2H3GX

Structure of the type iii pantothenate kinase (coax) from bacillus anthracis
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
254
structure length
247
Chain Sequence
b'MIFVLDVGNTNAVLGVFEEGELRQHWRMETDRHKTEDEYGMLVKQLLEHEGLSFEDVKGIIVSSVVPPIMFALERMCEKYFKIKPLVVGPGIKTGLNIKYENPREVGADRIVNAVAGIHLYGSPLIIVDFGTATTYCYINEEKHYMGGVITPGIMISAEALYSIEITKPSSVVGKNTVSAMQSGILYGYVGQVEGIVKRMKEEAKQEPKVIATGGLAKLISEESNVIDVVDPFLTLKGLYMLYERNA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords BIOSYNTHETIC PROTEIN
publication title Structure of the Type III Pantothenate Kinase from Bacillus anthracis at 2.0 A Resolution: Implications for Coenzyme A-Dependent Redox Biology.
pubmed doi rcsb
source organism Bacillus anthracis str.
molecule tags Biosynthetic protein
total genus 74
structure length 247
sequence length 254
ec nomenclature ec 2.7.1.33: Pantothenate kinase.
pdb deposition date 2006-05-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
X PF03309 Pan_kinase Type III pantothenate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.40 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 2h3gX02
3.30.420.40 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 2h3gX01
3H1VX 3KVGA 2EWSA 2BUPA 4FWPA 4CBUA 3D2EA 1HLUA 1MWMA 4B1UB 5LY3A 2FSKA 3U9ZA 1NGJA 3WQTA 5BREA 1XC3A 3VF6A 1LOTB 3IDHA 3VPZA 3WXIA 4DCHA 3ENOA 4AM6A 4DQ8A 3O1BA 3CHWA 4DHYA 3O8MA 4BROA 4CD1A 1D4XA 1BU6O 3D2FB 1SAZA 2A5XA 2CGJA 3IFRA 5AFUH 3CERA 3FZMA 2HF3A 2NLXA 3J8AA 4BC5A 1HX1A 3H46O 2ZGYA 4CZMA 3BF3A 3JXUA 2FF6A 3EL2A 3L0QA 1QQMA 5F2RA 3H3NO 4K43A 5CE3A 3AY9A 2CGKA 2BTFA 2GUPA 5AQVA 4PL7A 3HTVA 1NMDA 1NGFA 5KPZA 1QQNA 3D2FA 4B1ZA 3WEEB 5FPDA 5AQOA 4IXCA 4CZGA 2QXLA 4LC9B 4JAXA 2A40A 4K41A 3CETA 4H5VA 4FWKA 1GLDG 3CJ1A 4EHUA 4JHDB 1HPMA 4FWLA 3DXKB 1S22A 3L4IA 5BPLA 5KPRA 2Q36A 2QW9A 4H0OA 4PL8A 4F9OA 2P9PB 3WEEA 1JCEA 3W0LA 4IZ9A 3I33A 1NGAA 2KHOA 4BQLA 1C0FA 5AQFA 1BUPA 4H03B 2A3ZA 3BF1A 3O1WA 3U9DA 5BPNA 4BG9A 4XH5A 1NGHA 4A2BA 3UE5A 4JHDA 2Q31A 4A62A 2CH5A 1K8KB 4FPBA 3LDPA 2ITMA 4JN4A 1NGCA 3H45C 1XQSC 2P9PA 4H0YB 3F9MA 4FOEA 2V7ZA 4O8KA 3C7NB 3M3ZA 4Y0WA 4BVOA 1BOTO 1HUXA 2YHXA 3AARA 3MN6A 5KPTA 1DKGD 3C0BA 4BRPA 2QWNA 1QZ5A 4BRAA 5AQIA 1WOQA 4PKGA 1K8KA 4JD2B 3CJBA 4IJNA 1BA1A 3ZEUB 3WT0A 3QDKA 4M7XA 4CZEA 2GWJA 3DWLA 3MN7A 1S3XA 3ULEB 1BA0A 3FZHA 4BRKA 2A6AA 3CJ9A 2V52B 5AQLA 2DPNA 5AQXA 1RFQA 4BVPA 3LDQA 4B1XB 4A61A 3VENA 3O6WA 4BRNA 3DXMB 3D7EO 1ATNA 5AFUA 3ZEUA 3SJHA 2P9KB 2ZF5O 4JNEA 1EQYA 2YCHA 3ULEA 1GLBG 3A0IX 3VGMA 4ISGA 2ASMA 1NGEA 3CJCA 2VWBA 1SQKA 2P9UB 4HTLA 3LDNA 4YDUC 5AQMA 4FWSA 1HKCA 4BC4A 3O4WA 3VOVA 1QHAA 4ISEA 4NO7A 5AZJB 5BR9A 3GDQA 2E2OA 5EY4A 3DXMA 4WQ4C 2J4RA 1ATSA 3M1FA 4WQ5C 3P4IA 4FPAA 2H3GX 2P9KA 2FLOA 3JS6A 1X9JA 2Q97A 4RTFD 3VEXA 4QS7A 3EN9A 3ENHA 3LM9A 3W3DA 3EZWA 3LM2A 4BRIA 3CQXA 3ATUA 2NRHA 3EKUA 3ZETA 2P9UA 4BC2A 2GWKA 4MO5A 5JLFA 3ZX0A 1IJJA 1NGGA 2ZWHA 5AZJA 3QBXA 1MWKA 1V4SA 1V4TA 4H0PA 4IJAA 3GBTA 5EVZA 4EIAA 2NZTA 2V51B 2UYTA 1TYQA 3MN5A 3FLCO 5E84A 1H1VA 2FSNA 4WYBA 4CZLA 2ASOA 4J8FA 4K42A 2QWQA 1HKBA 3A8YA 3ID8A 1JCFA 5AQRA 2E88A 4FOIA 1YAGA 4MO4A 3UKRB 3HI0A 1WUAA 4Z94A 4BREA 2GTDA 1DGKN 1MA9B 3FZKA 4BR4A 3WUHA 4BQZA 2WUSA 4B1WB 2ASPA 5ELZA 2YJFA 4A2AA 2HMPA 3SMPA 3UKUB 4CZKA 3L6QA 2CGLA 3KHYA 2I7PA 3RSEB 1T6DA 3GL1A 2D0PA 3GE1A 2D4WA 3UKRA 3VEYA 2W41A 1KAXA 1ZBSA 5AQTA 2HF4A 4IO8A 1BO5O 2VYPA 5AQQA 3VF2A 3UKUA 3VEWA 5AQUA 4CZHA 4BRLA 2A41A 4CBXA 1KXPA 3BEXA 4XH4A 4BR0A 2E8AA 2GEMA 3LDOA 3RSEA 4EFHA 3FGUA 5BN9A 5AQNA 3WXLA 4MLEA 3U8XA 4CZJA 3B8AX 3WQUA 5F1XA 1HJOA 3A5MC 1U2VB 1ZC6A 3VERA 3ZX2A 3I8BA 3MN9A 5AQZA 1MDUB 1TUUA 4CI6A 5F0XA 4BRDA 2A42A 3MMVA 3CI5A 2D0OA 4BRQA 3SLCA 1GLEG 2P9LA 2V7YA 4BGAA 1RGIA 4MLHA 3U4LA 4L3QA 1U2VA 5BPMA 3O80A 1X3MA 1QZ6A 1BWFO 2IIRA 2E1YA 1RDWX 3IUCA 4CZFA 1R59O 3HSCA 5AQWA 4FWNA 3H6EA 1SZ2A 4BG8A 4BRMA 4FWRA 5JICA 5JMVA 1T6CA 3FE1A 1J6ZA 5TKYA 4IWVA 3ZETB 5AQGA 4NB4A 3FFKB 4GY2B 3ATVA 4PKHA 4BR5A 5B8HA 1Q18A 2Q0UA 4BR7A 1KAZA 2Q2RA 2P9IB 4M63C 1NM1A 3R6MA 4B9QA 3CJAA 3QMLA 4EAHD 1TYQB 2FXUA 2PBDA 2ZGZA 3HZ6A 5KQ8A 5KQDA 1ATRA 1KAYA 1GLAG 1Z05A 4E1JA 1NGDA 1JCGA 3H1QA 4BRHA 4FO0A 3A5NC 5AQJA 1BG3A 2P9NA 4H5WA 4RWTA 2F9WA 2HOEA 2P9IA 2VCPA 5EOYA 4PKIA 4BGBA 4BR2A 1Z6RA 4B1VA 3VGLA 2I7NA 5EX5A 4C23A 5ADXH 3VF4A 3SK3A 4FL9A 4K25A 3CJ7A 2E20A 3MK6A 3DJCA 2FSJA 3GOIA 3H3OB 4H5NA 5BN8A 1QQOA 3VGKA 2QWRA 4FSVA 5AQPA 3O08A 4RCHA 3FZLA 5AQKA 2P9SB 3VEVA 3DAWA 4CJ7A 3WXKA 1IG8A 5JLHA 1XUPO 3EO3A 1CZAN 1LCUA 1Y64A 4YDUA 4H5RA 5BRFA 5I9EB 3AAQA 1GLFO 3G25A 5BRDA 5LJVA 2IVNA 3QFUA 4WQ4A 4O5FA 4GNIA 4WQ5A 4H0XB 1E4GT 1YXQA 5EXWA 2P9SA 1T44A 5BRHA 4I6MB 2D1KA 3R9PA 5AZIB 1G99A 5E26A 3BUZB 5FPMA 3ZX3A 1GLJO 3FR0A 1GLCG 4CBWA 1GLLO 3QBWA 3QB0A 4H0VB 4QS8A 2IVOA 3TPQA 5FPNA 2YHWA 4B1YB 3O5BA 3IMXA 2P9LB 4BR9A 2F9TA 1ZXOA 2QWPA 4EHTA 3LDLA 3OHRA 4XH1A 2OANA 3UB5A 4XEIA 2IVPA 2YI1A 2YHYA 1U6ZA 3MDQA 3CQYA 5AR0A 2PAVA 1BDGA 4I6MA 3TU5A 1NLVA 1X3NA 3DXKA 5AZIA 3SMSA 4FWQA 4H5TA 2QWMA 1DEJA 4BRFA 2GELA 2CH6A 3AAPA 5LJWA 5AQHA 2AP1A 1YUWA 3EKSA 2QWOA 5FPEA 2QM1A 1YVNA 3A5OC 4FWOA 4AM7A 4KBOA 3BP8A 4CD3A 4CZIA 3VETA 3M6GA 3R8EA 4H0TB 1HKGA 1ESVA 2Q1NA 2QWLA 3MCPA 1TUYA 1OKJA 3WXJA 3VESA 1NWKA 3QFPA 2YJEA 3FZFA 3C7NA 2W40A 3GG4A 1E4FT 4FWMA 2Q0RA 4BRCA 1NGBA 3D2EB 3LL3A 4QS9A 2AA4A 2P9NB 5AQYA 4BRGA 5ADXA 1P8ZA 2FF3B 4JD2A 1NGIA 3HM8A 4BC3A 4M7YA 2E2NA 3QICA 5AQSA 3A5LC 3KZBA 3HBTA 4DB3A 1NBWA 2E2PA 3S41A 2E1ZA 4ISFA 3VEOA 4HWIA 3CIPA 2E2QA 3VEZA 1C0GA
chains in the Genus database with same CATH superfamily
5CYMA 3LAKA 2HHWA 4BDYA 4BE0A 2O8CA 3D2EA 2FSKA 2VQFK 3U9ZA 1X9SA 3VQ8A 4JYAK 3ZT4A 4CJKA 5DMRA 3TAPA 1T3VA 4AM6A 4JV5K 4DHYA 1RDDA 5T7BA 3D2FB 4IDKA 2I5JA 2ZJQL 4B3TK 4DV1K 3CG7A 3QETA 5KGWA 1WN7A 4MFBA 2P5GA 3RWUA 3D0PA 3FZMA 2HF3A 2NLXA 3THVA 4KO0A 1HX1A 1D9DA 3M8QA 4CZMA 4CE9A 3SAHA 3L0QA 1EETA 4YOTA 2O8EA 2CGKA 2BTFA 2GUPA 5J2MA 3QESA 1UA0A 3O3GA 1GOBA 1OH6A 1QQNA 3D2FA 4JI1K 3WEEB 4KKOA 2QXLA 4LC9B 1FW6A 4DS4A 4DU4A 4CHZA 4FWKA 4KTZA 3CJ1A 4EHUA 1HPMA 1JXBA 3P31A 5M1FA 1S22A 2UXBK 1EKEA 5M1OA 4ELVA 3VN5A 2HBJA 4PL8A 2P9PB 3WEEA 3C95A 3I33A 2KHOA 4BQLA 1L5UA 1BUPA 2A3ZA 4CF0A 3L4QA 4B9UA 2NNWA 1JKHA 4ID1A 1W9HA 4M3UA 1LAVA 2DFEA 4GKKK 4E7IA 1NOYA 2PYJA 3DLRA 2ITMA 1YTUA 3H45C 3J7ZO 3LWLA 1XQSC 2P9PA 4HHTA 1YJNN 3L2RA 4UY8O 2KZZA 3C7NB 3O3FA 4CJRA 3AARA 3C0BA 3O9RA 4DV7K 4N5SA 2ATQA 5CR4A 1S1TA 4W5OA 1DT9A 2PFUA 4RW6A 3QDKA 4M7XA 1JL2A 3C65A 5KI6A 1BA0A 4OX9K 1ZBLA 2V52B 5AQLA 2HNYA 3B6OA 1ILYA 1OH5A 3OYDA 4FVMA 4BRNA 1WSIA 3V4IA 3LWMA 3DXMB 1WSHA 5AFUA 1ASUA 3SJHA 1W2BM 2ZF5O 1EQYA 2YCHA 1GLBG 3A0IX 4H4MA 4KFBA 3VQ5A 1Q7YO 4ISGA 3EYZA 4K8ZA 4WE1A 2VWBA 3IG1A 2P9UB 4HTLA 4YDUC 1HKCA 3PO4A 3VOVA 1S9GA 4C1NK 5EU7A 3O9UA 3DXMA 1ATSA 4CW7B 1KFSA 2QKKA 3JS6A 2FLOA 4JEPA 4RTFD 4CF8A 1T8EA 4LY7A 3AO5A 4QS7A 1VQNN 3KD5E 1E3MA 2KFZA 3HSTB 3VQ7A 2P9UA 3HRGA 4LH4A 4DR4K 1BIUA 2GWKA 4DV5K 3C94A 1NGGA 1V4SA 1QSSA 5EVZA 4EIAA 2NZTA 3PIPL 3MN5A 3FLCO 2XY5A 4CJUA 3CD6N 4J8FA 1BGXT 3ID8A 5AQRA 3E9PA 4FOIA 2OTJN 3HYFA 1WUAA 1NK5A 2GTDA 1DGKN 1J5OA 5ELZA 3LDSA 1VQ8N 3SMPA 3UKUB 3VMFB 3B6PA 3L6QA 1EXQA 2CGLA 4DTUA 2D4WA 2OPPA 4XIUA 2O8DB 1KAXA 1ZBSA 3U3GA 3G4SN 1K6YA 1IBKK 1WLJA 3CFOA 4DSJA 4DQIA 5AQQA 3ZT2A 3UKUA 4FW1A 2P5OA 3IAYA 4XH4A 1B9FA 4FLWA 3D6RA 4CHOA 3IRXA 5AQNA 4MLEA 3ASMA 4RW7A 5F1XA 2O8DA 4CHQA 2OPRA 3VERA 3QIOA 3MN9A 3NGYA 4I9QA 1RDCA 5AQZA 2HB5A 4DQSA 3CI5A 1SKSA 4CJSA 4DWIA 4JRQA 2NRRA 4FJIA 3T69A 3LP2A 1CXUA 4NLBA 3P83D 1YJWN 2ZJRL 1D5AA 4AH9A 4YY3K 5BPMA 5KGXA 1BWFO 1XWLA 3AV9A 2KZMA 3F9KA 4DTSA 1SKWA 4CZFA 4Z4HA 1WSJA 2IGIA 1R59O 4FWNA 4KH6A 3OBYA 1J6ZA 4IWVA 3P1GA 3J81O 3ZETB 3RR7A 4GY2B 3LANA 4PKHA 3LAMA 1QE1A 1RDUA 1Z25A 4I2PA 4B8CA 3P5JA 3MX5A 4A57A 3AVIA 1C1AA 5FRMA 4E7KA 1TYQB 3VQAA 3HZ6A 1KCFA 2XO7A 1ATRA 3OS2A 4B3RK 4OLAA 2HSTA 2OTLN 1NGDA 3S3OA 3AVLA 3H1QA 4BRHA 4FO0A 5AQJA 2P9NA 1W0HA 1RT3A 4RWTA 3DM2A 4PKIA 1Z6RA 2I7NA 3SK3A 2Z1JA 5C25A 1KVBA 4FL9A 3CJ7A 4A5AA 3SUQA 4DFKA 4I2QA 1X9WA 4FJKA 1NJIO 4H5NA 4CJ4A 3VGKA 4DQQA 2QWRA 5AQPA 3VQ4A 1XMOK 4V19S 1VAZA 3FZLA 1VQ9N 4JI2K 3M8RA 4OLBA 4GV6A 4CF9A 4DSKA 1CZAN 3SZ2A 2O8BB 2QTDA 2UUAK 4H5RA 5I9EB 1GLFO 1SUQA 4CJVA 2G8IA 3QFUA 2KLAA 4O5FA 2OZSA 3RRGA 4FJ9A 3EY1A 1T44A 3R9PA 3ZT3A 5AZIB 1G99A 3BUZB 3OYGA 3FR0A 2O8BA 4CEBA 3TPQA 4MDBA 1NK9A 4IG0A 2W6KA 2FBTA 3IMXA 5FDLA 2F9TA 1ZXOA 2QWPA 4EHTA 4XH1A 1DLOA 4Z0UA 2IVPA 2D5RA 4KB1A 4BACA 3CQYA 5AR0A 3SBGA 4RG8A 1VSJA 4DTPA 5I3UA 1JXEA 4KH5A 2HHUA 1BDGA 1RT7A 5C0YA 1EO1A 4JK7A 1NLVA 3SCXA 5AZIA 3NDKA 1WBBA 4A5BA 4FWQA 2QWMA 5KTQA 4BRFA 4KHPK 3OS0A 2YKMA 3TAQA 1YUWA 4CK3A 3EKSA 3CCUN 3MWPA 1RT6A 1YVNA 3HP9A 4EP4A 3V1QA 5FRNA 1NKBA 4KBOA 4KTQA 5GINA 3KD1E 3R8EA 3JAMO 4PY5A 1Q9XA 3UIQA 2QWLA 2IC3A 3MCPA 4M3RA 4N76A 2P1JA 1KLNA 4FJHA 1NOZA 4FJLA 3S3MA 1U4BA 3ZSQA 2G8FA 4AILC 3CC2N 3OA9A 3TANA 2Q0RA 3I0RA 4DSEA 4BRCA 3VQCA 1YITN 3K5OA 1D9FA 4AQYK 5ADXA 2FF3B 3DOKA 1CZ9A 1IBMK 1U48A 2Y1JA 3QICA 1NU0A 3A5LC 3NVMA 1NJXA 3HBTA 1NBWA 3S41A 2E1ZA 4ISFA 3VEOA 2WTUA 4F2SA 3CXCM 1QS4A 3MXIA 3ZSZA 1C0TA 3E66A 1HLUA 1NKEA 3M8PA 4YFUA 1NGJA 2F96A 4W5TA 1XC3A 3VF6A 3OYAA 2W42A 1KVCA 3O9TA 4QCLA 3SAFA 3O1BA 4JS4A 4MDAA 3KLHA 1D4XA 4WF9L 3K59A 1SAZA 3IFRA 4E1NA 4DG1A 3RMBA 4JKDA 3CERA 3J8AA 3NGZA 4O5BA 1Q9YA 4GKJK 2HVHA 4BC5A 1VSDA 4Q0BA 3WNHA 1RBVA 3NAEA 4FJXA 1VSMA 4WFAL 4BDPA 5F2RA 2OPSA 4K43A 4C8MA 3AY9A 5AQVA 3OJUA 1JLCA 1NGFA 3RMCA 5FPDA 4JK8A 1HNZK 4N56A 5AQOA 4E3SA 4CZGA 4IEEA 3KK7A 1OVYA 2WONA 2A40A 3SQ2A 4IBNA 3ZSWA 3QEWA 1KC8O 3PSIA 4OKJA 3THYA 4F3TA 3NBPA 4AHVA 1HYVA 5KPRA 3L3VA 1Z26A 2QW9A 3CC7N 4F9OA 2BE2A 1YT3A 3CCQN 1VQ5N 2G8UA 3ULDA 3F5TA 5AQFA 3MX2A 2VWKA 1QSYA 2KQ2A 3EE8A 4BG9A 3OYJA 1LW2A 4EP5A 1K73O 4CJWA 3UE5A 1TVRA 1C6VA 1HNIA 1A5XA 2Q31A 4A62A 4DLEA 2Q3SA 3AVGA 4LFBK 4JN4A 3MAQA 1NJYA 1RT2A 4H0YB 4IOCL 4DTRA 4X64K 4FM2A 5JVGL 2V7ZA 2RF2A 3M3ZA 1M90O 4O8UA 5KPTA 1DKGD 5IT9O 1VRUA 5C24A 4IO9L 2QWNA 3NF8A 5AQIA 4JD2B 1K9MO 4IJNA 1SL1A 4CZEA 2GWJA 3MN7A 4DFJA 3AA2A 1S3XA 3ULEB 1I3AA 4KV8A 4DSFA 3K9KA 5HLFA 4LFAK 1IO2A 2A6AA 3CJ9A 4DTMA 1T7PA 2ZM6K 4BVPA 4IOXA 4HUGA 1ZBHA 4YOVA 3VENA 4JKEA 3OYCA 2WFBA 1HQUA 1ATNA 1W7AA 3O9QA 3DLEA 2P9KB 4JNEA 5A2QO 3ULEA 3VGMA 3HJFA 3CPWM 4BDZA 1KTQA 2ASMA 3DRRA 4FWSA 5HL7L 1QHAA 4C1NI 4JKAA 4ISEA 3GDQA 2E2OA 3N4PA 2O8EB 1DTQA 4WQ4C 2J4RA 2OPQA 3RR8A 2P9KA 4CFDA 4OKKA 2IS3A 2F8TA 1RDBA 3CFPA 3ENHA 3LM9A 3OTOK 3W3DA 3LM2A 4BRIA 5JVHL 3CQXA 2NRHA 4BC2A 4O4GA 4FJ5A 2G8VA 4I9LA 4PQUA 1BCOA 3KLGA 4MO5A 5JLFA 1I94K 4IKFA 3ZX0A 4KHWA 3NE6A 1XHZA 3QBXA 4O55A 1MWKA 1RT1A 2O4IA 1S1WA 4JKGA 1KSPA 2V51B 3LZJA 3SJJA 1H1VA 5C15A 1UAXA 3I55N 3NH2A 3A8YA 4NXNK 2IDOA 2UUCK 3PUFA 3IS9A 2WUSA 4B1WB 5AJ3K 4E7LA 1BCMA 4A2AA 3L3UA 3PX4A 3LZIA 2NRWA 5CY4A 4M45A 3ZSYA 1YF5L 4C8KA 3GL1A 4W5QA 4Z4CA 4FJJA 3KLFA 4OO1J 5AQTA 1TL1A 1L3UA 4RW9A 1BO5O 5KRSA 1RCHA 1RBTA 4LF9K 1VQPN 3CPEA 2OA8A 2Z1HA 1J9AA 4LSNA 4CZHA 1X9MA 4GMJB 2E6LA 1NG9A 3BEXA 4BR0A 2E8AA 3LDOA 4EFHA 4CCHA 3ID6A 1NK4A 4LF7K 3WQUA 4DTXA 3A5MC 1U2VB 3I8BA 3LP1A 3PO5A 4J2DA 4CI6A 5F0XA 4ILJA 3SNNA 3SLCA 3SUNA 4CFAA 3VA3A 3PLAA 2P9LA 1HYSA 3CCVN 3U4LA 4L3QA 4BE1A 4JKHA 1U2VA 2RPIA 2GX9A 3O80A 1GOCA 4DKWA 1X3MA 2HHSA 3J7AP 2IIRA 2E1YA 4FVUA 2X6SA 4CJ3A 2HHTA 4DSIA 5H1SQ 4B3OA 5AQWA 2AJQA 3H6EA 3C6AA 3C6UA 4FWRA 5JICA 3C6TA 4RW8A 2WBNA 3FE1A 1HRHA 1VSFA 3FFKB 4AHRA 4DMNA 2XY6A 4YOUA 4FJ7A 2Q2RA 3KLIA 2P9IB 4M63C 3R1XA 3TARA 1NM1A 4B9QA 4MQ3A 3QMLA 4FLYA 2IOCA 4JI0K 2ZGZA 5LL6Z 3KWGA 1GLAG 4E1JA 4DU3A 4JI5K 4K0KK 1K8AO 4QOZB 1XNQK 1QVGM 2HHXA 2JGUA 2P9IA 5EOYA 3ZT1A 1LV5A 4LH5A 1TK5A 3QEIA 3VGLA 4C23A 3LP3A 5J2QA 3OBWA 3VF4A 4KHQA 4FJGA 4K25A 3TI0A 2E20A 3NF6A 3DJCA 2FSJA 3GOIA 3RMDA 4H8KA 4B9LA 1LW0A 4FZYA 2YHBA 4LF5K 4CEFA 1XUPO 3SI6A 4FXDA 3ZSRA 3QINA 4FLXA 4DF4A 4JI7K 1LCUA 1Y64A 5BRFA 4CHNA 4IFEA 2O8FA 4R79A 1RBUA 4FJNA 1R0AA 1T05A 5LJVA 1HNVA 2NUBA 4GNIA 4WQ5A 4CIFA 1E4GT 3O4QA 1WBDA 3NF7A 3AGKA 4I6MB 5BRHA 2D1KA 3KK1A 2OYQA 5FPMA 2P51A 4J2BA 4FLTA 5HRPA 3N4QA 4H0VB 2IVOA 3NGIA 4B9VA 1BQNA 2B4JA 2HBLA 3OYHA 3V9UA 3HK2A 3HPOA 4B3MK 3UB5A 4E7HA 4XEIA 2YHYA 1U6ZA 1YTAA 2PAVA 4I6MA 3J7YP 2E4LA 4M3XA 3DXKA 4Z4FA 4CJPA 1VSKA 1DEJA 3T1YK 5AQHA 4IFVA 2QWOA 1YHQN 1O13A 5DK5A 3BDPA 4JRPA 3OY9A 3BP8A 4BE2A 4CGJA 4CZIA 1RTDA 1REVA 3VQ9A 5FROA 1HKGA 1ESVA 3DRSA 1BIZA 3THWA 1TUYA 5CZ1A 1IKWA 1YJ9N 3DMJA 3QFPA 4E89A 3BZCA 4PUOA 3FZFA 1BHLA 3CYMA 1E4FT 2RHKA 3V1OA 3VQDA 1NGBA 3LL3A 1SS6A 4YHHK 2P9NB 5AQYA 4DU1A 1TV6A 4B9SA 1SV5A 4DR2K 2HBMA 1VQ6N 3NVKA 3KZBA 2KKZA 1LWFA 2VGNA 3TWHA 4KH4A 3M5RA 3KKSA 3VEZA 3NCIA 1C0GA 5TKWA 3KVGA 4B1UB 5LY3A 4KAZA 3OVNA 1Q86O 5BREA 3NHGA 3IDHA 3VPZA 3WXIA 4DCHA 4LF6K 3JSMA 3ENOA 4HCBA 4DQ8A 3CHWA 1QQCA 3O8MA 2QK9A 3FFIA 4O0IA 4DFPA 3PX0A 3VQEA 2ZD1A 3L8BA 2HHVA 2CGJA 5AFUH 1RT4A 4O44A 2QI2A 1FJGK 4NLCA 1NJWA 1IKVA 1S6QA 3KLEA 1MU2A 4WCEL 1RTIA 3EL2A 1QQMA 2O4GA 3H3NO 3MCAB 5CE3A 3SQ4A 2FBVA 4PL7A 1TAQA 3DLGA 1NMDA 4F4KA 4JI3K 5KPZA 5C2DA 3OW2M 1NK6A 2YNGA 4DR1K 3O3HA 4BWJA 3I8DA 4JAXA 2JLEA 3MEEA 3CCJN 4DLGA 4E19A 3AA5X 3CETA 1IKXA 1VQKN 3S9HA 5HRNA 1S6PA 3DLHA 1GLDG 5GAEP 4JHDB 4FW2A 5IWAK 3L4IA 5BPLA 1S9EA 2Q36A 1JLQA 4H0OA 3I0SA 4W5RA 3O9SA 3K58A 3K5MA 4JS5A 1NGAA 1C0FA 3BGRA 3O1WA 4H03B 3U9DA 4XH5A 1CXQA 4CJLA 1WSEA 3OS1A 1WB9A 1RBRA 4CERA 4JHDA 2B6AA 4ELUA 2QA4N 1K8KB 4CK1A 5M1PA 4CF1A 1ZYQA 1NGCA 1D8YA 4CECA 3DI6A 1A5VA 1IBLK 1NKCA 3L2QA 4LF8K 2VQEK 3AO2A 4Y0WA 2YHXA 1JLFA 3MN6A 4JKFA 5FLXO 3K0SA 3AVBA 1LWEA 4ZTFA 3DRPA 1N32K 4U7BA 4W5NA 4BRAA 3LALA 3ISNC 1K8KA 3OYIA 4DSLA 3ENBA 1X1PA 1HMVA 2YKNA 1RBSA 3FZHA 4YOWA 3M8SA 1RTHA 2DPNA 5AQXA 5CYQA 1RFQA 3LDQA 4C8NA 1WAJA 4A61A 2ITGA 4CF2A 1CLQA 4UQGA 4NXMK 3EZ5A 3WNGA 3OJSA 4ZTJA 1U45A 1Q81O 1NGEA 3NF9A 1SQKA 4HUFA 4YORA 1JLGA 4FK4A 4NO7A 5BR9A 3CF5L 3C6HA 3G10A 4QAGA 3M1FA 4CJQA 2GBZA 3P4IA 4FPAA 5M1NA 1X9JA 2Q97A 3QO9A 3LPUA 3VEXA 2E5LK 3EZWA 2EHGA 2BDPA 1BL3A 5K14A 3G6EN 4K8XA 3KKRA 3THYB 1IJJA 4CESA 5C10A 2PZSA 3T1AA 3PIOL 1V4TA 4OGCA 4IJAA 1KVAA 1YIJN 1IG9A 2UYTA 3CCRN 4KI6A 4ICLA 4GV3A 4WYBA 4CZLA 2ASOA 4J2AA 2QWQA 1HKBA 1SL2A 4CJEA 3AVCA 5HRSA 1TK8A 3TAMA 1IH7A 3RVCA 3OYKA 3FZKA 3S3NA 4CJTA 3TR8A 3WUHA 3AO3A 1KLMA 5D3GA 2PYLA 2HMPA 5M1QA 4CVNE 1JLBA 4CZKA 1WAFA 4YNQA 3DLLL 1T03A 3QNOA 5C12A 4CGFA 3KHYA 3F2KA 3V6DA 1T6DA 4FM1A 3RRHA 2D0PA 3RTVA 2W41A 4B08A 4DV2K 3G71N 4U67L 2VYPA 1SKRA 3VEWA 5AQUA 2KFNA 2GV9A 3ZSXA 3EE9A 3ZSVA 2YNHA 4JI8K 2GEMA 3FGUA 5BN9A 1JJ2M 4CZJA 4Y1DA 3V9WA 5DM7L 2ZQBA 1TAUA 3ZX2A 3DOLA 4Y1CA 3BZKA 5JS2A 4BRDA 1KQSM 4NCAA 3MMVA 4IOAL 2D0OA 5J2NA 1VQMN 4CEDA 1GLEG 2HNZA 3K9JA 4CFCA 4R5PA 1RGIA 4MLHA 3VQPA 2X78A 5LMUK 3V9ZA 4OVLA 4OPJA 4EZ6A 1J54A 2UXCK 3PSFA 1RDWX 1L3SA 4O0JA 4FJ8A 4HVJA 3HSCA 5HRRA 4DTJA 1C0UA 3E01A 3F73A 4BG8A 3CM5A 4BRMA 1N34K 5JMVA 3HPHA 4B9NA 5TKYA 3HL8A 4IDHA 2X74A 4DS5A 3ATVA 4JKCA 4BR5A 2BH1A 2Z1GA 4CIGA 5I42A 4BR7A 3MECA 3HXMA 1A5WA 4E1MA 4JKGB 1UWBA 4EAHD 4M41A 4ZHRA 2FXUA 2HHHK 1KAYA 3G0ZA 2WC9A 3NFAA 1EX4A 4NCBA 4OPAA 3Q7CA 4AHTA 5E41A 1BG3A 4H5WA 2HMIA 4M42A 3AO1A 3NMUA 1KFDA 2F9WA 2VCPA 4BGBA 4BR2A 1F21A 4OKEA 2OCEA 4GV9A 5ADXH 3HOTA 3V81A 2D0AA 4CEQA 4FZXC 5BN8A 1HQEA 1QQOA 1J53A 4FSVA 4RCHA 1Q82O 1J5EK 5AQKA 3VEVA 3AVJA 3DAWA 4CJ7A 4X62K 3SAGA 4AF1A 5CHIA 3EO3A 1DTTA 1NNEA 1RNHA 4YDUA 4B9MA 3AAQA 1L3TA 1OH8A 3CCMN 3G25A 5BRDA 2VG5A 4PHTX 4B8AB 3OYBA 5HOOA 3QEXA 5CZ2A 3SQ0A 4LF4K 1KRPA 1TGOA 3WXMB 2UU9K 5E26A 3MEDA 1GLCG 4CBWA 1GLLO 3QBWA 3QB0A 4QS8A 4CJFA 3VTHA 2YHWA 3O5BA 2P9LB 4BR9A 4CEOA 3WNFA 1CZBA 3LDLA 2EX3A 2OANA 2HW3A 2A1SA 3MDQA 2HVIA 3D45A 4JKBA 1VSIA 3OYEA 3VQBA 3TU5A 1VSHA 4KTWA 1X3NA 4LFCK 3SMSA 3CM6A 4H5TA 3MXJA 2X6NA 1BI4B 2GELA 4HCCA 2YX6A 5LJWA 2YV0X 3DYAA 3KIOA 2UXDK 1M1KO 2GUIA 3TAGA 4Z4EA 4FWOA 1VHXA 3KWIA 4KHNA 1P90A 4CD3A 4FZZA 3VETA 3M6GA 3U6FA 4IG3A 4B9TA 1EWRA 2XY7A 1BI4A 4DTOA 5GAGP 5J2PA 3VESA 3QLHA 2ZJPL 3TAFA 4OJRA 1ZBFA 2YJEA 2QKBA 3K2PA 3C7NA 4DUYK 1XHXA 4FWMA 3P38A 2VGMA 1HPZA 3HP6A 4FK2A 3SBTA 3L2WA 3H08A 3EEQA 1XNRK 1N5YA 1NGIA 4M7YA 2E2NA 5AQSA 2QEXN 1HJRA 4DB3A 1VQ4N 2DFFA 4HWIA 3CIPA 4M3YA 4M3TA 2E2QA 4KHYA 3H1VX 3Q7BA 2UUBK 2EWSA 2BUPA 4ILGB 4FWPA 4CBUA 2DY4A 1MWMA 3ZSOA 3V1RA 1S1XA 1EWQA 3WQTA 1LOTB 4BROA 4CD1A 1BU6O 2DFHA 3CMAN 3TAEA 2A5XA 2QXFA 2XRIA 5GAHP 3AVNA 2O8FB 2LSNA 3I56N 3SYZA 3CMEN 3ZLJA 4OPKA 2B5JA 1BISA 3H46O 4OGEA 2ZGYA 3BF3A 3JXUA 2FF6A 3THXB 4CHYA 3KTQA 3E1YA 3HTVA 4B1ZA 4B3SK 4DR7K 4IXCA 1TKXA 2OZMA 1U47A 4FCYA 4K41A 1VQ7N 4OPHA 4X66K 4H5VA 4L8RB 4H4OA 5GIOA 3TSPA 4ID5A 4CEAA 3OYNA 2XHBA 4Q5VA 3THXA 3T7ZA 4FWLA 4GVEA 3DXKB 4Z4IA 4NYFA 3A2FA 3HOSA 1S5JA 3OYLA 1JCEA 3W0LA 4IZ9A 5KRTA 4DV4K 1I39A 2PY5A 2Y1IA 2NRXA 4CGHA 3BF1A 5BPNA 4CEEA 1NGHA 4A2BA 1JL1A 4CIEA 3J80O 4DTNA 2HHQA 2CH5A 1NK8A 4FPBA 3LDPA 3THWB 3K57A 4LSLA 4DV0K 3IKMA 3F9MA 4FOEA 2JWLA 3MWTA 2YNFA 4ILHA 1HYZA 4O8KA 1C1CA 4BVOA 1BOTO 1HUXA 4BRPA 4CHPA 1QZ5A 2HNDA 1GOAA 1WOQA 4PKGA 3CJBA 4Z4GA 1BA1A 3CFRA 3ZEUB 1VSLA 3WT0A 4DFMA 3TSQA 4CJ5A 4DF8A 3DWLA 3TSUA 3ZCMA 4NYNA 4FYDA 4BRKA 4YOXA 1FKPA 3CQ8A 4B1XB 3SPYA 3DLKA 2D0CA 3T19A 5JS1A 3O6WA 1ASWA 3D7EO 3DLBA 3ZEUA 3HPGA 1RDAA 2VG6A 5C2FA 3CJCA 1N36K 3LDNA 5AQMA 5SZTA 4BC4A 3O4WA 3PX6A 4FM0A 4JLHA 4FLZA 3VQQA 5AZJB 5EY4A 4BY9C 4WQ5C 1TKTA 2HBKA 4DR3K 2H3GX 3SUPA 5HP1A 3ALYA 3E9OA 1IKYA 1IV0A 4KPYA 4E0DA 1O1WA 3EN9A 1OH7A 3ZETA 3ATUA 3EKUA 3VQ6A 1TKDA 1HNXK 2R7YA 2XY8A 2ZWHA 5AZJA 3QNNA 4FLVA 5DM6L 1XMQK 4H0PA 3QEVA 3GBTA 1NK0A 2ZE2A 1TYQA 4JI6K 5E84A 4FLUA 4BWMA 4PA1A 1HNWK 2FSNA 2F8SA 2YHAA 4K42A 2G8WA 1W97L 3AA3A 3AVAA 4DR5K 1JCFA 4RW4A 1N6QA 2E88A 3UKRB 1ITGA 1YAGA 4MO4A 3HI0A 5C42A 1SL0A 4Z94A 4BREA 1S1UA 1MA9B 4BR4A 3L2VA 4BQZA 1N33K 2ASPA 1ASVA 2YJFA 3VA0A 3V9XA 4DV6K 2E6MA 2NRTA 4HTUA 1N8RO 1NK7A 2I7PA 3RSEB 4G9ZA 1WNSA 4KB0A 3GE1A 4CK2A 3K5NA 3O4NA 3AVHA 3UKRA 3VEYA 4CGDA 3TABA 1TK0A 4C8LA 2KW4A 4JI4K 1VRTA 1U49A 4DQRA 2HF4A 4IO8A 3AVKA 1Y97A 1UOCA 3KJVA 3VF2A 2RE2A 3TTCA 1KD1O 4ELTA 3HM9A 4BRLA 1FKOA 1RT5A 2A41A 4CBXA 1KXPA 2KTQA 5HROA 3CCEN 3RSEA 4DV3K 3WXLA 3BY5A 4KHSA 4DR6K 3U8XA 3B8AX 2FC0A 1HJOA 1ZC6A 4AHUA 2VWJA 2RKIA 5SWMA 5MLCQ 1QVFM 1MDUB 1TUUA 4M3WA 4N47A 2A42A 5M1KA 4BRQA 4G1QA 3AVFA 2VG7A 2V7YA 4BGAA 4HUEA 1VK0A 3VTIA 3QEPA 4PWDA 2ETJA 4F8RA 3KK2A 4AHSA 1QZ6A 1HR0K 4F3OA 3IUCA 2D0BA 4N41A 2BANA 5HBMA 1TKZA 1SZ2A 3V9SA 1XI1A 2NRZA 2RN2A 4F2RA 4WFBL 1T6CA 4WFNL 4IFYA 4TSXA 3AO4A 5AQGA 1WSGA 4NB4A 4CGGA 5B8HA 1Q18A 1S1VA 1ZBIA 2Q0UA 1RTJA 3ZYYX 5LMNK 3MEGA 1KAZA 1JLAA 3R6MA 3CJAA 3JYTA 3AVMA 3R3LA 2DTUA 3SPZA 4X65K 2PBDA 3KK3A 4J2EA 5KQ8A 1VQLN 5KQDA 4GVMA 1YVUA 1LAWA 2FBXA 1Z05A 5BR8K 3TTFA 2G8HA 1JCGA 3MXMA 3A5NC 4LD0A 4E7JA 2HOEA 2FBYA 4CEZA 4B1VA 1TL3A 3LP0A 5EX5A 5GIPA 3TTDA 1UA1A 3WNEA 1VSEA 3AA4A 3LPTA 3MK6A 3T1HK 2NRVA 3H3OB 1U04A 4KI4A 3O08A 3CC4N 2P9SB 3P39A 3WXKA 1IG8A 5JLHA 1BQMA 3RMAA 1G15A 1QTMA 3HO1A 2IAJA 3CCSN 3ITHA 1XC9A 4DQPA 3HVTA 1ZBUA 1RILA 2A1RA 2IVNA 5J1EA 1OVQA 4WQ4A 3SUOA 2WOMA 4H0XB 1YXQA 5EXWA 3L2UA 2P9SA 3ZX3A 1GLJO 1YI2N 1FK9A 2Z1IA 1LWCA 4C8OA 3OYMA 4EZ9A 1C0MA 5FPNA 1VQON 3U3YA 4B1YB 2G8KA 4KREA 1FXXA 3NH1A 1Q8IA 4CGIA 2F7TA 4KRFA 3OHRA 1L3VA 4NCGA 3K5LA 3SV4A 3QERA 2YI1A 3SV3A 1QHTA 4A59A 1NJZA 4CFBA 3PV8A 1WSFA 1C1BA 2CH6A 3AAPA 4GW6A 1B92A 2W6LA 2AP1A 4JK9A 1S72N 5FPEA 2QM1A 3A5OC 3T3FA 4AM7A 2YNIA 3HVRA 3SQ1A 1B9DA 4H0TB 4YOYA 2Q1NA 3HT3A 3OYFA 1OKJA 1EP4A 3WXJA 1NWKA 4AHCA 4M3ZA 3AGRA 1QSLA 3PY8A 3ZT0A 2W40A 3GG4A 4I7FA 2O8CB 3D2EB 1NMNA 4QS9A 2AA4A 4BRGA 2JWKA 1P8ZA 4DUZK 1JLEA 3E9LA 4JD2A 4FK0A 3HM8A 4BC3A 2F4VK 4IEIA 4FJMA 3NH0A 2E2PA 2BGGA 4KHUA 5GADP 3QIPA 3CCLN
chains in the Genus database with same CATH topology
3H1VX 5TKWA 3KVGA 3CXCM 3Q7BA 2EWSA 2BUPA 4ILGB 4FWPA 4CBUA 3D2EA 1HLUA 1MWMA 3E66A 4B1UB 5LY3A 2FSKA 3U9ZA 1NGJA 1Q86O 3WQTA 5BREA 1XC3A 3VF6A 1LOTB 3IDHA 1T3VA 3VPZA 3WXIA 4DCHA 3O9TA 3ENOA 4AM6A 4DQ8A 3SAFA 3O1BA 4MDAA 3CHWA 4DHYA 3O8MA 4BROA 4CD1A 1D4XA 1BU6O 3D2FB 4WF9L 2ZJQL 1SAZA 3CMAN 2A5XA 5GAHP 2CGJA 3I56N 3IFRA 5AFUH 2QI2A 3CMEN 4JKDA 3CERA 4NLCA 3FZMA 2HF3A 2NLXA 3J8AA 4BC5A 1HX1A 3H46O 2ZGYA 4CZMA 3BF3A 4WCEL 3JXUA 3SAHA 2FF6A 3EL2A 4WFAL 3L0QA 1QQMA 5F2RA 4YOTA 3H3NO 4K43A 3MCAB 3AY9A 2CGKA 2BTFA 2GUPA 5AQVA 5CE3A 4PL7A 3E1YA 3HTVA 1NMDA 1NGFA 5KPZA 1QQNA 3D2FA 4B1ZA 4JK8A 3WEEB 5FPDA 5AQOA 4IXCA 4CZGA 4IEEA 5C2DA 2QXLA 3OW2M 4LC9B 3KK7A 1OVYA 4JAXA 3CCJN 2A40A 4K41A 1VQ7N 4OPHA 3CETA 4H5VA 1VQKN 5GIOA 1KC8O 4FWKA 3TSPA 1GLDG 5GAEP 3CJ1A 4EHUA 4JHDB 1HPMA 3T7ZA 4FWLA 4GVEA 3DXKB 3P31A 5M1FA 1S22A 3L4IA 5M1OA 5BPLA 5KPRA 2Q36A 3HOSA 2QW9A 4H0OA 3CC7N 2HBJA 4PL8A 4F9OA 2P9PB 3WEEA 3O9SA 1JCEA 3W0LA 3CCQN 1VQ5N 4IZ9A 3I33A 1NGAA 2KHOA 4BQLA 1C0FA 3F5TA 5AQFA 2NRXA 1BUPA 3MX2A 4H03B 2A3ZA 3BF1A 3EE8A 3O1WA 3U9DA 4BG9A 5BPNA 3L4QA 4XH5A 1NGHA 2NNWA 4A2BA 1K73O 3UE5A 4JHDA 2Q31A 4A62A 2CH5A 2QA4N 1K8KB 4FPBA 3LDPA 2ITMA 5M1PA 4JN4A 1NGCA 3H45C 3IKMA 3J7ZO 1XQSC 2P9PA 4H0YB 4IOCL 3F9MA 4FOEA 2JWLA 3MWTA 1YJNN 4UY8O 4ILHA 5JVGL 2V7ZA 4O8KA 3C7NB 3M3ZA 4Y0WA 1M90O 4BVOA 1BOTO 1HUXA 2YHXA 3AARA 3MN6A 4JKFA 1DKGD 4O8UA 5KPTA 3C0BA 3O9RA 4BRPA 4U7BA 4IO9L 2QWNA 1QZ5A 4BRAA 5AQIA 5CR4A 1WOQA 4PKGA 1DT9A 1K8KA 4JD2B 1K9MO 2PFUA 3CJBA 4IJNA 1BA1A 3ZEUB 3WT0A 3QDKA 4M7XA 3TSQA 3ENBA 4CZEA 2GWJA 3DWLA 3MN7A 1S3XA 3ULEB 3TSUA 3C65A 1BA0A 3FZHA 3K9KA 4BRKA 4YOWA 2A6AA 3CJ9A 2V52B 5AQLA 4YOXA 2DPNA 5AQXA 1RFQA 4BVPA 3LDQA 4IOXA 4YOVA 4B1XB 4A61A 1ILYA 3VENA 4JKEA 3O6WA 4BRNA 3DXMB 2WFBA 3D7EO 1ATNA 5AFUA 3ZEUA 3O9QA 3SJHA 1W2BM 2P9KB 2ZF5O 4JNEA 1EQYA 2YCHA 3ULEA 1GLBG 3A0IX 3VGMA 3CPWM 1Q7YO 4ISGA 5C2FA 1Q81O 2ASMA 1NGEA 3CJCA 2VWBA 1SQKA 2P9UB 4HTLA 3LDNA 4YDUC 5AQMA 4FWSA 1HKCA 4BC4A 3O4WA 4YORA 3VOVA 5HL7L 1QHAA 4C1NI 4JKAA 4ISEA 4NO7A 5AZJB 4C1NK 5BR9A 3O9UA 3GDQA 2E2OA 3CF5L 3N4PA 3C6HA 3DXMA 4WQ4C 2J4RA 1ATSA 5EY4A 3M1FA 4BY9C 4WQ5C 2HBKA 3P4IA 4FPAA 2H3GX 2P9KA 2FLOA 3JS6A 4JEPA 5M1NA 3E9OA 1X9JA 2Q97A 4RTFD 3VEXA 4QS7A 3EN9A 3ENHA 3LM9A 1VQNN 3W3DA 3EZWA 3LM2A 3CCLN 4BRIA 5JVHL 3CQXA 3ATUA 2NRHA 3EKUA 3ZETA 2P9UA 3HRGA 4BC2A 3G6EN 2GWKA 4MO5A 5JLFA 3ZX0A 1IJJA 1NGGA 2ZWHA 5AZJA 3QBXA 5DM6L 1MWKA 1V4SA 5C10A 3PIOL 1V4TA 4H0PA 4IJAA 4JKGA 3GBTA 5EVZA 4EIAA 2NZTA 2V51B 2UYTA 3PIPL 3CCRN 1TYQA 1YIJN 3MN5A 3FLCO 5E84A 1H1VA 4GV3A 2FSNA 4WYBA 4CZLA 2ASOA 3CD6N 4J8FA 5C15A 3I55N 4K42A 2QWQA 1W97L 1HKBA 3A8YA 3ID8A 1JCFA 5AQRA 2E88A 3E9PA 4FOIA 1YAGA 4MO4A 3UKRB 3HI0A 1WUAA 2OTJN 4Z94A 4BREA 2GTDA 1DGKN 3RVCA 1MA9B 3FZKA 4BR4A 3WUHA 4BQZA 2WUSA 4B1WB 2ASPA 5ELZA 2YJFA 4A2AA 2HMPA 5M1QA 1VQ8N 3SMPA 2NRWA 3UKUB 4CZKA 2NRTA 3L6QA 3VMFB 1N8RO 2CGLA 3DLLL 5C12A 3KHYA 2I7PA 3F2KA 1YF5L 3RSEB 1T6DA 4G9ZA 3GL1A 2D0PA 3GE1A 2D4WA 3UKRA 3VEYA 2W41A 1KAXA 1ZBSA 3G4SN 3G71N 5AQTA 4U67L 4OO1J 2HF4A 4IO8A 1BO5O 2VYPA 5AQQA 3VF2A 2RE2A 1VQPN 3UKUA 3TTCA 1KD1O 3CPEA 3VEWA 5AQUA 4CZHA 4BRLA 2A41A 4CBXA 1KXPA 3EE9A 3BEXA 4XH4A 4BR0A 2E8AA 2GEMA 3D6RA 3LDOA 3RSEA 4EFHA 3CCEN 3FGUA 3ID6A 5AQNA 5BN9A 3WXLA 1JJ2M 4MLEA 3U8XA 4CZJA 3B8AX 3WQUA 5F1XA 1HJOA 5DM7L 3A5MC 1U2VB 1ZC6A 3VERA 3ZX2A 5MLCQ 3I8BA 3MN9A 5AQZA 1QVFM 1MDUB 1TUUA 4CI6A 5F0XA 4BRDA 1KQSM 2A42A 4ILJA 3MMVA 5M1KA 3CI5A 2D0OA 4IOAL 4BRQA 3SLCA 1VQMN 2NRRA 3PLAA 1GLEG 3T69A 2P9LA 2V7YA 3K9JA 4NLBA 4BGAA 1YJWN 3CCVN 1RGIA 4MLHA 3VTIA 2ZJRL 3U4LA 4L3QA 4JKHA 1U2VA 5BPMA 2GX9A 3O80A 4DKWA 1X3MA 1QZ6A 1BWFO 2IIRA 2E1YA 4FVUA 1RDWX 3IUCA 4CZFA 5H1SQ 1R59O 3HSCA 5AQWA 4FWNA 4KH6A 3H6EA 1SZ2A 2NRZA 4BG8A 3C6AA 3OBYA 4BRMA 4FWRA 5JICA 4WFBL 5JMVA 1T6CA 2WBNA 3FE1A 1J6ZA 5TKYA 4WFNL 4IWVA 3ZETB 5AQGA 4IDHA 4NB4A 3FFKB 4GY2B 3ATVA 4JKCA 4PKHA 4BR5A 2BH1A 5B8HA 1Q18A 4YOUA 2Q0UA 3ZYYX 1RDUA 4BR7A 1KAZA 2Q2RA 3MX5A 2P9IB 4M63C 3R1XA 4A57A 1NM1A 3R6MA 4JKGB 4B9QA 3CJAA 3QMLA 3R3LA 4EAHD 1TYQB 2FXUA 2PBDA 2ZGZA 3HZ6A 5KQ8A 1VQLN 5KQDA 1ATRA 3KWGA 1KAYA 1GLAG 1Z05A 2HSTA 2WC9A 1NGDA 4E1JA 2OTLN 1K8AO 3TTFA 1JCGA 3H1QA 3Q7CA 4OPAA 4BRHA 4FO0A 1QVGM 3A5NC 5AQJA 1BG3A 2P9NA 4H5WA 4RWTA 3NMUA 2F9WA 2HOEA 2P9IA 2VCPA 5EOYA 4PKIA 4BGBA 4BR2A 1Z6RA 4B1VA 3VGLA 2I7NA 5EX5A 4C23A 5GIPA 3TTDA 4GV9A 3OBWA 5ADXH 3VF4A 3SK3A 4FL9A 4K25A 3HOTA 3CJ7A 4A5AA 2E20A 3MK6A 2NRVA 3DJCA 2FSJA 3GOIA 3H3OB 4H5NA 5BN8A 1QQOA 1NJIO 3VGKA 2QWRA 4FSVA 5AQPA 3O08A 1VAZA 4RCHA 3FZLA 1VQ9N 3CC4N 1Q82O 5AQKA 2P9SB 3P39A 3VEVA 4GV6A 3DAWA 4CJ7A 3WXKA 1IG8A 5JLHA 1XUPO 3SAGA 4AF1A 5CHIA 3EO3A 1CZAN 2QTDA 1LCUA 3CCSN 1Y64A 4YDUA 4H5RA 5BRFA 5I9EB 3AAQA 4IFEA 4R79A 3CCMN 1GLFO 3G25A 5BRDA 5LJVA 2IVNA 4PHTX 3QFUA 2KLAA 4WQ4A 4O5FA 4GNIA 5HOOA 4WQ5A 4H0XB 1E4GT 1YXQA 5EXWA 2P9SA 1T44A 3AGKA 4I6MB 5BRHA 2D1KA 3R9PA 3WXMB 5AZIB 1G99A 5E26A 3BUZB 5FPMA 3ZX3A 1GLJO 1YI2N 3FR0A 1GLCG 3N4QA 4CBWA 1GLLO 3QBWA 3QB0A 4H0VB 4QS8A 2IVOA 3TPQA 3VTHA 5FPNA 4MDBA 2YHWA 1VQON 4B1YB 3O5BA 3IMXA 2HBLA 2P9LB 4BR9A 2F9TA 1ZXOA 2QWPA 4EHTA 2F7TA 3LDLA 3OHRA 4XH1A 2OANA 3UB5A 4XEIA 2IVPA 2YI1A 2YHYA 1U6ZA 3MDQA 3CQYA 5AR0A 3SBGA 4JKBA 5C0YA 1EO1A 2PAVA 4KH5A 1BDGA 4I6MA 3TU5A 4A59A 4JK7A 1NLVA 1X3NA 3DXKA 5AZIA 3SMSA 4A5BA 4FWQA 4H5TA 2QWMA 1DEJA 4BRFA 2GELA 2CH6A 3AAPA 2YX6A 5LJWA 5AQHA 2AP1A 4JK9A 1YUWA 1S72N 3EKSA 1M1KO 2QWOA 3CCUN 3MWPA 5FPEA 2QM1A 1YHQN 1O13A 1YVNA 3A5OC 4FWOA 4AM7A 3KWIA 4KBOA 3BP8A 1P90A 4CD3A 4CZIA 5GINA 3VETA 3M6GA 3R8EA 4H0TB 4YOYA 1HKGA 1ESVA 2Q1NA 2QWLA 3MCPA 1TUYA 5GAGP 1YJ9N 1OKJA 3WXJA 3VESA 2ZJPL 1NWKA 3QFPA 2YJEA 3FZFA 3C7NA 3AGRA 3CC2N 3OA9A 2W40A 3GG4A 1E4FT 4FWMA 2Q0RA 2RHKA 4BRCA 3P38A 1NGBA 3D2EB 2VGMA 3LL3A 1SS6A 1YITN 4QS9A 2AA4A 2P9NB 5AQYA 4BRGA 5ADXA 3SBTA 2JWKA 1P8ZA 2FF3B 3E9LA 4JD2A 1NGIA 1VQ6N 2HBMA 3HM8A 4BC3A 4M7YA 2E2NA 4IEIA 3QICA 5AQSA 3NVKA 3A5LC 3NVMA 2QEXN 3KZBA 3HBTA 4DB3A 1NBWA 2E2PA 2KKZA 3S41A 1VQ4N 2E1ZA 4ISFA 3VEOA 2VGNA 4KH4A 4HWIA 3CIPA 5GADP 3M5RA 2E2QA 3VEZA 1C0GA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3H1V X;  3KVG A;  2EWS A;  2BUP A;  4FWP A;  4CBU A;  3D2E A;  1HLU A;  1MWM A;  4B1U B;  5LY3 A;  2FSK A;  3U9Z A;  1NGJ A;  3WQT A;  5BRE A;  1XC3 A;  3VF6 A;  1LOT B;  3IDH A;  3VPZ A;  3WXI A;  4DCH A;  3ENO A;  4AM6 A;  4DQ8 A;  3O1B A;  3CHW A;  4DHY A;  3O8M A;  4BRO A;  4CD1 A;  1D4X A;  1BU6 O;  3D2F B;  1SAZ A;  2A5X A;  2CGJ A;  3IFR A;  5AFU H;  3CER A;  3FZM A;  2HF3 A;  2NLX A;  3J8A A;  4BC5 A;  1HX1 A;  3H46 O;  2ZGY A;  4CZM A;  3BF3 A;  3JXU A;  2FF6 A;  3EL2 A;  3L0Q A;  1QQM A;  5F2R A;  3H3N O;  4K43 A;  5CE3 A;  3AY9 A;  2CGK A;  2BTF A;  2GUP A;  5AQV A;  4PL7 A;  3HTV A;  1NMD A;  1NGF A;  5KPZ A;  1QQN A;  3D2F A;  4B1Z A;  3WEE B;  5FPD A;  5AQO A;  4IXC A;  4CZG A;  2QXL A;  4LC9 B;  4JAX A;  2A40 A;  4K41 A;  3CET A;  4H5V A;  4FWK A;  1GLD G;  3CJ1 A;  4EHU A;  4JHD B;  1HPM A;  4FWL A;  3DXK B;  1S22 A;  3L4I A;  5BPL A;  5KPR A;  2Q36 A;  2QW9 A;  4H0O A;  4PL8 A;  4F9O A;  2P9P B;  3WEE A;  1JCE A;  3W0L A;  4IZ9 A;  3I33 A;  1NGA A;  2KHO A;  4BQL A;  1C0F A;  5AQF A;  1BUP A;  4H03 B;  2A3Z A;  3BF1 A;  3O1W A;  3U9D A;  5BPN A;  4BG9 A;  4XH5 A;  1NGH A;  4A2B A;  3UE5 A;  4JHD A;  2Q31 A;  4A62 A;  2CH5 A;  1K8K B;  4FPB A;  3LDP A;  2ITM A;  4JN4 A;  1NGC A;  3H45 C;  1XQS C;  2P9P A;  4H0Y B;  3F9M A;  4FOE A;  2V7Z A;  4O8K A;  3C7N B;  3M3Z A;  4Y0W A;  4BVO A;  1BOT O;  1HUX A;  2YHX A;  3AAR A;  3MN6 A;  5KPT A;  1DKG D;  3C0B A;  4BRP A;  2QWN A;  1QZ5 A;  4BRA A;  5AQI A;  1WOQ A;  4PKG A;  1K8K A;  4JD2 B;  3CJB A;  4IJN A;  1BA1 A;  3ZEU B;  3WT0 A;  3QDK A;  4M7X A;  4CZE A;  2GWJ A;  3DWL A;  3MN7 A;  1S3X A;  3ULE B;  1BA0 A;  3FZH A;  4BRK A;  2A6A A;  3CJ9 A;  2V52 B;  5AQL A;  2DPN A;  5AQX A;  1RFQ A;  4BVP A;  3LDQ A;  4B1X B;  4A61 A;  3VEN A;  3O6W A;  4BRN A;  3DXM B;  3D7E O;  1ATN A;  5AFU A;  3ZEU A;  3SJH A;  2P9K B;  2ZF5 O;  4JNE A;  1EQY A;  2YCH A;  3ULE A;  1GLB G;  3A0I X;  3VGM A;  4ISG A;  2ASM A;  1NGE A;  3CJC A;  2VWB A;  1SQK A;  2P9U B;  4HTL A;  3LDN A;  4YDU C;  5AQM A;  4FWS A;  1HKC A;  4BC4 A;  3O4W A;  3VOV A;  1QHA A;  4ISE A;  4NO7 A;  5AZJ B;  5BR9 A;  3GDQ A;  2E2O A;  5EY4 A;  3DXM A;  4WQ4 C;  2J4R A;  1ATS A;  3M1F A;  4WQ5 C;  3P4I A;  4FPA A;  2H3G X;  2P9K A;  2FLO A;  3JS6 A;  1X9J A;  2Q97 A;  4RTF D;  3VEX A;  4QS7 A;  3EN9 A;  3ENH A;  3LM9 A;  3W3D A;  3EZW A;  3LM2 A;  4BRI A;  3CQX A;  3ATU A;  2NRH A;  3EKU A;  3ZET A;  2P9U A;  4BC2 A;  2GWK A;  4MO5 A;  5JLF A;  3ZX0 A;  1IJJ A;  1NGG A;  2ZWH A;  5AZJ A;  3QBX A;  1MWK A;  1V4S A;  1V4T A;  4H0P A;  4IJA A;  3GBT A;  5EVZ A;  4EIA A;  2NZT A;  2V51 B;  2UYT A;  1TYQ A;  3MN5 A;  3FLC O;  5E84 A;  1H1V A;  2FSN A;  4WYB A;  4CZL A;  2ASO A;  4J8F A;  4K42 A;  2QWQ A;  1HKB A;  3A8Y A;  3ID8 A;  1JCF A;  5AQR A;  2E88 A;  4FOI A;  1YAG A;  4MO4 A;  3UKR B;  3HI0 A;  1WUA A;  4Z94 A;  4BRE A;  2GTD A;  1DGK N;  1MA9 B;  3FZK A;  4BR4 A;  3WUH A;  4BQZ A;  2WUS A;  4B1W B;  2ASP A;  5ELZ A;  2YJF A;  4A2A A;  2HMP A;  3SMP A;  3UKU B;  4CZK A;  3L6Q A;  2CGL A;  3KHY A;  2I7P A;  3RSE B;  1T6D A;  3GL1 A;  2D0P A;  3GE1 A;  2D4W A;  3UKR A;  3VEY A;  2W41 A;  1KAX A;  1ZBS A;  5AQT A;  2HF4 A;  4IO8 A;  1BO5 O;  2VYP A;  5AQQ A;  3VF2 A;  3UKU A;  3VEW A;  5AQU A;  4CZH A;  4BRL A;  2A41 A;  4CBX A;  1KXP A;  3BEX A;  4XH4 A;  4BR0 A;  2E8A A;  2GEM A;  3LDO A;  3RSE A;  4EFH A;  3FGU A;  5BN9 A;  5AQN A;  3WXL A;  4MLE A;  3U8X A;  4CZJ A;  3B8A X;  3WQU A;  5F1X A;  1HJO A;  3A5M C;  1U2V B;  1ZC6 A;  3VER A;  3ZX2 A;  3I8B A;  3MN9 A;  5AQZ A;  1MDU B;  1TUU A;  4CI6 A;  5F0X A;  4BRD A;  2A42 A;  3MMV A;  3CI5 A;  2D0O A;  4BRQ A;  3SLC A;  1GLE G;  2P9L A;  2V7Y A;  4BGA A;  1RGI A;  4MLH A;  3U4L A;  4L3Q A;  1U2V A;  5BPM A;  3O80 A;  1X3M A;  1QZ6 A;  1BWF O;  2IIR A;  2E1Y A;  1RDW X;  3IUC A;  4CZF A;  1R59 O;  3HSC A;  5AQW A;  4FWN A;  3H6E A;  1SZ2 A;  4BG8 A;  4BRM A;  4FWR A;  5JIC A;  5JMV A;  1T6C A;  3FE1 A;  1J6Z A;  5TKY A;  4IWV A;  3ZET B;  5AQG A;  4NB4 A;  3FFK B;  4GY2 B;  3ATV A;  4PKH A;  4BR5 A;  5B8H A;  1Q18 A;  2Q0U A;  4BR7 A;  1KAZ A;  2Q2R A;  2P9I B;  4M63 C;  1NM1 A;  3R6M A;  4B9Q A;  3CJA A;  3QML A;  4EAH D;  1TYQ B;  2FXU A;  2PBD A;  2ZGZ A;  3HZ6 A;  5KQ8 A;  5KQD A;  1ATR A;  1KAY A;  1GLA G;  1Z05 A;  4E1J A;  1NGD A;  1JCG A;  3H1Q A;  4BRH A;  4FO0 A;  3A5N C;  5AQJ A;  1BG3 A;  2P9N A;  4H5W A;  4RWT A;  2F9W A;  2HOE A;  2P9I A;  2VCP A;  5EOY A;  4PKI A;  4BGB A;  4BR2 A;  1Z6R A;  4B1V A;  3VGL A;  2I7N A;  5EX5 A;  4C23 A;  5ADX H;  3VF4 A;  3SK3 A;  4FL9 A;  4K25 A;  3CJ7 A;  2E20 A;  3MK6 A;  3DJC A;  2FSJ A;  3GOI A;  3H3O B;  4H5N A;  5BN8 A;  1QQO A;  3VGK A;  2QWR A;  4FSV A;  5AQP A;  3O08 A;  4RCH A;  3FZL A;  5AQK A;  2P9S B;  3VEV A;  3DAW A;  4CJ7 A;  3WXK A;  1IG8 A;  5JLH A;  1XUP O;  3EO3 A;  1CZA N;  1LCU A;  1Y64 A;  4YDU A;  4H5R A;  5BRF A;  5I9E B;  3AAQ A;  1GLF O;  3G25 A;  5BRD A;  5LJV A;  2IVN A;  3QFU A;  4WQ4 A;  4O5F A;  4GNI A;  4WQ5 A;  4H0X B;  1E4G T;  1YXQ A;  5EXW A;  2P9S A;  1T44 A;  5BRH A;  4I6M B;  2D1K A;  3R9P A;  5AZI B;  1G99 A;  5E26 A;  3BUZ B;  5FPM A;  3ZX3 A;  1GLJ O;  3FR0 A;  1GLC G;  4CBW A;  1GLL O;  3QBW A;  3QB0 A;  4H0V B;  4QS8 A;  2IVO A;  3TPQ A;  5FPN A;  2YHW A;  4B1Y B;  3O5B A;  3IMX A;  2P9L B;  4BR9 A;  2F9T A;  1ZXO A;  2QWP A;  4EHT A;  3LDL A;  3OHR A;  4XH1 A;  2OAN A;  3UB5 A;  4XEI A;  2IVP A;  2YI1 A;  2YHY A;  1U6Z A;  3MDQ A;  3CQY A;  5AR0 A;  2PAV A;  1BDG A;  4I6M A;  3TU5 A;  1NLV A;  1X3N A;  3DXK A;  5AZI A;  3SMS A;  4FWQ A;  4H5T A;  2QWM A;  1DEJ A;  4BRF A;  2GEL A;  2CH6 A;  3AAP A;  5LJW A;  5AQH A;  2AP1 A;  1YUW A;  3EKS A;  2QWO A;  5FPE A;  2QM1 A;  1YVN A;  3A5O C;  4FWO A;  4AM7 A;  4KBO A;  3BP8 A;  4CD3 A;  4CZI A;  3VET A;  3M6G A;  3R8E A;  4H0T B;  1HKG A;  1ESV A;  2Q1N A;  2QWL A;  3MCP A;  1TUY A;  1OKJ A;  3WXJ A;  3VES A;  1NWK A;  3QFP A;  2YJE A;  3FZF A;  3C7N A;  2W40 A;  3GG4 A;  1E4F T;  4FWM A;  2Q0R A;  4BRC A;  1NGB A;  3D2E B;  3LL3 A;  4QS9 A;  2AA4 A;  2P9N B;  5AQY A;  4BRG A;  5ADX A;  1P8Z A;  2FF3 B;  4JD2 A;  1NGI A;  3HM8 A;  4BC3 A;  4M7Y A;  2E2N A;  3QIC A;  5AQS A;  3A5L C;  3KZB A;  3HBT A;  4DB3 A;  1NBW A;  2E2P A;  3S41 A;  2E1Z A;  4ISF A;  3VEO A;  4HWI A;  3CIP A;  2E2Q A;  3VEZ A;  1C0G A; 
#chains in the Genus database with same CATH topology
 5CYM A;  3LAK A;  2HHW A;  4BDY A;  4BE0 A;  2O8C A;  3D2E A;  2FSK A;  2VQF K;  3U9Z A;  1X9S A;  3VQ8 A;  4JYA K;  3ZT4 A;  4CJK A;  5DMR A;  3TAP A;  1T3V A;  4AM6 A;  4JV5 K;  4DHY A;  1RDD A;  5T7B A;  3D2F B;  4IDK A;  2I5J A;  2ZJQ L;  4B3T K;  4DV1 K;  3CG7 A;  3QET A;  5KGW A;  1WN7 A;  4MFB A;  2P5G A;  3RWU A;  3D0P A;  3FZM A;  2HF3 A;  2NLX A;  3THV A;  4KO0 A;  1HX1 A;  1D9D A;  3M8Q A;  4CZM A;  4CE9 A;  3SAH A;  3L0Q A;  1EET A;  4YOT A;  2O8E A;  2CGK A;  2BTF A;  2GUP A;  5J2M A;  3QES A;  1UA0 A;  3O3G A;  1GOB A;  1OH6 A;  1QQN A;  3D2F A;  4JI1 K;  3WEE B;  4KKO A;  2QXL A;  4LC9 B;  1FW6 A;  4DS4 A;  4DU4 A;  4CHZ A;  4FWK A;  4KTZ A;  3CJ1 A;  4EHU A;  1HPM A;  1JXB A;  3P31 A;  5M1F A;  1S22 A;  2UXB K;  1EKE A;  5M1O A;  4ELV A;  3VN5 A;  2HBJ A;  4PL8 A;  2P9P B;  3WEE A;  3C95 A;  3I33 A;  2KHO A;  4BQL A;  1L5U A;  1BUP A;  2A3Z A;  4CF0 A;  3L4Q A;  4B9U A;  2NNW A;  1JKH A;  4ID1 A;  1W9H A;  4M3U A;  1LAV A;  2DFE A;  4GKK K;  4E7I A;  1NOY A;  2PYJ A;  3DLR A;  2ITM A;  1YTU A;  3H45 C;  3J7Z O;  3LWL A;  1XQS C;  2P9P A;  4HHT A;  1YJN N;  3L2R A;  4UY8 O;  2KZZ A;  3C7N B;  3O3F A;  4CJR A;  3AAR A;  3C0B A;  3O9R A;  4DV7 K;  4N5S A;  2ATQ A;  5CR4 A;  1S1T A;  4W5O A;  1DT9 A;  2PFU A;  4RW6 A;  3QDK A;  4M7X A;  1JL2 A;  3C65 A;  5KI6 A;  1BA0 A;  4OX9 K;  1ZBL A;  2V52 B;  5AQL A;  2HNY A;  3B6O A;  1ILY A;  1OH5 A;  3OYD A;  4FVM A;  4BRN A;  1WSI A;  3V4I A;  3LWM A;  3DXM B;  1WSH A;  5AFU A;  1ASU A;  3SJH A;  1W2B M;  2ZF5 O;  1EQY A;  2YCH A;  1GLB G;  3A0I X;  4H4M A;  4KFB A;  3VQ5 A;  1Q7Y O;  4ISG A;  3EYZ A;  4K8Z A;  4WE1 A;  2VWB A;  3IG1 A;  2P9U B;  4HTL A;  4YDU C;  1HKC A;  3PO4 A;  3VOV A;  1S9G A;  4C1N K;  5EU7 A;  3O9U A;  3DXM A;  1ATS A;  4CW7 B;  1KFS A;  2QKK A;  3JS6 A;  2FLO A;  4JEP A;  4RTF D;  4CF8 A;  1T8E A;  4LY7 A;  3AO5 A;  4QS7 A;  1VQN N;  3KD5 E;  1E3M A;  2KFZ A;  3HST B;  3VQ7 A;  2P9U A;  3HRG A;  4LH4 A;  4DR4 K;  1BIU A;  2GWK A;  4DV5 K;  3C94 A;  1NGG A;  1V4S A;  1QSS A;  5EVZ A;  4EIA A;  2NZT A;  3PIP L;  3MN5 A;  3FLC O;  2XY5 A;  4CJU A;  3CD6 N;  4J8F A;  1BGX T;  3ID8 A;  5AQR A;  3E9P A;  4FOI A;  2OTJ N;  3HYF A;  1WUA A;  1NK5 A;  2GTD A;  1DGK N;  1J5O A;  5ELZ A;  3LDS A;  1VQ8 N;  3SMP A;  3UKU B;  3VMF B;  3B6P A;  3L6Q A;  1EXQ A;  2CGL A;  4DTU A;  2D4W A;  2OPP A;  4XIU A;  2O8D B;  1KAX A;  1ZBS A;  3U3G A;  3G4S N;  1K6Y A;  1IBK K;  1WLJ A;  3CFO A;  4DSJ A;  4DQI A;  5AQQ A;  3ZT2 A;  3UKU A;  4FW1 A;  2P5O A;  3IAY A;  4XH4 A;  1B9F A;  4FLW A;  3D6R A;  4CHO A;  3IRX A;  5AQN A;  4MLE A;  3ASM A;  4RW7 A;  5F1X A;  2O8D A;  4CHQ A;  2OPR A;  3VER A;  3QIO A;  3MN9 A;  3NGY A;  4I9Q A;  1RDC A;  5AQZ A;  2HB5 A;  4DQS A;  3CI5 A;  1SKS A;  4CJS A;  4DWI A;  4JRQ A;  2NRR A;  4FJI A;  3T69 A;  3LP2 A;  1CXU A;  4NLB A;  3P83 D;  1YJW N;  2ZJR L;  1D5A A;  4AH9 A;  4YY3 K;  5BPM A;  5KGX A;  1BWF O;  1XWL A;  3AV9 A;  2KZM A;  3F9K A;  4DTS A;  1SKW A;  4CZF A;  4Z4H A;  1WSJ A;  2IGI A;  1R59 O;  4FWN A;  4KH6 A;  3OBY A;  1J6Z A;  4IWV A;  3P1G A;  3J81 O;  3ZET B;  3RR7 A;  4GY2 B;  3LAN A;  4PKH A;  3LAM A;  1QE1 A;  1RDU A;  1Z25 A;  4I2P A;  4B8C A;  3P5J A;  3MX5 A;  4A57 A;  3AVI A;  1C1A A;  5FRM A;  4E7K A;  1TYQ B;  3VQA A;  3HZ6 A;  1KCF A;  2XO7 A;  1ATR A;  3OS2 A;  4B3R K;  4OLA A;  2HST A;  2OTL N;  1NGD A;  3S3O A;  3AVL A;  3H1Q A;  4BRH A;  4FO0 A;  5AQJ A;  2P9N A;  1W0H A;  1RT3 A;  4RWT A;  3DM2 A;  4PKI A;  1Z6R A;  2I7N A;  3SK3 A;  2Z1J A;  5C25 A;  1KVB A;  4FL9 A;  3CJ7 A;  4A5A A;  3SUQ A;  4DFK A;  4I2Q A;  1X9W A;  4FJK A;  1NJI O;  4H5N A;  4CJ4 A;  3VGK A;  4DQQ A;  2QWR A;  5AQP A;  3VQ4 A;  1XMO K;  4V19 S;  1VAZ A;  3FZL A;  1VQ9 N;  4JI2 K;  3M8R A;  4OLB A;  4GV6 A;  4CF9 A;  4DSK A;  1CZA N;  3SZ2 A;  2O8B B;  2QTD A;  2UUA K;  4H5R A;  5I9E B;  1GLF O;  1SUQ A;  4CJV A;  2G8I A;  3QFU A;  2KLA A;  4O5F A;  2OZS A;  3RRG A;  4FJ9 A;  3EY1 A;  1T44 A;  3R9P A;  3ZT3 A;  5AZI B;  1G99 A;  3BUZ B;  3OYG A;  3FR0 A;  2O8B A;  4CEB A;  3TPQ A;  4MDB A;  1NK9 A;  4IG0 A;  2W6K A;  2FBT A;  3IMX A;  5FDL A;  2F9T A;  1ZXO A;  2QWP A;  4EHT A;  4XH1 A;  1DLO A;  4Z0U A;  2IVP A;  2D5R A;  4KB1 A;  4BAC A;  3CQY A;  5AR0 A;  3SBG A;  4RG8 A;  1VSJ A;  4DTP A;  5I3U A;  1JXE A;  4KH5 A;  2HHU A;  1BDG A;  1RT7 A;  5C0Y A;  1EO1 A;  4JK7 A;  1NLV A;  3SCX A;  5AZI A;  3NDK A;  1WBB A;  4A5B A;  4FWQ A;  2QWM A;  5KTQ A;  4BRF A;  4KHP K;  3OS0 A;  2YKM A;  3TAQ A;  1YUW A;  4CK3 A;  3EKS A;  3CCU N;  3MWP A;  1RT6 A;  1YVN A;  3HP9 A;  4EP4 A;  3V1Q A;  5FRN A;  1NKB A;  4KBO A;  4KTQ A;  5GIN A;  3KD1 E;  3R8E A;  3JAM O;  4PY5 A;  1Q9X A;  3UIQ A;  2QWL A;  2IC3 A;  3MCP A;  4M3R A;  4N76 A;  2P1J A;  1KLN A;  4FJH A;  1NOZ A;  4FJL A;  3S3M A;  1U4B A;  3ZSQ A;  2G8F A;  4AIL C;  3CC2 N;  3OA9 A;  3TAN A;  2Q0R A;  3I0R A;  4DSE A;  4BRC A;  3VQC A;  1YIT N;  3K5O A;  1D9F A;  4AQY K;  5ADX A;  2FF3 B;  3DOK A;  1CZ9 A;  1IBM K;  1U48 A;  2Y1J A;  3QIC A;  1NU0 A;  3A5L C;  3NVM A;  1NJX A;  3HBT A;  1NBW A;  3S41 A;  2E1Z A;  4ISF A;  3VEO A;  2WTU A;  4F2S A;  3CXC M;  1QS4 A;  3MXI A;  3ZSZ A;  1C0T A;  3E66 A;  1HLU A;  1NKE A;  3M8P A;  4YFU A;  1NGJ A;  2F96 A;  4W5T A;  1XC3 A;  3VF6 A;  3OYA A;  2W42 A;  1KVC A;  3O9T A;  4QCL A;  3SAF A;  3O1B A;  4JS4 A;  4MDA A;  3KLH A;  1D4X A;  4WF9 L;  3K59 A;  1SAZ A;  3IFR A;  4E1N A;  4DG1 A;  3RMB A;  4JKD A;  3CER A;  3J8A A;  3NGZ A;  4O5B A;  1Q9Y A;  4GKJ K;  2HVH A;  4BC5 A;  1VSD A;  4Q0B A;  3WNH A;  1RBV A;  3NAE A;  4FJX A;  1VSM A;  4WFA L;  4BDP A;  5F2R A;  2OPS A;  4K43 A;  4C8M A;  3AY9 A;  5AQV A;  3OJU A;  1JLC A;  1NGF A;  3RMC A;  5FPD A;  4JK8 A;  1HNZ K;  4N56 A;  5AQO A;  4E3S A;  4CZG A;  4IEE A;  3KK7 A;  1OVY A;  2WON A;  2A40 A;  3SQ2 A;  4IBN A;  3ZSW A;  3QEW A;  1KC8 O;  3PSI A;  4OKJ A;  3THY A;  4F3T A;  3NBP A;  4AHV A;  1HYV A;  5KPR A;  3L3V A;  1Z26 A;  2QW9 A;  3CC7 N;  4F9O A;  2BE2 A;  1YT3 A;  3CCQ N;  1VQ5 N;  2G8U A;  3ULD A;  3F5T A;  5AQF A;  3MX2 A;  2VWK A;  1QSY A;  2KQ2 A;  3EE8 A;  4BG9 A;  3OYJ A;  1LW2 A;  4EP5 A;  1K73 O;  4CJW A;  3UE5 A;  1TVR A;  1C6V A;  1HNI A;  1A5X A;  2Q31 A;  4A62 A;  4DLE A;  2Q3S A;  3AVG A;  4LFB K;  4JN4 A;  3MAQ A;  1NJY A;  1RT2 A;  4H0Y B;  4IOC L;  4DTR A;  4X64 K;  4FM2 A;  5JVG L;  2V7Z A;  2RF2 A;  3M3Z A;  1M90 O;  4O8U A;  5KPT A;  1DKG D;  5IT9 O;  1VRU A;  5C24 A;  4IO9 L;  2QWN A;  3NF8 A;  5AQI A;  4JD2 B;  1K9M O;  4IJN A;  1SL1 A;  4CZE A;  2GWJ A;  3MN7 A;  4DFJ A;  3AA2 A;  1S3X A;  3ULE B;  1I3A A;  4KV8 A;  4DSF A;  3K9K A;  5HLF A;  4LFA K;  1IO2 A;  2A6A A;  3CJ9 A;  4DTM A;  1T7P A;  2ZM6 K;  4BVP A;  4IOX A;  4HUG A;  1ZBH A;  4YOV A;  3VEN A;  4JKE A;  3OYC A;  2WFB A;  1HQU A;  1ATN A;  1W7A A;  3O9Q A;  3DLE A;  2P9K B;  4JNE A;  5A2Q O;  3ULE A;  3VGM A;  3HJF A;  3CPW M;  4BDZ A;  1KTQ A;  2ASM A;  3DRR A;  4FWS A;  5HL7 L;  1QHA A;  4C1N I;  4JKA A;  4ISE A;  3GDQ A;  2E2O A;  3N4P A;  2O8E B;  1DTQ A;  4WQ4 C;  2J4R A;  2OPQ A;  3RR8 A;  2P9K A;  4CFD A;  4OKK A;  2IS3 A;  2F8T A;  1RDB A;  3CFP A;  3ENH A;  3LM9 A;  3OTO K;  3W3D A;  3LM2 A;  4BRI A;  5JVH L;  3CQX A;  2NRH A;  4BC2 A;  4O4G A;  4FJ5 A;  2G8V A;  4I9L A;  4PQU A;  1BCO A;  3KLG A;  4MO5 A;  5JLF A;  1I94 K;  4IKF A;  3ZX0 A;  4KHW A;  3NE6 A;  1XHZ A;  3QBX A;  4O55 A;  1MWK A;  1RT1 A;  2O4I A;  1S1W A;  4JKG A;  1KSP A;  2V51 B;  3LZJ A;  3SJJ A;  1H1V A;  5C15 A;  1UAX A;  3I55 N;  3NH2 A;  3A8Y A;  4NXN K;  2IDO A;  2UUC K;  3PUF A;  3IS9 A;  2WUS A;  4B1W B;  5AJ3 K;  4E7L A;  1BCM A;  4A2A A;  3L3U A;  3PX4 A;  3LZI A;  2NRW A;  5CY4 A;  4M45 A;  3ZSY A;  1YF5 L;  4C8K A;  3GL1 A;  4W5Q A;  4Z4C A;  4FJJ A;  3KLF A;  4OO1 J;  5AQT A;  1TL1 A;  1L3U A;  4RW9 A;  1BO5 O;  5KRS A;  1RCH A;  1RBT A;  4LF9 K;  1VQP N;  3CPE A;  2OA8 A;  2Z1H A;  1J9A A;  4LSN A;  4CZH A;  1X9M A;  4GMJ B;  2E6L A;  1NG9 A;  3BEX A;  4BR0 A;  2E8A A;  3LDO A;  4EFH A;  4CCH A;  3ID6 A;  1NK4 A;  4LF7 K;  3WQU A;  4DTX A;  3A5M C;  1U2V B;  3I8B A;  3LP1 A;  3PO5 A;  4J2D A;  4CI6 A;  5F0X A;  4ILJ A;  3SNN A;  3SLC A;  3SUN A;  4CFA A;  3VA3 A;  3PLA A;  2P9L A;  1HYS A;  3CCV N;  3U4L A;  4L3Q A;  4BE1 A;  4JKH A;  1U2V A;  2RPI A;  2GX9 A;  3O80 A;  1GOC A;  4DKW A;  1X3M A;  2HHS A;  3J7A P;  2IIR A;  2E1Y A;  4FVU A;  2X6S A;  4CJ3 A;  2HHT A;  4DSI A;  5H1S Q;  4B3O A;  5AQW A;  2AJQ A;  3H6E A;  3C6A A;  3C6U A;  4FWR A;  5JIC A;  3C6T A;  4RW8 A;  2WBN A;  3FE1 A;  1HRH A;  1VSF A;  3FFK B;  4AHR A;  4DMN A;  2XY6 A;  4YOU A;  4FJ7 A;  2Q2R A;  3KLI A;  2P9I B;  4M63 C;  3R1X A;  3TAR A;  1NM1 A;  4B9Q A;  4MQ3 A;  3QML A;  4FLY A;  2IOC A;  4JI0 K;  2ZGZ A;  5LL6 Z;  3KWG A;  1GLA G;  4E1J A;  4DU3 A;  4JI5 K;  4K0K K;  1K8A O;  4QOZ B;  1XNQ K;  1QVG M;  2HHX A;  2JGU A;  2P9I A;  5EOY A;  3ZT1 A;  1LV5 A;  4LH5 A;  1TK5 A;  3QEI A;  3VGL A;  4C23 A;  3LP3 A;  5J2Q A;  3OBW A;  3VF4 A;  4KHQ A;  4FJG A;  4K25 A;  3TI0 A;  2E20 A;  3NF6 A;  3DJC A;  2FSJ A;  3GOI A;  3RMD A;  4H8K A;  4B9L A;  1LW0 A;  4FZY A;  2YHB A;  4LF5 K;  4CEF A;  1XUP O;  3SI6 A;  4FXD A;  3ZSR A;  3QIN A;  4FLX A;  4DF4 A;  4JI7 K;  1LCU A;  1Y64 A;  5BRF A;  4CHN A;  4IFE A;  2O8F A;  4R79 A;  1RBU A;  4FJN A;  1R0A A;  1T05 A;  5LJV A;  1HNV A;  2NUB A;  4GNI A;  4WQ5 A;  4CIF A;  1E4G T;  3O4Q A;  1WBD A;  3NF7 A;  3AGK A;  4I6M B;  5BRH A;  2D1K A;  3KK1 A;  2OYQ A;  5FPM A;  2P51 A;  4J2B A;  4FLT A;  5HRP A;  3N4Q A;  4H0V B;  2IVO A;  3NGI A;  4B9V A;  1BQN A;  2B4J A;  2HBL A;  3OYH A;  3V9U A;  3HK2 A;  3HPO A;  4B3M K;  3UB5 A;  4E7H A;  4XEI A;  2YHY A;  1U6Z A;  1YTA A;  2PAV A;  4I6M A;  3J7Y P;  2E4L A;  4M3X A;  3DXK A;  4Z4F A;  4CJP A;  1VSK A;  1DEJ A;  3T1Y K;  5AQH A;  4IFV A;  2QWO A;  1YHQ N;  1O13 A;  5DK5 A;  3BDP A;  4JRP A;  3OY9 A;  3BP8 A;  4BE2 A;  4CGJ A;  4CZI A;  1RTD A;  1REV A;  3VQ9 A;  5FRO A;  1HKG A;  1ESV A;  3DRS A;  1BIZ A;  3THW A;  1TUY A;  5CZ1 A;  1IKW A;  1YJ9 N;  3DMJ A;  3QFP A;  4E89 A;  3BZC A;  4PUO A;  3FZF A;  1BHL A;  3CYM A;  1E4F T;  2RHK A;  3V1O A;  3VQD A;  1NGB A;  3LL3 A;  1SS6 A;  4YHH K;  2P9N B;  5AQY A;  4DU1 A;  1TV6 A;  4B9S A;  1SV5 A;  4DR2 K;  2HBM A;  1VQ6 N;  3NVK A;  3KZB A;  2KKZ A;  1LWF A;  2VGN A;  3TWH A;  4KH4 A;  3M5R A;  3KKS A;  3VEZ A;  3NCI A;  1C0G A;  5TKW A;  3KVG A;  4B1U B;  5LY3 A;  4KAZ A;  3OVN A;  1Q86 O;  5BRE A;  3NHG A;  3IDH A;  3VPZ A;  3WXI A;  4DCH A;  4LF6 K;  3JSM A;  3ENO A;  4HCB A;  4DQ8 A;  3CHW A;  1QQC A;  3O8M A;  2QK9 A;  3FFI A;  4O0I A;  4DFP A;  3PX0 A;  3VQE A;  2ZD1 A;  3L8B A;  2HHV A;  2CGJ A;  5AFU H;  1RT4 A;  4O44 A;  2QI2 A;  1FJG K;  4NLC A;  1NJW A;  1IKV A;  1S6Q A;  3KLE A;  1MU2 A;  4WCE L;  1RTI A;  3EL2 A;  1QQM A;  2O4G A;  3H3N O;  3MCA B;  5CE3 A;  3SQ4 A;  2FBV A;  4PL7 A;  1TAQ A;  3DLG A;  1NMD A;  4F4K A;  4JI3 K;  5KPZ A;  5C2D A;  3OW2 M;  1NK6 A;  2YNG A;  4DR1 K;  3O3H A;  4BWJ A;  3I8D A;  4JAX A;  2JLE A;  3MEE A;  3CCJ N;  4DLG A;  4E19 A;  3AA5 X;  3CET A;  1IKX A;  1VQK N;  3S9H A;  5HRN A;  1S6P A;  3DLH A;  1GLD G;  5GAE P;  4JHD B;  4FW2 A;  5IWA K;  3L4I A;  5BPL A;  1S9E A;  2Q36 A;  1JLQ A;  4H0O A;  3I0S A;  4W5R A;  3O9S A;  3K58 A;  3K5M A;  4JS5 A;  1NGA A;  1C0F A;  3BGR A;  3O1W A;  4H03 B;  3U9D A;  4XH5 A;  1CXQ A;  4CJL A;  1WSE A;  3OS1 A;  1WB9 A;  1RBR A;  4CER A;  4JHD A;  2B6A A;  4ELU A;  2QA4 N;  1K8K B;  4CK1 A;  5M1P A;  4CF1 A;  1ZYQ A;  1NGC A;  1D8Y A;  4CEC A;  3DI6 A;  1A5V A;  1IBL K;  1NKC A;  3L2Q A;  4LF8 K;  2VQE K;  3AO2 A;  4Y0W A;  2YHX A;  1JLF A;  3MN6 A;  4JKF A;  5FLX O;  3K0S A;  3AVB A;  1LWE A;  4ZTF A;  3DRP A;  1N32 K;  4U7B A;  4W5N A;  4BRA A;  3LAL A;  3ISN C;  1K8K A;  3OYI A;  4DSL A;  3ENB A;  1X1P A;  1HMV A;  2YKN A;  1RBS A;  3FZH A;  4YOW A;  3M8S A;  1RTH A;  2DPN A;  5AQX A;  5CYQ A;  1RFQ A;  3LDQ A;  4C8N A;  1WAJ A;  4A61 A;  2ITG A;  4CF2 A;  1CLQ A;  4UQG A;  4NXM K;  3EZ5 A;  3WNG A;  3OJS A;  4ZTJ A;  1U45 A;  1Q81 O;  1NGE A;  3NF9 A;  1SQK A;  4HUF A;  4YOR A;  1JLG A;  4FK4 A;  4NO7 A;  5BR9 A;  3CF5 L;  3C6H A;  3G10 A;  4QAG A;  3M1F A;  4CJQ A;  2GBZ A;  3P4I A;  4FPA A;  5M1N A;  1X9J A;  2Q97 A;  3QO9 A;  3LPU A;  3VEX A;  2E5L K;  3EZW A;  2EHG A;  2BDP A;  1BL3 A;  5K14 A;  3G6E N;  4K8X A;  3KKR A;  3THY B;  1IJJ A;  4CES A;  5C10 A;  2PZS A;  3T1A A;  3PIO L;  1V4T A;  4OGC A;  4IJA A;  1KVA A;  1YIJ N;  1IG9 A;  2UYT A;  3CCR N;  4KI6 A;  4ICL A;  4GV3 A;  4WYB A;  4CZL A;  2ASO A;  4J2A A;  2QWQ A;  1HKB A;  1SL2 A;  4CJE A;  3AVC A;  5HRS A;  1TK8 A;  3TAM A;  1IH7 A;  3RVC A;  3OYK A;  3FZK A;  3S3N A;  4CJT A;  3TR8 A;  3WUH A;  3AO3 A;  1KLM A;  5D3G A;  2PYL A;  2HMP A;  5M1Q A;  4CVN E;  1JLB A;  4CZK A;  1WAF A;  4YNQ A;  3DLL L;  1T03 A;  3QNO A;  5C12 A;  4CGF A;  3KHY A;  3F2K A;  3V6D A;  1T6D A;  4FM1 A;  3RRH A;  2D0P A;  3RTV A;  2W41 A;  4B08 A;  4DV2 K;  3G71 N;  4U67 L;  2VYP A;  1SKR A;  3VEW A;  5AQU A;  2KFN A;  2GV9 A;  3ZSX A;  3EE9 A;  3ZSV A;  2YNH A;  4JI8 K;  2GEM A;  3FGU A;  5BN9 A;  1JJ2 M;  4CZJ A;  4Y1D A;  3V9W A;  5DM7 L;  2ZQB A;  1TAU A;  3ZX2 A;  3DOL A;  4Y1C A;  3BZK A;  5JS2 A;  4BRD A;  1KQS M;  4NCA A;  3MMV A;  4IOA L;  2D0O A;  5J2N A;  1VQM N;  4CED A;  1GLE G;  2HNZ A;  3K9J A;  4CFC A;  4R5P A;  1RGI A;  4MLH A;  3VQP A;  2X78 A;  5LMU K;  3V9Z A;  4OVL A;  4OPJ A;  4EZ6 A;  1J54 A;  2UXC K;  3PSF A;  1RDW X;  1L3S A;  4O0J A;  4FJ8 A;  4HVJ A;  3HSC A;  5HRR A;  4DTJ A;  1C0U A;  3E01 A;  3F73 A;  4BG8 A;  3CM5 A;  4BRM A;  1N34 K;  5JMV A;  3HPH A;  4B9N A;  5TKY A;  3HL8 A;  4IDH A;  2X74 A;  4DS5 A;  3ATV A;  4JKC A;  4BR5 A;  2BH1 A;  2Z1G A;  4CIG A;  5I42 A;  4BR7 A;  3MEC A;  3HXM A;  1A5W A;  4E1M A;  4JKG B;  1UWB A;  4EAH D;  4M41 A;  4ZHR A;  2FXU A;  2HHH K;  1KAY A;  3G0Z A;  2WC9 A;  3NFA A;  1EX4 A;  4NCB A;  4OPA A;  3Q7C A;  4AHT A;  5E41 A;  1BG3 A;  4H5W A;  2HMI A;  4M42 A;  3AO1 A;  3NMU A;  1KFD A;  2F9W A;  2VCP A;  4BGB A;  4BR2 A;  1F21 A;  4OKE A;  2OCE A;  4GV9 A;  5ADX H;  3HOT A;  3V81 A;  2D0A A;  4CEQ A;  4FZX C;  5BN8 A;  1HQE A;  1QQO A;  1J53 A;  4FSV A;  4RCH A;  1Q82 O;  1J5E K;  5AQK A;  3VEV A;  3AVJ A;  3DAW A;  4CJ7 A;  4X62 K;  3SAG A;  4AF1 A;  5CHI A;  3EO3 A;  1DTT A;  1NNE A;  1RNH A;  4YDU A;  4B9M A;  3AAQ A;  1L3T A;  1OH8 A;  3CCM N;  3G25 A;  5BRD A;  2VG5 A;  4PHT X;  4B8A B;  3OYB A;  5HOO A;  3QEX A;  5CZ2 A;  3SQ0 A;  4LF4 K;  1KRP A;  1TGO A;  3WXM B;  2UU9 K;  5E26 A;  3MED A;  1GLC G;  4CBW A;  1GLL O;  3QBW A;  3QB0 A;  4QS8 A;  4CJF A;  3VTH A;  2YHW A;  3O5B A;  2P9L B;  4BR9 A;  4CEO A;  3WNF A;  1CZB A;  3LDL A;  2EX3 A;  2OAN A;  2HW3 A;  2A1S A;  3MDQ A;  2HVI A;  3D45 A;  4JKB A;  1VSI A;  3OYE A;  3VQB A;  3TU5 A;  1VSH A;  4KTW A;  1X3N A;  4LFC K;  3SMS A;  3CM6 A;  4H5T A;  3MXJ A;  2X6N A;  1BI4 B;  2GEL A;  4HCC A;  2YX6 A;  5LJW A;  2YV0 X;  3DYA A;  3KIO A;  2UXD K;  1M1K O;  2GUI A;  3TAG A;  4Z4E A;  4FWO A;  1VHX A;  3KWI A;  4KHN A;  1P90 A;  4CD3 A;  4FZZ A;  3VET A;  3M6G A;  3U6F A;  4IG3 A;  4B9T A;  1EWR A;  2XY7 A;  1BI4 A;  4DTO A;  5GAG P;  5J2P A;  3VES A;  3QLH A;  2ZJP L;  3TAF A;  4OJR A;  1ZBF A;  2YJE A;  2QKB A;  3K2P A;  3C7N A;  4DUY K;  1XHX A;  4FWM A;  3P38 A;  2VGM A;  1HPZ A;  3HP6 A;  4FK2 A;  3SBT A;  3L2W A;  3H08 A;  3EEQ A;  1XNR K;  1N5Y A;  1NGI A;  4M7Y A;  2E2N A;  5AQS A;  2QEX N;  1HJR A;  4DB3 A;  1VQ4 N;  2DFF A;  4HWI A;  3CIP A;  4M3Y A;  4M3T A;  2E2Q A;  4KHY A;  3H1V X;  3Q7B A;  2UUB K;  2EWS A;  2BUP A;  4ILG B;  4FWP A;  4CBU A;  2DY4 A;  1MWM A;  3ZSO A;  3V1R A;  1S1X A;  1EWQ A;  3WQT A;  1LOT B;  4BRO A;  4CD1 A;  1BU6 O;  2DFH A;  3CMA N;  3TAE A;  2A5X A;  2QXF A;  2XRI A;  5GAH P;  3AVN A;  2O8F B;  2LSN A;  3I56 N;  3SYZ A;  3CME N;  3ZLJ A;  4OPK A;  2B5J A;  1BIS A;  3H46 O;  4OGE A;  2ZGY A;  3BF3 A;  3JXU A;  2FF6 A;  3THX B;  4CHY A;  3KTQ A;  3E1Y A;  3HTV A;  4B1Z A;  4B3S K;  4DR7 K;  4IXC A;  1TKX A;  2OZM A;  1U47 A;  4FCY A;  4K41 A;  1VQ7 N;  4OPH A;  4X66 K;  4H5V A;  4L8R B;  4H4O A;  5GIO A;  3TSP A;  4ID5 A;  4CEA A;  3OYN A;  2XHB A;  4Q5V A;  3THX A;  3T7Z A;  4FWL A;  4GVE A;  3DXK B;  4Z4I A;  4NYF A;  3A2F A;  3HOS A;  1S5J A;  3OYL A;  1JCE A;  3W0L A;  4IZ9 A;  5KRT A;  4DV4 K;  1I39 A;  2PY5 A;  2Y1I A;  2NRX A;  4CGH A;  3BF1 A;  5BPN A;  4CEE A;  1NGH A;  4A2B A;  1JL1 A;  4CIE A;  3J80 O;  4DTN A;  2HHQ A;  2CH5 A;  1NK8 A;  4FPB A;  3LDP A;  3THW B;  3K57 A;  4LSL A;  4DV0 K;  3IKM A;  3F9M A;  4FOE A;  2JWL A;  3MWT A;  2YNF A;  4ILH A;  1HYZ A;  4O8K A;  1C1C A;  4BVO A;  1BOT O;  1HUX A;  4BRP A;  4CHP A;  1QZ5 A;  2HND A;  1GOA A;  1WOQ A;  4PKG A;  3CJB A;  4Z4G A;  1BA1 A;  3CFR A;  3ZEU B;  1VSL A;  3WT0 A;  4DFM A;  3TSQ A;  4CJ5 A;  4DF8 A;  3DWL A;  3TSU A;  3ZCM A;  4NYN A;  4FYD A;  4BRK A;  4YOX A;  1FKP A;  3CQ8 A;  4B1X B;  3SPY A;  3DLK A;  2D0C A;  3T19 A;  5JS1 A;  3O6W A;  1ASW A;  3D7E O;  3DLB A;  3ZEU A;  3HPG A;  1RDA A;  2VG6 A;  5C2F A;  3CJC A;  1N36 K;  3LDN A;  5AQM A;  5SZT A;  4BC4 A;  3O4W A;  3PX6 A;  4FM0 A;  4JLH A;  4FLZ A;  3VQQ A;  5AZJ B;  5EY4 A;  4BY9 C;  4WQ5 C;  1TKT A;  2HBK A;  4DR3 K;  2H3G X;  3SUP A;  5HP1 A;  3ALY A;  3E9O A;  1IKY A;  1IV0 A;  4KPY A;  4E0D A;  1O1W A;  3EN9 A;  1OH7 A;  3ZET A;  3ATU A;  3EKU A;  3VQ6 A;  1TKD A;  1HNX K;  2R7Y A;  2XY8 A;  2ZWH A;  5AZJ A;  3QNN A;  4FLV A;  5DM6 L;  1XMQ K;  4H0P A;  3QEV A;  3GBT A;  1NK0 A;  2ZE2 A;  1TYQ A;  4JI6 K;  5E84 A;  4FLU A;  4BWM A;  4PA1 A;  1HNW K;  2FSN A;  2F8S A;  2YHA A;  4K42 A;  2G8W A;  1W97 L;  3AA3 A;  3AVA A;  4DR5 K;  1JCF A;  4RW4 A;  1N6Q A;  2E88 A;  3UKR B;  1ITG A;  1YAG A;  4MO4 A;  3HI0 A;  5C42 A;  1SL0 A;  4Z94 A;  4BRE A;  1S1U A;  1MA9 B;  4BR4 A;  3L2V A;  4BQZ A;  1N33 K;  2ASP A;  1ASV A;  2YJF A;  3VA0 A;  3V9X A;  4DV6 K;  2E6M A;  2NRT A;  4HTU A;  1N8R O;  1NK7 A;  2I7P A;  3RSE B;  4G9Z A;  1WNS A;  4KB0 A;  3GE1 A;  4CK2 A;  3K5N A;  3O4N A;  3AVH A;  3UKR A;  3VEY A;  4CGD A;  3TAB A;  1TK0 A;  4C8L A;  2KW4 A;  4JI4 K;  1VRT A;  1U49 A;  4DQR A;  2HF4 A;  4IO8 A;  3AVK A;  1Y97 A;  1UOC A;  3KJV A;  3VF2 A;  2RE2 A;  3TTC A;  1KD1 O;  4ELT A;  3HM9 A;  4BRL A;  1FKO A;  1RT5 A;  2A41 A;  4CBX A;  1KXP A;  2KTQ A;  5HRO A;  3CCE N;  3RSE A;  4DV3 K;  3WXL A;  3BY5 A;  4KHS A;  4DR6 K;  3U8X A;  3B8A X;  2FC0 A;  1HJO A;  1ZC6 A;  4AHU A;  2VWJ A;  2RKI A;  5SWM A;  5MLC Q;  1QVF M;  1MDU B;  1TUU A;  4M3W A;  4N47 A;  2A42 A;  5M1K A;  4BRQ A;  4G1Q A;  3AVF A;  2VG7 A;  2V7Y A;  4BGA A;  4HUE A;  1VK0 A;  3VTI A;  3QEP A;  4PWD A;  2ETJ A;  4F8R A;  3KK2 A;  4AHS A;  1QZ6 A;  1HR0 K;  4F3O A;  3IUC A;  2D0B A;  4N41 A;  2BAN A;  5HBM A;  1TKZ A;  1SZ2 A;  3V9S A;  1XI1 A;  2NRZ A;  2RN2 A;  4F2R A;  4WFB L;  1T6C A;  4WFN L;  4IFY A;  4TSX A;  3AO4 A;  5AQG A;  1WSG A;  4NB4 A;  4CGG A;  5B8H A;  1Q18 A;  1S1V A;  1ZBI A;  2Q0U A;  1RTJ A;  3ZYY X;  5LMN K;  3MEG A;  1KAZ A;  1JLA A;  3R6M A;  3CJA A;  3JYT A;  3AVM A;  3R3L A;  2DTU A;  3SPZ A;  4X65 K;  2PBD A;  3KK3 A;  4J2E A;  5KQ8 A;  1VQL N;  5KQD A;  4GVM A;  1YVU A;  1LAW A;  2FBX A;  1Z05 A;  5BR8 K;  3TTF A;  2G8H A;  1JCG A;  3MXM A;  3A5N C;  4LD0 A;  4E7J A;  2HOE A;  2FBY A;  4CEZ A;  4B1V A;  1TL3 A;  3LP0 A;  5EX5 A;  5GIP A;  3TTD A;  1UA1 A;  3WNE A;  1VSE A;  3AA4 A;  3LPT A;  3MK6 A;  3T1H K;  2NRV A;  3H3O B;  1U04 A;  4KI4 A;  3O08 A;  3CC4 N;  2P9S B;  3P39 A;  3WXK A;  1IG8 A;  5JLH A;  1BQM A;  3RMA A;  1G15 A;  1QTM A;  3HO1 A;  2IAJ A;  3CCS N;  3ITH A;  1XC9 A;  4DQP A;  3HVT A;  1ZBU A;  1RIL A;  2A1R A;  2IVN A;  5J1E A;  1OVQ A;  4WQ4 A;  3SUO A;  2WOM A;  4H0X B;  1YXQ A;  5EXW A;  3L2U A;  2P9S A;  3ZX3 A;  1GLJ O;  1YI2 N;  1FK9 A;  2Z1I A;  1LWC A;  4C8O A;  3OYM A;  4EZ9 A;  1C0M A;  5FPN A;  1VQO N;  3U3Y A;  4B1Y B;  2G8K A;  4KRE A;  1FXX A;  3NH1 A;  1Q8I A;  4CGI A;  2F7T A;  4KRF A;  3OHR A;  1L3V A;  4NCG A;  3K5L A;  3SV4 A;  3QER A;  2YI1 A;  3SV3 A;  1QHT A;  4A59 A;  1NJZ A;  4CFB A;  3PV8 A;  1WSF A;  1C1B A;  2CH6 A;  3AAP A;  4GW6 A;  1B92 A;  2W6L A;  2AP1 A;  4JK9 A;  1S72 N;  5FPE A;  2QM1 A;  3A5O C;  3T3F A;  4AM7 A;  2YNI A;  3HVR A;  3SQ1 A;  1B9D A;  4H0T B;  4YOY A;  2Q1N A;  3HT3 A;  3OYF A;  1OKJ A;  1EP4 A;  3WXJ A;  1NWK A;  4AHC A;  4M3Z A;  3AGR A;  1QSL A;  3PY8 A;  3ZT0 A;  2W40 A;  3GG4 A;  4I7F A;  2O8C B;  3D2E B;  1NMN A;  4QS9 A;  2AA4 A;  4BRG A;  2JWK A;  1P8Z A;  4DUZ K;  1JLE A;  3E9L A;  4JD2 A;  4FK0 A;  3HM8 A;  4BC3 A;  2F4V K;  4IEI A;  4FJM A;  3NH0 A;  2E2P A;  2BGG A;  4KHU A;  5GAD P;  3QIP A;  3CCL N; 
#chains in the Genus database with same CATH homology
 3H1V X;  5TKW A;  3KVG A;  3CXC M;  3Q7B A;  2EWS A;  2BUP A;  4ILG B;  4FWP A;  4CBU A;  3D2E A;  1HLU A;  1MWM A;  3E66 A;  4B1U B;  5LY3 A;  2FSK A;  3U9Z A;  1NGJ A;  1Q86 O;  3WQT A;  5BRE A;  1XC3 A;  3VF6 A;  1LOT B;  3IDH A;  1T3V A;  3VPZ A;  3WXI A;  4DCH A;  3O9T A;  3ENO A;  4AM6 A;  4DQ8 A;  3SAF A;  3O1B A;  4MDA A;  3CHW A;  4DHY A;  3O8M A;  4BRO A;  4CD1 A;  1D4X A;  1BU6 O;  3D2F B;  4WF9 L;  2ZJQ L;  1SAZ A;  3CMA N;  2A5X A;  5GAH P;  2CGJ A;  3I56 N;  3IFR A;  5AFU H;  2QI2 A;  3CME N;  4JKD A;  3CER A;  4NLC A;  3FZM A;  2HF3 A;  2NLX A;  3J8A A;  4BC5 A;  1HX1 A;  3H46 O;  2ZGY A;  4CZM A;  3BF3 A;  4WCE L;  3JXU A;  3SAH A;  2FF6 A;  3EL2 A;  4WFA L;  3L0Q A;  1QQM A;  5F2R A;  4YOT A;  3H3N O;  4K43 A;  3MCA B;  3AY9 A;  2CGK A;  2BTF A;  2GUP A;  5AQV A;  5CE3 A;  4PL7 A;  3E1Y A;  3HTV A;  1NMD A;  1NGF A;  5KPZ A;  1QQN A;  3D2F A;  4B1Z A;  4JK8 A;  3WEE B;  5FPD A;  5AQO A;  4IXC A;  4CZG A;  4IEE A;  5C2D A;  2QXL A;  3OW2 M;  4LC9 B;  3KK7 A;  1OVY A;  4JAX A;  3CCJ N;  2A40 A;  4K41 A;  1VQ7 N;  4OPH A;  3CET A;  4H5V A;  1VQK N;  5GIO A;  1KC8 O;  4FWK A;  3TSP A;  1GLD G;  5GAE P;  3CJ1 A;  4EHU A;  4JHD B;  1HPM A;  3T7Z A;  4FWL A;  4GVE A;  3DXK B;  3P31 A;  5M1F A;  1S22 A;  3L4I A;  5M1O A;  5BPL A;  5KPR A;  2Q36 A;  3HOS A;  2QW9 A;  4H0O A;  3CC7 N;  2HBJ A;  4PL8 A;  4F9O A;  2P9P B;  3WEE A;  3O9S A;  1JCE A;  3W0L A;  3CCQ N;  1VQ5 N;  4IZ9 A;  3I33 A;  1NGA A;  2KHO A;  4BQL A;  1C0F A;  3F5T A;  5AQF A;  2NRX A;  1BUP A;  3MX2 A;  4H03 B;  2A3Z A;  3BF1 A;  3EE8 A;  3O1W A;  3U9D A;  4BG9 A;  5BPN A;  3L4Q A;  4XH5 A;  1NGH A;  2NNW A;  4A2B A;  1K73 O;  3UE5 A;  4JHD A;  2Q31 A;  4A62 A;  2CH5 A;  2QA4 N;  1K8K B;  4FPB A;  3LDP A;  2ITM A;  5M1P A;  4JN4 A;  1NGC A;  3H45 C;  3IKM A;  3J7Z O;  1XQS C;  2P9P A;  4H0Y B;  4IOC L;  3F9M A;  4FOE A;  2JWL A;  3MWT A;  1YJN N;  4UY8 O;  4ILH A;  5JVG L;  2V7Z A;  4O8K A;  3C7N B;  3M3Z A;  4Y0W A;  1M90 O;  4BVO A;  1BOT O;  1HUX A;  2YHX A;  3AAR A;  3MN6 A;  4JKF A;  1DKG D;  4O8U A;  5KPT A;  3C0B A;  3O9R A;  4BRP A;  4U7B A;  4IO9 L;  2QWN A;  1QZ5 A;  4BRA A;  5AQI A;  5CR4 A;  1WOQ A;  4PKG A;  1DT9 A;  1K8K A;  4JD2 B;  1K9M O;  2PFU A;  3CJB A;  4IJN A;  1BA1 A;  3ZEU B;  3WT0 A;  3QDK A;  4M7X A;  3TSQ A;  3ENB A;  4CZE A;  2GWJ A;  3DWL A;  3MN7 A;  1S3X A;  3ULE B;  3TSU A;  3C65 A;  1BA0 A;  3FZH A;  3K9K A;  4BRK A;  4YOW A;  2A6A A;  3CJ9 A;  2V52 B;  5AQL A;  4YOX A;  2DPN A;  5AQX A;  1RFQ A;  4BVP A;  3LDQ A;  4IOX A;  4YOV A;  4B1X B;  4A61 A;  1ILY A;  3VEN A;  4JKE A;  3O6W A;  4BRN A;  3DXM B;  2WFB A;  3D7E O;  1ATN A;  5AFU A;  3ZEU A;  3O9Q A;  3SJH A;  1W2B M;  2P9K B;  2ZF5 O;  4JNE A;  1EQY A;  2YCH A;  3ULE A;  1GLB G;  3A0I X;  3VGM A;  3CPW M;  1Q7Y O;  4ISG A;  5C2F A;  1Q81 O;  2ASM A;  1NGE A;  3CJC A;  2VWB A;  1SQK A;  2P9U B;  4HTL A;  3LDN A;  4YDU C;  5AQM A;  4FWS A;  1HKC A;  4BC4 A;  3O4W A;  4YOR A;  3VOV A;  5HL7 L;  1QHA A;  4C1N I;  4JKA A;  4ISE A;  4NO7 A;  5AZJ B;  4C1N K;  5BR9 A;  3O9U A;  3GDQ A;  2E2O A;  3CF5 L;  3N4P A;  3C6H A;  3DXM A;  4WQ4 C;  2J4R A;  1ATS A;  5EY4 A;  3M1F A;  4BY9 C;  4WQ5 C;  2HBK A;  3P4I A;  4FPA A;  2H3G X;  2P9K A;  2FLO A;  3JS6 A;  4JEP A;  5M1N A;  3E9O A;  1X9J A;  2Q97 A;  4RTF D;  3VEX A;  4QS7 A;  3EN9 A;  3ENH A;  3LM9 A;  1VQN N;  3W3D A;  3EZW A;  3LM2 A;  3CCL N;  4BRI A;  5JVH L;  3CQX A;  3ATU A;  2NRH A;  3EKU A;  3ZET A;  2P9U A;  3HRG A;  4BC2 A;  3G6E N;  2GWK A;  4MO5 A;  5JLF A;  3ZX0 A;  1IJJ A;  1NGG A;  2ZWH A;  5AZJ A;  3QBX A;  5DM6 L;  1MWK A;  1V4S A;  5C10 A;  3PIO L;  1V4T A;  4H0P A;  4IJA A;  4JKG A;  3GBT A;  5EVZ A;  4EIA A;  2NZT A;  2V51 B;  2UYT A;  3PIP L;  3CCR N;  1TYQ A;  1YIJ N;  3MN5 A;  3FLC O;  5E84 A;  1H1V A;  4GV3 A;  2FSN A;  4WYB A;  4CZL A;  2ASO A;  3CD6 N;  4J8F A;  5C15 A;  3I55 N;  4K42 A;  2QWQ A;  1W97 L;  1HKB A;  3A8Y A;  3ID8 A;  1JCF A;  5AQR A;  2E88 A;  3E9P A;  4FOI A;  1YAG A;  4MO4 A;  3UKR B;  3HI0 A;  1WUA A;  2OTJ N;  4Z94 A;  4BRE A;  2GTD A;  1DGK N;  3RVC A;  1MA9 B;  3FZK A;  4BR4 A;  3WUH A;  4BQZ A;  2WUS A;  4B1W B;  2ASP A;  5ELZ A;  2YJF A;  4A2A A;  2HMP A;  5M1Q A;  1VQ8 N;  3SMP A;  2NRW A;  3UKU B;  4CZK A;  2NRT A;  3L6Q A;  3VMF B;  1N8R O;  2CGL A;  3DLL L;  5C12 A;  3KHY A;  2I7P A;  3F2K A;  1YF5 L;  3RSE B;  1T6D A;  4G9Z A;  3GL1 A;  2D0P A;  3GE1 A;  2D4W A;  3UKR A;  3VEY A;  2W41 A;  1KAX A;  1ZBS A;  3G4S N;  3G71 N;  5AQT A;  4U67 L;  4OO1 J;  2HF4 A;  4IO8 A;  1BO5 O;  2VYP A;  5AQQ A;  3VF2 A;  2RE2 A;  1VQP N;  3UKU A;  3TTC A;  1KD1 O;  3CPE A;  3VEW A;  5AQU A;  4CZH A;  4BRL A;  2A41 A;  4CBX A;  1KXP A;  3EE9 A;  3BEX A;  4XH4 A;  4BR0 A;  2E8A A;  2GEM A;  3D6R A;  3LDO A;  3RSE A;  4EFH A;  3CCE N;  3FGU A;  3ID6 A;  5AQN A;  5BN9 A;  3WXL A;  1JJ2 M;  4MLE A;  3U8X A;  4CZJ A;  3B8A X;  3WQU A;  5F1X A;  1HJO A;  5DM7 L;  3A5M C;  1U2V B;  1ZC6 A;  3VER A;  3ZX2 A;  5MLC Q;  3I8B A;  3MN9 A;  5AQZ A;  1QVF M;  1MDU B;  1TUU A;  4CI6 A;  5F0X A;  4BRD A;  1KQS M;  2A42 A;  4ILJ A;  3MMV A;  5M1K A;  3CI5 A;  2D0O A;  4IOA L;  4BRQ A;  3SLC A;  1VQM N;  2NRR A;  3PLA A;  1GLE G;  3T69 A;  2P9L A;  2V7Y A;  3K9J A;  4NLB A;  4BGA A;  1YJW N;  3CCV N;  1RGI A;  4MLH A;  3VTI A;  2ZJR L;  3U4L A;  4L3Q A;  4JKH A;  1U2V A;  5BPM A;  2GX9 A;  3O80 A;  4DKW A;  1X3M A;  1QZ6 A;  1BWF O;  2IIR A;  2E1Y A;  4FVU A;  1RDW X;  3IUC A;  4CZF A;  5H1S Q;  1R59 O;  3HSC A;  5AQW A;  4FWN A;  4KH6 A;  3H6E A;  1SZ2 A;  2NRZ A;  4BG8 A;  3C6A A;  3OBY A;  4BRM A;  4FWR A;  5JIC A;  4WFB L;  5JMV A;  1T6C A;  2WBN A;  3FE1 A;  1J6Z A;  5TKY A;  4WFN L;  4IWV A;  3ZET B;  5AQG A;  4IDH A;  4NB4 A;  3FFK B;  4GY2 B;  3ATV A;  4JKC A;  4PKH A;  4BR5 A;  2BH1 A;  5B8H A;  1Q18 A;  4YOU A;  2Q0U A;  3ZYY X;  1RDU A;  4BR7 A;  1KAZ A;  2Q2R A;  3MX5 A;  2P9I B;  4M63 C;  3R1X A;  4A57 A;  1NM1 A;  3R6M A;  4JKG B;  4B9Q A;  3CJA A;  3QML A;  3R3L A;  4EAH D;  1TYQ B;  2FXU A;  2PBD A;  2ZGZ A;  3HZ6 A;  5KQ8 A;  1VQL N;  5KQD A;  1ATR A;  3KWG A;  1KAY A;  1GLA G;  1Z05 A;  2HST A;  2WC9 A;  1NGD A;  4E1J A;  2OTL N;  1K8A O;  3TTF A;  1JCG A;  3H1Q A;  3Q7C A;  4OPA A;  4BRH A;  4FO0 A;  1QVG M;  3A5N C;  5AQJ A;  1BG3 A;  2P9N A;  4H5W A;  4RWT A;  3NMU A;  2F9W A;  2HOE A;  2P9I A;  2VCP A;  5EOY A;  4PKI A;  4BGB A;  4BR2 A;  1Z6R A;  4B1V A;  3VGL A;  2I7N A;  5EX5 A;  4C23 A;  5GIP A;  3TTD A;  4GV9 A;  3OBW A;  5ADX H;  3VF4 A;  3SK3 A;  4FL9 A;  4K25 A;  3HOT A;  3CJ7 A;  4A5A A;  2E20 A;  3MK6 A;  2NRV A;  3DJC A;  2FSJ A;  3GOI A;  3H3O B;  4H5N A;  5BN8 A;  1QQO A;  1NJI O;  3VGK A;  2QWR A;  4FSV A;  5AQP A;  3O08 A;  1VAZ A;  4RCH A;  3FZL A;  1VQ9 N;  3CC4 N;  1Q82 O;  5AQK A;  2P9S B;  3P39 A;  3VEV A;  4GV6 A;  3DAW A;  4CJ7 A;  3WXK A;  1IG8 A;  5JLH A;  1XUP O;  3SAG A;  4AF1 A;  5CHI A;  3EO3 A;  1CZA N;  2QTD A;  1LCU A;  3CCS N;  1Y64 A;  4YDU A;  4H5R A;  5BRF A;  5I9E B;  3AAQ A;  4IFE A;  4R79 A;  3CCM N;  1GLF O;  3G25 A;  5BRD A;  5LJV A;  2IVN A;  4PHT X;  3QFU A;  2KLA A;  4WQ4 A;  4O5F A;  4GNI A;  5HOO A;  4WQ5 A;  4H0X B;  1E4G T;  1YXQ A;  5EXW A;  2P9S A;  1T44 A;  3AGK A;  4I6M B;  5BRH A;  2D1K A;  3R9P A;  3WXM B;  5AZI B;  1G99 A;  5E26 A;  3BUZ B;  5FPM A;  3ZX3 A;  1GLJ O;  1YI2 N;  3FR0 A;  1GLC G;  3N4Q A;  4CBW A;  1GLL O;  3QBW A;  3QB0 A;  4H0V B;  4QS8 A;  2IVO A;  3TPQ A;  3VTH A;  5FPN A;  4MDB A;  2YHW A;  1VQO N;  4B1Y B;  3O5B A;  3IMX A;  2HBL A;  2P9L B;  4BR9 A;  2F9T A;  1ZXO A;  2QWP A;  4EHT A;  2F7T A;  3LDL A;  3OHR A;  4XH1 A;  2OAN A;  3UB5 A;  4XEI A;  2IVP A;  2YI1 A;  2YHY A;  1U6Z A;  3MDQ A;  3CQY A;  5AR0 A;  3SBG A;  4JKB A;  5C0Y A;  1EO1 A;  2PAV A;  4KH5 A;  1BDG A;  4I6M A;  3TU5 A;  4A59 A;  4JK7 A;  1NLV A;  1X3N A;  3DXK A;  5AZI A;  3SMS A;  4A5B A;  4FWQ A;  4H5T A;  2QWM A;  1DEJ A;  4BRF A;  2GEL A;  2CH6 A;  3AAP A;  2YX6 A;  5LJW A;  5AQH A;  2AP1 A;  4JK9 A;  1YUW A;  1S72 N;  3EKS A;  1M1K O;  2QWO A;  3CCU N;  3MWP A;  5FPE A;  2QM1 A;  1YHQ N;  1O13 A;  1YVN A;  3A5O C;  4FWO A;  4AM7 A;  3KWI A;  4KBO A;  3BP8 A;  1P90 A;  4CD3 A;  4CZI A;  5GIN A;  3VET A;  3M6G A;  3R8E A;  4H0T B;  4YOY A;  1HKG A;  1ESV A;  2Q1N A;  2QWL A;  3MCP A;  1TUY A;  5GAG P;  1YJ9 N;  1OKJ A;  3WXJ A;  3VES A;  2ZJP L;  1NWK A;  3QFP A;  2YJE A;  3FZF A;  3C7N A;  3AGR A;  3CC2 N;  3OA9 A;  2W40 A;  3GG4 A;  1E4F T;  4FWM A;  2Q0R A;  2RHK A;  4BRC A;  3P38 A;  1NGB A;  3D2E B;  2VGM A;  3LL3 A;  1SS6 A;  1YIT N;  4QS9 A;  2AA4 A;  2P9N B;  5AQY A;  4BRG A;  5ADX A;  3SBT A;  2JWK A;  1P8Z A;  2FF3 B;  3E9L A;  4JD2 A;  1NGI A;  1VQ6 N;  2HBM A;  3HM8 A;  4BC3 A;  4M7Y A;  2E2N A;  4IEI A;  3QIC A;  5AQS A;  3NVK A;  3A5L C;  3NVM A;  2QEX N;  3KZB A;  3HBT A;  4DB3 A;  1NBW A;  2E2P A;  2KKZ A;  3S41 A;  1VQ4 N;  2E1Z A;  4ISF A;  3VEO A;  2VGN A;  4KH4 A;  4HWI A;  3CIP A;  5GAD P;  3M5R A;  2E2Q A;  3VEZ A;  1C0G A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...