZA 4E3SA 1TKTA 3PLAA 4CD3A 4DTJA 5K14A 3LAMA 2HBKA 2B6AA 4BWJA 3SUQA 5SZTA 3L3VA 4FW2A 1TAUA 4JKAA 1BI4A 3T69A 2ZJQL 4CJSA 4F3TA 4B3MK 4FLTA 3KWIA 1GLJO 4IOCL 4F9OA 4A5AA 3DXKA 4CJKA 1OH8A 1R59O 2ZWHA 1ZYQA 4BDPA 4H0XB 5AQJA 3P5JA 5F2RA 3V81A 1QSYA 1E4GT 2OZMA 4H0TB 3HOTA 4EAHD 4JI1K 4QAGA 3HPHA 4J2EA 1BU6O 1SQKA 4WQ4A 3TAMA 3L2RA 2P9SA 4DSIA 2KTQA 3ZT1A 3CG7A 4FPAA 3ATUA 2FSNA 4KV8A 4NCBA 4E7JA 2WOMA 1C0TA 4BR4A 3MXMA 3DLBA 3MEGA 1Q7YO 1J5OA 3CCVN 4M3YA 4CHYA 1NKBA 1YJ9N 2QWRA 4FJ7A 3BZCA 3CJ7A 3VA0A 3QNNA 5AR0A 5AQXA 3VQBA 3ZSRA 4EHUA 1Q82O 5HRPA 3LDSA 4CCHA 3CC7N 1IJJA 3K58A 4CZEA 1WLJA 1MWMA 2YHAA 3HPOA 2KZZA 4JKFA 3U4LA 1U2VB 4BRGA 3A5OC 3MWPA 3HSTB 5CYQA 1GOAA 3E66A 1GLDG 4C1NK 1WB9A 4OX9K 4CZFA 2CGJA 1U47A 3NF6A 4G1QA 3SBTA 3BEXA 1BG3A 1QZ5A 3E9OA 2IIRA 5E84A 2UUBK 2FF6A 1DEJA 1NK8A 2ASMA 4EHTA 4KRFA 4B9TA 2FC0A 4BVOA 4Z4GA 3FZMA 2ETJA 3CFPA 3CPEA 3JXUA 4A57A 2I7PA 1IG8A 4B9QA 2HHTA 3DRSA 4LH5A 1VSFA 4J2BA 4B9NA 4K25A 4FO0A 1KFSA 4B9LA 3MCAB 4JD2A 3HXMA 5C2FA 2GEMA 3P31A 5C25A 4DFKA 1TYQB 4XEIA 3TSQA 3CCJN 4FSVA 2F8TA 1RT7A 2ZQBA 4JI7K 2NRRA 5BPNA 2UYTA 2FBTA 1C0MA 3CCSN 1JL2A 3L2UA 3ZX2A 3VF6A 4DUYK 3LM9A 3S3MA 1DGKN 1KAYA 3WXIA 4KFBA 1S1TA 4DQQA 4DFJA 5AQOA 1W9HA 3KHYA 1IKXA 5EXWA 3OTOK 1X3MA 2BH1A 3WT0A 4BC2A 4FZZA 3SAHA 1M1KO 4CECA 2CH5A 3HSCA 4JI5K 1XMQK 1HNWK 2PFUA 5HRSA 1KSPA 1BGXT 1Z05A 3A5MC 1MDUB 3OYFA 1ZBUA 2P9UB 4DSFA 4ZTJA 4AHVA 1NBWA 4H0VB 4CJLA 2H3GX 1L3SA 4FLVA 2NUBA 2YNIA 4ISEA 4FM2A 3V9WA 2ZGZA 1NG9A 4KPYA 1RDCA 1O13A 5HRRA 4Q5VA 4WE1A 4DFMA 3HL8A 3OVNA 4XH1A 1T6DA 3K57A 2QI2A 3O3HA 4KHPK 2D0AA 4ID5A 1QQMA 2Q0UA 4CHQA 3SV4A 1S72N 2O8DB 2JWKA 3OYDA 2ZJPL 4DR5K 4NYNA 4KTZA 4MLHA 3L6QA 5EX5A 3P83D 4DUZK 4O44A 3CCUN 5T7BA 5CZ1A 4CE9A 3A8YA 2ZD1A 3OW2M 3CI5A 3CPWM 1VSMA 2KHOA 5LMNK 4BRIA 4ISGA 1ZBFA 1DLOA 3O4WA 5AQSA 4CZHA 3IMXA 4FJ5A 2ZM6K 1S22A 3CQ8A 2D0OA 2P9UA 1WSEA 5AQKA 2B4JA 1QQOA 3MK6A 4E7IA 3WNGA 4CESA 1YUWA 4IFYA 4H03B 4LFCK 4AILC 3E01A 3H46O 3MECA 1WSIA 2HHUA 4OPHA 1NGAA 4M7YA 4Q0BA 3THWA 4JI0K 1KFDA 2QEXN 5GADP 1Q8IA 3R3LA 5LJVA 4B3OA 1W2BM 2HVHA 3C95A 4E0DA 3LDQA 2YCHA 1EP4A 2QM1A 2JWLA 2QXFA 4CERA 1D4XA 4WFNL 4BE0A 3PIPL 4HUGA 3H1VX 3K2PA 5KPTA 4BRHA 2A1RA 3V9XA 1L5UA 4FLZA 4HTLA 3J81O 3H3OB 4JNEA 4CEBA 4KHNA 1S5JA 3SQ1A 4CIFA 4FWOA 3LWLA 3EE8A 4DF8A 1I39A 1RT6A 3LP1A 3J8AA 4LSNA 5M1FA 4FJGA 3ID8A 4MFBA 4IBNA 2FSKA 4WCEL 3CCEN 2E1YA 1YJWN 3U9ZA 5M1NA 1WBDA 4A2BA 4LFBK 3KIOA 3MN5A 1A5VA 4FWQA 4DR3K 2QWNA 2Z1JA 1TGOA 4LF9K 4LFAK 1WSFA 5C42A 3QINA 4HCCA 2VWBA 3D2FB 5LJWA 3I33A 3BUZB 4QS7A 2O8EB 5BRDA 1UA0A 5BPLA 1XHXA 4BG9A 4KH4A 1IKYA 4JLHA 4IFEA 1DTQA 1TV6A 2ASPA 3SK3A 3G6EN 3QNOA 3VQPA 4BRMA 4KB1A 5AQNA 3IS9A 4YOVA 5TKWA 4CK1A 1JCGA 3NGYA 2NRTA 2CGLA 1YVUA 2VQFK 3P1GA 4C8MA 3MEEA 1NGBA 3RMCA 1BA1A 4Z4CA 3AVNA 4W5QA 2NRWA 3KTQA 1IG9A 3VPZA 4ZHRA 3NVMA 5LMUK 5CE3A 4BR9A 2E88A 1H1VA 5JS1A 3VA3A 1YVNA 4DV3K 2YNHA 4H5TA 4A62A 1OVQA 1CZAN 4ILHA 3NBPA 2EHGA 2R7YA 4CJEA 4IWVA 3PX6A 2HVIA 2XY6A 4BREA 1YAGA 5C0YA 1LAWA 4M7XA 1S1WA 4QS9A 4CEFA 2P1JA 1NGFA 3R8EA 3FLCO 1VSHA 4M63C 4BACA 1C0GA 2B5JA 3HVTA 4X66K 3RMAA 2BGGA 3AGKA 4CFCA 2A6AA 4K42A 1TVRA 4IEIA 3QFUA 4FOEA 4RG8A 3T19A 3VOVA 5B8HA 4W5TA 3NCIA 4M3TA 3CCQN 3M1FA 5KTQA 1S6QA 5J2MA 1ZBIA 3SV3A 4A2AA 1GOCA 4CF2A 1QHAA 2X6NA 3T7ZA 4CIEA 2FBVA 3CQXA 1A5WA 1G15A 5I42A 4I7FA 4BC3A 1VSEA 3SI6A 2O8FA 4H0PA 4JS4A 4HCBA 4DB3A 4AH9A 4CGIA 3VEXA 4BRPA 3SJHA 4HUEA 2O8CB 4FWSA 4GY2B 3UKUB 4DTSA 3DRRA 1SKRA 1U6ZA 4Z0UA 4KO0A 4LH4A 3ASMA 4DQPA 4JKBA 4CEDA 4OJRA 3QDKA 4PHTX 1FKPA 3HM8A 4XIUA 2Y1JA 3RR8A 5AQVA 5AZIA 3OYMA 4DSJA 1RTDA 3VN5A 2PYLA 1WOQA 3DWLA 4BRNA 3O9UA 4F8RA 1BIUA 3CIPA 3C6HA 3RSEA 4B9SA 1JJ2M 5ADXH 4BQZA 2AP1A 4ICLA 1VQ4N 2EWSA 3THYB 4BRLA 2I7NA 4K8ZA 5CY4A 1F21A 3VEVA 5JVGL 1VRTA 5FRNA 4LD0A 3GBTA 4W5NA 4FK2A 4B1ZA 1VQ7N 1MWKA 3THXB 4DV4K 1GLEG 4CJ7A 4HHTA 3CYMA 3LP3A 1HYZA 1NGCA 3NF8A 5KQ8A 4KKOA 4CF9A 4LC9B 3AARA 3CFOA 5IT9O 3F9KA 1KTQA 3B6PA 4FWRA 5AQRA 1HNVA 2F9WA 2WFBA 2G8UA 4V19S 1QTMA 1NKEA 4RW9A 1XNRK 1NMDA 5AQPA 1BCOA 3WNEA 4FK0A 2W6LA 3VQDA 4WQ5C 1GOBA 1TKXA 3QEWA 3HT3A 3NGZA 2W42A 3KK1A 2DFHA 1YHQN 1FXXA 3D2EB 4C8OA 5J2PA 1FJGK 1J5EK 4MDBA 1X9JA 3MWTA 4E89A 4YDUC 4H5NA 5CHIA 1JLEA 2HMPA 4DQSA 3FGUA 3O9QA 1BCMA 3HK2A 2YHYA 4IO9L 1IBLK 1N6QA 4CJFA 2D0CA 1BISA 4I9LA 1JLFA 4W5OA 4I2QA 3CF5L 3F2KA 3HO1A 1B9DA 2E2NA 1RDBA 2PAVA 2OANA 4CZIA 3PX4A 4X65K 1XC9A 5GINA 1K8KB 1VSDA 4DTUA 1NGIA 3VQ9A 4Z4FA 3ZYYX 1LOTB 5AQZA 5FROA 3EYZA 1QSLA 5FRMA 3G71N 1SV5A 1HPZA 5AQHA 4DG1A 3OYKA 1XMOK 2F9TA 4OKJA 4YHHK 1U45A 2P9PB 2E20A 3AVAA 2Q36A 1IKVA 3IUCA 3WXJA 3ZSQA 1JLCA 4M42A 1GLLO 1NK9A 4RW6A 4CGGA 4FLXA 1KAZA 4BDYA 4KI6A 1RDDA 3EY1A 1RTHA 3QEVA 4KI4A 3KLFA 1TL3A 2RF2A 3AVJA 3ZSVA 2V7YA 3VTIA 2X74A 3ZSYA 1DT9A 3FE1A 2ITMA 4CGDA 1Q9XA 3V1OA 1DTTA 2E4LA 4TSXA 4CZLA 2P9KB 3BY5A 3OYAA 1K73O 1CZ9A 1XC3A 1C0UA 3OHRA 3SZ2A 2HW3A 1ZXOA 4H8KA 3VQAA 2Z1IA 2WTUA 1HNIA 4RWTA 4JKCA 4YOXA 3K0SA 4Z4HA 3MDQA 3G25A 2YI1A 4DLEA 3O3GA 2HHSA 1OH6A 1VQ5N 4EFHA 2CH6A 2J4RA 4CFBA 1JLQA 1JXEA 3D0PA 2QTDA 2G8FA 3J7YP 1X9SA 2A40A 5CZ2A 1NGHA 3O80A 2E1ZA 4CFDA 2RKIA 3K9KA 1LV5A 4J2DA 4H4MA 3SQ0A 4WYBA 1HQEA 4F2RA 1NJXA 3V1QA 4DFPA 4BR0A 3VGMA 4CF0A 2PYJA 1TUYA 2D0PA 2KLAA 3L4QA 5BPMA 4GKKK 2WC9A 4C8NA 1Y97A 3KKSA 5AQLA 4OO1J 3CFRA 5EVZA 4FVUA 3DJCA 5BREA 2BUPA 5CYMA 5JLHA 4B3RK 2F96A 1NGEA 1J54A 1Q86O 4M3XA 4DCHA 3VQCA 1K9MO 3H1QA 4DTNA 3CQYA 3K5OA 1IBKK 4DU1A 3TABA 1T44A 1HKCA 2DFFA 3VF2A 3TR8A 3AVHA 1D5AA 3EE9A 4BR7A 2UXBK 4RW7A 3AO4A 3PY8A 3QEPA 5J1EA 2P9LB 1U2VA 4Y0WA 1ASWA 1NGJA 4GV6A 3UKRB 3O08A 4YOUA 3WQTA 5C15A 3QICA 4YORA 4DTOA 5J2QA 3E1YA 3QIOA 4IXCA 4IG3A 4KHSA 3U8XA 2Q31A 4OLBA 3AVIA 4B1XB 4KHUA 1J6ZA 4FCYA 1RDUA 3K5MA 1VSIA 1YF5L 4E19A 1RBTA 1HQUA 4ILGB 4IJAA 2DY4A 3FZFA 4CJ5A 3C6UA 3K5LA 4CFAA 5KPZA 4KBOA 1KVCA 3TTDA 2CGKA 4C8KA 3CMAN 5AFUA 1D9FA 4NYFA 4OKKA 5FPEA 3QIPA 2I5JA 4Z4EA 4IG0A 3PV8A 3NF9A 3RVCA 1VQKN 4PA1A 4JI6K 5AJ3K 4AHRA 3PIOL 5HBMA 1TYQA 2NZTA 1RGIA 4CEOA 4O8KA 3UIQA 2P9LA 3L0QA 1Z26A 2PY5A 1YTAA 3UKRA 1RT3A 3LP0A 5C24A 2NRXA 1NK7A 3MN7A 2GUPA 3H08A 3KJVA 2QW9A 4AHCA 3LZJA 4IOAL 4WFAL 4RW4A 3C7NB 4AF1A 5KGXA 3CCRN 3TAPA 4PUOA 3DXMB 3E9PA 3PO5A 1Z6RA 3I55N 3OBWA 2V51B 1ITGA 3T1HK 4CJTA 3M8SA 2LSNA 3A5LC 4PKIA 1A5XA 4JKGB 5FDLA 3NHGA 4FWLA 3OYLA 5BRFA 3U9DA 4EP4A 1KCFA 4FJKA 3ENHA 2P5GA 4LF8K 5AQGA 3TSPA 2WUSA 2IVNA 3VQ7A 3L8BA 2HBJA 3SQ4A 4GW6A 4Z4IA 1BOTO 3WNFA 4CBXA 3O9RA 3WEEB 4DV6K 1YT3A 4DMNA 4MLEA 3E9LA 3BZKA 1S1VA 2ITGA 3OYNA 4OPAA 4DV0K 2VWJA 3KD1E 1IH7A 2YHXA 1SL2A 2BDPA 1VQ6N 4CJ4A 3CXCM 1L3TA 4DV2K 4KREA 1WAFA 2HHQA 3RMDA 3Q7CA 5AQWA 4YFUA 3QBXA 4JI3K 3AA2A 5CR4A 2KQ2A 2ZF5O 3BGRA 4E1JA 3RWUA 4IEEA 2IOCA 2O8DA 1UWBA 3L3UA 3ULEB 4CJRA 4LF4K 4CF8A 1XWLA 1VQ9N 2BTFA 3HM9A 4G9ZA 3NVKA 4R5PA 3QERA 5FPDA 2QWOA 4MQ3A 4BRQA 3MXIA 4E7LA 3SAGA 5HOOA 2OA8A 4LSLA 4BDZA 3ZT4A 3DLLL 4M3RA 4U67L 3TAQA 1Y64A 3RTVA 5KGWA 5HLFA 4B1YB 3LPUA 3K5NA 4DV5K 1CZBA 2D1KA 4GVEA 4FM1A 2OPRA 4FOIA 3CCMN 1YITN 3U6FA 2GTDA 4Y1CA 3LZIA 5I3UA 1J9AA 3QFPA 1EO1A 3KWGA 3D7EO 3HZ6A 2NRHA 4O5BA 1IKWA 1NGDA 1XI1A 4I6MB 1SZ2A 3RRHA 2KFNA 2HSTA 2UUAK 3ZETB 4NXNK 3VGLA 4PY5A 3TAEA 1OKJA 3OS1A 3MEDA 5E26A 4X64K 2X78A 4JS5A 3FZKA 4CZKA 3AVFA 3GE1A 4CBWA 4EZ6A 3NH1A 4K41A 1NNEA 3LDNA 1W0HA 3KD5E 4BG8A 2HHHK 2HNDA 4XH5A 1SUQA 3NAEA 4JRPA 4DU4A 1X9MA 4B9UA 1ZBHA 4BGBA 1NGGA 3TI0A 1YTUA 3C6TA 5BN9A 3HRGA 2OCEA 2Z1HA 2IVOA 1MA9B 4WQ5A 1RFQA 3SUPA 3A0IX 1R0AA 4I6MA 1KLNA 4CBUA 4DF4A 4YDUA 3EN9A 1LAVA 3WQUA 4BROA 4BE1A 3D2FA 4O8UA 4DWIA 5JMVA 1T3VA 4RW8A 4FJIA 2O8EA 3SUNA 2D5RA 1N36K 4CEQA 2O4IA 4KTWA 1SL0A 3DOLA 3LAKA 4A59A 5I9EB 4DR1K 2IC3A 3WNHA 5KPRA 3OS0A 1SL1A 2IS3A 4FJJA 4I2PA 5E41A 5DM7L 3O3FA 2WBNA 3AV9A 3OYGA 1HX1A 1YJNN 1KXPA 3CJCA 1KC8O 4CIGA 3FZLA 4DTPA 3O9SA 2YX6A 5AZJB 2XY7A 4JKHA 4A5BA 3H3NO 4FL9A 1V4SA 1TUUA 4FJXA 3SMPA 3VEYA 1RT4A 4ELVA 1VK0A 1HKBA 4KH5A 1VQMN 2HHXA 3CM5A 2YNGA 3ZCMA 1VQPN 3CMEN 4FJLA 1S9GA 3DLKA 2P51A 3V9SA 3WXKA 5BRHA 4GNIA 1EX4A 3D45A 1CXQA 3MX5A 3J7AP 3KLGA 3AVLA 3VEOA 1X3NA 2PZSA 4ZTFA 4AQYK 1WSGA 1QVFM 4H4OA 3F73A 2HF4A 1BQMA 3DLRA 3SCXA 4ELUA 3AO1A 3OBYA 5AQFA 3RR7A 5MLCQ 3IKMA 2BANA 1T6CA 3HP9A 1LW0A 3M8QA 3D6RA 5AQTA 5AZJA 3VQ6A 2PBDA 4FXDA 3C0BA 1KVBA 4IDKA 3SJJA 4FLYA 3N4QA 1NOZA 4Y1DA 2ATQA 2UXCK 3CJBA 5IWAK 3CM6A 1HNZK 2HNYA 2FSJA 4JK8A 4CZMA 1TKDA 3ZT2A 2NNWA 4DR2K 4BC4A 2DFEA 1GLCG 5GIPA 4CZGA 4EZ9A 3BF1A 4IDHA 5C10A 2FLOA 2A41A 3PSFA 2IVPA 4NLCA 2QWMA 4OGCA 3AA3A 4CEEA 4DTMA 1XUPO 4NO7A 4NLBA 2E8AA 1SAZA 4M3UA 4FYDA 1KLMA 5HROA 2YV0X 1QE1A 3DM2A 3O4NA 2W6KA 3ZT0A 2O8CA 3DI6A 1BIZA 3UKUA 5HL7L 4PKGA 3VENA 3I8DA 2HNZA 3EZWA 1KD1O 4CK3A 1J53A 1ZBLA 4DHYA 2OZSA 3FZHA 1NK4A 1YI2N 3SPZA 3V9ZA 2E2PA 3K59A 1E3MA 3O4QA 5JS2A 3SLCA 4JEPA 1S6PA 3EZ5A 5J2NA 4M3ZA 1VSKA 1RDAA 1EXQA 3HVRA 2HF3A 2RE2A 1U49A 3KZBA 1SKWA 2O8BB 4CI6A 2P9NB 3THYA 3LL3A 4CHZA 2G8HA 4E1MA 3CCLN 1D8YA 3VGKA 1CLQA 1RCHA 3OYIA 4MDAA 3THXA 1VQ8N 4JN4A 2HMIA 1EWQA 4IZ9A 1B92A 3ULDA 4FJNA 1SKSA 4FJ9A 5LL6Z 3RMBA 4KTQA 4OLAA 3DLEA 2KW4A 4B1WB 2KZMA 3AGRA 4MO5A 4DS4A 4IFVA 1W7AA 1FKOA 3D2EA 3CJAA 5AQQA 3VETA 3VQ4A 3ZT3A 1VQNN 4DV1K 4FWMA 2A5XA 4B8CA 4RCHA 4HVJA 1KRPA 1YXQA 2P9NA 4RTFD 5F0XA 5BR8K 4I9QA 1LWCA 2GX9A 3AA4A 3DXKB 4GV9A 1VHXA 3B6OA 3CJ9A 4J8FA 3OYCA 1Q18A 1HYVA 1UOCA 4H5WA 1Q81O 3TARA 4BGAA 1RTIA 5AQYA 5HP1A 3HPGA 2OPPA 1HLUA 2GWKA 4LF5K 3J7ZO 1KAXA 3O1BA 1K8KA 2OTJN 2AA4A 3ZX3A 4B1VA 3S41A 1JLBA 3WUHA 3LM2A 2QWPA 1RBRA 3VF4A 4KH6A 5M1KA 4PQUA 4H5VA 4DTXA 4YOWA 1GLFO 1L3UA 1JCFA 4FWNA 1E4FT 1NOYA 2P9PA 3AVCA 4GMJB 2VG7A 4JKDA 1MU2A 3DYAA 1ATRA 1S3XA 3J80O 4JV5K 1JXBA 3ZSOA 1LCUA 2Y1IA 2IDOA 1N34K 3R6MA 4CJVA 3MN9A 3KVGA 1K8AO 3VTHA 4FJHA 4NCAA 1X1PA 1VSJA 4FWKA 3B8AX 3H45C 5M1QA 2HBLA 3HOSA 3IRXA 1TK0A 3NGIA 1V4TA 3U3YA 1ZC6A 3PX0A 4FVMA 2QXLA 4CZJA 2RPIA 4DR7K 2G8KA 4QS8A 1NLVA 2GELA 4MO4A 3O5BA 4HWIA 3GOIA 2E2QA 2P9KA 4EP5A 5M1OA 3QEIA 4BQLA 2FBXA 2O4GA 3NDKA 4AM6A 4K43A 1WUAA 4FW1A 5GAGP 4JD2B 3SBGA 1I94K 1JLGA 3T1YK 4O5FA 3TSUA 1BQNA 1NK5A 4YOTA 4CEZA 3EKUA 4AHSA 4DS5A 3I0SA 4JI2K 3MMVA 2VQEK 1N33K 1RT5A 1RBVA 3H6EA 1NWKA 3I56N 3JS6A 1C0FA 3PUFA 3FFIA 4LF7K 4KHYA 3M5RA 3MXJA 3AVBA 3Q7BA 1JKHA 4J2AA 3WXLA 1NJZA 4H5RA 2QKKA 3GDQA 4F3OA 1C6VA 3SUOA 5F1XA 1W97L 2Q3SA 3P4IA 5JLFA 2OYQA 3C65A 2NRVA 2HBMA 3TAGA 3LANA 5GAEP 2UXDK 1N8RO 3HP6A 3NMUA 5C12A 4E7KA 1P8ZA 3LDLA 4AHTA 4R79A 1U48A 4C8LA 3BF3A 1T03A 1C1AA 2E6LA 3AY9A 3ENBA 2QWQA 1NJYA 3LALA 4KHWA 1VRUA 4JRQA 1IBMK 3HI0A 3AO3A 1OH5A 4B3SK 1O1WA 1OVYA 3R9PA 3BP8A 2WONA 3ZLJA 4DV7K 4CF1A 4JHDB 4CHPA 2ZE2A 2A1SA 1RBUA 5HRNA 1M90O 3L4IA 4H0OA 1ASUA 1U4BA 1K6YA 5ADXA 4HUFA 1TAQA 1WSJA 5EY4A 4GV3A 5M1PA 3NH0A 2YHBA 2D4WA 1XQSC 4FK4A 1TKZA 3AAQA 5C2DA 3W0LA 3HYFA 4JK9A 5AQIA 3AAPA 1HJOA 5GAHP 1QZ6A 4N5SA 5SWMA 2QA4N 4PL8A 2RHKA 2W40A 2FF3B 2GWJA 3VEWA 1UA1A 3DRPA 3S3NA 4BY9C 4FZYA 2V52B 4KB0A 1ASVA 3ALYA 3NH2A 3O6WA 5EU7A 4DTRA 3TANA 2X6SA 3GL1A 3G4SN 3I0RA 3THWB 4IJNA 2HHVA 4JHDA 3ITHA 2BE2A 1HR0K 2KKZA 2UUCK 3KLEA 4JI4K 1ATSA 1UAXA 2VYPA 3V6DA 4DLGA 4CHNA 2HHWA 1KQSM 3CC2N 1NMNA 5FPMA 2HB5A 4BE2A 3C94A 3AVMA 2A42A 1NJWA 1EWRA 4WQ4C 4CJWA 1OH7A 2XY8A 3F9MA 3IFRA 5TKYA 3UE5A 4JK7A 1BUPA 3N4PA 1C1BA 2Q97A 3AVGA 4NCGA 3P38A 1S1XA 3C7NA 3KLIA 1EQYA 3DXMA 3R1XA 4QCLA 1LWFA 4KAZA 2IAJA 1TK5A 1SS6A 4JKGA 4EIAA 4K8XA 1IO2A 3LWMA 3VESA 3EEQA 4XH4A 5FPNA 4ID1A 2W41A 3SPYA 3OJSA 3OYEA 3M6GA 4DQIA 5ELZA 4BRAA 3TTFA 4OKEA 4ISFA 1ILYA 2F4VK 1TL1A 3WEEA 2V7ZA 5D3GA 2XHBA 2D0BA 2Z1GA 1BDGA 1WNSA 3FFKB 4U7BA 1QQNA 5KI6A 1Z25A 5DM6L 3L2VA 3UB5A 3MCPA 4BVPA 4FJMA 2VWKA 4M41A 3CETA 1NK0A 4FPBA 2VGNA 3CHWA 4M45A 4N76A 3VEZA 4LF6K 2KFZA 1BWFO 3ATVA 3L2WA 4BRFA 3MAQA 1RTJA 3OS2A 1WAJA 1HKGA 1HNXK 2DPNA 3ULEA 3L2QA 4WFBL 4N56A 4BWMA 1JLAA 4OVLA 3QO9A 3VQEA 1QVGM 1Q9YA 1BO5O 4BC5A 4CHOA 3O1WA 2FXUA 3O8MA 2A3ZA 2YJFA 3W3DA 3VQQA 2QWLA 3ZSZA 4DR6K 4CGFA 3LPTA 3QMLA 4GVMA 1B9FA 2EX3A 1XNQK 3PO4A 4DQ8A 4YNQA 2GUIA 4E7HA 3TTCA 1I3AA 3QESA 3PSIA 5KRTA 4OPKA 4JAXA 2Q2RA 2QK9A 4ILJA 1QQCA 4NXMK 3AO2A 3ZX0A 1BA0A 4YOYA 3CD6N 4CJ3A 3ZETA 4FJ8A 2JLEA 3S9HA 1QS4A 1EKEA 4L8RB 1QHTA 3OYBA 3BDPA 3CERA 1HUXA 4BRCA 3GG4A 2E2OA 1WBBA 4DKWA 2HOEA 1NJIO 3IDHA 1NKCA 5KRSA 3SAFA 3EKSA 5BN8A 1FK9A 3TWHA 3T1AA 2G8VA 2GV9A 3NF7A 3JSMA 3M8PA 3TAFA 1QSSA 3KKRA 3T3FA 3P39A 4FLUA 2O8FB 3QBWA 2F7TA 4WF9L 1XHZA 3OJUA 1HMVA 3QB0A 3G10A 3OA9A 1RBSA 1VQLN 1HRHA 1JL1A 4DSEA 1RDWX 1IV0A 2YKMA 4GKJK 2YKNA 1GLAG 3HBTA 3EO3A 3MN6A 1N5YA 1BHLA 2NLXA 4N47A 4FZXC 3KK3A 3THVA 1DKGD 4OGEA 4O4GA 4FWPA 3VERA 1LWEA 2F8SA 5FLXO 4B08A 3A5NC 3M8RA 3S3OA 4O0IA 2JGUA 5AZIB 3ZEUB 1BL3A 4OPJA 4PL7A 3SNNA 1C1CA 2DTUA 2XRIA 2VG5A 3SYZA 1REVA 3F5TA 3DMJA 1RT1A 4CJUA 2NRZA 3RSEB 3TPQA 3ZSXA 3LP2A 4B1UB 4H0YB 4DSKA 1RILA 4CJPA 2OTLN 1ATNA 4IKFA 4DU3A 4Z94A 2XO7A 5BR9A 3SQ2A 5DMRA 3CJ1A 2RN2A 3TU5A 2VGMA 3ZSWA 5GIOA 5H1SQ 1P90A 3DAWA 3ISNC 4UQGA 1VQON 1NK6A 3IAYA 1ZBSA 3KK2A 3V4IA 4JYAK 2YJEA 1WN7A 1KVAA 3EL2A 4LY7A 4IO8A 2IGIA 3DLHA 4C23A 1EETA 3QEXA 1HYSA 5KQDA 3AA5X 3ZEUA 2YNFA 3ENOA 4FM0A 2P5OA 4B3TK 4C1NI 5AFUH 2Q0RA 4O0JA 5JICA 3OYHA 3NFAA 3OY9A 3O9TA 1X9WA 2ZJRL 3KK7A 4L3QA 4YY3K 1HJRA 3ID6A 3A2FA 4FLWA 3LDPA 4JKEA 1L3VA 1NM1A 2Q1NA 1HPMA 1T7PA 4AM7A 4B9VA 4F2SA 4HTUA 2QKBA 3LDOA 3OYJA 4JI8K 4B8AB 3WXMB 1U04A 3DLGA 1GLBG 4QOZB 4E1NA 5AQUA 4BR5A 3VMFB 3SMSA 4CD1A 4DR4K 4DSLA 4BRKA 2FBYA 4CW7B 1D9DA 5LY3A 2OPQA 4PKHA 2VCPA 4CJQA 4CK2A 5A2QO 1T8EA 1TK8A 5EOYA 4M3WA 3FR0A 4IOXA 4DQRA 4K0KK 1S9EA 3JYTA 2ASOA 2P9IB 1FW6A 1G99A 4N41A 1T05A 4CVNE 3AVKA 3V1RA 4A61A 4F4KA 3G0ZA 2VG6A 1VAZA 4B9MA 1N32K 4BR2A 2E5LK 4KHQA 3IG1A 3M3ZA 1YIJN 5AQMA 4CEAA 4O55A 2G8IA 4W5RA 4PWDA 3HJFA 3U3GA 3KLHA 2E6MA 3RRGA 2UU9K 3DOKA 1JCEA 4NB4A 3HTVA 4UY8O 2ZGYA 3I8BA 4AHUA 4CGJA 3C6AA 2O8BA 1BI4B 1RT2A 4X62K 3CC4N 3QETA 3AO5A 1WSHA 2YHWA 1LW2A 4BRDA 4CGHA 3NE6A 2OPSA 2G8WA 1S1UA 1RNHA 1VSLA 2P9IA 5JVHL 3K9JA 3VQ5A 3V9UA 2AJQA 1NU0A 2P9SB
chains in the Genus database with same CATH topology
1NGDA 4FWSA 4GY2B 3UKUB 1ESVA 4I6MB 1SZ2A 1U6ZA 1M90O 2HSTA 3ZETB 3L4IA 4JKBA 4H0OA 3VGLA 3MX2A 5ADXA 3QDKA 4PHTX 3HM8A 1VQ4N 5EY4A 4GV3A 5M1PA 3PLAA 5AQVA 5AZIA 2D4WA 4CD3A 1XQSC 1OKJA 5E26A 3AAQA 2HBKA 5C2DA 1WOQA 3DWLA 4BRNA 3FZKA 3O9UA 3GE1A 4CBWA 4CZKA 3W0LA 4JK9A 4K41A 3LDNA 4JKAA 5AQIA 3T69A 2ZJQL 3AAPA 3CIPA 1HJOA 5GAHP 1QZ6A 3C6HA 4BG8A 3RSEA 2QA4N 1JJ2M 5ADXH 4PL8A 3KWIA 2AP1A 2RHKA 1GLJO 2FF3B 2GWJA 2W40A 4XH5A 3VEWA 4BQZA 4F9OA 4IOCL 2EWSA 4BGBA 1NGGA 3DXKA 2I7NA 4A5AA 4BRLA 1R59O 2ZWHA 4H0XB 5AQJA 5F2RA 2V52B 5BN9A 3HRGA 3VEVA 5JVGL 4BY9C 3GBTA 4B1ZA 3O6WA 1E4GT 1VQ7N 4H0TB 3HOTA 1MWKA 3GL1A 4EAHD 2IVOA 3G4SN 1GLEG 1MA9B 4WQ5A 4CJ7A 1RFQA 4IJNA 1BU6O 1SQKA 4WQ4A 1NGCA 2P9SA 5KQ8A 3A0IX 4JHDA 4FPAA 3AARA 4LC9B 3ATUA 2FSNA 4I6MA 2KKZA 1ATSA 4FWRA 2VYPA 5AQRA 2F9WA 4CBUA 2WFBA 4YDUA 4BR4A 1Q7YO 3EN9A 3CCVN 3WQUA 4BROA 1KQSM 1NMDA 1YJ9N 3D2FA 2QWRA 3CC2N 4O8UA 5AQPA 3CJ7A 5FPMA 5JMVA 1T3VA 4WQ5C 2A42A 5AR0A 5AQXA 4WQ4C 4EHUA 1Q82O 1YHQN 3CC7N 1IJJA 3F9MA 3D2EB 3IFRA 4CZEA 1MWMA 4JKFA 3U4LA 4A59A 1U2VB 5TKYA 4MDBA 3A5OC 4BRGA 5I9EB 3MWPA 5KPRA 1X9JA 3MWTA 4YDUC 3E66A 4H5NA 3UE5A 1GLDG 4JK7A 1BUPA 3N4PA 4C1NK 5DM7L 2WBNA 4CZFA 2CGJA 2Q97A 1HX1A 5CHIA 1YJNN 2HMPA 3P38A 3FGUA 1KXPA 3CJCA 1KC8O 3O9QA 3FZLA 3SBTA 3O9SA 3C7NA 3BEXA 1BG3A 1QZ5A 2YHYA 2IIRA 3E9OA 2YX6A 5E84A 2FF6A 4IO9L 1EQYA 3DXMA 3R1XA 1DEJA 5AZJB 4JKHA 4A5BA 2ASMA 4EHTA 1SS6A 3H3NO 4JKGA 4EIAA 4FL9A 1V4SA 1TUUA 3CF5L 3VESA 3SMPA 3VEYA 3F2KA 4BVOA 2E2NA 3FZMA 4XH4A 5FPNA 2PAVA 2OANA 3CPEA 2W41A 3JXUA 4A57A 4CZIA 2I7PA 1HKBA 4KH5A 1IG8A 1VQMN 3M6GA 5ELZA 4BRAA 3TTFA 1VQPN 5GINA 1K8KB 4B9QA 3CMEN 4ISFA 1ILYA 1NGIA 3WEEA 2V7ZA 3ZYYX 4K25A 1LOTB 5AQZA 4FO0A 3G71N 5AQHA 1BDGA 3MCAB 3FFKB 4JD2A 3WXKA 1QQNA 4GNIA 5BRHA 4U7BA 5C2FA 2GEMA 3P31A 5DM6L 1TYQB 4XEIA 3UB5A 2F9TA 3MCPA 3MX5A 4BVPA 3TSQA 3CETA 3CCJN 2P9PB 2E20A 4FSVA 4FPBA 1X3NA 3VEOA 2VGNA 3CHWA 2Q36A 2NRRA 3VEZA 5BPNA 1QVFM 2UYTA 1BWFO 2HF4A 3IUCA 3ATVA 3OBYA 5AQFA 5MLCQ 3WXJA 3IKMA 3CCSN 4BRFA 1T6CA 3ZX2A 3VF6A 1GLLO 3D6RA 1HKGA 2DPNA 3LM9A 5AQTA 3ULEA 1KAZA 5AZJA 1DGKN 1KAYA 2PBDA 3WXIA 4WFBL 3C0BA 5AQOA 3KHYA 1QVGM 5EXWA 1X3MA 2BH1A 3N4QA 3WT0A 4BC2A 1BO5O 3SAHA 1M1KO 4BC5A 3O1WA 2FXUA 3O8MA 3CJBA 2CH5A 2V7YA 3VTIA 3HSCA 1DT9A 3FE1A 2ITMA 2A3ZA 2PFUA 2FSJA 4JK8A 4CZMA 4CZLA 2P9KB 1Z05A 3A5MC 1K73O 1MDUB 2NNWA 1XC3A 4BC4A 2YJFA 3W3DA 3OHRA 2P9UB 1GLCG 2QWLA 5GIPA 4CZGA 1ZXOA 3BF1A 4IDHA 3QMLA 1NBWA 5C10A 2FLOA 4H0VB 2A41A 4JKCA 4RWTA 2H3GX 4YOXA 2IVPA 4NLCA 2QWMA 4DQ8A 3MDQA 3G25A 4ISEA 2YI1A 2ZGZA 3TTCA 1XUPO 4NO7A 4NLBA 2E8AA 1SAZA 1VQ5N 1O13A 4EFHA 4JAXA 4XH1A 2CH6A 2J4RA 2Q2RA 4ILJA 1T6DA 2QI2A 3UKUA 3ZX0A 1BA0A 2QTDA 5HL7L 4YOYA 4PKGA 3VENA 3CD6N 3ZETA 1QQMA 2A40A 2Q0UA 3EZWA 1NGHA 3O80A 1KD1O 2E1ZA 1S72N 4DHYA 2JWKA 3FZHA 3K9KA 3CERA 1HUXA 4BRCA 2ZJPL 1YI2N 5EX5A 4MLHA 3L6QA 3GG4A 4WYBA 2E2OA 2E2PA 3CCUN 3OW2M 3A8YA 4DKWA 3CI5A 3CPWM 4BR0A 2HOEA 2KHOA 1NJIO 3IDHA 4ISGA 4JEPA 3SLCA 4BRIA 3O4WA 5AQSA 3VGMA 3IMXA 4CZHA 1TUYA 3EKSA 5BN8A 1S22A 2D0PA 3SAFA 2KLAA 3L4QA 5BPMA 2HF3A 2D0OA 2RE2A 2P9UA 3KZBA 5AQKA 2WC9A 1QQOA 5AQLA 4CI6A 4OO1J 3MK6A 3P39A 2P9NB 3LL3A 3QBWA 5EVZA 3DJCA 2F7TA 4FVUA 3CCLN 4WF9L 3VGKA 5BREA 2BUPA 3QB0A 1YUWA 4H03B 5JLHA 1NGEA 3OA9A 4MDAA 3H46O 1VQLN 4OPHA 1Q86O 1NGAA 4M7YA 1VQ8N 4JN4A 4DCHA 1K9MO 3H1QA 3CQYA 2QEXN 5GADP 1RDWX 3R3LA 5LJVA 4IZ9A 1GLAG 3HBTA 1W2BM 1T44A 1HKCA 3EO3A 3MN6A 2NLXA 3LDQA 2YCHA 3VF2A 3EE9A 1DKGD 2QM1A 2JWLA 4B1WB 4FWPA 3VERA 4BR7A 1D4XA 3A5NC 4WFNL 3AGRA 4MO5A 3PIPL 3H1VX 5KPTA 4BRHA 5AZIB 4HTLA 3ZEUB 3H3OB 4PL7A 4JNEA 3D2EA 3CJAA 5AQQA 3VETA 2P9LB 1U2VA 4Y0WA 1VQNN 3F5TA 4FWMA 1NGJA 4GV6A 2A5XA 3O08A 3UKRB 4YOUA 4RCHA 4FWOA 3WQTA 1YXQA 2P9NA 4RTFD 2NRZA 3RSEB 5C15A 3EE8A 3TPQA 4B1UB 5F0XA 4H0YB 3QICA 4YORA 3E1YA 2GX9A 4IXCA 3U8XA 2Q31A 2OTLN 1ATNA 3DXKB 4B1XB 1J6ZA 4GV9A 3J8AA 5M1FA 3ID8A 1RDUA 3CJ9A 4J8FA 1YF5L 1Q18A 4Z94A 5BR9A 2FSKA 4WCEL 3CCEN 4H5WA 4ILGB 3CJ1A 4IJAA 1Q81O 2E1YA 3FZFA 3TU5A 3U9ZA 4BGAA 1YJWN 2VGMA 5GIOA 5H1SQ 5AQYA 5M1NA 5KPZA 4KBOA 1P90A 3TTDA 2CGKA 3DAWA 1HLUA 3CMAN 4A2BA 2GWKA 5AFUA 3J7ZO 1VQON 1KAXA 3O1BA 1K8KA 1ZBSA 2OTJN 3MN5A 2AA4A 4FWQA 3ZX3A 4B1VA 5FPEA 2QWNA 2YJEA 3S41A 3EL2A 3WUHA 3LM2A 2QWPA 4IO8A 4C23A 2VWBA 3VF4A 4KH6A 3RVCA 5M1KA 3D2FB 5KQDA 3I33A 4H5VA 3BUZB 5LJWA 1VQKN 4YOWA 1GLFO 3PIOL 4QS7A 3ZEUA 1TYQA 1JCFA 3ENOA 4FWNA 2NZTA 1E4FT 1RGIA 4O8KA 2P9PA 2P9LA 3L0QA 5BRDA 5BPLA 4JKDA 4BG9A 5AFUH 4C1NI 4KH4A 2Q0RA 3UKRA 4IFEA 5JICA 1ATRA 1S3XA 2ASPA 3SK3A 3G6EN 1LCUA 3O9TA 2NRXA 4BRMA 2ZJRL 3KK7A 4L3QA 5AQNA 3MN7A 2GUPA 3R6MA 3ID6A 3MN9A 4YOVA 3KVGA 5TKWA 1K8AO 2QW9A 3VTHA 1JCGA 2NRTA 2CGLA 4FWKA 3LDPA 4IOAL 4JKEA 4WFAL 1NGBA 1NM1A 3B8AX 2Q1NA 3C7NB 1BA1A 1HPMA 4AF1A 3CCRN 2NRWA 4AM7A 3DXMB 3E9PA 3H45C 2HBLA 5M1QA 1Z6RA 3VPZA 3HOSA 3NVMA 3I55N 3OBWA 1V4TA 4BR9A 1ZC6A 2V51B 5CE3A 2QXLA 3A5LC 4PKIA 4JKGB 4CZJA 2E88A 1H1VA 4QS8A 1NLVA 4FWLA 5BRFA 1YVNA 2GELA 3LDOA 3U9DA 4MO4A 3ENHA 3O5BA 4H5TA 4HWIA 3WXMB 1GLBG 4A62A 3GOIA 4ILHA 1CZAN 2E2QA 2P9KA 5AQGA 3TSPA 2WUSA 5M1OA 2IVNA 4BQLA 2HBJA 4IWVA 5AQUA 4AM6A 4BR5A 1BOTO 3SMSA 3VMFB 4CD1A 4CBXA 3O9RA 4K43A 1WUAA 3WEEB 4BRKA 5GAGP 5LY3A 4PKHA 4MLEA 4BREA 1YAGA 2VCPA 3E9LA 5C0YA 4JD2B 3SBGA 4M7XA 4OPAA 5EOYA 4QS9A 3FR0A 4IOXA 4O5FA 2YHXA 3TSUA 1NGFA 3R8EA 1VQ6N 3FLCO 2ASOA 2P9IB 3CXCM 1G99A 4YOTA 4M63C 1C0GA 3EKUA 3AGKA 3Q7CA 5AQWA 3QBXA 3MMVA 2A6AA 5CR4A 4K42A 4A61A 4IEIA 3QFUA 4FOEA 2ZF5O 3H6EA 1NWKA 3I56N 3VOVA 4E1JA 5B8HA 3JS6A 1C0FA 1VAZA 4IEEA 4BR2A 3M5RA 3CCQN 3M3ZA 3ULEB 1YIJN 3Q7BA 3M1FA 5AQMA 3WXLA 4H5RA 4A2AA 3GDQA 1VQ9N 2BTFA 4G9ZA 1QHAA 3NVKA 3T7ZA 5FPDA 1JCEA 4NB4A 5F1XA 1W97L 3HTVA 3P4IA 5JLFA 4UY8O 2ZGYA 3C65A 2NRVA 3I8BA 2HBMA 2QWOA 3CQXA 4BRQA 3C6AA 5GAEP 3SAGA 5HOOA 1N8RO 3NMUA 5C12A 3DLLL 1P8ZA 3CC4N 3LDLA 4R79A 4U67L 4BC3A 1Y64A 3BF3A 3AY9A 2YHWA 3ENBA 2QWQA 4H0PA 4DB3A 4B1YB 4BRDA 2D1KA 4GVEA 3HI0A 4FOIA 3CCMN 3VEXA 1YITN 2GTDA 2P9IA 1OVYA 4BRPA 5JVHL 3K9JA 3R9PA 3BP8A 3QFPA 3SJHA 1EO1A 3KWGA 3D7EO 2P9SB 3HZ6A 2NRHA 4JHDB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1NGD A;  4FWS A;  4GY2 B;  3UKU B;  1ESV A;  4I6M B;  1SZ2 A;  1U6Z A;  3ZET B;  3L4I A;  4H0O A;  3VGL A;  5ADX A;  3QDK A;  3HM8 A;  5EY4 A;  5AQV A;  5AZI A;  2D4W A;  4CD3 A;  1XQS C;  1OKJ A;  5E26 A;  3AAQ A;  1WOQ A;  3DWL A;  4BRN A;  3FZK A;  4CZK A;  3GE1 A;  4CBW A;  3W0L A;  4K41 A;  3LDN A;  5AQI A;  3AAP A;  3CIP A;  1HJO A;  1QZ6 A;  4BG8 A;  3RSE A;  5ADX H;  4PL8 A;  4BQZ A;  2AP1 A;  2W40 A;  1GLJ O;  2FF3 B;  2GWJ A;  4XH5 A;  3VEW A;  4F9O A;  2EWS A;  4BGB A;  1NGG A;  3DXK A;  2I7N A;  4BRL A;  1R59 O;  2ZWH A;  4H0X B;  5AQJ A;  5F2R A;  2V52 B;  5BN9 A;  3VEV A;  3GBT A;  4B1Z A;  3O6W A;  1E4G T;  4H0T B;  1MWK A;  3GL1 A;  4EAH D;  2IVO A;  1GLE G;  1MA9 B;  4WQ5 A;  4CJ7 A;  1RFQ A;  4IJN A;  1BU6 O;  1SQK A;  4WQ4 A;  1NGC A;  2P9S A;  5KQ8 A;  3A0I X;  4JHD A;  4FPA A;  3AAR A;  4LC9 B;  3ATU A;  2FSN A;  4I6M A;  1ATS A;  4FWR A;  2VYP A;  5AQR A;  2F9W A;  4CBU A;  4YDU A;  4BR4 A;  3EN9 A;  3WQU A;  4BRO A;  1NMD A;  3D2F A;  2QWR A;  5AQP A;  3CJ7 A;  5FPM A;  5JMV A;  4WQ5 C;  2A42 A;  5AR0 A;  5AQX A;  4WQ4 C;  4EHU A;  1IJJ A;  3F9M A;  3D2E B;  3IFR A;  4CZE A;  1MWM A;  3U4L A;  5I9E B;  1U2V B;  5TKY A;  4BRG A;  3A5O C;  5KPR A;  1X9J A;  4YDU C;  4H5N A;  3UE5 A;  1GLD G;  1BUP A;  4CZF A;  2CGJ A;  2Q97 A;  1HX1 A;  2HMP A;  3FGU A;  1KXP A;  3CJC A;  3FZL A;  3C7N A;  3BEX A;  1BG3 A;  1QZ5 A;  2YHY A;  2IIR A;  5E84 A;  2FF6 A;  1EQY A;  3DXM A;  1DEJ A;  5AZJ B;  2ASM A;  4EHT A;  3H3N O;  4EIA A;  4FL9 A;  1V4S A;  1TUU A;  3VES A;  3SMP A;  3VEY A;  4BVO A;  2E2N A;  3FZM A;  4XH4 A;  5FPN A;  2PAV A;  2OAN A;  3JXU A;  2W41 A;  4CZI A;  2I7P A;  1HKB A;  1IG8 A;  3M6G A;  5ELZ A;  4BRA A;  1K8K B;  4B9Q A;  4ISF A;  1NGI A;  3WEE A;  2V7Z A;  4K25 A;  1LOT B;  5AQZ A;  4FO0 A;  5AQH A;  1BDG A;  4JD2 A;  3FFK B;  3WXK A;  5BRH A;  1QQN A;  4GNI A;  2GEM A;  1TYQ B;  4XEI A;  3UB5 A;  2F9T A;  3MCP A;  4BVP A;  3CET A;  2P9P B;  2E20 A;  4FSV A;  4FPB A;  1X3N A;  3VEO A;  3CHW A;  2Q36 A;  5BPN A;  3VEZ A;  2UYT A;  1BWF O;  2HF4 A;  3IUC A;  3ATV A;  5AQF A;  3WXJ A;  4BRF A;  1T6C A;  3ZX2 A;  3VF6 A;  1GLL O;  1HKG A;  2DPN A;  3LM9 A;  5AQT A;  3ULE A;  1KAZ A;  5AZJ A;  1DGK N;  1KAY A;  2PBD A;  3WXI A;  3C0B A;  5AQO A;  3KHY A;  5EXW A;  1X3M A;  3WT0 A;  4BC2 A;  1BO5 O;  4BC5 A;  3O1W A;  2FXU A;  3O8M A;  3CJB A;  2CH5 A;  2V7Y A;  3HSC A;  3FE1 A;  2ITM A;  2A3Z A;  2FSJ A;  4CZM A;  4CZL A;  2P9K B;  1Z05 A;  3A5M C;  1MDU B;  1XC3 A;  4BC4 A;  2YJF A;  3W3D A;  3OHR A;  2P9U B;  1GLC G;  2QWL A;  4CZG A;  1ZXO A;  3BF1 A;  3QML A;  1NBW A;  2FLO A;  4H0V B;  2A41 A;  4RWT A;  2H3G X;  2IVP A;  2QWM A;  4DQ8 A;  3MDQ A;  3G25 A;  4ISE A;  2YI1 A;  2ZGZ A;  1XUP O;  4NO7 A;  2E8A A;  1SAZ A;  4EFH A;  4JAX A;  4XH1 A;  2CH6 A;  2J4R A;  2Q2R A;  1T6D A;  3UKU A;  3ZX0 A;  1BA0 A;  4PKG A;  3VEN A;  3ZET A;  1QQM A;  2A40 A;  2Q0U A;  3EZW A;  1NGH A;  3O80 A;  2E1Z A;  4DHY A;  3FZH A;  3CER A;  1HUX A;  4BRC A;  5EX5 A;  4MLH A;  3L6Q A;  3GG4 A;  4WYB A;  2E2O A;  2E2P A;  3A8Y A;  3CI5 A;  4BR0 A;  2HOE A;  2KHO A;  3IDH A;  4ISG A;  3SLC A;  4BRI A;  3O4W A;  5AQS A;  3VGM A;  3IMX A;  4CZH A;  1TUY A;  3EKS A;  5BN8 A;  1S22 A;  2D0P A;  5BPM A;  2HF3 A;  2D0O A;  2P9U A;  3KZB A;  5AQK A;  1QQO A;  5AQL A;  4CI6 A;  3MK6 A;  2P9N B;  3LL3 A;  3QBW A;  5EVZ A;  3DJC A;  3VGK A;  5BRE A;  2BUP A;  3QB0 A;  1YUW A;  4H03 B;  5JLH A;  1NGE A;  3H46 O;  1NGA A;  4M7Y A;  4JN4 A;  4DCH A;  3H1Q A;  3CQY A;  1RDW X;  5LJV A;  4IZ9 A;  1GLA G;  3HBT A;  1T44 A;  1HKC A;  3EO3 A;  3MN6 A;  2NLX A;  3LDQ A;  2YCH A;  3VF2 A;  1DKG D;  2QM1 A;  4B1W B;  4FWP A;  3VER A;  4BR7 A;  1D4X A;  3A5N C;  4MO5 A;  3H1V X;  5KPT A;  4BRH A;  5AZI B;  4HTL A;  3ZEU B;  3H3O B;  4PL7 A;  4JNE A;  3D2E A;  3CJA A;  5AQQ A;  3VET A;  2P9L B;  1U2V A;  4Y0W A;  4FWM A;  1NGJ A;  2A5X A;  3O08 A;  3UKR B;  4RCH A;  4FWO A;  3WQT A;  1YXQ A;  2P9N A;  4RTF D;  3RSE B;  3TPQ A;  4B1U B;  5F0X A;  4H0Y B;  3QIC A;  4IXC A;  3U8X A;  2Q31 A;  1ATN A;  3DXK B;  4B1X B;  1J6Z A;  3J8A A;  3ID8 A;  3CJ9 A;  4J8F A;  1Q18 A;  4Z94 A;  5BR9 A;  2FSK A;  4H5W A;  3CJ1 A;  4IJA A;  2E1Y A;  3FZF A;  3TU5 A;  3U9Z A;  4BGA A;  5AQY A;  5KPZ A;  4KBO A;  2CGK A;  3DAW A;  1HLU A;  4A2B A;  2GWK A;  5AFU A;  1KAX A;  3O1B A;  1K8K A;  1ZBS A;  3MN5 A;  2AA4 A;  4FWQ A;  3ZX3 A;  4B1V A;  5FPE A;  2QWN A;  2YJE A;  3S41 A;  3EL2 A;  3WUH A;  3LM2 A;  2QWP A;  4IO8 A;  4C23 A;  2VWB A;  3VF4 A;  3D2F B;  5KQD A;  3I33 A;  4H5V A;  3BUZ B;  5LJW A;  1GLF O;  4QS7 A;  3ZEU A;  1TYQ A;  1JCF A;  3ENO A;  4FWN A;  2NZT A;  1E4F T;  1RGI A;  4O8K A;  2P9P A;  2P9L A;  3L0Q A;  5BRD A;  5BPL A;  4BG9 A;  5AFU H;  2Q0R A;  3UKR A;  5JIC A;  1ATR A;  1S3X A;  2ASP A;  3SK3 A;  1LCU A;  4BRM A;  4L3Q A;  5AQN A;  3MN7 A;  2GUP A;  3R6M A;  3MN9 A;  3KVG A;  2QW9 A;  1JCG A;  2CGL A;  4FWK A;  3LDP A;  1NGB A;  1NM1 A;  3B8A X;  2Q1N A;  3C7N B;  1BA1 A;  1HPM A;  4AM7 A;  3DXM B;  3H45 C;  3VPZ A;  1Z6R A;  5CE3 A;  1V4T A;  4BR9 A;  1ZC6 A;  2V51 B;  2QXL A;  3A5L C;  4PKI A;  4CZJ A;  2E88 A;  1H1V A;  4QS8 A;  1NLV A;  4FWL A;  5BRF A;  1YVN A;  2GEL A;  3LDO A;  3U9D A;  4MO4 A;  3ENH A;  3O5B A;  4H5T A;  4HWI A;  4A62 A;  1GLB G;  3GOI A;  1CZA N;  2E2Q A;  2P9K A;  5AQG A;  2WUS A;  2IVN A;  4BQL A;  4IWV A;  5AQU A;  4AM6 A;  4BR5 A;  1BOT O;  3SMS A;  4CD1 A;  4CBX A;  4K43 A;  1WUA A;  3WEE B;  4BRK A;  5LY3 A;  4PKH A;  4MLE A;  4BRE A;  1YAG A;  2VCP A;  4JD2 B;  4M7X A;  5EOY A;  4QS9 A;  3FR0 A;  4O5F A;  2YHX A;  1NGF A;  3R8E A;  3FLC O;  2ASO A;  2P9I B;  1G99 A;  4M63 C;  1C0G A;  3EKU A;  5AQW A;  3QBX A;  3MMV A;  2A6A A;  4A61 A;  4K42 A;  3QFU A;  4FOE A;  2ZF5 O;  3H6E A;  1NWK A;  3VOV A;  4E1J A;  5B8H A;  3JS6 A;  1C0F A;  4BR2 A;  3M3Z A;  3ULE B;  3M1F A;  5AQM A;  3WXL A;  4H5R A;  4A2A A;  3GDQ A;  2BTF A;  1QHA A;  5FPD A;  1JCE A;  4NB4 A;  5F1X A;  3P4I A;  3HTV A;  5JLF A;  2ZGY A;  3I8B A;  2QWO A;  3CQX A;  4BRQ A;  1P8Z A;  3LDL A;  4BC3 A;  1Y64 A;  3BF3 A;  3AY9 A;  2YHW A;  2QWQ A;  4H0P A;  4DB3 A;  4B1Y B;  4BRD A;  2D1K A;  3HI0 A;  4FOI A;  3VEX A;  2GTD A;  2P9I A;  4BRP A;  3R9P A;  3BP8 A;  3QFP A;  3SJH A;  3D7E O;  2P9S B;  3HZ6 A;  2NRH A;  4JHD B; 
#chains in the Genus database with same CATH topology
 5DK5 A;  1ESV A;  3JAM O;  3VQ8 A;  2XY5 A;  3QLH A;  4ELT A;  3MX2 A;  1CXU A;  2GBZ A;  4E3S A;  1TKT A;  3PLA A;  4CD3 A;  4DTJ A;  5K14 A;  3LAM A;  2HBK A;  2B6A A;  4BWJ A;  3SUQ A;  5SZT A;  3L3V A;  4FW2 A;  1TAU A;  4JKA A;  1BI4 A;  3T69 A;  2ZJQ L;  4CJS A;  4F3T A;  4B3M K;  4FLT A;  3KWI A;  1GLJ O;  4IOC L;  4F9O A;  4A5A A;  3DXK A;  4CJK A;  1OH8 A;  1R59 O;  2ZWH A;  1ZYQ A;  4BDP A;  4H0X B;  5AQJ A;  3P5J A;  5F2R A;  3V81 A;  1QSY A;  1E4G T;  2OZM A;  4H0T B;  3HOT A;  4EAH D;  4JI1 K;  4QAG A;  3HPH A;  4J2E A;  1BU6 O;  1SQK A;  4WQ4 A;  3TAM A;  3L2R A;  2P9S A;  4DSI A;  2KTQ A;  3ZT1 A;  3CG7 A;  4FPA A;  3ATU A;  2FSN A;  4KV8 A;  4NCB A;  4E7J A;  2WOM A;  1C0T A;  4BR4 A;  3MXM A;  3DLB A;  3MEG A;  1Q7Y O;  1J5O A;  3CCV N;  4M3Y A;  4CHY A;  1NKB A;  1YJ9 N;  2QWR A;  4FJ7 A;  3BZC A;  3CJ7 A;  3VA0 A;  3QNN A;  5AR0 A;  5AQX A;  3VQB A;  3ZSR A;  4EHU A;  1Q82 O;  5HRP A;  3LDS A;  4CCH A;  3CC7 N;  1IJJ A;  3K58 A;  4CZE A;  1WLJ A;  1MWM A;  2YHA A;  3HPO A;  2KZZ A;  4JKF A;  3U4L A;  1U2V B;  4BRG A;  3A5O C;  3MWP A;  3HST B;  5CYQ A;  1GOA A;  3E66 A;  1GLD G;  4C1N K;  1WB9 A;  4OX9 K;  4CZF A;  2CGJ A;  1U47 A;  3NF6 A;  4G1Q A;  3SBT A;  3BEX A;  1BG3 A;  1QZ5 A;  3E9O A;  2IIR A;  5E84 A;  2UUB K;  2FF6 A;  1DEJ A;  1NK8 A;  2ASM A;  4EHT A;  4KRF A;  4B9T A;  2FC0 A;  4BVO A;  4Z4G A;  3FZM A;  2ETJ A;  3CFP A;  3CPE A;  3JXU A;  4A57 A;  2I7P A;  1IG8 A;  4B9Q A;  2HHT A;  3DRS A;  4LH5 A;  1VSF A;  4J2B A;  4B9N A;  4K25 A;  4FO0 A;  1KFS A;  4B9L A;  3MCA B;  4JD2 A;  3HXM A;  5C2F A;  2GEM A;  3P31 A;  5C25 A;  4DFK A;  1TYQ B;  4XEI A;  3TSQ A;  3CCJ N;  4FSV A;  2F8T A;  1RT7 A;  2ZQB A;  4JI7 K;  2NRR A;  5BPN A;  2UYT A;  2FBT A;  1C0M A;  3CCS N;  1JL2 A;  3L2U A;  3ZX2 A;  3VF6 A;  4DUY K;  3LM9 A;  3S3M A;  1DGK N;  1KAY A;  3WXI A;  4KFB A;  1S1T A;  4DQQ A;  4DFJ A;  5AQO A;  1W9H A;  3KHY A;  1IKX A;  5EXW A;  3OTO K;  1X3M A;  2BH1 A;  3WT0 A;  4BC2 A;  4FZZ A;  3SAH A;  1M1K O;  4CEC A;  2CH5 A;  3HSC A;  4JI5 K;  1XMQ K;  1HNW K;  2PFU A;  5HRS A;  1KSP A;  1BGX T;  1Z05 A;  3A5M C;  1MDU B;  3OYF A;  1ZBU A;  2P9U B;  4DSF A;  4ZTJ A;  4AHV A;  1NBW A;  4H0V B;  4CJL A;  2H3G X;  1L3S A;  4FLV A;  2NUB A;  2YNI A;  4ISE A;  4FM2 A;  3V9W A;  2ZGZ A;  1NG9 A;  4KPY A;  1RDC A;  1O13 A;  5HRR A;  4Q5V A;  4WE1 A;  4DFM A;  3HL8 A;  3OVN A;  4XH1 A;  1T6D A;  3K57 A;  2QI2 A;  3O3H A;  4KHP K;  2D0A A;  4ID5 A;  1QQM A;  2Q0U A;  4CHQ A;  3SV4 A;  1S72 N;  2O8D B;  2JWK A;  3OYD A;  2ZJP L;  4DR5 K;  4NYN A;  4KTZ A;  4MLH A;  3L6Q A;  5EX5 A;  3P83 D;  4DUZ K;  4O44 A;  3CCU N;  5T7B A;  5CZ1 A;  4CE9 A;  3A8Y A;  2ZD1 A;  3OW2 M;  3CI5 A;  3CPW M;  1VSM A;  2KHO A;  5LMN K;  4BRI A;  4ISG A;  1ZBF A;  1DLO A;  3O4W A;  5AQS A;  4CZH A;  3IMX A;  4FJ5 A;  2ZM6 K;  1S22 A;  3CQ8 A;  2D0O A;  2P9U A;  1WSE A;  5AQK A;  2B4J A;  1QQO A;  3MK6 A;  4E7I A;  3WNG A;  4CES A;  1YUW A;  4IFY A;  4H03 B;  4LFC K;  4AIL C;  3E01 A;  3H46 O;  3MEC A;  1WSI A;  2HHU A;  4OPH A;  1NGA A;  4M7Y A;  4Q0B A;  3THW A;  4JI0 K;  1KFD A;  2QEX N;  5GAD P;  1Q8I A;  3R3L A;  5LJV A;  4B3O A;  1W2B M;  2HVH A;  3C95 A;  4E0D A;  3LDQ A;  2YCH A;  1EP4 A;  2QM1 A;  2JWL A;  2QXF A;  4CER A;  1D4X A;  4WFN L;  4BE0 A;  3PIP L;  4HUG A;  3H1V X;  3K2P A;  5KPT A;  4BRH A;  2A1R A;  3V9X A;  1L5U A;  4FLZ A;  4HTL A;  3J81 O;  3H3O B;  4JNE A;  4CEB A;  4KHN A;  1S5J A;  3SQ1 A;  4CIF A;  4FWO A;  3LWL A;  3EE8 A;  4DF8 A;  1I39 A;  1RT6 A;  3LP1 A;  3J8A A;  4LSN A;  5M1F A;  4FJG A;  3ID8 A;  4MFB A;  4IBN A;  2FSK A;  4WCE L;  3CCE N;  2E1Y A;  1YJW N;  3U9Z A;  5M1N A;  1WBD A;  4A2B A;  4LFB K;  3KIO A;  3MN5 A;  1A5V A;  4FWQ A;  4DR3 K;  2QWN A;  2Z1J A;  1TGO A;  4LF9 K;  4LFA K;  1WSF A;  5C42 A;  3QIN A;  4HCC A;  2VWB A;  3D2F B;  5LJW A;  3I33 A;  3BUZ B;  4QS7 A;  2O8E B;  5BRD A;  1UA0 A;  5BPL A;  1XHX A;  4BG9 A;  4KH4 A;  1IKY A;  4JLH A;  4IFE A;  1DTQ A;  1TV6 A;  2ASP A;  3SK3 A;  3G6E N;  3QNO A;  3VQP A;  4BRM A;  4KB1 A;  5AQN A;  3IS9 A;  4YOV A;  5TKW A;  4CK1 A;  1JCG A;  3NGY A;  2NRT A;  2CGL A;  1YVU A;  2VQF K;  3P1G A;  4C8M A;  3MEE A;  1NGB A;  3RMC A;  1BA1 A;  4Z4C A;  3AVN A;  4W5Q A;  2NRW A;  3KTQ A;  1IG9 A;  3VPZ A;  4ZHR A;  3NVM A;  5LMU K;  5CE3 A;  4BR9 A;  2E88 A;  1H1V A;  5JS1 A;  3VA3 A;  1YVN A;  4DV3 K;  2YNH A;  4H5T A;  4A62 A;  1OVQ A;  1CZA N;  4ILH A;  3NBP A;  2EHG A;  2R7Y A;  4CJE A;  4IWV A;  3PX6 A;  2HVI A;  2XY6 A;  4BRE A;  1YAG A;  5C0Y A;  1LAW A;  4M7X A;  1S1W A;  4QS9 A;  4CEF A;  2P1J A;  1NGF A;  3R8E A;  3FLC O;  1VSH A;  4M63 C;  4BAC A;  1C0G A;  2B5J A;  3HVT A;  4X66 K;  3RMA A;  2BGG A;  3AGK A;  4CFC A;  2A6A A;  4K42 A;  1TVR A;  4IEI A;  3QFU A;  4FOE A;  4RG8 A;  3T19 A;  3VOV A;  5B8H A;  4W5T A;  3NCI A;  4M3T A;  3CCQ N;  3M1F A;  5KTQ A;  1S6Q A;  5J2M A;  1ZBI A;  3SV3 A;  4A2A A;  1GOC A;  4CF2 A;  1QHA A;  2X6N A;  3T7Z A;  4CIE A;  2FBV A;  3CQX A;  1A5W A;  1G15 A;  5I42 A;  4I7F A;  4BC3 A;  1VSE A;  3SI6 A;  2O8F A;  4H0P A;  4JS4 A;  4HCB A;  4DB3 A;  4AH9 A;  4CGI A;  3VEX A;  4BRP A;  3SJH A;  4HUE A;  2O8C B;  4FWS A;  4GY2 B;  3UKU B;  4DTS A;  3DRR A;  1SKR A;  1U6Z A;  4Z0U A;  4KO0 A;  4LH4 A;  3ASM A;  4DQP A;  4JKB A;  4CED A;  4OJR A;  3QDK A;  4PHT X;  1FKP A;  3HM8 A;  4XIU A;  2Y1J A;  3RR8 A;  5AQV A;  5AZI A;  3OYM A;  4DSJ A;  1RTD A;  3VN5 A;  2PYL A;  1WOQ A;  3DWL A;  4BRN A;  3O9U A;  4F8R A;  1BIU A;  3CIP A;  3C6H A;  3RSE A;  4B9S A;  1JJ2 M;  5ADX H;  4BQZ A;  2AP1 A;  4ICL A;  1VQ4 N;  2EWS A;  3THY B;  4BRL A;  2I7N A;  4K8Z A;  5CY4 A;  1F21 A;  3VEV A;  5JVG L;  1VRT A;  5FRN A;  4LD0 A;  3GBT A;  4W5N A;  4FK2 A;  4B1Z A;  1VQ7 N;  1MWK A;  3THX B;  4DV4 K;  1GLE G;  4CJ7 A;  4HHT A;  3CYM A;  3LP3 A;  1HYZ A;  1NGC A;  3NF8 A;  5KQ8 A;  4KKO A;  4CF9 A;  4LC9 B;  3AAR A;  3CFO A;  5IT9 O;  3F9K A;  1KTQ A;  3B6P A;  4FWR A;  5AQR A;  1HNV A;  2F9W A;  2WFB A;  2G8U A;  4V19 S;  1QTM A;  1NKE A;  4RW9 A;  1XNR K;  1NMD A;  5AQP A;  1BCO A;  3WNE A;  4FK0 A;  2W6L A;  3VQD A;  4WQ5 C;  1GOB A;  1TKX A;  3QEW A;  3HT3 A;  3NGZ A;  2W42 A;  3KK1 A;  2DFH A;  1YHQ N;  1FXX A;  3D2E B;  4C8O A;  5J2P A;  1FJG K;  1J5E K;  4MDB A;  1X9J A;  3MWT A;  4E89 A;  4YDU C;  4H5N A;  5CHI A;  1JLE A;  2HMP A;  4DQS A;  3FGU A;  3O9Q A;  1BCM A;  3HK2 A;  2YHY A;  4IO9 L;  1IBL K;  1N6Q A;  4CJF A;  2D0C A;  1BIS A;  4I9L A;  1JLF A;  4W5O A;  4I2Q A;  3CF5 L;  3F2K A;  3HO1 A;  1B9D A;  2E2N A;  1RDB A;  2PAV A;  2OAN A;  4CZI A;  3PX4 A;  4X65 K;  1XC9 A;  5GIN A;  1K8K B;  1VSD A;  4DTU A;  1NGI A;  3VQ9 A;  4Z4F A;  3ZYY X;  1LOT B;  5AQZ A;  5FRO A;  3EYZ A;  1QSL A;  5FRM A;  3G71 N;  1SV5 A;  1HPZ A;  5AQH A;  4DG1 A;  3OYK A;  1XMO K;  2F9T A;  4OKJ A;  4YHH K;  1U45 A;  2P9P B;  2E20 A;  3AVA A;  2Q36 A;  1IKV A;  3IUC A;  3WXJ A;  3ZSQ A;  1JLC A;  4M42 A;  1GLL O;  1NK9 A;  4RW6 A;  4CGG A;  4FLX A;  1KAZ A;  4BDY A;  4KI6 A;  1RDD A;  3EY1 A;  1RTH A;  3QEV A;  4KI4 A;  3KLF A;  1TL3 A;  2RF2 A;  3AVJ A;  3ZSV A;  2V7Y A;  3VTI A;  2X74 A;  3ZSY A;  1DT9 A;  3FE1 A;  2ITM A;  4CGD A;  1Q9X A;  3V1O A;  1DTT A;  2E4L A;  4TSX A;  4CZL A;  2P9K B;  3BY5 A;  3OYA A;  1K73 O;  1CZ9 A;  1XC3 A;  1C0U A;  3OHR A;  3SZ2 A;  2HW3 A;  1ZXO A;  4H8K A;  3VQA A;  2Z1I A;  2WTU A;  1HNI A;  4RWT A;  4JKC A;  4YOX A;  3K0S A;  4Z4H A;  3MDQ A;  3G25 A;  2YI1 A;  4DLE A;  3O3G A;  2HHS A;  1OH6 A;  1VQ5 N;  4EFH A;  2CH6 A;  2J4R A;  4CFB A;  1JLQ A;  1JXE A;  3D0P A;  2QTD A;  2G8F A;  3J7Y P;  1X9S A;  2A40 A;  5CZ2 A;  1NGH A;  3O80 A;  2E1Z A;  4CFD A;  2RKI A;  3K9K A;  1LV5 A;  4J2D A;  4H4M A;  3SQ0 A;  4WYB A;  1HQE A;  4F2R A;  1NJX A;  3V1Q A;  4DFP A;  4BR0 A;  3VGM A;  4CF0 A;  2PYJ A;  1TUY A;  2D0P A;  2KLA A;  3L4Q A;  5BPM A;  4GKK K;  2WC9 A;  4C8N A;  1Y97 A;  3KKS A;  5AQL A;  4OO1 J;  3CFR A;  5EVZ A;  4FVU A;  3DJC A;  5BRE A;  2BUP A;  5CYM A;  5JLH A;  4B3R K;  2F96 A;  1NGE A;  1J54 A;  1Q86 O;  4M3X A;  4DCH A;  3VQC A;  1K9M O;  3H1Q A;  4DTN A;  3CQY A;  3K5O A;  1IBK K;  4DU1 A;  3TAB A;  1T44 A;  1HKC A;  2DFF A;  3VF2 A;  3TR8 A;  3AVH A;  1D5A A;  3EE9 A;  4BR7 A;  2UXB K;  4RW7 A;  3AO4 A;  3PY8 A;  3QEP A;  5J1E A;  2P9L B;  1U2V A;  4Y0W A;  1ASW A;  1NGJ A;  4GV6 A;  3UKR B;  3O08 A;  4YOU A;  3WQT A;  5C15 A;  3QIC A;  4YOR A;  4DTO A;  5J2Q A;  3E1Y A;  3QIO A;  4IXC A;  4IG3 A;  4KHS A;  3U8X A;  2Q31 A;  4OLB A;  3AVI A;  4B1X B;  4KHU A;  1J6Z A;  4FCY A;  1RDU A;  3K5M A;  1VSI A;  1YF5 L;  4E19 A;  1RBT A;  1HQU A;  4ILG B;  4IJA A;  2DY4 A;  3FZF A;  4CJ5 A;  3C6U A;  3K5L A;  4CFA A;  5KPZ A;  4KBO A;  1KVC A;  3TTD A;  2CGK A;  4C8K A;  3CMA N;  5AFU A;  1D9F A;  4NYF A;  4OKK A;  5FPE A;  3QIP A;  2I5J A;  4Z4E A;  4IG0 A;  3PV8 A;  3NF9 A;  3RVC A;  1VQK N;  4PA1 A;  4JI6 K;  5AJ3 K;  4AHR A;  3PIO L;  5HBM A;  1TYQ A;  2NZT A;  1RGI A;  4CEO A;  4O8K A;  3UIQ A;  2P9L A;  3L0Q A;  1Z26 A;  2PY5 A;  1YTA A;  3UKR A;  1RT3 A;  3LP0 A;  5C24 A;  2NRX A;  1NK7 A;  3MN7 A;  2GUP A;  3H08 A;  3KJV A;  2QW9 A;  4AHC A;  3LZJ A;  4IOA L;  4WFA L;  4RW4 A;  3C7N B;  4AF1 A;  5KGX A;  3CCR N;  3TAP A;  4PUO A;  3DXM B;  3E9P A;  3PO5 A;  1Z6R A;  3I55 N;  3OBW A;  2V51 B;  1ITG A;  3T1H K;  4CJT A;  3M8S A;  2LSN A;  3A5L C;  4PKI A;  1A5X A;  4JKG B;  5FDL A;  3NHG A;  4FWL A;  3OYL A;  5BRF A;  3U9D A;  4EP4 A;  1KCF A;  4FJK A;  3ENH A;  2P5G A;  4LF8 K;  5AQG A;  3TSP A;  2WUS A;  2IVN A;  3VQ7 A;  3L8B A;  2HBJ A;  3SQ4 A;  4GW6 A;  4Z4I A;  1BOT O;  3WNF A;  4CBX A;  3O9R A;  3WEE B;  4DV6 K;  1YT3 A;  4DMN A;  4MLE A;  3E9L A;  3BZK A;  1S1V A;  2ITG A;  3OYN A;  4OPA A;  4DV0 K;  2VWJ A;  3KD1 E;  1IH7 A;  2YHX A;  1SL2 A;  2BDP A;  1VQ6 N;  4CJ4 A;  3CXC M;  1L3T A;  4DV2 K;  4KRE A;  1WAF A;  2HHQ A;  3RMD A;  3Q7C A;  5AQW A;  4YFU A;  3QBX A;  4JI3 K;  3AA2 A;  5CR4 A;  2KQ2 A;  2ZF5 O;  3BGR A;  4E1J A;  3RWU A;  4IEE A;  2IOC A;  2O8D A;  1UWB A;  3L3U A;  3ULE B;  4CJR A;  4LF4 K;  4CF8 A;  1XWL A;  1VQ9 N;  2BTF A;  3HM9 A;  4G9Z A;  3NVK A;  4R5P A;  3QER A;  5FPD A;  2QWO A;  4MQ3 A;  4BRQ A;  3MXI A;  4E7L A;  3SAG A;  5HOO A;  2OA8 A;  4LSL A;  4BDZ A;  3ZT4 A;  3DLL L;  4M3R A;  4U67 L;  3TAQ A;  1Y64 A;  3RTV A;  5KGW A;  5HLF A;  4B1Y B;  3LPU A;  3K5N A;  4DV5 K;  1CZB A;  2D1K A;  4GVE A;  4FM1 A;  2OPR A;  4FOI A;  3CCM N;  1YIT N;  3U6F A;  2GTD A;  4Y1C A;  3LZI A;  5I3U A;  1J9A A;  3QFP A;  1EO1 A;  3KWG A;  3D7E O;  3HZ6 A;  2NRH A;  4O5B A;  1IKW A;  1NGD A;  1XI1 A;  4I6M B;  1SZ2 A;  3RRH A;  2KFN A;  2HST A;  2UUA K;  3ZET B;  4NXN K;  3VGL A;  4PY5 A;  3TAE A;  1OKJ A;  3OS1 A;  3MED A;  5E26 A;  4X64 K;  2X78 A;  4JS5 A;  3FZK A;  4CZK A;  3AVF A;  3GE1 A;  4CBW A;  4EZ6 A;  3NH1 A;  4K41 A;  1NNE A;  3LDN A;  1W0H A;  3KD5 E;  4BG8 A;  2HHH K;  2HND A;  4XH5 A;  1SUQ A;  3NAE A;  4JRP A;  4DU4 A;  1X9M A;  4B9U A;  1ZBH A;  4BGB A;  1NGG A;  3TI0 A;  1YTU A;  3C6T A;  5BN9 A;  3HRG A;  2OCE A;  2Z1H A;  2IVO A;  1MA9 B;  4WQ5 A;  1RFQ A;  3SUP A;  3A0I X;  1R0A A;  4I6M A;  1KLN A;  4CBU A;  4DF4 A;  4YDU A;  3EN9 A;  1LAV A;  3WQU A;  4BRO A;  4BE1 A;  3D2F A;  4O8U A;  4DWI A;  5JMV A;  1T3V A;  4RW8 A;  4FJI A;  2O8E A;  3SUN A;  2D5R A;  1N36 K;  4CEQ A;  2O4I A;  4KTW A;  1SL0 A;  3DOL A;  3LAK A;  4A59 A;  5I9E B;  4DR1 K;  2IC3 A;  3WNH A;  5KPR A;  3OS0 A;  1SL1 A;  2IS3 A;  4FJJ A;  4I2P A;  5E41 A;  5DM7 L;  3O3F A;  2WBN A;  3AV9 A;  3OYG A;  1HX1 A;  1YJN N;  1KXP A;  3CJC A;  1KC8 O;  4CIG A;  3FZL A;  4DTP A;  3O9S A;  2YX6 A;  5AZJ B;  2XY7 A;  4JKH A;  4A5B A;  3H3N O;  4FL9 A;  1V4S A;  1TUU A;  4FJX A;  3SMP A;  3VEY A;  1RT4 A;  4ELV A;  1VK0 A;  1HKB A;  4KH5 A;  1VQM N;  2HHX A;  3CM5 A;  2YNG A;  3ZCM A;  1VQP N;  3CME N;  4FJL A;  1S9G A;  3DLK A;  2P51 A;  3V9S A;  3WXK A;  5BRH A;  4GNI A;  1EX4 A;  3D45 A;  1CXQ A;  3MX5 A;  3J7A P;  3KLG A;  3AVL A;  3VEO A;  1X3N A;  2PZS A;  4ZTF A;  4AQY K;  1WSG A;  1QVF M;  4H4O A;  3F73 A;  2HF4 A;  1BQM A;  3DLR A;  3SCX A;  4ELU A;  3AO1 A;  3OBY A;  5AQF A;  3RR7 A;  5MLC Q;  3IKM A;  2BAN A;  1T6C A;  3HP9 A;  1LW0 A;  3M8Q A;  3D6R A;  5AQT A;  5AZJ A;  3VQ6 A;  2PBD A;  4FXD A;  3C0B A;  1KVB A;  4IDK A;  3SJJ A;  4FLY A;  3N4Q A;  1NOZ A;  4Y1D A;  2ATQ A;  2UXC K;  3CJB A;  5IWA K;  3CM6 A;  1HNZ K;  2HNY A;  2FSJ A;  4JK8 A;  4CZM A;  1TKD A;  3ZT2 A;  2NNW A;  4DR2 K;  4BC4 A;  2DFE A;  1GLC G;  5GIP A;  4CZG A;  4EZ9 A;  3BF1 A;  4IDH A;  5C10 A;  2FLO A;  2A41 A;  3PSF A;  2IVP A;  4NLC A;  2QWM A;  4OGC A;  3AA3 A;  4CEE A;  4DTM A;  1XUP O;  4NO7 A;  4NLB A;  2E8A A;  1SAZ A;  4M3U A;  4FYD A;  1KLM A;  5HRO A;  2YV0 X;  1QE1 A;  3DM2 A;  3O4N A;  2W6K A;  3ZT0 A;  2O8C A;  3DI6 A;  1BIZ A;  3UKU A;  5HL7 L;  4PKG A;  3VEN A;  3I8D A;  2HNZ A;  3EZW A;  1KD1 O;  4CK3 A;  1J53 A;  1ZBL A;  4DHY A;  2OZS A;  3FZH A;  1NK4 A;  1YI2 N;  3SPZ A;  3V9Z A;  2E2P A;  3K59 A;  1E3M A;  3O4Q A;  5JS2 A;  3SLC A;  4JEP A;  1S6P A;  3EZ5 A;  5J2N A;  4M3Z A;  1VSK A;  1RDA A;  1EXQ A;  3HVR A;  2HF3 A;  2RE2 A;  1U49 A;  3KZB A;  1SKW A;  2O8B B;  4CI6 A;  2P9N B;  3THY A;  3LL3 A;  4CHZ A;  2G8H A;  4E1M A;  3CCL N;  1D8Y A;  3VGK A;  1CLQ A;  1RCH A;  3OYI A;  4MDA A;  3THX A;  1VQ8 N;  4JN4 A;  2HMI A;  1EWQ A;  4IZ9 A;  1B92 A;  3ULD A;  4FJN A;  1SKS A;  4FJ9 A;  5LL6 Z;  3RMB A;  4KTQ A;  4OLA A;  3DLE A;  2KW4 A;  4B1W B;  2KZM A;  3AGR A;  4MO5 A;  4DS4 A;  4IFV A;  1W7A A;  1FKO A;  3D2E A;  3CJA A;  5AQQ A;  3VET A;  3VQ4 A;  3ZT3 A;  1VQN N;  4DV1 K;  4FWM A;  2A5X A;  4B8C A;  4RCH A;  4HVJ A;  1KRP A;  1YXQ A;  2P9N A;  4RTF D;  5F0X A;  5BR8 K;  4I9Q A;  1LWC A;  2GX9 A;  3AA4 A;  3DXK B;  4GV9 A;  1VHX A;  3B6O A;  3CJ9 A;  4J8F A;  3OYC A;  1Q18 A;  1HYV A;  1UOC A;  4H5W A;  1Q81 O;  3TAR A;  4BGA A;  1RTI A;  5AQY A;  5HP1 A;  3HPG A;  2OPP A;  1HLU A;  2GWK A;  4LF5 K;  3J7Z O;  1KAX A;  3O1B A;  1K8K A;  2OTJ N;  2AA4 A;  3ZX3 A;  4B1V A;  3S41 A;  1JLB A;  3WUH A;  3LM2 A;  2QWP A;  1RBR A;  3VF4 A;  4KH6 A;  5M1K A;  4PQU A;  4H5V A;  4DTX A;  4YOW A;  1GLF O;  1L3U A;  1JCF A;  4FWN A;  1E4F T;  1NOY A;  2P9P A;  3AVC A;  4GMJ B;  2VG7 A;  4JKD A;  1MU2 A;  3DYA A;  1ATR A;  1S3X A;  3J80 O;  4JV5 K;  1JXB A;  3ZSO A;  1LCU A;  2Y1I A;  2IDO A;  1N34 K;  3R6M A;  4CJV A;  3MN9 A;  3KVG A;  1K8A O;  3VTH A;  4FJH A;  4NCA A;  1X1P A;  1VSJ A;  4FWK A;  3B8A X;  3H45 C;  5M1Q A;  2HBL A;  3HOS A;  3IRX A;  1TK0 A;  3NGI A;  1V4T A;  3U3Y A;  1ZC6 A;  3PX0 A;  4FVM A;  2QXL A;  4CZJ A;  2RPI A;  4DR7 K;  2G8K A;  4QS8 A;  1NLV A;  2GEL A;  4MO4 A;  3O5B A;  4HWI A;  3GOI A;  2E2Q A;  2P9K A;  4EP5 A;  5M1O A;  3QEI A;  4BQL A;  2FBX A;  2O4G A;  3NDK A;  4AM6 A;  4K43 A;  1WUA A;  4FW1 A;  5GAG P;  4JD2 B;  3SBG A;  1I94 K;  1JLG A;  3T1Y K;  4O5F A;  3TSU A;  1BQN A;  1NK5 A;  4YOT A;  4CEZ A;  3EKU A;  4AHS A;  4DS5 A;  3I0S A;  4JI2 K;  3MMV A;  2VQE K;  1N33 K;  1RT5 A;  1RBV A;  3H6E A;  1NWK A;  3I56 N;  3JS6 A;  1C0F A;  3PUF A;  3FFI A;  4LF7 K;  4KHY A;  3M5R A;  3MXJ A;  3AVB A;  3Q7B A;  1JKH A;  4J2A A;  3WXL A;  1NJZ A;  4H5R A;  2QKK A;  3GDQ A;  4F3O A;  1C6V A;  3SUO A;  5F1X A;  1W97 L;  2Q3S A;  3P4I A;  5JLF A;  2OYQ A;  3C65 A;  2NRV A;  2HBM A;  3TAG A;  3LAN A;  5GAE P;  2UXD K;  1N8R O;  3HP6 A;  3NMU A;  5C12 A;  4E7K A;  1P8Z A;  3LDL A;  4AHT A;  4R79 A;  1U48 A;  4C8L A;  3BF3 A;  1T03 A;  1C1A A;  2E6L A;  3AY9 A;  3ENB A;  2QWQ A;  1NJY A;  3LAL A;  4KHW A;  1VRU A;  4JRQ A;  1IBM K;  3HI0 A;  3AO3 A;  1OH5 A;  4B3S K;  1O1W A;  1OVY A;  3R9P A;  3BP8 A;  2WON A;  3ZLJ A;  4DV7 K;  4CF1 A;  4JHD B;  4CHP A;  2ZE2 A;  2A1S A;  1RBU A;  5HRN A;  1M90 O;  3L4I A;  4H0O A;  1ASU A;  1U4B A;  1K6Y A;  5ADX A;  4HUF A;  1TAQ A;  1WSJ A;  5EY4 A;  4GV3 A;  5M1P A;  3NH0 A;  2YHB A;  2D4W A;  1XQS C;  4FK4 A;  1TKZ A;  3AAQ A;  5C2D A;  3W0L A;  3HYF A;  4JK9 A;  5AQI A;  3AAP A;  1HJO A;  5GAH P;  1QZ6 A;  4N5S A;  5SWM A;  2QA4 N;  4PL8 A;  2RHK A;  2W40 A;  2FF3 B;  2GWJ A;  3VEW A;  1UA1 A;  3DRP A;  3S3N A;  4BY9 C;  4FZY A;  2V52 B;  4KB0 A;  1ASV A;  3ALY A;  3NH2 A;  3O6W A;  5EU7 A;  4DTR A;  3TAN A;  2X6S A;  3GL1 A;  3G4S N;  3I0R A;  3THW B;  4IJN A;  2HHV A;  4JHD A;  3ITH A;  2BE2 A;  1HR0 K;  2KKZ A;  2UUC K;  3KLE A;  4JI4 K;  1ATS A;  1UAX A;  2VYP A;  3V6D A;  4DLG A;  4CHN A;  2HHW A;  1KQS M;  3CC2 N;  1NMN A;  5FPM A;  2HB5 A;  4BE2 A;  3C94 A;  3AVM A;  2A42 A;  1NJW A;  1EWR A;  4WQ4 C;  4CJW A;  1OH7 A;  2XY8 A;  3F9M A;  3IFR A;  5TKY A;  3UE5 A;  4JK7 A;  1BUP A;  3N4P A;  1C1B A;  2Q97 A;  3AVG A;  4NCG A;  3P38 A;  1S1X A;  3C7N A;  3KLI A;  1EQY A;  3DXM A;  3R1X A;  4QCL A;  1LWF A;  4KAZ A;  2IAJ A;  1TK5 A;  1SS6 A;  4JKG A;  4EIA A;  4K8X A;  1IO2 A;  3LWM A;  3VES A;  3EEQ A;  4XH4 A;  5FPN A;  4ID1 A;  2W41 A;  3SPY A;  3OJS A;  3OYE A;  3M6G A;  4DQI A;  5ELZ A;  4BRA A;  3TTF A;  4OKE A;  4ISF A;  1ILY A;  2F4V K;  1TL1 A;  3WEE A;  2V7Z A;  5D3G A;  2XHB A;  2D0B A;  2Z1G A;  1BDG A;  1WNS A;  3FFK B;  4U7B A;  1QQN A;  5KI6 A;  1Z25 A;  5DM6 L;  3L2V A;  3UB5 A;  3MCP A;  4BVP A;  4FJM A;  2VWK A;  4M41 A;  3CET A;  1NK0 A;  4FPB A;  2VGN A;  3CHW A;  4M45 A;  4N76 A;  3VEZ A;  4LF6 K;  2KFZ A;  1BWF O;  3ATV A;  3L2W A;  4BRF A;  3MAQ A;  1RTJ A;  3OS2 A;  1WAJ A;  1HKG A;  1HNX K;  2DPN A;  3ULE A;  3L2Q A;  4WFB L;  4N56 A;  4BWM A;  1JLA A;  4OVL A;  3QO9 A;  3VQE A;  1QVG M;  1Q9Y A;  1BO5 O;  4BC5 A;  4CHO A;  3O1W A;  2FXU A;  3O8M A;  2A3Z A;  2YJF A;  3W3D A;  3VQQ A;  2QWL A;  3ZSZ A;  4DR6 K;  4CGF A;  3LPT A;  3QML A;  4GVM A;  1B9F A;  2EX3 A;  1XNQ K;  3PO4 A;  4DQ8 A;  4YNQ A;  2GUI A;  4E7H A;  3TTC A;  1I3A A;  3QES A;  3PSI A;  5KRT A;  4OPK A;  4JAX A;  2Q2R A;  2QK9 A;  4ILJ A;  1QQC A;  4NXM K;  3AO2 A;  3ZX0 A;  1BA0 A;  4YOY A;  3CD6 N;  4CJ3 A;  3ZET A;  4FJ8 A;  2JLE A;  3S9H A;  1QS4 A;  1EKE A;  4L8R B;  1QHT A;  3OYB A;  3BDP A;  3CER A;  1HUX A;  4BRC A;  3GG4 A;  2E2O A;  1WBB A;  4DKW A;  2HOE A;  1NJI O;  3IDH A;  1NKC A;  5KRS A;  3SAF A;  3EKS A;  5BN8 A;  1FK9 A;  3TWH A;  3T1A A;  2G8V A;  2GV9 A;  3NF7 A;  3JSM A;  3M8P A;  3TAF A;  1QSS A;  3KKR A;  3T3F A;  3P39 A;  4FLU A;  2O8F B;  3QBW A;  2F7T A;  4WF9 L;  1XHZ A;  3OJU A;  1HMV A;  3QB0 A;  3G10 A;  3OA9 A;  1RBS A;  1VQL N;  1HRH A;  1JL1 A;  4DSE A;  1RDW X;  1IV0 A;  2YKM A;  4GKJ K;  2YKN A;  1GLA G;  3HBT A;  3EO3 A;  3MN6 A;  1N5Y A;  1BHL A;  2NLX A;  4N47 A;  4FZX C;  3KK3 A;  3THV A;  1DKG D;  4OGE A;  4O4G A;  4FWP A;  3VER A;  1LWE A;  2F8S A;  5FLX O;  4B08 A;  3A5N C;  3M8R A;  3S3O A;  4O0I A;  2JGU A;  5AZI B;  3ZEU B;  1BL3 A;  4OPJ A;  4PL7 A;  3SNN A;  1C1C A;  2DTU A;  2XRI A;  2VG5 A;  3SYZ A;  1REV A;  3F5T A;  3DMJ A;  1RT1 A;  4CJU A;  2NRZ A;  3RSE B;  3TPQ A;  3ZSX A;  3LP2 A;  4B1U B;  4H0Y B;  4DSK A;  1RIL A;  4CJP A;  2OTL N;  1ATN A;  4IKF A;  4DU3 A;  4Z94 A;  2XO7 A;  5BR9 A;  3SQ2 A;  5DMR A;  3CJ1 A;  2RN2 A;  3TU5 A;  2VGM A;  3ZSW A;  5GIO A;  5H1S Q;  1P90 A;  3DAW A;  3ISN C;  4UQG A;  1VQO N;  1NK6 A;  3IAY A;  1ZBS A;  3KK2 A;  3V4I A;  4JYA K;  2YJE A;  1WN7 A;  1KVA A;  3EL2 A;  4LY7 A;  4IO8 A;  2IGI A;  3DLH A;  4C23 A;  1EET A;  3QEX A;  1HYS A;  5KQD A;  3AA5 X;  3ZEU A;  2YNF A;  3ENO A;  4FM0 A;  2P5O A;  4B3T K;  4C1N I;  5AFU H;  2Q0R A;  4O0J A;  5JIC A;  3OYH A;  3NFA A;  3OY9 A;  3O9T A;  1X9W A;  2ZJR L;  3KK7 A;  4L3Q A;  4YY3 K;  1HJR A;  3ID6 A;  3A2F A;  4FLW A;  3LDP A;  4JKE A;  1L3V A;  1NM1 A;  2Q1N A;  1HPM A;  1T7P A;  4AM7 A;  4B9V A;  4F2S A;  4HTU A;  2QKB A;  3LDO A;  3OYJ A;  4JI8 K;  4B8A B;  3WXM B;  1U04 A;  3DLG A;  1GLB G;  4QOZ B;  4E1N A;  5AQU A;  4BR5 A;  3VMF B;  3SMS A;  4CD1 A;  4DR4 K;  4DSL A;  4BRK A;  2FBY A;  4CW7 B;  1D9D A;  5LY3 A;  2OPQ A;  4PKH A;  2VCP A;  4CJQ A;  4CK2 A;  5A2Q O;  1T8E A;  1TK8 A;  5EOY A;  4M3W A;  3FR0 A;  4IOX A;  4DQR A;  4K0K K;  1S9E A;  3JYT A;  2ASO A;  2P9I B;  1FW6 A;  1G99 A;  4N41 A;  1T05 A;  4CVN E;  3AVK A;  3V1R A;  4A61 A;  4F4K A;  3G0Z A;  2VG6 A;  1VAZ A;  4B9M A;  1N32 K;  4BR2 A;  2E5L K;  4KHQ A;  3IG1 A;  3M3Z A;  1YIJ N;  5AQM A;  4CEA A;  4O55 A;  2G8I A;  4W5R A;  4PWD A;  3HJF A;  3U3G A;  3KLH A;  2E6M A;  3RRG A;  2UU9 K;  3DOK A;  1JCE A;  4NB4 A;  3HTV A;  4UY8 O;  2ZGY A;  3I8B A;  4AHU A;  4CGJ A;  3C6A A;  2O8B A;  1BI4 B;  1RT2 A;  4X62 K;  3CC4 N;  3QET A;  3AO5 A;  1WSH A;  2YHW A;  1LW2 A;  4BRD A;  4CGH A;  3NE6 A;  2OPS A;  2G8W A;  1S1U A;  1RNH A;  1VSL A;  2P9I A;  5JVH L;  3K9J A;  3VQ5 A;  3V9U A;  2AJQ A;  1NU0 A;  2P9S B; 
#chains in the Genus database with same CATH homology
 1NGD A;  4FWS A;  4GY2 B;  3UKU B;  1ESV A;  4I6M B;  1SZ2 A;  1U6Z A;  1M90 O;  2HST A;  3ZET B;  3L4I A;  4JKB A;  4H0O A;  3VGL A;  3MX2 A;  5ADX A;  3QDK A;  4PHT X;  3HM8 A;  1VQ4 N;  5EY4 A;  4GV3 A;  5M1P A;  3PLA A;  5AQV A;  5AZI A;  2D4W A;  4CD3 A;  1XQS C;  1OKJ A;  5E26 A;  3AAQ A;  2HBK A;  5C2D A;  1WOQ A;  3DWL A;  4BRN A;  3FZK A;  3O9U A;  3GE1 A;  4CBW A;  4CZK A;  3W0L A;  4JK9 A;  4K41 A;  3LDN A;  4JKA A;  5AQI A;  3T69 A;  2ZJQ L;  3AAP A;  3CIP A;  1HJO A;  5GAH P;  1QZ6 A;  3C6H A;  4BG8 A;  3RSE A;  2QA4 N;  1JJ2 M;  5ADX H;  4PL8 A;  3KWI A;  2AP1 A;  2RHK A;  1GLJ O;  2FF3 B;  2GWJ A;  2W40 A;  4XH5 A;  3VEW A;  4BQZ A;  4F9O A;  4IOC L;  2EWS A;  4BGB A;  1NGG A;  3DXK A;  2I7N A;  4A5A A;  4BRL A;  1R59 O;  2ZWH A;  4H0X B;  5AQJ A;  5F2R A;  2V52 B;  5BN9 A;  3HRG A;  3VEV A;  5JVG L;  4BY9 C;  3GBT A;  4B1Z A;  3O6W A;  1E4G T;  1VQ7 N;  4H0T B;  3HOT A;  1MWK A;  3GL1 A;  4EAH D;  2IVO A;  3G4S N;  1GLE G;  1MA9 B;  4WQ5 A;  4CJ7 A;  1RFQ A;  4IJN A;  1BU6 O;  1SQK A;  4WQ4 A;  1NGC A;  2P9S A;  5KQ8 A;  3A0I X;  4JHD A;  4FPA A;  3AAR A;  4LC9 B;  3ATU A;  2FSN A;  4I6M A;  2KKZ A;  1ATS A;  4FWR A;  2VYP A;  5AQR A;  2F9W A;  4CBU A;  2WFB A;  4YDU A;  4BR4 A;  1Q7Y O;  3EN9 A;  3CCV N;  3WQU A;  4BRO A;  1KQS M;  1NMD A;  1YJ9 N;  3D2F A;  2QWR A;  3CC2 N;  4O8U A;  5AQP A;  3CJ7 A;  5FPM A;  5JMV A;  1T3V A;  4WQ5 C;  2A42 A;  5AR0 A;  5AQX A;  4WQ4 C;  4EHU A;  1Q82 O;  1YHQ N;  3CC7 N;  1IJJ A;  3F9M A;  3D2E B;  3IFR A;  4CZE A;  1MWM A;  4JKF A;  3U4L A;  4A59 A;  1U2V B;  5TKY A;  4MDB A;  3A5O C;  4BRG A;  5I9E B;  3MWP A;  5KPR A;  1X9J A;  3MWT A;  4YDU C;  3E66 A;  4H5N A;  3UE5 A;  1GLD G;  4JK7 A;  1BUP A;  3N4P A;  4C1N K;  5DM7 L;  2WBN A;  4CZF A;  2CGJ A;  2Q97 A;  1HX1 A;  5CHI A;  1YJN N;  2HMP A;  3P38 A;  3FGU A;  1KXP A;  3CJC A;  1KC8 O;  3O9Q A;  3FZL A;  3SBT A;  3O9S A;  3C7N A;  3BEX A;  1BG3 A;  1QZ5 A;  2YHY A;  2IIR A;  3E9O A;  2YX6 A;  5E84 A;  2FF6 A;  4IO9 L;  1EQY A;  3DXM A;  3R1X A;  1DEJ A;  5AZJ B;  4JKH A;  4A5B A;  2ASM A;  4EHT A;  1SS6 A;  3H3N O;  4JKG A;  4EIA A;  4FL9 A;  1V4S A;  1TUU A;  3CF5 L;  3VES A;  3SMP A;  3VEY A;  3F2K A;  4BVO A;  2E2N A;  3FZM A;  4XH4 A;  5FPN A;  2PAV A;  2OAN A;  3CPE A;  2W41 A;  3JXU A;  4A57 A;  4CZI A;  2I7P A;  1HKB A;  4KH5 A;  1IG8 A;  1VQM N;  3M6G A;  5ELZ A;  4BRA A;  3TTF A;  1VQP N;  5GIN A;  1K8K B;  4B9Q A;  3CME N;  4ISF A;  1ILY A;  1NGI A;  3WEE A;  2V7Z A;  3ZYY X;  4K25 A;  1LOT B;  5AQZ A;  4FO0 A;  3G71 N;  5AQH A;  1BDG A;  3MCA B;  3FFK B;  4JD2 A;  3WXK A;  1QQN A;  4GNI A;  5BRH A;  4U7B A;  5C2F A;  2GEM A;  3P31 A;  5DM6 L;  1TYQ B;  4XEI A;  3UB5 A;  2F9T A;  3MCP A;  3MX5 A;  4BVP A;  3TSQ A;  3CET A;  3CCJ N;  2P9P B;  2E20 A;  4FSV A;  4FPB A;  1X3N A;  3VEO A;  2VGN A;  3CHW A;  2Q36 A;  2NRR A;  3VEZ A;  5BPN A;  1QVF M;  2UYT A;  1BWF O;  2HF4 A;  3IUC A;  3ATV A;  3OBY A;  5AQF A;  5MLC Q;  3WXJ A;  3IKM A;  3CCS N;  4BRF A;  1T6C A;  3ZX2 A;  3VF6 A;  1GLL O;  3D6R A;  1HKG A;  2DPN A;  3LM9 A;  5AQT A;  3ULE A;  1KAZ A;  5AZJ A;  1DGK N;  1KAY A;  2PBD A;  3WXI A;  4WFB L;  3C0B A;  5AQO A;  3KHY A;  1QVG M;  5EXW A;  1X3M A;  2BH1 A;  3N4Q A;  3WT0 A;  4BC2 A;  1BO5 O;  3SAH A;  1M1K O;  4BC5 A;  3O1W A;  2FXU A;  3O8M A;  3CJB A;  2CH5 A;  2V7Y A;  3VTI A;  3HSC A;  1DT9 A;  3FE1 A;  2ITM A;  2A3Z A;  2PFU A;  2FSJ A;  4JK8 A;  4CZM A;  4CZL A;  2P9K B;  1Z05 A;  3A5M C;  1K73 O;  1MDU B;  2NNW A;  1XC3 A;  4BC4 A;  2YJF A;  3W3D A;  3OHR A;  2P9U B;  1GLC G;  2QWL A;  5GIP A;  4CZG A;  1ZXO A;  3BF1 A;  4IDH A;  3QML A;  1NBW A;  5C10 A;  2FLO A;  4H0V B;  2A41 A;  4JKC A;  4RWT A;  2H3G X;  4YOX A;  2IVP A;  4NLC A;  2QWM A;  4DQ8 A;  3MDQ A;  3G25 A;  4ISE A;  2YI1 A;  2ZGZ A;  3TTC A;  1XUP O;  4NO7 A;  4NLB A;  2E8A A;  1SAZ A;  1VQ5 N;  1O13 A;  4EFH A;  4JAX A;  4XH1 A;  2CH6 A;  2J4R A;  2Q2R A;  4ILJ A;  1T6D A;  2QI2 A;  3UKU A;  3ZX0 A;  1BA0 A;  2QTD A;  5HL7 L;  4YOY A;  4PKG A;  3VEN A;  3CD6 N;  3ZET A;  1QQM A;  2A40 A;  2Q0U A;  3EZW A;  1NGH A;  3O80 A;  1KD1 O;  2E1Z A;  1S72 N;  4DHY A;  2JWK A;  3FZH A;  3K9K A;  3CER A;  1HUX A;  4BRC A;  2ZJP L;  1YI2 N;  5EX5 A;  4MLH A;  3L6Q A;  3GG4 A;  4WYB A;  2E2O A;  2E2P A;  3CCU N;  3OW2 M;  3A8Y A;  4DKW A;  3CI5 A;  3CPW M;  4BR0 A;  2HOE A;  2KHO A;  1NJI O;  3IDH A;  4ISG A;  4JEP A;  3SLC A;  4BRI A;  3O4W A;  5AQS A;  3VGM A;  3IMX A;  4CZH A;  1TUY A;  3EKS A;  5BN8 A;  1S22 A;  2D0P A;  3SAF A;  2KLA A;  3L4Q A;  5BPM A;  2HF3 A;  2D0O A;  2RE2 A;  2P9U A;  3KZB A;  5AQK A;  2WC9 A;  1QQO A;  5AQL A;  4CI6 A;  4OO1 J;  3MK6 A;  3P39 A;  2P9N B;  3LL3 A;  3QBW A;  5EVZ A;  3DJC A;  2F7T A;  4FVU A;  3CCL N;  4WF9 L;  3VGK A;  5BRE A;  2BUP A;  3QB0 A;  1YUW A;  4H03 B;  5JLH A;  1NGE A;  3OA9 A;  4MDA A;  3H46 O;  1VQL N;  4OPH A;  1Q86 O;  1NGA A;  4M7Y A;  1VQ8 N;  4JN4 A;  4DCH A;  1K9M O;  3H1Q A;  3CQY A;  2QEX N;  5GAD P;  1RDW X;  3R3L A;  5LJV A;  4IZ9 A;  1GLA G;  3HBT A;  1W2B M;  1T44 A;  1HKC A;  3EO3 A;  3MN6 A;  2NLX A;  3LDQ A;  2YCH A;  3VF2 A;  3EE9 A;  1DKG D;  2QM1 A;  2JWL A;  4B1W B;  4FWP A;  3VER A;  4BR7 A;  1D4X A;  3A5N C;  4WFN L;  3AGR A;  4MO5 A;  3PIP L;  3H1V X;  5KPT A;  4BRH A;  5AZI B;  4HTL A;  3ZEU B;  3H3O B;  4PL7 A;  4JNE A;  3D2E A;  3CJA A;  5AQQ A;  3VET A;  2P9L B;  1U2V A;  4Y0W A;  1VQN N;  3F5T A;  4FWM A;  1NGJ A;  4GV6 A;  2A5X A;  3O08 A;  3UKR B;  4YOU A;  4RCH A;  4FWO A;  3WQT A;  1YXQ A;  2P9N A;  4RTF D;  2NRZ A;  3RSE B;  5C15 A;  3EE8 A;  3TPQ A;  4B1U B;  5F0X A;  4H0Y B;  3QIC A;  4YOR A;  3E1Y A;  2GX9 A;  4IXC A;  3U8X A;  2Q31 A;  2OTL N;  1ATN A;  3DXK B;  4B1X B;  1J6Z A;  4GV9 A;  3J8A A;  5M1F A;  3ID8 A;  1RDU A;  3CJ9 A;  4J8F A;  1YF5 L;  1Q18 A;  4Z94 A;  5BR9 A;  2FSK A;  4WCE L;  3CCE N;  4H5W A;  4ILG B;  3CJ1 A;  4IJA A;  1Q81 O;  2E1Y A;  3FZF A;  3TU5 A;  3U9Z A;  4BGA A;  1YJW N;  2VGM A;  5GIO A;  5H1S Q;  5AQY A;  5M1N A;  5KPZ A;  4KBO A;  1P90 A;  3TTD A;  2CGK A;  3DAW A;  1HLU A;  3CMA N;  4A2B A;  2GWK A;  5AFU A;  3J7Z O;  1VQO N;  1KAX A;  3O1B A;  1K8K A;  1ZBS A;  2OTJ N;  3MN5 A;  2AA4 A;  4FWQ A;  3ZX3 A;  4B1V A;  5FPE A;  2QWN A;  2YJE A;  3S41 A;  3EL2 A;  3WUH A;  3LM2 A;  2QWP A;  4IO8 A;  4C23 A;  2VWB A;  3VF4 A;  4KH6 A;  3RVC A;  5M1K A;  3D2F B;  5KQD A;  3I33 A;  4H5V A;  3BUZ B;  5LJW A;  1VQK N;  4YOW A;  1GLF O;  3PIO L;  4QS7 A;  3ZEU A;  1TYQ A;  1JCF A;  3ENO A;  4FWN A;  2NZT A;  1E4F T;  1RGI A;  4O8K A;  2P9P A;  2P9L A;  3L0Q A;  5BRD A;  5BPL A;  4JKD A;  4BG9 A;  5AFU H;  4C1N I;  4KH4 A;  2Q0R A;  3UKR A;  4IFE A;  5JIC A;  1ATR A;  1S3X A;  2ASP A;  3SK3 A;  3G6E N;  1LCU A;  3O9T A;  2NRX A;  4BRM A;  2ZJR L;  3KK7 A;  4L3Q A;  5AQN A;  3MN7 A;  2GUP A;  3R6M A;  3ID6 A;  3MN9 A;  4YOV A;  3KVG A;  5TKW A;  1K8A O;  2QW9 A;  3VTH A;  1JCG A;  2NRT A;  2CGL A;  4FWK A;  3LDP A;  4IOA L;  4JKE A;  4WFA L;  1NGB A;  1NM1 A;  3B8A X;  2Q1N A;  3C7N B;  1BA1 A;  1HPM A;  4AF1 A;  3CCR N;  2NRW A;  4AM7 A;  3DXM B;  3E9P A;  3H45 C;  2HBL A;  5M1Q A;  1Z6R A;  3VPZ A;  3HOS A;  3NVM A;  3I55 N;  3OBW A;  1V4T A;  4BR9 A;  1ZC6 A;  2V51 B;  5CE3 A;  2QXL A;  3A5L C;  4PKI A;  4JKG B;  4CZJ A;  2E88 A;  1H1V A;  4QS8 A;  1NLV A;  4FWL A;  5BRF A;  1YVN A;  2GEL A;  3LDO A;  3U9D A;  4MO4 A;  3ENH A;  3O5B A;  4H5T A;  4HWI A;  3WXM B;  1GLB G;  4A62 A;  3GOI A;  4ILH A;  1CZA N;  2E2Q A;  2P9K A;  5AQG A;  3TSP A;  2WUS A;  5M1O A;  2IVN A;  4BQL A;  2HBJ A;  4IWV A;  5AQU A;  4AM6 A;  4BR5 A;  1BOT O;  3SMS A;  3VMF B;  4CD1 A;  4CBX A;  3O9R A;  4K43 A;  1WUA A;  3WEE B;  4BRK A;  5GAG P;  5LY3 A;  4PKH A;  4MLE A;  4BRE A;  1YAG A;  2VCP A;  3E9L A;  5C0Y A;  4JD2 B;  3SBG A;  4M7X A;  4OPA A;  5EOY A;  4QS9 A;  3FR0 A;  4IOX A;  4O5F A;  2YHX A;  3TSU A;  1NGF A;  3R8E A;  1VQ6 N;  3FLC O;  2ASO A;  2P9I B;  3CXC M;  1G99 A;  4YOT A;  4M63 C;  1C0G A;  3EKU A;  3AGK A;  3Q7C A;  5AQW A;  3QBX A;  3MMV A;  2A6A A;  5CR4 A;  4K42 A;  4A61 A;  4IEI A;  3QFU A;  4FOE A;  2ZF5 O;  3H6E A;  1NWK A;  3I56 N;  3VOV A;  4E1J A;  5B8H A;  3JS6 A;  1C0F A;  1VAZ A;  4IEE A;  4BR2 A;  3M5R A;  3CCQ N;  3M3Z A;  3ULE B;  1YIJ N;  3Q7B A;  3M1F A;  5AQM A;  3WXL A;  4H5R A;  4A2A A;  3GDQ A;  1VQ9 N;  2BTF A;  4G9Z A;  1QHA A;  3NVK A;  3T7Z A;  5FPD A;  1JCE A;  4NB4 A;  5F1X A;  1W97 L;  3HTV A;  3P4I A;  5JLF A;  4UY8 O;  2ZGY A;  3C65 A;  2NRV A;  3I8B A;  2HBM A;  2QWO A;  3CQX A;  4BRQ A;  3C6A A;  5GAE P;  3SAG A;  5HOO A;  1N8R O;  3NMU A;  5C12 A;  3DLL L;  1P8Z A;  3CC4 N;  3LDL A;  4R79 A;  4U67 L;  4BC3 A;  1Y64 A;  3BF3 A;  3AY9 A;  2YHW A;  3ENB A;  2QWQ A;  4H0P A;  4DB3 A;  4B1Y B;  4BRD A;  2D1K A;  4GVE A;  3HI0 A;  4FOI A;  3CCM N;  3VEX A;  1YIT N;  2GTD A;  2P9I A;  1OVY A;  4BRP A;  5JVH L;  3K9J A;  3R9P A;  3BP8 A;  3QFP A;  3SJH A;  1EO1 A;  3KWG A;  3D7E O;  2P9S B;  3HZ6 A;  2NRH A;  4JHD B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...