2H3GX

Structure of the type iii pantothenate kinase (coax) from bacillus anthracis
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
254
structure length
247
Chain Sequence
MIFVLDVGNTNAVLGVFEEGELRQHWRMETDRHKTEDEYGMLVKQLLEHEGLSFEDVKGIIVSSVVPPIMFALERMCEKYFKIKPLVVGPGIKTGLNIKYENPREVGADRIVNAVAGIHLYGSPLIIVDFGTATTYCYINEEKHYMGGVITPGIMISAEALYSIEITKPSSVVGKNTVSAMQSGILYGYVGQVEGIVKRMKEEAKQEPKVIATGGLAKLISEESNVIDVVDPFLTLKGLYMLYERNA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of the Type III Pantothenate Kinase from Bacillus anthracis at 2.0 A Resolution: Implications for Coenzyme A-Dependent Redox Biology.
pubmed doi rcsb
source organism Bacillus anthracis str.
molecule tags Biosynthetic protein
molecule keywords BIOSYNTHETIC PROTEIN
total genus 74
structure length 247
sequence length 254
ec nomenclature ec 2.7.1.33: Pantothenate kinase.
pdb deposition date 2006-05-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
X PF03309 Pan_kinase Type III pantothenate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.40 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 2h3gX02
3.30.420.40 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 2h3gX01
3VETA 4GNIA 3VGMA 3A8YA 3CETA 3JXUA 4H0XB 4JAXA 1GLLO 2P9IB 4DQ8A 1NGFA 4AM6A 3ENOA 3IMXA 2CGLA 4B1VA 4BRHA 5AQOA 4BR7A 4A2AA 1KXPA 2V51B 3FFKB 4HWIA 3TU5A 1NGIA 4FOEA 4BR2A 3CIPA 3VF2A 4CZEA 4JD2A 3WQTA 3MN6A 3LDQA 1XQSC 3GL1A 2Q1NA 3CERA 4IZ9A 4BC2A 4FSVA 1CZAN 3ZETA 4CZIA 1T6CA 3CJCA 5KQDA 4WQ5A 1GLBG 3GDQA 5LY3A 1ATRA 2ZGYA 4HTLA 4CZHA 4BRDA 3FLCO 3DWLA 2VCPA 3TPQA 2EWSA 4BG8A 4BGAA 4BRFA 1T6DA 3MK6A 4BR0A 2J4RA 3D2FB 3WXJA 5F0XA 1BO5O 4FWQA 2V52B 4JHDB 4H0TB 3U9ZA 1HPMA 1KAXA 3VPZA 4H0VB 3AAPA 4JHDA 4B1WB 1LOTB 3AARA 5FPNA 2HF3A 4GY2B 1H1VA 3R9PA 3UB5A 5FPEA 4J8FA 3C7NA 5LJWA 2HOEA 3AY9A 3DJCA 3O80A 2GEMA 3BF3A 3DXKB 3QBXA 1TUYA 3MMVA 1RGIA 3EKSA 2ITMA 2GELA 2YJEA 5AQGA 3UKRB 1Q18A 2E20A 2QM1A 3RSEB 4BVPA 3LDPA 2FF3B 4RTFD 5F1XA 3QBWA 4EIAA 1G99A 5AQNA 1XUPO 2Q97A 3KVGA 4NB4A 1GLAG 3O4WA 3WT0A 5EOYA 4H0OA 4B1YB 5AQXA 2H3GX 1Z6RA 4MLEA 2FLOA 4BR5A 4BR9A 3DXMA 4EFHA 3MDQA 1X3MA 3H46O 4FL9A 1ZC6A 1XC3A 2ZWHA 3U9DA 4BRIA 3I33A 3EKUA 3ZX2A 1U2VA 5AQUA 1MWMA 1BG3A 3WEEB 5AQJA 4F9OA 3WXLA 2GWKA 1HX1A 3CJAA 4FWMA 4BC3A 3ATUA 1BA1A 4YDUC 4DCHA 3HTVA 4B9QA 4CZJA 1YXQA 5AQLA 3VF6A 3VERA 5BPLA 1P8ZA 1NGCA 1NGBA 2P9NA 4PL8A 5EY4A 4B1UB 3O8MA 3LDOA 3EN9A 1QQMA 3W3DA 2I7NA 4CZLA 5BPMA 2E1ZA 5KPZA 2KHOA 3BEXA 1TYQA 5AQFA 3DAWA 4PKHA 3ZEUA 2QWNA 4H5WA 3O6WA 5BR9A 4CZKA 5BN8A 5LJVA 5FPDA 1E4FT 4YDUA 4BRCA 4A2BA 2BUPA 5JLFA 3CJ7A 4RWTA 1IG8A 3VEZA 5E26A 4QS7A 4A62A 4CBWA 5E84A 3IFRA 5AQHA 2IVNA 4BC4A 4EHUA 1NWKA 2NZTA 2ZGZA 3P4IA 3RSEA 2ASOA 4CBUA 1JCGA 2E8AA 5B8HA 2P9KB 3GG4A 3O1BA 4FPAA 1RDWX 4M7YA 1LCUA 2CGKA 2YHYA 5KPTA 2E2QA 3UKUB 1OKJA 2QWQA 2QW9A 3ATVA 2FSKA 4BROA 1R59O 2P9PA 1GLFO 1NGGA 4H0YB 1K8KB 3M6GA 3VENA 3FZLA 2IVOA 2NRHA 3FZHA 1MA9B 2OANA 3GE1A 4BRMA 3EZWA 3JS6A 3ULEB 3CQXA 3ZETB 2W41A 3CI5A 3M1FA 3ULEA 1QQNA 4K25A 4I6MB 1NBWA 1NGAA 5BREA 2PBDA 2FSJA 5CE3A 4M63C 5I9EB 3H1VX 5JLHA 5ADXA 3O1WA 4BRQA 3VEOA 2P9UB 5AQPA 3KHYA 4BRPA 2A42A 3BUZB 3IUCA 4IWVA 3WXIA 1ATSA 3D2FA 3VGLA 4ISFA 3LDLA 4ISEA 4H5VA 5AQZA 4CZFA 4K41A 2Q36A 1ESVA 2A40A 3CJ1A 5AQTA 4IO8A 4B1XB 4XEIA 4WQ5C 3ZEUB 1S22A 2W40A 3CJBA 2E2NA 3G25A 3WEEA 3ZX3A 2VYPA 1Z05A 1NLVA 1KAZA 3CHWA 4FWRA 4IJAA 5EVZA 3A5OC 4MO5A 1BDGA 3GBTA 3QMLA 2D0PA 5EX5A 1E4GT 1Y64A 4WQ4A 3AAQA 2QWPA 5F2RA 2P9NB 5AZJB 2YCHA 1DGKN 3C0BA 2FSNA 2AA4A 4H5NA 2Q0UA 2NLXA 2D1KA 3C7NB 4CJ7A 1EQYA 5AQIA 5JICA 1X9JA 1BUPA 3W0LA 2P9LB 2A5XA 3MN9A 3ID8A 4BRGA 2YJFA 2F9WA 3D2EA 4Z94A 1HKBA 2QWOA 3FGUA 4AM7A 4B1ZA 2CH6A 4XH1A 4EAHD 3A5MC 2P9PB 3EL2A 2E88A 2PAVA 4I6MA 3H45C 3HI0A 5AQWA 3H6EA 3VGKA 1HLUA 3H3OB 3BF1A 1SQKA 2P9SA 3L6QA 3VEVA 2E2OA 4PKGA 1D4XA 2P9SB 3R8EA 3QDKA 4CZMA 5BRHA 1GLCG 2YHWA 1QHAA 4FWPA 3O08A 2A3ZA 3VEYA 5AFUA 4DHYA 3MN7A 2A41A 3A5LC 1C0GA 1S3XA 2A6AA 4FOIA 1DKGD 2FF6A 3H1QA 4O5FA 5AZIA 2GTDA 2P9IA 2QXLA 3B8AX 3FR0A 4C23A 4XH5A 3L4IA 1TYQB 5AQVA 5AFUH 5AQKA 2WUSA 4PKIA 4FWKA 4K42A 5AQYA 4CD1A 4FWLA 5EXWA 3SK3A 1NMDA 3QICA 3EO3A 4O8KA 4H5TA 3QFPA 4BVOA 4RCHA 1HKGA 5BPNA 3VEWA 5AZJA 1QQOA 2P9LA 3UKUA 2IVPA 4WQ4C 3CJ9A 1JCFA 4IJNA 1YAGA 3DXKA 1U6ZA 3ENHA 2HF4A 5BN9A 1BWFO 3VOVA 1V4SA 4BREA 4BG9A 1MWKA 3FZFA 3UKRA 3HZ6A 3LM2A 1NGHA 3DXMB 5AR0A 3MN5A 3WQUA 3SLCA 3FE1A 4QS9A 3HSCA 4BC5A 3LM9A 3S41A 2Q0RA 5KPRA 4EHTA 3VF4A 4A61A 2Q31A 4PL7A 1V4TA 1KAYA 1NGEA 3QFUA 2P9KA 2HMPA 2D4WA 4JNEA 4H5RA 4BRLA 1SZ2A 4BR4A 3FZMA 3IDHA 3OHRA 1ATNA 4FWOA 1RFQA 2QWRA 4BQLA 2FXUA 4CZGA 4H03B 2QWMA 3ZX0A 2CH5A 1BOTO 2P9UA 4WYBA 3R6MA 5KQ8A 3WXKA 4BRAA 4JN4A 3U4LA 1DEJA 5ELZA 1K8KA 4JD2B 3F9MA 1YVNA 3WUHA 1NM1A 4H0PA 3I8BA 3VEXA 5AZIB 1HKCA 5JMVA 2GUPA 2UYTA 3L0QA 4QS8A 5BRFA 2I7PA 1NGDA 5FPMA 4BRKA 2GWJA 1U2VB 5AQRA 4BRNA 1QZ6A 3A5NC 3QB0A 2V7ZA 2F9TA 4K43A 5ADXH 3KZBA 2DPNA 3SMSA 2YI1A 3U8XA 1BA0A 2CGJA 4CBXA 3LDNA 2VWBA 5AQSA 1YUWA 3J8AA 3SJHA 1TUUA 1ZXOA 2QWLA 4MO4A 4FPBA 4BGBA 4Y0WA 4FWSA 4CD3A 3UE5A 3D2EB 3D7EO 1HJOA 1MDUB 1SAZA 2ASMA 2BTFA 4FWNA 4DB3A 1GLDG 2IIRA 3SMPA 4E1JA 3O5BA 3HM8A 1BU6O 4CI6A 3FZKA 2V7YA 4FO0A 1WUAA 4L3QA 4BQZA 3HBTA 5AQMA 2ZF5O 1C0FA 3GOIA 1IJJA 1X3NA 1T44A 2D0OA 4LC9B 4NO7A 5BRDA 2E1YA 3MCPA 1GLEG 4ISGA 5AQQA 4KBOA 3H3NO 4M7XA 4XH4A 2ASPA 4MLHA 3A0IX 2AP1A 3LL3A 4IXCA 3BP8A 1ZBSA 2Q2RA 2YHXA 1WOQA 3CQYA 1J6ZA 1GLJO 1NGJA 1QZ5A 3M3ZA 5TKYA 1JCEA 1HUXA 3VESA 2E2PA
chains in the Genus database with same CATH superfamily
1ZYQA 4AHUA 5M1FA 1S5JA 4Z0UA 5C10A 4DV1K 3CCQN 4H0XB 1IKWA 4DQ8A 3EEQA 4FLYA 4B1VA 4DWIA 5AQOA 1KSPA 3OW2M 1KXPA 1JKHA 4FOEA 4BR2A 3CIPA 4YFUA 2G8WA 3QO9A 3BZKA 1QVFM 4UQGA 3THXA 5DK5A 4M3RA 1XQSC 2Z1IA 3C6UA 4CF2A 1CZAN 4CZIA 1TL3A 5JS1A 2G8VA 4W5QA 4NYFA 2QTDA 5LY3A 5J2PA 3KK2A 3SAHA 2O8BA 4HTLA 1JLQA 4GMJB 4BRFA 4FVMA 4V19S 4BR0A 4M42A 2J4RA 3TI0A 3WXJA 3PLAA 3PO4A 1BO5O 1TKTA 4M41A 4H0TB 3V1OA 1KAXA 3VPZA 4B8AB 2DTUA 4H0VB 3AAPA 1WSEA 1LOTB 4MQ3A 5FRMA 4JKFA 2HF3A 4JS5A 3C65A 4DFPA 4DFJA 5LMNK 3DJCA 5KGWA 3DXKB 1VQNN 3MCAB 1KVAA 3QBXA 1L5UA 1RGIA 3DLEA 2ITMA 1BCOA 2FBXA 2YJEA 5AQGA 3OS1A 1IBMK 2E20A 2QM1A 3SQ0A 1K8AO 3L2QA 3QBWA 4LF4K 1G99A 5AQNA 1XUPO 3HK2A 4N5SA 4NCBA 4NB4A 4KHPK 3DLLL 5CYMA 3K5OA 4H0OA 4B1YB 2HB5A 3ZT2A 1VSKA 4MLEA 4BR5A 1YJWN 4EFHA 2UXCK 1JXBA 3AV9A 1TV6A 3EKUA 2YNHA 1GOAA 4C8MA 3TR8A 1KLNA 2BE2A 5E41A 1N36K 3TAGA 4FK2A 4F2RA 4DLGA 4DTPA 1TAUA 1HX1A 1EX4A 1G15A 4FWMA 1BA1A 3MWTA 4WFBL 4CZJA 4ICLA 1YXQA 4OGCA 4ELTA 1P8ZA 4CK2A 4JKGB 1VQLN 4E3SA 4E1NA 5HOOA 3PIOL 1RT2A 3O8MA 3LDOA 4B9SA 3EN9A 2JGUA 3NCIA 4CF0A 5KPZA 5D3GA 3DAWA 4J2BA 1VSEA 3QEXA 3RMBA 2Z1JA 3P38A 4JKBA 3G4SN 1NJZA 2ZE2A 4IOCL 3CJ7A 4OPAA 4O8UA 1WBDA 2GV9A 3L3VA 2IVNA 3K5LA 3DRRA 4DR4K 3AVHA 2NZTA 1HNZK 2ASOA 3OBYA 5B8HA 1K6YA 2P9KB 3GG4A 1T7PA 4FPAA 3RTVA 1NJYA 1RT7A 2E2QA 2A1RA 2QWQA 5GIOA 4GW6A 2OYQA 1QSSA 4CIGA 5HBMA 4B3RK 4NYNA 2VGNA 1VSMA 4GV3A 1IKVA 2NRHA 1YJ9N 1TK0A 1MA9B 2OANA 4BRMA 3SAGA 3JS6A 3KLIA 2IOCA 3CI5A 3DLGA 3DLBA 3M1FA 3M8SA 4FJ8A 4I6MB 3LP1A 5BREA 5I9EB 3H1VX 2F8SA 2OTJN 3NF9A 4BRPA 1JL1A 3BUZB 4IWVA 3ISNC 2HHVA 3RMCA 4ISFA 3THXB 4ISEA 1KTQA 4OPKA 4H5VA 5AQZA 1VQON 1C1AA 3HVTA 1NOZA 2JWKA 4C1NI 1D9DA 3NHGA 4XEIA 3HYFA 3ZEUB 4FYDA 2W40A 4AQYK 2OPPA 4JI6K 2VYPA 3VTIA 4IJAA 1YTAA 1Z05A 1I3AA 1NLVA 1C1BA 1LWEA 1O1WA 2FBTA 1WSFA 4MO5A 3WNHA 2AJQA 1BDGA 1HNIA 1Y64A 1RCHA 3KWGA 3KK7A 1S9EA 5GAGP 2QWPA 2P9NB 5AZJB 3LZJA 2YCHA 4CJWA 3NF8A 4OJRA 2RF2A 3K58A 2HHTA 2AA4A 4W5NA 1RILA 1SV5A 2Q0UA 2NLXA 1IG9A 5JICA 1S1TA 1QHTA 4H4MA 3W0LA 2P9LB 2A5XA 1OVYA 3O9UA 4FZXC 4A59A 2G8FA 2F9WA 2XRIA 1TL1A 3AGRA 3LP0A 4N47A 2Y1IA 4B9LA 2LSNA 3AVAA 4XH1A 3A5MC 4DQSA 3LDSA 3SYZA 1YITN 2E88A 3THWA 3THYA 2X78A 1HLUA 2DY4A 3BF1A 1RTDA 1FW6A 2HVIA 4JKEA 1B9FA 3L8BA 1D4XA 3OYGA 5CHIA 1GLCG 2YHWA 1QHAA 4FWPA 3O08A 4IFVA 4H8KA 3KD5E 3LAMA 2A41A 4CJLA 3A5LC 3BZCA 5HROA 3N4QA 1C0GA 1KLMA 2O8EB 4KH5A 4L8RB 2FF6A 3M5RA 2GTDA 2KFNA 3HL8A 4OX9K 4Q0BA 4C23A 3O9SA 4FLXA 1KRPA 2HHXA 2NUBA 4K0KK 1UAXA 3SUOA 5AQVA 3EY1A 1NKCA 4PHTX 1FJGK 1A5XA 5CY4A 3UIQA 1CXQA 5EXWA 3SK3A 1NK9A 4CHYA 4O8KA 4CW7B 3V9XA 3QFPA 3M8RA 1N8RO 3V1QA 4DTMA 1OH5A 1U49A 4FJNA 4IJNA 1KC8O 3IRXA 3VOVA 3V6DA 3U3GA 4BG9A 3AO1A 1QS4A 4DTSA 4DUZK 4B9MA 4UY8O 1RNHA 4W5TA 4N56A 4TSXA 4FCYA 2QKKA 3SLCA 1JXEA 1SL1A 3TTFA 4IFYA 3P39A 4DQPA 1CZ9A 3S41A 1RTJA 5KPRA 4OPHA 1WBBA 4JK9A 1WSIA 4PL7A 3E1YA 1KAYA 2F8TA 2VQFK 2D4WA 1ZBUA 3CFRA 4CF9A 5M1PA 4H5RA 4BRLA 4CK1A 2W42A 1RTHA 4AHCA 1TGOA 3OHRA 1HQEA 1ATNA 3QLHA 5GIPA 2FXUA 2ATQA 1VQ7N 1SL0A 2CH5A 2P9UA 4BRAA 1RT1A 5SWMA 2GX9A 3S3OA 3T7ZA 2VWKA 4QCLA 4O0JA 5FLXO 3WUHA 4B9VA 4DF8A 4DV6K 5JMVA 1L3TA 2WTUA 4DTJA 4DQIA 3OY9A 2JWLA 3OYEA 4HVJA 3A5NC 3QB0A 1KFSA 2HMIA 5ADXH 3U8XA 4CBXA 3AVCA 4I2PA 4Z4IA 2UU9K 2O4IA 2UUAK 3UE5A 4JV5K 3OA9A 4O55A 1EETA 3VQ5A 3ENBA 2BTFA 4FWNA 1GLDG 1HYSA 2NRTA 3O5BA 3I0SA 3HM8A 1BU6O 3P83D 3KLFA 2HVHA 5J2NA 4FO0A 4BE2A 4RW8A 3HOTA 3HBTA 3PY8A 3WXMB 1T44A 4LC9B 1X9WA 4NO7A 1BCMA 4Z4GA 2EX3A 1WAJA 5TKWA 3HPOA 3DLKA 1QQCA 1LW2A 3PUFA 1NJIO 4BY9C 4FJ5A 3O3HA 2ASPA 2NRRA 3D6RA 3LL3A 4IXCA 4DG1A 4YOWA 4GV6A 1D9FA 4DV0K 3Q7BA 1Q7YO 3SBTA 4DS4A 1J6ZA 3CQYA 4I7FA 5C15A 5KTQA 1VSDA 3EE8A 1YVUA 1QSYA 1Q86O 2PYJA 4X62K 3PX6A 4GNIA 3VGMA 1TKXA 4E89A 3CETA 2OPRA 3J7ZO 4HCCA 1HQUA 1Q81O 1VSJA 4HWIA 3TU5A 4FW2A 2WFBA 1SKSA 1XHXA 4JD2A 3VQ4A 3WQTA 1NJXA 3LDQA 1D5AA 1BISA 5KGXA 4BC2A 3KLHA 4FSVA 1TKDA 3AVGA 4DSIA 4NLCA 4FJIA 4KAZA 2YHAA 4M3UA 4R5PA 4OGEA 1KCFA 3NVMA 4CZHA 3OJUA 4BRDA 3FLCO 2HW3A 2VCPA 1HNXK 4BGAA 4FK0A 4FM1A 3MK6A 3PO5A 5F0XA 4EP4A 4GVEA 5KRSA 4IG0A 4CVNE 1XI1A 1KD1O 1A5VA 1H1VA 3R9PA 1NKBA 3UB5A 4CE9A 3C7NA 3KWIA 4CJRA 3AO5A 4M3YA 4FZYA 2HOEA 1LWFA 3O80A 2GEMA 3CMAN 3QNNA 3OJSA 5DM6L 3AA3A 1TUYA 2XY7A 2D0BA 2GELA 3PSFA 3LP3A 3OYCA 1Q18A 3SUQA 3J7AP 2IS3A 3RSEB 3QINA 2KZZA 5F1XA 4EIAA 1XMQK 3AA2A 5I42A 4CEBA 5EOYA 1C1CA 3AVKA 4E7LA 5C0YA 5AQXA 1J53A 1Z6RA 2FLOA 2F4VK 3DXMA 5J2QA 3CXCM 4FL9A 1QSLA 1ZC6A 1XC3A 4LFBK 1X9SA 3U9DA 5DMRA 1VQ5N 4JI3K 3V4IA 2RE2A 2ETJA 3ULDA 2X6SA 3BDPA 1BG3A 1HYZA 2RKIA 3THYB 1RDDA 3V81A 1NU0A 3ATUA 4CHZA 1RT6A 4B9QA 4FJXA 4PY5A 3VF6A 4B9NA 4YOTA 3VA3A 1BQMA 1M1KO 1W0HA 3W3DA 5BPMA 2E1ZA 4IG3A 5EU7A 5AQFA 4H5WA 3O6WA 3VQPA 4CZKA 1ASUA 3MX5A 1E4FT 1ASVA 5MLCQ 5JLFA 4CHPA 4A62A 1B9DA 2RHKA 5E84A 4ELVA 5AQHA 2UXDK 3S3NA 1VQ4N 5J1EA 2ZGZA 3P4IA 3KLGA 3CF5L 4Z4HA 3G6EN 3T69A 3HVRA 1S1XA 3O1BA 4DTOA 1DTQA 3F9KA 5IWAK 4WFNL 3PX0A 2CGKA 4DS5A 4Z4CA 2QW9A 2P9PA 3AA5X 1GLFO 1NGGA 1K9MO 2O8EA 5JS2A 4DFMA 1ZBFA 3CC2N 3ITHA 3R3LA 4E19A 3DI6A 3CQXA 3ZETB 3VQEA 4CHOA 4C8OA 1QQNA 4K25A 2G8KA 2UUBK 1NBWA 1NGAA 1TKZA 1Z25A 3V1RA 3PV8A 1U4BA 3KJVA 1XMOK 5ADXA 3O1WA 4XIUA 1E3MA 5AQPA 2IC3A 3A2FA 3KHYA 1FKPA 1ZBLA 4CJQA 3IUCA 3MEGA 1ATSA 3VGLA 1NK6A 3NGZA 4IOAL 2HHQA 1SS6A 4FJ9A 4QOZB 2O8BB 1Q9XA 4FJ7A 3LP2A 4DF4A 4Y1CA 3I0RA 3T19A 3G25A 1DT9A 3CHWA 4FWRA 2UUCK 3A5OC 4KH4A 3AAQA 4N76A 1DGKN 3C0BA 4X66K 2NNWA 1TK8A 4DSJA 1SL2A 3QEPA 2ZD1A 3CG7A 4DV7K 2FBVA 1W9HA 2VWJA 1LAVA 3K5MA 2HHHK 4CJ7A 4PQUA 1EQYA 3AGKA 3DLHA 4DTXA 1QVGM 2HSTA 2YJFA 3IG1A 1HKBA 4KV8A 3FGUA 2CH6A 3QIOA 4EAHD 1K73O 3TAPA 3IS9A 4BACA 2PAVA 4CGGA 1RT5A 2D0AA 2YHBA 3H45C 3HI0A 4I6MA 5AQWA 4W5OA 4M3WA 3H6EA 3H3OB 3OYHA 1SQKA 2P9SA 4LH5A 3CCUN 1U04A 3SNNA 1TVRA 4DTNA 4KTWA 3LPUA 3VEYA 4HUFA 4DTRA 4DHYA 2Z1HA 3MN7A 3OYLA 2P5GA 3NDKA 1S3XA 4FOIA 1DKGD 4FJGA 4LF5K 3I55N 4EZ9A 3QERA 2QXLA 3HP6A 3B8AX 4DR5K 3P1GA 3AVBA 4XH5A 4DV3K 4NXNK 1IBLK 4PKIA 3OS0A 3CFPA 4Y1DA 4B3TK 5AQYA 4FWLA 1KFDA 4CHNA 4ZHRA 2HNZA 4FJMA 3EO3A 4CJVA 4DFKA 4IO9L 4BVOA 2XO7A 2HBJA 2F96A 1QQOA 2P9LA 3RR8A 3CJ9A 4H4OA 2ZM6K 2FBYA 4CEQA 1U6ZA 2WONA 3ENHA 2HF4A 1NOYA 1RDUA 1BI4A 4B8CA 3J81O 2O8DA 4CEFA 1TK5A 1UA0A 3THWB 3MX2A 1IO2A 3WQUA 4DR6K 4EZ6A 3FE1A 3AVFA 5KRTA 4LF6K 3L2VA 3KK1A 2E4LA 2Q0RA 3NMUA 4YOVA 5A2QO 1RBRA 1OH6A 3T1HK 2HMPA 2NRZA 4DR2K 3QESA 1JLFA 3K9JA 3HO1A 2I5JA 3ZSXA 2B6AA 2QI2A 4JKDA 4BE0A 3U3YA 2F7TA 4FWOA 3V9SA 2QWRA 1L3VA 2QWMA 2WBNA 3T1AA 1BOTO 4J2EA 3WXKA 4JN4A 4JKGA 5ELZA 5C24A 3SBGA 2QKBA 3IAYA 1YVNA 1NM1A 3VEXA 3I8BA 2ZQBA 3O4QA 4CJFA 1IBKK 3L0QA 3LAKA 1J5EK 2I7PA 4R79A 1NK5A 5HRSA 2GWJA 1BGXT 1VSIA 3M8QA 4KHSA 3IKMA 3RVCA 3ZSVA 1YI2N 5SZTA 4GKKK 3LDNA 1N34K 3HM9A 3MECA 1WSJA 1ZXOA 4MO4A 4CGDA 1VSFA 3D2EB 3D7EO 3OYMA 2VG6A 3BGRA 5HL7L 4CI6A 3E9OA 5AQMA 3KK3A 3VQ9A 4KPYA 3AO3A 4YOUA 4ISGA 5AQQA 2OZMA 3VQ7A 3A0IX 2AP1A 1IKYA 1S72N 1GLJO 3L2RA 3KLEA 3M3ZA 3TSUA 5TKYA 3TAFA 3V9UA 3VESA 2E2PA 4JS4A 3VETA 3V9WA 2A1SA 3CCRN 3A8YA 1GLLO 4AM6A 4KB1A 3IMXA 2CGLA 4BRHA 4LH4A 2ZJRL 4KTZA 4IEIA 4A2AA 2V51B 4RW4A 4LD0A 4WCEL 3TARA 4HCBA 4I2QA 1W2BM 3RR7A 2Q1NA 3ZETA 4A5AA 4WQ5A 3GDQA 4WE1A 3DOLA 3ZSOA 4LFCK 4KRFA 1ATRA 2ZGYA 1WSGA 3ZT1A 2EWSA 4BG8A 4CGJA 1T6DA 4OKEA 4ELUA 3PSIA 4JI2K 3TTCA 3P5JA 4HUGA 4JHDB 3NH0A 4CJPA 3C6HA 1I39A 3SV3A 4B3OA 3C6TA 4JHDA 4B1WB 1U47A 5FPNA 2PFUA 1C6VA 3CCEN 4J8FA 3T1YK 3R1XA 3HOSA 3JYTA 4FLUA 3AY9A 3BF3A 4DU1A 2B4JA 1UA1A 3MMVA 5IT9O 3TSPA 4FLTA 3LDPA 4RTFD 4CCHA 1GLAG 3O4WA 3WT0A 4FM0A 3SAFA 2OPQA 4JEPA 2H3GX 1RBVA 3VQ8A 4BR9A 3LANA 3MDQA 1X3MA 3H46O 3MXJA 2ZWHA 4BRIA 4B3SK 3ZX2A 3HP9A 5AQUA 1MWMA 3AA4A 4OKJA 4B9UA 4O4GA 4F9OA 4FLVA 2VGMA 4M3TA 1REVA 2GWKA 3TWHA 4BC3A 2OA8A 3K9KA 3VERA 1DTTA 3VQDA 1M90O 1NGCA 3SCXA 4PWDA 1NGBA 3NVKA 4PL8A 5EY4A 4CIFA 5GAEP 2BANA 5HRNA 2BGGA 1XHZA 2KHOA 1TYQA 3O9RA 3ZEUA 5BR9A 2OZSA 1WSHA 1EO1A 4DSKA 5LJVA 3MAQA 5FPDA 4YDUA 4BRCA 1D8YA 2BUPA 3MWPA 1C0UA 1F21A 1TAQA 3OYJA 3TANA 4X64K 4RWTA 1IG8A 3VEZA 1BIUA 4QS7A 2YX6A 4OO1J 4N41A 4GV9A 3IFRA 4CJEA 3K0SA 4FM2A 3DM2A 3TABA 1JJ2M 4JI5K 3O9TA 1VQPN 1NWKA 1W7AA 2KW4A 5FDLA 3RSEA 4CBUA 4JI8K 3FFIA 2E8AA 4IOXA 2VQEK 4B3MK 1HYVA 4ID5A 2YHYA 1J5OA 5KPTA 1BHLA 5K14A 4YHHK 1L3UA 1OH8A 3ATVA 2OPSA 4BROA 3THVA 4B9TA 2G8IA 2ITGA 4GVMA 1K8KB 4I9LA 3VENA 4LFAK 3FZHA 2YV0X 3CPEA 3GE1A 5CZ2A 3EZWA 1FKOA 1XNRK 3H08A 4B08A 3AO4A 5FROA 4AHSA 2FC0A 2PBDA 2FSJA 3SUNA 4M63C 2PY5A 3VEOA 1C0TA 2EHGA 3OYAA 2YKMA 3D2FA 3CCMN 4O0IA 3LDLA 1B92A 2O8FB 1NMNA 2OCEA 3NBPA 1HR0K 4K41A 2Q36A 1QE1A 2A40A 4JI1K 3EZ5A 5AQTA 4IO8A 4AF1A 4YOXA 3SPYA 3MEDA 2W6KA 4A57A 3CCSN 4WQ5C 5DM7L 4AHTA 1JLAA 3ZT3A 3CJBA 3WEEA 1KAZA 5EVZA 4KHUA 3QMLA 1WAFA 1E4GT 3OS2A 4WQ4A 3KTQA 4AILC 5F2RA 1A5WA 1W97L 4JKHA 5CZ1A 1VQMN 1S6PA 2FSNA 3VTHA 1U48A 1SKRA 1X1PA 4F3TA 4H5NA 1UOCA 2WOMA 1NK8A 2DFHA 2D1KA 1WN7A 1BUPA 3MXMA 3ID8A 1BQNA 1WNSA 3D2EA 3DRSA 3OTOK 4AM7A 4B1ZA 4KFBA 5C2FA 1BI4B 3CQ8A 3EYZA 1HRHA 3VGKA 3S3MA 4LF8K 4C1NK 4LSLA 1CLQA 3TTDA 2GBZA 3VEVA 1XWLA 1ILYA 3R8EA 4CGFA 4DR1K 1JL2A 2HBLA 5AJ3K 4HHTA 4BWMA 1VK0A 1YF5L 3CCJN 4CECA 1HMVA 4JI0K 4W5RA 4RW7A 5GAHP 4DKWA 3LWMA 4U7BA 1EXQA 2O8FA 2A6AA 3H1QA 4C8NA 3ZLJA 4BDYA 4LF9K 3FR0A 1VSLA 4KHWA 1KVBA 3RMAA 5GADP 5AFUH 5AQKA 2WUSA 3NGYA 1HNVA 3ZSZA 3L4QA 1NMDA 3SZ2A 3J80O 2JLEA 1RBSA 4GKJK 1RDBA 5BR8K 1HKGA 4DMNA 5BPNA 5AZJA 3L2UA 5HP1A 1X9MA 3UKUA 2IVPA 4WQ4C 4PA1A 3Q7CA 5LMUK 4E7JA 3TAQA 4CESA 2X74A 1YAGA 4JI4K 5BN9A 1BWFO 4DUYK 2KFZA 3FZFA 1Q82O 3UKRA 3HZ6A 4HTUA 3HRGA 3MN5A 2HNYA 1EKEA 1UWBA 1EWQA 3LM9A 4CJTA 4JK7A 4FLZA 1KVCA 4A61A 2XY5A 1V4TA 3SPZA 3QFUA 3ID6A 4KKOA 4JNEA 3B6OA 1GOCA 2W6LA 3SV4A 4F8RA 3NF6A 1RDAA 3SQ2A 4NCGA 4CZGA 3ZX0A 1HJRA 5KQ8A 4DLEA 3U4LA 1DEJA 3J7YP 4JD2B 4CFDA 2R7YA 3E01A 5CR4A 1IKXA 4H0PA 3EE9A 4DTUA 2D5RA 2B5JA 1HKCA 4M3XA 2GUPA 4KI4A 4ID1A 4CEEA 1NGDA 5FPMA 1LW0A 5AQRA 4CJSA 1LV5A 1QZ6A 1FXXA 2V7ZA 4KTQA 3VMFB 4DU3A 1RT4A 2DPNA 3KZBA 1L3SA 2XHBA 3SMSA 2CGJA 4CHQA 1YIJN 5M1OA 2VWBA 2QXFA 5AQSA 1YUWA 3PIPL 3VQAA 4MDBA 4Z4EA 2D0CA 1EP4A 2VG7A 4FPBA 4Y0WA 4FWSA 3K59A 4FXDA 4CD3A 3DYAA 3PX4A 1LAWA 4IDKA 5HRPA 1HJOA 1MDUB 1SAZA 2ASMA 4DB3A 3HPGA 3SMPA 4E1JA 3S9HA 2Y1JA 2HBMA 2IGIA 4IFEA 3F5TA 3U6FA 3FZKA 2V7YA 4L3QA 1WUAA 4G1QA 1N5YA 2ZF5O 3GOIA 1IJJA 3I8DA 2KTQA 3C6AA 5GINA 3O4NA 3MCPA 3I56N 1GLEG 4ZTFA 3ZT0A 4E7IA 4KBOA 3CM6A 3H3NO 4M7XA 4E7HA 4CERA 1NJWA 4MLHA 4CJ5A 1WLJA 3VQQA 1JLCA 1J54A 3BP8A 1ZBSA 4O44A 2YHXA 1IH7A 1QZ5A 4RG8A 4RW6A 1JCEA 2DFEA 3MXIA 1HUXA 2D0OA 4I9QA 3CYMA 3OYBA 4DV5K 3JXUA 4JAXA 2UXBK 2P9IB 1NGFA 4DQQA 2DFFA 3ENOA 4DU4A 1VQ6N 4DV2K 3F73A 4BR7A 4IEEA 5CYQA 3O3FA 3FFKB 3WNFA 1NGIA 3VF2A 4JI7K 4CZEA 1KQSM 3VA0A 3MN6A 3GL1A 4IZ9A 3CERA 1BL3A 1SUQA 3SI6A 1T6CA 3CJCA 5KQDA 1GLBG 3KKSA 2YNIA 4YNQA 1ZBIA 3CMEN 3SUPA 4CGHA 4OLAA 3DWLA 3TSQA 1S9GA 3TPQA 4FJJA 4BE1A 4F4KA 4CJ4A 2G8HA 5JVGL 3D2FB 4FWQA 2V52B 2RN2A 3U9ZA 1HPMA 4DR7K 4KHQA 3QIPA 2PZSA 3ZYYX 3AARA 4KHYA 3WNEA 4CF1A 4GY2B 1VAZA 5FPEA 4ILHA 2XY6A 3WNGA 5LJWA 3QEIA 4CEAA 4CEDA 1LWCA 5HLFA 3EKSA 2P51A 3UKRB 1RT3A 1YJNN 4NXMK 2KZMA 2RPIA 4BVPA 2FF3B 2VG5A 3QETA 3M8PA 2Q97A 3KVGA 3OBWA 3AVNA 3NF7A 4JLHA 2HNDA 5H1SQ 3SQ1A 4CJKA 3JSMA 1T05A 2WC9A 4JYAK 1YTUA 1S1WA 1RTIA 4IDHA 3RWUA 3I33A 4KB0A 4AH9A 1U2VA 4JKAA 4YORA 3O3GA 4KO0A 4ILGB 4E0DA 3WEEB 5AQJA 3HSTB 1FK9A 3WXLA 4KI6A 3CJAA 3AO2A 4CIEA 4YDUC 4DCHA 3HTVA 4CEZA 5AQLA 1U45A 5BPLA 4CGIA 4Q5VA 1DLOA 2P9NA 4B1UB 1QQMA 2I7NA 4CZLA 4CEOA 4LF7K 1S1VA 2PYLA 1SKWA 5KI6A 3LPTA 3BEXA 1YHQN 3G0ZA 4PKHA 2QWNA 2XY8A 3BY5A 5M1KA 4OPJA 5BN8A 2E5LK 3K57A 4CJ3A 4YOYA 4FW1A 4FLWA 4A2BA 1ASWA 1JLBA 1VHXA 1GOBA 4LY7A 3B6PA 5E26A 3NAEA 4CBWA 3ZSWA 4DV4K 2P1JA 3CFOA 4BC4A 4EHUA 3ASMA 2YNFA 1OVQA 3C95A 1VQ9N 5LL6Z 3RMDA 3K5NA 1JCGA 1XNQK 2HHSA 2OTLN 4MFBA 1QTMA 3NFAA 3NH2A 3L2WA 3HJFA 4DR3K 3D0PA 3QNOA 3DRPA 1RDWX 4CFAA 4M7YA 3K2PA 1T03A 3ZSYA 1LCUA 1MU2A 3E9PA 4CFBA 4JRPA 4FVUA 5C25A 3OYKA 3G71N 3UKUB 1OKJA 2FSKA 1S1UA 4K8XA 1R59O 4H0YB 1T8EA 2NRVA 2HBKA 3M6GA 3FZLA 2IVOA 1N33K 1VQKN 3F2KA 3ULEB 3D45A 2W41A 4DSLA 3ULEA 4CFCA 1WB9A 4AHRA 4JRQA 5CE3A 4M3ZA 5JLHA 2KKZA 4BRQA 3ZSQA 2P9UB 4JKCA 2A42A 3WXIA 3KD1E 5HRRA 1HNWK 1Q9YA 3LZIA 3NH1A 3ZT4A 3HXMA 1Y97A 4U67L 3LWLA 1Z26A 3DLRA 3SQ4A 4CZFA 4QAGA 3C94A 1ESVA 3AVMA 3CJ1A 3VQCA 1OH7A 4B1XB 5JVHL 4G9ZA 2X6NA 1S22A 2E2NA 3ZX3A 2E6LA 3VQ6A 3CM5A 2KQ2A 2IDOA 3ZCMA 4FK4A 4FJKA 3GBTA 1BIZA 2D0PA 5EX5A 3AVIA 4IKFA 1ZBHA 4MDAA 3RRGA 3HPHA 4KH6A 3P31A 1VRTA 4WFAL 5I3UA 3V9ZA 3N4PA 2IAJA 3AVLA 4NCAA 4A5BA 2QEXN 3C7NB 5AQIA 2KLAA 1X9JA 4NLBA 2NRXA 1NK4A 3MN9A 4BRGA 4BDPA 4YY3K 4Z94A 2QWOA 2P9PB 3EL2A 2YKNA 1EWRA 4M45A 3LALA 4ILJA 3OYIA 1NK0A 4AHVA 1IV0A 3OYNA 3L6QA 3QEWA 4F2SA 4BDZA 3CD6N 5C2DA 4KHNA 1HPZA 3NGIA 2E2OA 4WF9L 4PKGA 2P9SB 3DOKA 3QDKA 3G10A 4C8KA 2BH1A 4CZMA 4DSFA 3SJJA 5M1NA 5BRHA 3CC4N 3AVJA 5C12A 2A3ZA 5AFUA 3KKRA 1NKEA 3CCVN 2Q3SA 3KIOA 5AZIA 4O5FA 3OYFA 2P9IA 4RW9A 1Q8IA 2Z1GA 2O4GA 4EP5A 3O9QA 4FZZA 3L4IA 2P5OA 1TYQB 3OVNA 1YT3A 4E1MA 4FWKA 4K42A 4BWJA 4CD1A 4CF8A 3QICA 4H5TA 1J9AA 4RCHA 3OYDA 3VEWA 5M1QA 1JCFA 3DXKA 3CCLN 1T3VA 1V4SA 4BREA 2HHWA 5J2MA 1MWKA 3LM2A 4FJLA 1NGHA 3DXMB 4OLBA 3DMJA 5AR0A 4QS9A 2G8UA 3HSCA 4BC5A 4O5BA 1VRUA 4OVLA 3NE6A 3TAMA 4EHTA 3VF4A 2Q31A 1R0AA 1NGEA 2P9KA 3L3UA 4HUEA 4LSNA 2YNGA 4C8LA 2QK9A 1SZ2A 1C0MA 2O8CA 4BR4A 3FZMA 3IDHA 1CZBA 3E66A 1RFQA 4BQLA 5FRNA 4K8ZA 4H03B 5C42A 4X65K 2O8CB 1N32K 4WYBA 3R6MA 2HHUA 1K8KA 3F9MA 2BDPA 5AZIB 1RBUA 2NRWA 2UYTA 1RDCA 3ZSRA 4QS8A 5BRFA 1XC9A 1NK7A 3HT3A 4BRKA 4ZTJA 2ZJQL 1U2VB 4JK8A 4BRNA 4CJUA 1ITGA 2F9TA 4K43A 4E7KA 4FJHA 4KREA 2YI1A 4PUOA 1BA0A 1RBTA 4Z4FA 2E6MA 1NG9A 4DQRA 3J8AA 3SJHA 2ZJPL 1TUUA 4CK3A 2QWLA 3E9LA 3RRHA 4BGBA 3JAMO 3T3FA 1I94K 1JLGA 4DSEA 3VQBA 3ALYA 1P90A 2IIRA 2GUIA 2O8DB 3QEVA 4BQZA 3VN5A 1NNEA 1VSHA 1C0FA 1X3NA 4J2AA 3CC7N 5T7BA 5BRDA 1N6QA 1VQ8N 2E1YA 1CXUA 1S6QA 3MEEA 3CPWM 4XH4A 1O13A 2Q2RA 4IBNA 4J2DA 1WOQA 3TAEA 4OKKA 1JLEA 1NGJA 4F3OA 2QA4N
chains in the Genus database with same CATH topology
1Q86O 5M1FA 3VETA 4GNIA 5C10A 3VGMA 3CCRN 3A8YA 3CCQN 3CETA 3JXUA 4H0XB 4JAXA 1GLLO 2P9IB 4DQ8A 1NGFA 4AM6A 1VQ6N 3ENOA 3IMXA 3J7ZO 2CGLA 4B1VA 4BRHA 2ZJRL 5AQOA 4BR7A 4IEEA 4IEIA 4A2AA 3OW2M 1KXPA 2V51B 3FFKB 1Q81O 4HWIA 3TU5A 1NGIA 4FOEA 4BR2A 3CIPA 4WCEL 2WFBA 1W2BM 3VF2A 1QVFM 4CZEA 4JD2A 3WQTA 1KQSM 3MN6A 3LDQA 1XQSC 3GL1A 2Q1NA 3CERA 4IZ9A 4BC2A 4FSVA 1CZAN 3ZETA 4CZIA 1T6CA 4A5AA 3CJCA 5KQDA 4WQ5A 1GLBG 4NLCA 3GDQA 2QTDA 5LY3A 3CMEN 3SAHA 1ATRA 2ZGYA 4HTLA 3NVMA 4CZHA 4BRDA 3DWLA 3FLCO 2VCPA 3TSQA 3TPQA 2EWSA 4BG8A 4BGAA 4BRFA 1T6DA 3MK6A 4BR0A 5JVGL 2J4RA 3D2FB 3WXJA 5F0XA 3PLAA 1BO5O 4FWQA 3TTCA 2V52B 4JHDB 4H0TB 3U9ZA 1HPMA 3C6HA 1KAXA 3VPZA 4H0VB 3AAPA 4JHDA 4GVEA 4B1WB 1LOTB 3ZYYX 3AARA 5FPNA 1KD1O 4JKFA 2HF3A 2PFUA 3C65A 4GY2B 3CCEN 1H1VA 1VAZA 3R9PA 3UB5A 5FPEA 4ILHA 4J8FA 3C7NA 3KWIA 3R1XA 3HOSA 5LJWA 2HOEA 3AY9A 3DJCA 3O80A 2GEMA 3BF3A 3DXKB 3CMAN 1VQNN 3MCAB 5DM6L 3QBXA 1TUYA 3MMVA 1RGIA 3EKSA 2ITMA 2GELA 2YJEA 5AQGA 3UKRB 1YJNN 1Q18A 3TSPA 2E20A 2QM1A 3RSEB 4BVPA 3LDPA 2FF3B 1K8AO 4RTFD 5F1XA 3QBWA 4EIAA 1G99A 5AQNA 1XUPO 2Q97A 3KVGA 3OBWA 4NB4A 3DLLL 1GLAG 3O4WA 3WT0A 5EOYA 4H0OA 3SAFA 4B1YB 5C0YA 4JEPA 2H3GX 5AQXA 5H1SQ 1Z6RA 4MLEA 2FLOA 4BR5A 1YJWN 4BR9A 2WC9A 3DXMA 4EFHA 3MDQA 1X3MA 3H46O 3CXCM 4FL9A 1ZC6A 1XC3A 2ZWHA 3U9DA 1VQ5N 4IDHA 4BRIA 3I33A 3EKUA 2RE2A 3ZX2A 1U2VA 4JKAA 4YORA 5AQUA 1MWMA 4ILGB 1BG3A 3WEEB 5AQJA 4F9OA 2VGMA 3WXLA 2GWKA 3CJAA 1HX1A 4FWMA 4BC3A 3ATUA 1BA1A 3MWTA 4YDUC 3HTVA 4B9QA 4CZJA 4DCHA 1YXQA 3K9KA 5AQLA 4WFBL 3VF6A 3VERA 5BPLA 1M90O 1P8ZA 4YOTA 4JKGB 1VQLN 1NGCA 1NGBA 5HOOA 3PIOL 2P9NA 4PL8A 5EY4A 4B1UB 3NVKA 3O8MA 3LDOA 3EN9A 1M1KO 1QQMA 3W3DA 2I7NA 4CZLA 5BPMA 5GAEP 2E1ZA 5KPZA 2KHOA 3BEXA 1TYQA 5AQFA 3DAWA 3O9RA 4PKHA 1YHQN 3ZEUA 2QWNA 4H5WA 3O6WA 5BR9A 5M1KA 1EO1A 4CZKA 3MX5A 5BN8A 5LJVA 5FPDA 4YOYA 1E4FT 3P38A 4YDUA 4BRCA 4A2BA 2BUPA 3MWPA 4JKBA 5MLCQ 3G4SN 5JLFA 4IOCL 3CJ7A 4RWTA 1IG8A 3VEZA 4OPAA 5E26A 4QS7A 2YX6A 4O8UA 4A62A 4OO1J 4CBWA 2RHKA 5E84A 4GV9A 3IFRA 5AQHA 2IVNA 4BC4A 4EHUA 1JJ2M 1VQ9N 3O9TA 1VQ4N 1VQPN 1NWKA 2NZTA 2ZGZA 3P4IA 3RSEA 2ASOA 4CBUA 1JCGA 3CF5L 3OBYA 3G6EN 2OTLN 2E8AA 5B8HA 3T69A 2P9KB 3GG4A 3O1BA 4FPAA 4IOXA 1RDWX 4M7YA 4WFNL 1LCUA 2CGKA 2YHYA 3E9PA 5KPTA 4FVUA 2E2QA 3G71N 3UKUB 1OKJA 2QWQA 5GIOA 2QW9A 3ATVA 2FSKA 4BROA 1R59O 2P9PA 1GLFO 1NGGA 1K9MO 4H0YB 2NRVA 1K8KB 2HBKA 2VGNA 3M6GA 3VENA 3FZLA 2IVOA 4GV3A 3CC2N 2NRHA 3FZHA 1YJ9N 1MA9B 2OANA 3CPEA 3F2KA 3GE1A 3R3LA 4BRMA 3SAGA 3EZWA 3JS6A 3ULEB 3CQXA 3ZETB 2W41A 3CI5A 3M1FA 3ULEA 1QQNA 4K25A 4I6MB 1NBWA 1NGAA 5BREA 2PBDA 2FSJA 5CE3A 4M63C 5I9EB 3H1VX 5JLHA 2KKZA 3O1WA 4BRQA 5ADXA 2OTJN 3VEOA 2P9UB 5AQPA 3KHYA 4JKCA 4BRPA 2A42A 3BUZB 3IUCA 4IWVA 3WXIA 1ATSA 3D2FA 3VGLA 3CCMN 4ISFA 3LDLA 4IOAL 4ISEA 1SS6A 4H5VA 4U67L 5AQZA 4CZFA 1VQON 4K41A 4C1NI 2Q36A 2JWKA 1ESVA 2A40A 3CJ1A 5AQTA 4IO8A 4AF1A 4B1XB 4YOXA 5JVHL 4XEIA 4A57A 3CCSN 4WQ5C 3ZEUB 5DM7L 1S22A 4G9ZA 2W40A 3CJBA 2E2NA 3G25A 1DT9A 3WEEA 2VYPA 3ZX3A 3VTIA 1Z05A 1NLVA 1KAZA 3CHWA 4FWRA 4IJAA 5EVZA 3A5OC 4MO5A 1BDGA 3GBTA 3QMLA 2D0PA 5EX5A 1E4GT 1Y64A 4WQ4A 3KWGA 4KH4A 3KK7A 3AAQA 5GAGP 2QWPA 5F2RA 2P9NB 5AZJB 1W97L 4JKHA 2YCHA 1VQMN 1DGKN 3C0BA 2NNWA 4MDAA 2FSNA 3VTHA 4KH6A 3P31A 2AA4A 4WFAL 4H5NA 3N4PA 2Q0UA 4A5BA 2NLXA 2QEXN 2D1KA 3C7NB 4CJ7A 1EQYA 5AQIA 3AGKA 5JICA 2KLAA 1X9JA 1BUPA 4NLBA 2NRXA 2P9LB 3W0LA 1QVGM 2A5XA 1OVYA 2HSTA 3O9UA 3MN9A 4A59A 3ID8A 4BRGA 2YJFA 2F9WA 3AGRA 3D2EA 4Z94A 1HKBA 2QWOA 3FGUA 4AM7A 4B1ZA 2CH6A 4XH1A 4EAHD 3A5MC 5C2FA 1K73O 2P9PB 3EL2A 1YITN 2E88A 2PAVA 4I6MA 3H45C 3HI0A 5AQWA 3H6EA 3VGKA 1HLUA 3H3OB 4C1NK 3BF1A 4ILJA 3TTDA 1SQKA 4JKEA 2P9SA 3L6QA 3VEVA 3CD6N 5C2DA 1ILYA 2E2OA 4WF9L 4PKGA 1D4XA 2P9SB 3R8EA 5CHIA 3QDKA 3CCUN 2HBLA 2BH1A 4CZMA 5M1NA 5BRHA 1GLCG 2YHWA 3CC4N 3CCJN 1QHAA 1YF5L 4FWPA 5C12A 3O08A 2A3ZA 3VEYA 3EE8A 5AFUA 4DHYA 5GAHP 3MN7A 4DKWA 2A41A 4U7BA 3A5LC 3CCVN 3N4QA 1C0GA 4KH5A 1S3XA 2A6AA 4FOIA 1DKGD 2FF6A 3H1QA 3M5RA 4O5FA 5AZIA 3I55N 2GTDA 2P9IA 2QXLA 3B8AX 3FR0A 4C23A 3O9QA 3O9SA 4XH5A 3L4IA 1TYQB 5GADP 5AQVA 4PHTX 5AFUH 5AQKA 2WUSA 4PKIA 4FWKA 4K42A 5AQYA 4CD1A 4FWLA 5EXWA 3L4QA 1NMDA 3SK3A 3QICA 3EO3A 4O8KA 4H5TA 3QFPA 4IO9L 4BVOA 2HBJA 1N8RO 4RCHA 1HKGA 5BPNA 3VEWA 5AZJA 1QQOA 2P9LA 3UKUA 2IVPA 4WQ4C 3CJ9A 5M1QA 1JCFA 3Q7CA 4IJNA 1YAGA 3DXKA 1U6ZA 3ENHA 1KC8O 2HF4A 3CCLN 1T3VA 5BN9A 1BWFO 1RDUA 1V4SA 3VOVA 4BREA 4BG9A 1MWKA 3FZFA 1Q82O 3UKRA 3HZ6A 3LM2A 3MX2A 1NGHA 3DXMB 3HRGA 5AR0A 3MN5A 4UY8O 3WQUA 3SLCA 3FE1A 4QS9A 3TTFA 3HSCA 3P39A 3LM9A 4BC5A 3S41A 2Q0RA 3NMUA 5KPRA 4OPHA 4JK7A 4YOVA 4EHTA 3VF4A 4A61A 4JK9A 2Q31A 4PL7A 3E1YA 1V4TA 1KAYA 1NGEA 3QFUA 2P9KA 2HMPA 2D4WA 2NRZA 3ID6A 5M1PA 4JNEA 4H5RA 4BRLA 3K9JA 1SZ2A 2QI2A 4JKDA 4BR4A 3FZMA 3IDHA 3OHRA 1ATNA 2F7TA 3E66A 4FWOA 1RFQA 2QWRA 4BQLA 5GIPA 2FXUA 4CZGA 4H03B 1VQ7N 2QWMA 2WBNA 3ZX0A 2CH5A 1BOTO 2P9UA 4WYBA 3R6MA 5KQ8A 3WXKA 4BRAA 4JN4A 3U4LA 1DEJA 2GX9A 4JKGA 5ELZA 1K8KA 4JD2B 3SBGA 3T7ZA 3F9MA 1YVNA 5CR4A 3WUHA 1NM1A 4H0PA 3EE9A 3I8BA 3VEXA 5AZIB 1HKCA 5JMVA 2GUPA 2NRWA 2UYTA 3L0QA 4QS8A 5BRFA 2I7PA 2JWLA 1NGDA 4R79A 5FPMA 4BRKA 2GWJA 2ZJQL 1U2VB 5AQRA 4JK8A 4BRNA 1QZ6A 3A5NC 3QB0A 2V7ZA 3VMFB 2F9TA 3IKMA 4K43A 3RVCA 5ADXH 3KZBA 2DPNA 1YI2N 3SMSA 2YI1A 3U8XA 1BA0A 2CGJA 1YIJN 4CBXA 3LDNA 5M1OA 2VWBA 5AQSA 1YUWA 3PIPL 4MDBA 3J8AA 3SJHA 2ZJPL 1TUUA 1ZXOA 2QWLA 4MO4A 3E9LA 4FPBA 4BGBA 4Y0WA 4FWSA 4CD3A 3UE5A 3D2EB 3OA9A 3D7EO 1HJOA 1MDUB 3ENBA 1SAZA 2ASMA 2BTFA 4FWNA 4DB3A 1P90A 1GLDG 2IIRA 3SMPA 4E1JA 2NRTA 3O5BA 3HM8A 1BU6O 2HBMA 5HL7L 4IFEA 3F5TA 4CI6A 3FZKA 2V7YA 4FO0A 1WUAA 4L3QA 3E9OA 4BQZA 3HOTA 3HBTA 5AQMA 2ZF5O 1C0FA 3GOIA 1IJJA 1X3NA 1T44A 2D0OA 4LC9B 4NO7A 3WXMB 3CC7N 3C6AA 4YOUA 5BRDA 5TKWA 5GINA 2E1YA 3MCPA 1GLEG 4ISGA 5AQQA 3I56N 1NJIO 1VQ8N 4BY9C 4KBOA 3CPWM 3H3NO 4M7XA 4XH4A 2ASPA 2NRRA 3D6RA 3A0IX 2AP1A 3LL3A 4IXCA 4MLHA 1O13A 4YOWA 3BP8A 4GV6A 3Q7BA 1ZBSA 1Q7YO 2Q2RA 3SBTA 1S72N 2YHXA 1WOQA 3CQYA 1J6ZA 1GLJO 5C15A 1NGJA 1QZ5A 3M3ZA 5TKYA 3TSUA 1JCEA 2QA4N 1HUXA 3VESA 2E2PA 1VQKN
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3VET A;  4GNI A;  3VGM A;  3A8Y A;  3CET A;  3JXU A;  4H0X B;  4JAX A;  1GLL O;  2P9I B;  4DQ8 A;  1NGF A;  4AM6 A;  3ENO A;  3IMX A;  2CGL A;  4B1V A;  4BRH A;  5AQO A;  4BR7 A;  4A2A A;  1KXP A;  2V51 B;  3FFK B;  4HWI A;  3TU5 A;  1NGI A;  4FOE A;  4BR2 A;  3CIP A;  3VF2 A;  4CZE A;  4JD2 A;  3WQT A;  3MN6 A;  3LDQ A;  1XQS C;  3GL1 A;  2Q1N A;  3CER A;  4IZ9 A;  4BC2 A;  4FSV A;  1CZA N;  3ZET A;  4CZI A;  1T6C A;  3CJC A;  5KQD A;  4WQ5 A;  1GLB G;  3GDQ A;  5LY3 A;  1ATR A;  2ZGY A;  4HTL A;  4CZH A;  4BRD A;  3FLC O;  3DWL A;  2VCP A;  3TPQ A;  2EWS A;  4BG8 A;  4BGA A;  4BRF A;  1T6D A;  3MK6 A;  4BR0 A;  2J4R A;  3D2F B;  3WXJ A;  5F0X A;  1BO5 O;  4FWQ A;  2V52 B;  4JHD B;  4H0T B;  3U9Z A;  1HPM A;  1KAX A;  3VPZ A;  4H0V B;  3AAP A;  4JHD A;  4B1W B;  1LOT B;  3AAR A;  5FPN A;  2HF3 A;  4GY2 B;  1H1V A;  3R9P A;  3UB5 A;  5FPE A;  4J8F A;  3C7N A;  5LJW A;  2HOE A;  3AY9 A;  3DJC A;  3O80 A;  2GEM A;  3BF3 A;  3DXK B;  3QBX A;  1TUY A;  3MMV A;  1RGI A;  3EKS A;  2ITM A;  2GEL A;  2YJE A;  5AQG A;  3UKR B;  1Q18 A;  2E20 A;  2QM1 A;  3RSE B;  4BVP A;  3LDP A;  2FF3 B;  4RTF D;  5F1X A;  3QBW A;  4EIA A;  1G99 A;  5AQN A;  1XUP O;  2Q97 A;  3KVG A;  4NB4 A;  1GLA G;  3O4W A;  3WT0 A;  5EOY A;  4H0O A;  4B1Y B;  5AQX A;  2H3G X;  1Z6R A;  4MLE A;  2FLO A;  4BR5 A;  4BR9 A;  3DXM A;  4EFH A;  3MDQ A;  1X3M A;  3H46 O;  4FL9 A;  1ZC6 A;  1XC3 A;  2ZWH A;  3U9D A;  4BRI A;  3I33 A;  3EKU A;  3ZX2 A;  1U2V A;  5AQU A;  1MWM A;  1BG3 A;  3WEE B;  5AQJ A;  4F9O A;  3WXL A;  2GWK A;  1HX1 A;  3CJA A;  4FWM A;  4BC3 A;  3ATU A;  1BA1 A;  4YDU C;  4DCH A;  3HTV A;  4B9Q A;  4CZJ A;  1YXQ A;  5AQL A;  3VF6 A;  3VER A;  5BPL A;  1P8Z A;  1NGC A;  1NGB A;  2P9N A;  4PL8 A;  5EY4 A;  4B1U B;  3O8M A;  3LDO A;  3EN9 A;  1QQM A;  3W3D A;  2I7N A;  4CZL A;  5BPM A;  2E1Z A;  5KPZ A;  2KHO A;  3BEX A;  1TYQ A;  5AQF A;  3DAW A;  4PKH A;  3ZEU A;  2QWN A;  4H5W A;  3O6W A;  5BR9 A;  4CZK A;  5BN8 A;  5LJV A;  5FPD A;  1E4F T;  4YDU A;  4BRC A;  4A2B A;  2BUP A;  5JLF A;  3CJ7 A;  4RWT A;  1IG8 A;  3VEZ A;  5E26 A;  4QS7 A;  4A62 A;  4CBW A;  5E84 A;  3IFR A;  5AQH A;  2IVN A;  4BC4 A;  4EHU A;  1NWK A;  2NZT A;  2ZGZ A;  3P4I A;  3RSE A;  2ASO A;  4CBU A;  1JCG A;  2E8A A;  5B8H A;  2P9K B;  3GG4 A;  3O1B A;  4FPA A;  1RDW X;  4M7Y A;  1LCU A;  2CGK A;  2YHY A;  5KPT A;  2E2Q A;  3UKU B;  1OKJ A;  2QWQ A;  2QW9 A;  3ATV A;  2FSK A;  4BRO A;  1R59 O;  2P9P A;  1GLF O;  1NGG A;  4H0Y B;  1K8K B;  3M6G A;  3VEN A;  3FZL A;  2IVO A;  2NRH A;  3FZH A;  1MA9 B;  2OAN A;  3GE1 A;  4BRM A;  3EZW A;  3JS6 A;  3ULE B;  3CQX A;  3ZET B;  2W41 A;  3CI5 A;  3M1F A;  3ULE A;  1QQN A;  4K25 A;  4I6M B;  1NBW A;  1NGA A;  5BRE A;  2PBD A;  2FSJ A;  5CE3 A;  4M63 C;  5I9E B;  3H1V X;  5JLH A;  5ADX A;  3O1W A;  4BRQ A;  3VEO A;  2P9U B;  5AQP A;  3KHY A;  4BRP A;  2A42 A;  3BUZ B;  3IUC A;  4IWV A;  3WXI A;  1ATS A;  3D2F A;  3VGL A;  4ISF A;  3LDL A;  4ISE A;  4H5V A;  5AQZ A;  4CZF A;  4K41 A;  2Q36 A;  1ESV A;  2A40 A;  3CJ1 A;  5AQT A;  4IO8 A;  4B1X B;  4XEI A;  4WQ5 C;  3ZEU B;  1S22 A;  2W40 A;  3CJB A;  2E2N A;  3G25 A;  3WEE A;  3ZX3 A;  2VYP A;  1Z05 A;  1NLV A;  1KAZ A;  3CHW A;  4FWR A;  4IJA A;  5EVZ A;  3A5O C;  4MO5 A;  1BDG A;  3GBT A;  3QML A;  2D0P A;  5EX5 A;  1E4G T;  1Y64 A;  4WQ4 A;  3AAQ A;  2QWP A;  5F2R A;  2P9N B;  5AZJ B;  2YCH A;  1DGK N;  3C0B A;  2FSN A;  2AA4 A;  4H5N A;  2Q0U A;  2NLX A;  2D1K A;  3C7N B;  4CJ7 A;  1EQY A;  5AQI A;  5JIC A;  1X9J A;  1BUP A;  3W0L A;  2P9L B;  2A5X A;  3MN9 A;  3ID8 A;  4BRG A;  2YJF A;  2F9W A;  3D2E A;  4Z94 A;  1HKB A;  2QWO A;  3FGU A;  4AM7 A;  4B1Z A;  2CH6 A;  4XH1 A;  4EAH D;  3A5M C;  2P9P B;  3EL2 A;  2E88 A;  2PAV A;  4I6M A;  3H45 C;  3HI0 A;  5AQW A;  3H6E A;  3VGK A;  1HLU A;  3H3O B;  3BF1 A;  1SQK A;  2P9S A;  3L6Q A;  3VEV A;  2E2O A;  4PKG A;  1D4X A;  2P9S B;  3R8E A;  3QDK A;  4CZM A;  5BRH A;  1GLC G;  2YHW A;  1QHA A;  4FWP A;  3O08 A;  2A3Z A;  3VEY A;  5AFU A;  4DHY A;  3MN7 A;  2A41 A;  3A5L C;  1C0G A;  1S3X A;  2A6A A;  4FOI A;  1DKG D;  2FF6 A;  3H1Q A;  4O5F A;  5AZI A;  2GTD A;  2P9I A;  2QXL A;  3B8A X;  3FR0 A;  4C23 A;  4XH5 A;  3L4I A;  1TYQ B;  5AQV A;  5AFU H;  5AQK A;  2WUS A;  4PKI A;  4FWK A;  4K42 A;  5AQY A;  4CD1 A;  4FWL A;  5EXW A;  3SK3 A;  1NMD A;  3QIC A;  3EO3 A;  4O8K A;  4H5T A;  3QFP A;  4BVO A;  4RCH A;  1HKG A;  5BPN A;  3VEW A;  5AZJ A;  1QQO A;  2P9L A;  3UKU A;  2IVP A;  4WQ4 C;  3CJ9 A;  1JCF A;  4IJN A;  1YAG A;  3DXK A;  1U6Z A;  3ENH A;  2HF4 A;  5BN9 A;  1BWF O;  3VOV A;  1V4S A;  4BRE A;  4BG9 A;  1MWK A;  3FZF A;  3UKR A;  3HZ6 A;  3LM2 A;  1NGH A;  3DXM B;  5AR0 A;  3MN5 A;  3WQU A;  3SLC A;  3FE1 A;  4QS9 A;  3HSC A;  4BC5 A;  3LM9 A;  3S41 A;  2Q0R A;  5KPR A;  4EHT A;  3VF4 A;  4A61 A;  2Q31 A;  4PL7 A;  1V4T A;  1KAY A;  1NGE A;  3QFU A;  2P9K A;  2HMP A;  2D4W A;  4JNE A;  4H5R A;  4BRL A;  1SZ2 A;  4BR4 A;  3FZM A;  3IDH A;  3OHR A;  1ATN A;  4FWO A;  1RFQ A;  2QWR A;  4BQL A;  2FXU A;  4CZG A;  4H03 B;  2QWM A;  3ZX0 A;  2CH5 A;  1BOT O;  2P9U A;  4WYB A;  3R6M A;  5KQ8 A;  3WXK A;  4BRA A;  4JN4 A;  3U4L A;  1DEJ A;  5ELZ A;  1K8K A;  4JD2 B;  3F9M A;  1YVN A;  3WUH A;  1NM1 A;  4H0P A;  3I8B A;  3VEX A;  5AZI B;  1HKC A;  5JMV A;  2GUP A;  2UYT A;  3L0Q A;  4QS8 A;  5BRF A;  2I7P A;  1NGD A;  5FPM A;  4BRK A;  2GWJ A;  1U2V B;  5AQR A;  4BRN A;  1QZ6 A;  3A5N C;  3QB0 A;  2V7Z A;  2F9T A;  4K43 A;  5ADX H;  3KZB A;  2DPN A;  3SMS A;  2YI1 A;  3U8X A;  1BA0 A;  2CGJ A;  4CBX A;  3LDN A;  2VWB A;  5AQS A;  1YUW A;  3J8A A;  3SJH A;  1TUU A;  1ZXO A;  2QWL A;  4MO4 A;  4FPB A;  4BGB A;  4Y0W A;  4FWS A;  4CD3 A;  3UE5 A;  3D2E B;  3D7E O;  1HJO A;  1MDU B;  1SAZ A;  2ASM A;  2BTF A;  4FWN A;  4DB3 A;  1GLD G;  2IIR A;  3SMP A;  4E1J A;  3O5B A;  3HM8 A;  1BU6 O;  4CI6 A;  3FZK A;  2V7Y A;  4FO0 A;  1WUA A;  4L3Q A;  4BQZ A;  3HBT A;  5AQM A;  2ZF5 O;  1C0F A;  3GOI A;  1IJJ A;  1X3N A;  1T44 A;  2D0O A;  4LC9 B;  4NO7 A;  5BRD A;  2E1Y A;  3MCP A;  1GLE G;  4ISG A;  5AQQ A;  4KBO A;  3H3N O;  4M7X A;  4XH4 A;  2ASP A;  4MLH A;  3A0I X;  2AP1 A;  3LL3 A;  4IXC A;  3BP8 A;  1ZBS A;  2Q2R A;  2YHX A;  1WOQ A;  3CQY A;  1J6Z A;  1GLJ O;  1NGJ A;  1QZ5 A;  3M3Z A;  5TKY A;  1JCE A;  1HUX A;  3VES A;  2E2P A; 
#chains in the Genus database with same CATH topology
 1ZYQ A;  4AHU A;  5M1F A;  1S5J A;  4Z0U A;  5C10 A;  4DV1 K;  3CCQ N;  4H0X B;  1IKW A;  4DQ8 A;  3EEQ A;  4FLY A;  4B1V A;  4DWI A;  5AQO A;  1KSP A;  3OW2 M;  1KXP A;  1JKH A;  4FOE A;  4BR2 A;  3CIP A;  4YFU A;  2G8W A;  3QO9 A;  3BZK A;  1QVF M;  4UQG A;  3THX A;  5DK5 A;  4M3R A;  1XQS C;  2Z1I A;  3C6U A;  4CF2 A;  1CZA N;  4CZI A;  1TL3 A;  5JS1 A;  2G8V A;  4W5Q A;  4NYF A;  2QTD A;  5LY3 A;  5J2P A;  3KK2 A;  3SAH A;  2O8B A;  4HTL A;  1JLQ A;  4GMJ B;  4BRF A;  4FVM A;  4V19 S;  4BR0 A;  4M42 A;  2J4R A;  3TI0 A;  3WXJ A;  3PLA A;  3PO4 A;  1BO5 O;  1TKT A;  4M41 A;  4H0T B;  3V1O A;  1KAX A;  3VPZ A;  4B8A B;  2DTU A;  4H0V B;  3AAP A;  1WSE A;  1LOT B;  4MQ3 A;  5FRM A;  4JKF A;  2HF3 A;  4JS5 A;  3C65 A;  4DFP A;  4DFJ A;  5LMN K;  3DJC A;  5KGW A;  3DXK B;  1VQN N;  3MCA B;  1KVA A;  3QBX A;  1L5U A;  1RGI A;  3DLE A;  2ITM A;  1BCO A;  2FBX A;  2YJE A;  5AQG A;  3OS1 A;  1IBM K;  2E20 A;  2QM1 A;  3SQ0 A;  1K8A O;  3L2Q A;  3QBW A;  4LF4 K;  1G99 A;  5AQN A;  1XUP O;  3HK2 A;  4N5S A;  4NCB A;  4NB4 A;  4KHP K;  3DLL L;  5CYM A;  3K5O A;  4H0O A;  4B1Y B;  2HB5 A;  3ZT2 A;  1VSK A;  4MLE A;  4BR5 A;  1YJW N;  4EFH A;  2UXC K;  1JXB A;  3AV9 A;  1TV6 A;  3EKU A;  2YNH A;  1GOA A;  4C8M A;  3TR8 A;  1KLN A;  2BE2 A;  5E41 A;  1N36 K;  3TAG A;  4FK2 A;  4F2R A;  4DLG A;  4DTP A;  1TAU A;  1HX1 A;  1EX4 A;  1G15 A;  4FWM A;  1BA1 A;  3MWT A;  4WFB L;  4CZJ A;  4ICL A;  1YXQ A;  4OGC A;  4ELT A;  1P8Z A;  4CK2 A;  4JKG B;  1VQL N;  4E3S A;  4E1N A;  5HOO A;  3PIO L;  1RT2 A;  3O8M A;  3LDO A;  4B9S A;  3EN9 A;  2JGU A;  3NCI A;  4CF0 A;  5KPZ A;  5D3G A;  3DAW A;  4J2B A;  1VSE A;  3QEX A;  3RMB A;  2Z1J A;  3P38 A;  4JKB A;  3G4S N;  1NJZ A;  2ZE2 A;  4IOC L;  3CJ7 A;  4OPA A;  4O8U A;  1WBD A;  2GV9 A;  3L3V A;  2IVN A;  3K5L A;  3DRR A;  4DR4 K;  3AVH A;  2NZT A;  1HNZ K;  2ASO A;  3OBY A;  5B8H A;  1K6Y A;  2P9K B;  3GG4 A;  1T7P A;  4FPA A;  3RTV A;  1NJY A;  1RT7 A;  2E2Q A;  2A1R A;  2QWQ A;  5GIO A;  4GW6 A;  2OYQ A;  1QSS A;  4CIG A;  5HBM A;  4B3R K;  4NYN A;  2VGN A;  1VSM A;  4GV3 A;  1IKV A;  2NRH A;  1YJ9 N;  1TK0 A;  1MA9 B;  2OAN A;  4BRM A;  3SAG A;  3JS6 A;  3KLI A;  2IOC A;  3CI5 A;  3DLG A;  3DLB A;  3M1F A;  3M8S A;  4FJ8 A;  4I6M B;  3LP1 A;  5BRE A;  5I9E B;  3H1V X;  2F8S A;  2OTJ N;  3NF9 A;  4BRP A;  1JL1 A;  3BUZ B;  4IWV A;  3ISN C;  2HHV A;  3RMC A;  4ISF A;  3THX B;  4ISE A;  1KTQ A;  4OPK A;  4H5V A;  5AQZ A;  1VQO N;  1C1A A;  3HVT A;  1NOZ A;  2JWK A;  4C1N I;  1D9D A;  3NHG A;  4XEI A;  3HYF A;  3ZEU B;  4FYD A;  2W40 A;  4AQY K;  2OPP A;  4JI6 K;  2VYP A;  3VTI A;  4IJA A;  1YTA A;  1Z05 A;  1I3A A;  1NLV A;  1C1B A;  1LWE A;  1O1W A;  2FBT A;  1WSF A;  4MO5 A;  3WNH A;  2AJQ A;  1BDG A;  1HNI A;  1Y64 A;  1RCH A;  3KWG A;  3KK7 A;  1S9E A;  5GAG P;  2QWP A;  2P9N B;  5AZJ B;  3LZJ A;  2YCH A;  4CJW A;  3NF8 A;  4OJR A;  2RF2 A;  3K58 A;  2HHT A;  2AA4 A;  4W5N A;  1RIL A;  1SV5 A;  2Q0U A;  2NLX A;  1IG9 A;  5JIC A;  1S1T A;  1QHT A;  4H4M A;  3W0L A;  2P9L B;  2A5X A;  1OVY A;  3O9U A;  4FZX C;  4A59 A;  2G8F A;  2F9W A;  2XRI A;  1TL1 A;  3AGR A;  3LP0 A;  4N47 A;  2Y1I A;  4B9L A;  2LSN A;  3AVA A;  4XH1 A;  3A5M C;  4DQS A;  3LDS A;  3SYZ A;  1YIT N;  2E88 A;  3THW A;  3THY A;  2X78 A;  1HLU A;  2DY4 A;  3BF1 A;  1RTD A;  1FW6 A;  2HVI A;  4JKE A;  1B9F A;  3L8B A;  1D4X A;  3OYG A;  5CHI A;  1GLC G;  2YHW A;  1QHA A;  4FWP A;  3O08 A;  4IFV A;  4H8K A;  3KD5 E;  3LAM A;  2A41 A;  4CJL A;  3A5L C;  3BZC A;  5HRO A;  3N4Q A;  1C0G A;  1KLM A;  2O8E B;  4KH5 A;  4L8R B;  2FF6 A;  3M5R A;  2GTD A;  2KFN A;  3HL8 A;  4OX9 K;  4Q0B A;  4C23 A;  3O9S A;  4FLX A;  1KRP A;  2HHX A;  2NUB A;  4K0K K;  1UAX A;  3SUO A;  5AQV A;  3EY1 A;  1NKC A;  4PHT X;  1FJG K;  1A5X A;  5CY4 A;  3UIQ A;  1CXQ A;  5EXW A;  3SK3 A;  1NK9 A;  4CHY A;  4O8K A;  4CW7 B;  3V9X A;  3QFP A;  3M8R A;  1N8R O;  3V1Q A;  4DTM A;  1OH5 A;  1U49 A;  4FJN A;  4IJN A;  1KC8 O;  3IRX A;  3VOV A;  3V6D A;  3U3G A;  4BG9 A;  3AO1 A;  1QS4 A;  4DTS A;  4DUZ K;  4B9M A;  4UY8 O;  1RNH A;  4W5T A;  4N56 A;  4TSX A;  4FCY A;  2QKK A;  3SLC A;  1JXE A;  1SL1 A;  3TTF A;  4IFY A;  3P39 A;  4DQP A;  1CZ9 A;  3S41 A;  1RTJ A;  5KPR A;  4OPH A;  1WBB A;  4JK9 A;  1WSI A;  4PL7 A;  3E1Y A;  1KAY A;  2F8T A;  2VQF K;  2D4W A;  1ZBU A;  3CFR A;  4CF9 A;  5M1P A;  4H5R A;  4BRL A;  4CK1 A;  2W42 A;  1RTH A;  4AHC A;  1TGO A;  3OHR A;  1HQE A;  1ATN A;  3QLH A;  5GIP A;  2FXU A;  2ATQ A;  1VQ7 N;  1SL0 A;  2CH5 A;  2P9U A;  4BRA A;  1RT1 A;  5SWM A;  2GX9 A;  3S3O A;  3T7Z A;  2VWK A;  4QCL A;  4O0J A;  5FLX O;  3WUH A;  4B9V A;  4DF8 A;  4DV6 K;  5JMV A;  1L3T A;  2WTU A;  4DTJ A;  4DQI A;  3OY9 A;  2JWL A;  3OYE A;  4HVJ A;  3A5N C;  3QB0 A;  1KFS A;  2HMI A;  5ADX H;  3U8X A;  4CBX A;  3AVC A;  4I2P A;  4Z4I A;  2UU9 K;  2O4I A;  2UUA K;  3UE5 A;  4JV5 K;  3OA9 A;  4O55 A;  1EET A;  3VQ5 A;  3ENB A;  2BTF A;  4FWN A;  1GLD G;  1HYS A;  2NRT A;  3O5B A;  3I0S A;  3HM8 A;  1BU6 O;  3P83 D;  3KLF A;  2HVH A;  5J2N A;  4FO0 A;  4BE2 A;  4RW8 A;  3HOT A;  3HBT A;  3PY8 A;  3WXM B;  1T44 A;  4LC9 B;  1X9W A;  4NO7 A;  1BCM A;  4Z4G A;  2EX3 A;  1WAJ A;  5TKW A;  3HPO A;  3DLK A;  1QQC A;  1LW2 A;  3PUF A;  1NJI O;  4BY9 C;  4FJ5 A;  3O3H A;  2ASP A;  2NRR A;  3D6R A;  3LL3 A;  4IXC A;  4DG1 A;  4YOW A;  4GV6 A;  1D9F A;  4DV0 K;  3Q7B A;  1Q7Y O;  3SBT A;  4DS4 A;  1J6Z A;  3CQY A;  4I7F A;  5C15 A;  5KTQ A;  1VSD A;  3EE8 A;  1YVU A;  1QSY A;  1Q86 O;  2PYJ A;  4X62 K;  3PX6 A;  4GNI A;  3VGM A;  1TKX A;  4E89 A;  3CET A;  2OPR A;  3J7Z O;  4HCC A;  1HQU A;  1Q81 O;  1VSJ A;  4HWI A;  3TU5 A;  4FW2 A;  2WFB A;  1SKS A;  1XHX A;  4JD2 A;  3VQ4 A;  3WQT A;  1NJX A;  3LDQ A;  1D5A A;  1BIS A;  5KGX A;  4BC2 A;  3KLH A;  4FSV A;  1TKD A;  3AVG A;  4DSI A;  4NLC A;  4FJI A;  4KAZ A;  2YHA A;  4M3U A;  4R5P A;  4OGE A;  1KCF A;  3NVM A;  4CZH A;  3OJU A;  4BRD A;  3FLC O;  2HW3 A;  2VCP A;  1HNX K;  4BGA A;  4FK0 A;  4FM1 A;  3MK6 A;  3PO5 A;  5F0X A;  4EP4 A;  4GVE A;  5KRS A;  4IG0 A;  4CVN E;  1XI1 A;  1KD1 O;  1A5V A;  1H1V A;  3R9P A;  1NKB A;  3UB5 A;  4CE9 A;  3C7N A;  3KWI A;  4CJR A;  3AO5 A;  4M3Y A;  4FZY A;  2HOE A;  1LWF A;  3O80 A;  2GEM A;  3CMA N;  3QNN A;  3OJS A;  5DM6 L;  3AA3 A;  1TUY A;  2XY7 A;  2D0B A;  2GEL A;  3PSF A;  3LP3 A;  3OYC A;  1Q18 A;  3SUQ A;  3J7A P;  2IS3 A;  3RSE B;  3QIN A;  2KZZ A;  5F1X A;  4EIA A;  1XMQ K;  3AA2 A;  5I42 A;  4CEB A;  5EOY A;  1C1C A;  3AVK A;  4E7L A;  5C0Y A;  5AQX A;  1J53 A;  1Z6R A;  2FLO A;  2F4V K;  3DXM A;  5J2Q A;  3CXC M;  4FL9 A;  1QSL A;  1ZC6 A;  1XC3 A;  4LFB K;  1X9S A;  3U9D A;  5DMR A;  1VQ5 N;  4JI3 K;  3V4I A;  2RE2 A;  2ETJ A;  3ULD A;  2X6S A;  3BDP A;  1BG3 A;  1HYZ A;  2RKI A;  3THY B;  1RDD A;  3V81 A;  1NU0 A;  3ATU A;  4CHZ A;  1RT6 A;  4B9Q A;  4FJX A;  4PY5 A;  3VF6 A;  4B9N A;  4YOT A;  3VA3 A;  1BQM A;  1M1K O;  1W0H A;  3W3D A;  5BPM A;  2E1Z A;  4IG3 A;  5EU7 A;  5AQF A;  4H5W A;  3O6W A;  3VQP A;  4CZK A;  1ASU A;  3MX5 A;  1E4F T;  1ASV A;  5MLC Q;  5JLF A;  4CHP A;  4A62 A;  1B9D A;  2RHK A;  5E84 A;  4ELV A;  5AQH A;  2UXD K;  3S3N A;  1VQ4 N;  5J1E A;  2ZGZ A;  3P4I A;  3KLG A;  3CF5 L;  4Z4H A;  3G6E N;  3T69 A;  3HVR A;  1S1X A;  3O1B A;  4DTO A;  1DTQ A;  3F9K A;  5IWA K;  4WFN L;  3PX0 A;  2CGK A;  4DS5 A;  4Z4C A;  2QW9 A;  2P9P A;  3AA5 X;  1GLF O;  1NGG A;  1K9M O;  2O8E A;  5JS2 A;  4DFM A;  1ZBF A;  3CC2 N;  3ITH A;  3R3L A;  4E19 A;  3DI6 A;  3CQX A;  3ZET B;  3VQE A;  4CHO A;  4C8O A;  1QQN A;  4K25 A;  2G8K A;  2UUB K;  1NBW A;  1NGA A;  1TKZ A;  1Z25 A;  3V1R A;  3PV8 A;  1U4B A;  3KJV A;  1XMO K;  5ADX A;  3O1W A;  4XIU A;  1E3M A;  5AQP A;  2IC3 A;  3A2F A;  3KHY A;  1FKP A;  1ZBL A;  4CJQ A;  3IUC A;  3MEG A;  1ATS A;  3VGL A;  1NK6 A;  3NGZ A;  4IOA L;  2HHQ A;  1SS6 A;  4FJ9 A;  4QOZ B;  2O8B B;  1Q9X A;  4FJ7 A;  3LP2 A;  4DF4 A;  4Y1C A;  3I0R A;  3T19 A;  3G25 A;  1DT9 A;  3CHW A;  4FWR A;  2UUC K;  3A5O C;  4KH4 A;  3AAQ A;  4N76 A;  1DGK N;  3C0B A;  4X66 K;  2NNW A;  1TK8 A;  4DSJ A;  1SL2 A;  3QEP A;  2ZD1 A;  3CG7 A;  4DV7 K;  2FBV A;  1W9H A;  2VWJ A;  1LAV A;  3K5M A;  2HHH K;  4CJ7 A;  4PQU A;  1EQY A;  3AGK A;  3DLH A;  4DTX A;  1QVG M;  2HST A;  2YJF A;  3IG1 A;  1HKB A;  4KV8 A;  3FGU A;  2CH6 A;  3QIO A;  4EAH D;  1K73 O;  3TAP A;  3IS9 A;  4BAC A;  2PAV A;  4CGG A;  1RT5 A;  2D0A A;  2YHB A;  3H45 C;  3HI0 A;  4I6M A;  5AQW A;  4W5O A;  4M3W A;  3H6E A;  3H3O B;  3OYH A;  1SQK A;  2P9S A;  4LH5 A;  3CCU N;  1U04 A;  3SNN A;  1TVR A;  4DTN A;  4KTW A;  3LPU A;  3VEY A;  4HUF A;  4DTR A;  4DHY A;  2Z1H A;  3MN7 A;  3OYL A;  2P5G A;  3NDK A;  1S3X A;  4FOI A;  1DKG D;  4FJG A;  4LF5 K;  3I55 N;  4EZ9 A;  3QER A;  2QXL A;  3HP6 A;  3B8A X;  4DR5 K;  3P1G A;  3AVB A;  4XH5 A;  4DV3 K;  4NXN K;  1IBL K;  4PKI A;  3OS0 A;  3CFP A;  4Y1D A;  4B3T K;  5AQY A;  4FWL A;  1KFD A;  4CHN A;  4ZHR A;  2HNZ A;  4FJM A;  3EO3 A;  4CJV A;  4DFK A;  4IO9 L;  4BVO A;  2XO7 A;  2HBJ A;  2F96 A;  1QQO A;  2P9L A;  3RR8 A;  3CJ9 A;  4H4O A;  2ZM6 K;  2FBY A;  4CEQ A;  1U6Z A;  2WON A;  3ENH A;  2HF4 A;  1NOY A;  1RDU A;  1BI4 A;  4B8C A;  3J81 O;  2O8D A;  4CEF A;  1TK5 A;  1UA0 A;  3THW B;  3MX2 A;  1IO2 A;  3WQU A;  4DR6 K;  4EZ6 A;  3FE1 A;  3AVF A;  5KRT A;  4LF6 K;  3L2V A;  3KK1 A;  2E4L A;  2Q0R A;  3NMU A;  4YOV A;  5A2Q O;  1RBR A;  1OH6 A;  3T1H K;  2HMP A;  2NRZ A;  4DR2 K;  3QES A;  1JLF A;  3K9J A;  3HO1 A;  2I5J A;  3ZSX A;  2B6A A;  2QI2 A;  4JKD A;  4BE0 A;  3U3Y A;  2F7T A;  4FWO A;  3V9S A;  2QWR A;  1L3V A;  2QWM A;  2WBN A;  3T1A A;  1BOT O;  4J2E A;  3WXK A;  4JN4 A;  4JKG A;  5ELZ A;  5C24 A;  3SBG A;  2QKB A;  3IAY A;  1YVN A;  1NM1 A;  3VEX A;  3I8B A;  2ZQB A;  3O4Q A;  4CJF A;  1IBK K;  3L0Q A;  3LAK A;  1J5E K;  2I7P A;  4R79 A;  1NK5 A;  5HRS A;  2GWJ A;  1BGX T;  1VSI A;  3M8Q A;  4KHS A;  3IKM A;  3RVC A;  3ZSV A;  1YI2 N;  5SZT A;  4GKK K;  3LDN A;  1N34 K;  3HM9 A;  3MEC A;  1WSJ A;  1ZXO A;  4MO4 A;  4CGD A;  1VSF A;  3D2E B;  3D7E O;  3OYM A;  2VG6 A;  3BGR A;  5HL7 L;  4CI6 A;  3E9O A;  5AQM A;  3KK3 A;  3VQ9 A;  4KPY A;  3AO3 A;  4YOU A;  4ISG A;  5AQQ A;  2OZM A;  3VQ7 A;  3A0I X;  2AP1 A;  1IKY A;  1S72 N;  1GLJ O;  3L2R A;  3KLE A;  3M3Z A;  3TSU A;  5TKY A;  3TAF A;  3V9U A;  3VES A;  2E2P A;  4JS4 A;  3VET A;  3V9W A;  2A1S A;  3CCR N;  3A8Y A;  1GLL O;  4AM6 A;  4KB1 A;  3IMX A;  2CGL A;  4BRH A;  4LH4 A;  2ZJR L;  4KTZ A;  4IEI A;  4A2A A;  2V51 B;  4RW4 A;  4LD0 A;  4WCE L;  3TAR A;  4HCB A;  4I2Q A;  1W2B M;  3RR7 A;  2Q1N A;  3ZET A;  4A5A A;  4WQ5 A;  3GDQ A;  4WE1 A;  3DOL A;  3ZSO A;  4LFC K;  4KRF A;  1ATR A;  2ZGY A;  1WSG A;  3ZT1 A;  2EWS A;  4BG8 A;  4CGJ A;  1T6D A;  4OKE A;  4ELU A;  3PSI A;  4JI2 K;  3TTC A;  3P5J A;  4HUG A;  4JHD B;  3NH0 A;  4CJP A;  3C6H A;  1I39 A;  3SV3 A;  4B3O A;  3C6T A;  4JHD A;  4B1W B;  1U47 A;  5FPN A;  2PFU A;  1C6V A;  3CCE N;  4J8F A;  3T1Y K;  3R1X A;  3HOS A;  3JYT A;  4FLU A;  3AY9 A;  3BF3 A;  4DU1 A;  2B4J A;  1UA1 A;  3MMV A;  5IT9 O;  3TSP A;  4FLT A;  3LDP A;  4RTF D;  4CCH A;  1GLA G;  3O4W A;  3WT0 A;  4FM0 A;  3SAF A;  2OPQ A;  4JEP A;  2H3G X;  1RBV A;  3VQ8 A;  4BR9 A;  3LAN A;  3MDQ A;  1X3M A;  3H46 O;  3MXJ A;  2ZWH A;  4BRI A;  4B3S K;  3ZX2 A;  3HP9 A;  5AQU A;  1MWM A;  3AA4 A;  4OKJ A;  4B9U A;  4O4G A;  4F9O A;  4FLV A;  2VGM A;  4M3T A;  1REV A;  2GWK A;  3TWH A;  4BC3 A;  2OA8 A;  3K9K A;  3VER A;  1DTT A;  3VQD A;  1M90 O;  1NGC A;  3SCX A;  4PWD A;  1NGB A;  3NVK A;  4PL8 A;  5EY4 A;  4CIF A;  5GAE P;  2BAN A;  5HRN A;  2BGG A;  1XHZ A;  2KHO A;  1TYQ A;  3O9R A;  3ZEU A;  5BR9 A;  2OZS A;  1WSH A;  1EO1 A;  4DSK A;  5LJV A;  3MAQ A;  5FPD A;  4YDU A;  4BRC A;  1D8Y A;  2BUP A;  3MWP A;  1C0U A;  1F21 A;  1TAQ A;  3OYJ A;  3TAN A;  4X64 K;  4RWT A;  1IG8 A;  3VEZ A;  1BIU A;  4QS7 A;  2YX6 A;  4OO1 J;  4N41 A;  4GV9 A;  3IFR A;  4CJE A;  3K0S A;  4FM2 A;  3DM2 A;  3TAB A;  1JJ2 M;  4JI5 K;  3O9T A;  1VQP N;  1NWK A;  1W7A A;  2KW4 A;  5FDL A;  3RSE A;  4CBU A;  4JI8 K;  3FFI A;  2E8A A;  4IOX A;  2VQE K;  4B3M K;  1HYV A;  4ID5 A;  2YHY A;  1J5O A;  5KPT A;  1BHL A;  5K14 A;  4YHH K;  1L3U A;  1OH8 A;  3ATV A;  2OPS A;  4BRO A;  3THV A;  4B9T A;  2G8I A;  2ITG A;  4GVM A;  1K8K B;  4I9L A;  3VEN A;  4LFA K;  3FZH A;  2YV0 X;  3CPE A;  3GE1 A;  5CZ2 A;  3EZW A;  1FKO A;  1XNR K;  3H08 A;  4B08 A;  3AO4 A;  5FRO A;  4AHS A;  2FC0 A;  2PBD A;  2FSJ A;  3SUN A;  4M63 C;  2PY5 A;  3VEO A;  1C0T A;  2EHG A;  3OYA A;  2YKM A;  3D2F A;  3CCM N;  4O0I A;  3LDL A;  1B92 A;  2O8F B;  1NMN A;  2OCE A;  3NBP A;  1HR0 K;  4K41 A;  2Q36 A;  1QE1 A;  2A40 A;  4JI1 K;  3EZ5 A;  5AQT A;  4IO8 A;  4AF1 A;  4YOX A;  3SPY A;  3MED A;  2W6K A;  4A57 A;  3CCS N;  4WQ5 C;  5DM7 L;  4AHT A;  1JLA A;  3ZT3 A;  3CJB A;  3WEE A;  1KAZ A;  5EVZ A;  4KHU A;  3QML A;  1WAF A;  1E4G T;  3OS2 A;  4WQ4 A;  3KTQ A;  4AIL C;  5F2R A;  1A5W A;  1W97 L;  4JKH A;  5CZ1 A;  1VQM N;  1S6P A;  2FSN A;  3VTH A;  1U48 A;  1SKR A;  1X1P A;  4F3T A;  4H5N A;  1UOC A;  2WOM A;  1NK8 A;  2DFH A;  2D1K A;  1WN7 A;  1BUP A;  3MXM A;  3ID8 A;  1BQN A;  1WNS A;  3D2E A;  3DRS A;  3OTO K;  4AM7 A;  4B1Z A;  4KFB A;  5C2F A;  1BI4 B;  3CQ8 A;  3EYZ A;  1HRH A;  3VGK A;  3S3M A;  4LF8 K;  4C1N K;  4LSL A;  1CLQ A;  3TTD A;  2GBZ A;  3VEV A;  1XWL A;  1ILY A;  3R8E A;  4CGF A;  4DR1 K;  1JL2 A;  2HBL A;  5AJ3 K;  4HHT A;  4BWM A;  1VK0 A;  1YF5 L;  3CCJ N;  4CEC A;  1HMV A;  4JI0 K;  4W5R A;  4RW7 A;  5GAH P;  4DKW A;  3LWM A;  4U7B A;  1EXQ A;  2O8F A;  2A6A A;  3H1Q A;  4C8N A;  3ZLJ A;  4BDY A;  4LF9 K;  3FR0 A;  1VSL A;  4KHW A;  1KVB A;  3RMA A;  5GAD P;  5AFU H;  5AQK A;  2WUS A;  3NGY A;  1HNV A;  3ZSZ A;  3L4Q A;  1NMD A;  3SZ2 A;  3J80 O;  2JLE A;  1RBS A;  4GKJ K;  1RDB A;  5BR8 K;  1HKG A;  4DMN A;  5BPN A;  5AZJ A;  3L2U A;  5HP1 A;  1X9M A;  3UKU A;  2IVP A;  4WQ4 C;  4PA1 A;  3Q7C A;  5LMU K;  4E7J A;  3TAQ A;  4CES A;  2X74 A;  1YAG A;  4JI4 K;  5BN9 A;  1BWF O;  4DUY K;  2KFZ A;  3FZF A;  1Q82 O;  3UKR A;  3HZ6 A;  4HTU A;  3HRG A;  3MN5 A;  2HNY A;  1EKE A;  1UWB A;  1EWQ A;  3LM9 A;  4CJT A;  4JK7 A;  4FLZ A;  1KVC A;  4A61 A;  2XY5 A;  1V4T A;  3SPZ A;  3QFU A;  3ID6 A;  4KKO A;  4JNE A;  3B6O A;  1GOC A;  2W6L A;  3SV4 A;  4F8R A;  3NF6 A;  1RDA A;  3SQ2 A;  4NCG A;  4CZG A;  3ZX0 A;  1HJR A;  5KQ8 A;  4DLE A;  3U4L A;  1DEJ A;  3J7Y P;  4JD2 B;  4CFD A;  2R7Y A;  3E01 A;  5CR4 A;  1IKX A;  4H0P A;  3EE9 A;  4DTU A;  2D5R A;  2B5J A;  1HKC A;  4M3X A;  2GUP A;  4KI4 A;  4ID1 A;  4CEE A;  1NGD A;  5FPM A;  1LW0 A;  5AQR A;  4CJS A;  1LV5 A;  1QZ6 A;  1FXX A;  2V7Z A;  4KTQ A;  3VMF B;  4DU3 A;  1RT4 A;  2DPN A;  3KZB A;  1L3S A;  2XHB A;  3SMS A;  2CGJ A;  4CHQ A;  1YIJ N;  5M1O A;  2VWB A;  2QXF A;  5AQS A;  1YUW A;  3PIP L;  3VQA A;  4MDB A;  4Z4E A;  2D0C A;  1EP4 A;  2VG7 A;  4FPB A;  4Y0W A;  4FWS A;  3K59 A;  4FXD A;  4CD3 A;  3DYA A;  3PX4 A;  1LAW A;  4IDK A;  5HRP A;  1HJO A;  1MDU B;  1SAZ A;  2ASM A;  4DB3 A;  3HPG A;  3SMP A;  4E1J A;  3S9H A;  2Y1J A;  2HBM A;  2IGI A;  4IFE A;  3F5T A;  3U6F A;  3FZK A;  2V7Y A;  4L3Q A;  1WUA A;  4G1Q A;  1N5Y A;  2ZF5 O;  3GOI A;  1IJJ A;  3I8D A;  2KTQ A;  3C6A A;  5GIN A;  3O4N A;  3MCP A;  3I56 N;  1GLE G;  4ZTF A;  3ZT0 A;  4E7I A;  4KBO A;  3CM6 A;  3H3N O;  4M7X A;  4E7H A;  4CER A;  1NJW A;  4MLH A;  4CJ5 A;  1WLJ A;  3VQQ A;  1JLC A;  1J54 A;  3BP8 A;  1ZBS A;  4O44 A;  2YHX A;  1IH7 A;  1QZ5 A;  4RG8 A;  4RW6 A;  1JCE A;  2DFE A;  3MXI A;  1HUX A;  2D0O A;  4I9Q A;  3CYM A;  3OYB A;  4DV5 K;  3JXU A;  4JAX A;  2UXB K;  2P9I B;  1NGF A;  4DQQ A;  2DFF A;  3ENO A;  4DU4 A;  1VQ6 N;  4DV2 K;  3F73 A;  4BR7 A;  4IEE A;  5CYQ A;  3O3F A;  3FFK B;  3WNF A;  1NGI A;  3VF2 A;  4JI7 K;  4CZE A;  1KQS M;  3VA0 A;  3MN6 A;  3GL1 A;  4IZ9 A;  3CER A;  1BL3 A;  1SUQ A;  3SI6 A;  1T6C A;  3CJC A;  5KQD A;  1GLB G;  3KKS A;  2YNI A;  4YNQ A;  1ZBI A;  3CME N;  3SUP A;  4CGH A;  4OLA A;  3DWL A;  3TSQ A;  1S9G A;  3TPQ A;  4FJJ A;  4BE1 A;  4F4K A;  4CJ4 A;  2G8H A;  5JVG L;  3D2F B;  4FWQ A;  2V52 B;  2RN2 A;  3U9Z A;  1HPM A;  4DR7 K;  4KHQ A;  3QIP A;  2PZS A;  3ZYY X;  3AAR A;  4KHY A;  3WNE A;  4CF1 A;  4GY2 B;  1VAZ A;  5FPE A;  4ILH A;  2XY6 A;  3WNG A;  5LJW A;  3QEI A;  4CEA A;  4CED A;  1LWC A;  5HLF A;  3EKS A;  2P51 A;  3UKR B;  1RT3 A;  1YJN N;  4NXM K;  2KZM A;  2RPI A;  4BVP A;  2FF3 B;  2VG5 A;  3QET A;  3M8P A;  2Q97 A;  3KVG A;  3OBW A;  3AVN A;  3NF7 A;  4JLH A;  2HND A;  5H1S Q;  3SQ1 A;  4CJK A;  3JSM A;  1T05 A;  2WC9 A;  4JYA K;  1YTU A;  1S1W A;  1RTI A;  4IDH A;  3RWU A;  3I33 A;  4KB0 A;  4AH9 A;  1U2V A;  4JKA A;  4YOR A;  3O3G A;  4KO0 A;  4ILG B;  4E0D A;  3WEE B;  5AQJ A;  3HST B;  1FK9 A;  3WXL A;  4KI6 A;  3CJA A;  3AO2 A;  4CIE A;  4YDU C;  4DCH A;  3HTV A;  4CEZ A;  5AQL A;  1U45 A;  5BPL A;  4CGI A;  4Q5V A;  1DLO A;  2P9N A;  4B1U B;  1QQM A;  2I7N A;  4CZL A;  4CEO A;  4LF7 K;  1S1V A;  2PYL A;  1SKW A;  5KI6 A;  3LPT A;  3BEX A;  1YHQ N;  3G0Z A;  4PKH A;  2QWN A;  2XY8 A;  3BY5 A;  5M1K A;  4OPJ A;  5BN8 A;  2E5L K;  3K57 A;  4CJ3 A;  4YOY A;  4FW1 A;  4FLW A;  4A2B A;  1ASW A;  1JLB A;  1VHX A;  1GOB A;  4LY7 A;  3B6P A;  5E26 A;  3NAE A;  4CBW A;  3ZSW A;  4DV4 K;  2P1J A;  3CFO A;  4BC4 A;  4EHU A;  3ASM A;  2YNF A;  1OVQ A;  3C95 A;  1VQ9 N;  5LL6 Z;  3RMD A;  3K5N A;  1JCG A;  1XNQ K;  2HHS A;  2OTL N;  4MFB A;  1QTM A;  3NFA A;  3NH2 A;  3L2W A;  3HJF A;  4DR3 K;  3D0P A;  3QNO A;  3DRP A;  1RDW X;  4CFA A;  4M7Y A;  3K2P A;  1T03 A;  3ZSY A;  1LCU A;  1MU2 A;  3E9P A;  4CFB A;  4JRP A;  4FVU A;  5C25 A;  3OYK A;  3G71 N;  3UKU B;  1OKJ A;  2FSK A;  1S1U A;  4K8X A;  1R59 O;  4H0Y B;  1T8E A;  2NRV A;  2HBK A;  3M6G A;  3FZL A;  2IVO A;  1N33 K;  1VQK N;  3F2K A;  3ULE B;  3D45 A;  2W41 A;  4DSL A;  3ULE A;  4CFC A;  1WB9 A;  4AHR A;  4JRQ A;  5CE3 A;  4M3Z A;  5JLH A;  2KKZ A;  4BRQ A;  3ZSQ A;  2P9U B;  4JKC A;  2A42 A;  3WXI A;  3KD1 E;  5HRR A;  1HNW K;  1Q9Y A;  3LZI A;  3NH1 A;  3ZT4 A;  3HXM A;  1Y97 A;  4U67 L;  3LWL A;  1Z26 A;  3DLR A;  3SQ4 A;  4CZF A;  4QAG A;  3C94 A;  1ESV A;  3AVM A;  3CJ1 A;  3VQC A;  1OH7 A;  4B1X B;  5JVH L;  4G9Z A;  2X6N A;  1S22 A;  2E2N A;  3ZX3 A;  2E6L A;  3VQ6 A;  3CM5 A;  2KQ2 A;  2IDO A;  3ZCM A;  4FK4 A;  4FJK A;  3GBT A;  1BIZ A;  2D0P A;  5EX5 A;  3AVI A;  4IKF A;  1ZBH A;  4MDA A;  3RRG A;  3HPH A;  4KH6 A;  3P31 A;  1VRT A;  4WFA L;  5I3U A;  3V9Z A;  3N4P A;  2IAJ A;  3AVL A;  4NCA A;  4A5B A;  2QEX N;  3C7N B;  5AQI A;  2KLA A;  1X9J A;  4NLB A;  2NRX A;  1NK4 A;  3MN9 A;  4BRG A;  4BDP A;  4YY3 K;  4Z94 A;  2QWO A;  2P9P B;  3EL2 A;  2YKN A;  1EWR A;  4M45 A;  3LAL A;  4ILJ A;  3OYI A;  1NK0 A;  4AHV A;  1IV0 A;  3OYN A;  3L6Q A;  3QEW A;  4F2S A;  4BDZ A;  3CD6 N;  5C2D A;  4KHN A;  1HPZ A;  3NGI A;  2E2O A;  4WF9 L;  4PKG A;  2P9S B;  3DOK A;  3QDK A;  3G10 A;  4C8K A;  2BH1 A;  4CZM A;  4DSF A;  3SJJ A;  5M1N A;  5BRH A;  3CC4 N;  3AVJ A;  5C12 A;  2A3Z A;  5AFU A;  3KKR A;  1NKE A;  3CCV N;  2Q3S A;  3KIO A;  5AZI A;  4O5F A;  3OYF A;  2P9I A;  4RW9 A;  1Q8I A;  2Z1G A;  2O4G A;  4EP5 A;  3O9Q A;  4FZZ A;  3L4I A;  2P5O A;  1TYQ B;  3OVN A;  1YT3 A;  4E1M A;  4FWK A;  4K42 A;  4BWJ A;  4CD1 A;  4CF8 A;  3QIC A;  4H5T A;  1J9A A;  4RCH A;  3OYD A;  3VEW A;  5M1Q A;  1JCF A;  3DXK A;  3CCL N;  1T3V A;  1V4S A;  4BRE A;  2HHW A;  5J2M A;  1MWK A;  3LM2 A;  4FJL A;  1NGH A;  3DXM B;  4OLB A;  3DMJ A;  5AR0 A;  4QS9 A;  2G8U A;  3HSC A;  4BC5 A;  4O5B A;  1VRU A;  4OVL A;  3NE6 A;  3TAM A;  4EHT A;  3VF4 A;  2Q31 A;  1R0A A;  1NGE A;  2P9K A;  3L3U A;  4HUE A;  4LSN A;  2YNG A;  4C8L A;  2QK9 A;  1SZ2 A;  1C0M A;  2O8C A;  4BR4 A;  3FZM A;  3IDH A;  1CZB A;  3E66 A;  1RFQ A;  4BQL A;  5FRN A;  4K8Z A;  4H03 B;  5C42 A;  4X65 K;  2O8C B;  1N32 K;  4WYB A;  3R6M A;  2HHU A;  1K8K A;  3F9M A;  2BDP A;  5AZI B;  1RBU A;  2NRW A;  2UYT A;  1RDC A;  3ZSR A;  4QS8 A;  5BRF A;  1XC9 A;  1NK7 A;  3HT3 A;  4BRK A;  4ZTJ A;  2ZJQ L;  1U2V B;  4JK8 A;  4BRN A;  4CJU A;  1ITG A;  2F9T A;  4K43 A;  4E7K A;  4FJH A;  4KRE A;  2YI1 A;  4PUO A;  1BA0 A;  1RBT A;  4Z4F A;  2E6M A;  1NG9 A;  4DQR A;  3J8A A;  3SJH A;  2ZJP L;  1TUU A;  4CK3 A;  2QWL A;  3E9L A;  3RRH A;  4BGB A;  3JAM O;  3T3F A;  1I94 K;  1JLG A;  4DSE A;  3VQB A;  3ALY A;  1P90 A;  2IIR A;  2GUI A;  2O8D B;  3QEV A;  4BQZ A;  3VN5 A;  1NNE A;  1VSH A;  1C0F A;  1X3N A;  4J2A A;  3CC7 N;  5T7B A;  5BRD A;  1N6Q A;  1VQ8 N;  2E1Y A;  1CXU A;  1S6Q A;  3MEE A;  3CPW M;  4XH4 A;  1O13 A;  2Q2R A;  4IBN A;  4J2D A;  1WOQ A;  3TAE A;  4OKK A;  1JLE A;  1NGJ A;  4F3O A;  2QA4 N; 
#chains in the Genus database with same CATH homology
 1Q86 O;  5M1F A;  3VET A;  4GNI A;  5C10 A;  3VGM A;  3CCR N;  3A8Y A;  3CCQ N;  3CET A;  3JXU A;  4H0X B;  4JAX A;  1GLL O;  2P9I B;  4DQ8 A;  1NGF A;  4AM6 A;  1VQ6 N;  3ENO A;  3IMX A;  3J7Z O;  2CGL A;  4B1V A;  4BRH A;  2ZJR L;  5AQO A;  4BR7 A;  4IEE A;  4IEI A;  4A2A A;  3OW2 M;  1KXP A;  2V51 B;  3FFK B;  1Q81 O;  4HWI A;  3TU5 A;  1NGI A;  4FOE A;  4BR2 A;  3CIP A;  4WCE L;  2WFB A;  1W2B M;  3VF2 A;  1QVF M;  4CZE A;  4JD2 A;  3WQT A;  1KQS M;  3MN6 A;  3LDQ A;  1XQS C;  3GL1 A;  2Q1N A;  3CER A;  4IZ9 A;  4BC2 A;  4FSV A;  1CZA N;  3ZET A;  4CZI A;  1T6C A;  4A5A A;  3CJC A;  5KQD A;  4WQ5 A;  1GLB G;  4NLC A;  3GDQ A;  2QTD A;  5LY3 A;  3CME N;  3SAH A;  1ATR A;  2ZGY A;  4HTL A;  3NVM A;  4CZH A;  4BRD A;  3DWL A;  3FLC O;  2VCP A;  3TSQ A;  3TPQ A;  2EWS A;  4BG8 A;  4BGA A;  4BRF A;  1T6D A;  3MK6 A;  4BR0 A;  5JVG L;  2J4R A;  3D2F B;  3WXJ A;  5F0X A;  3PLA A;  1BO5 O;  4FWQ A;  3TTC A;  2V52 B;  4JHD B;  4H0T B;  3U9Z A;  1HPM A;  3C6H A;  1KAX A;  3VPZ A;  4H0V B;  3AAP A;  4JHD A;  4GVE A;  4B1W B;  1LOT B;  3ZYY X;  3AAR A;  5FPN A;  1KD1 O;  4JKF A;  2HF3 A;  2PFU A;  3C65 A;  4GY2 B;  3CCE N;  1H1V A;  1VAZ A;  3R9P A;  3UB5 A;  5FPE A;  4ILH A;  4J8F A;  3C7N A;  3KWI A;  3R1X A;  3HOS A;  5LJW A;  2HOE A;  3AY9 A;  3DJC A;  3O80 A;  2GEM A;  3BF3 A;  3DXK B;  3CMA N;  1VQN N;  3MCA B;  5DM6 L;  3QBX A;  1TUY A;  3MMV A;  1RGI A;  3EKS A;  2ITM A;  2GEL A;  2YJE A;  5AQG A;  3UKR B;  1YJN N;  1Q18 A;  3TSP A;  2E20 A;  2QM1 A;  3RSE B;  4BVP A;  3LDP A;  2FF3 B;  1K8A O;  4RTF D;  5F1X A;  3QBW A;  4EIA A;  1G99 A;  5AQN A;  1XUP O;  2Q97 A;  3KVG A;  3OBW A;  4NB4 A;  3DLL L;  1GLA G;  3O4W A;  3WT0 A;  5EOY A;  4H0O A;  3SAF A;  4B1Y B;  5C0Y A;  4JEP A;  2H3G X;  5AQX A;  5H1S Q;  1Z6R A;  4MLE A;  2FLO A;  4BR5 A;  1YJW N;  4BR9 A;  2WC9 A;  3DXM A;  4EFH A;  3MDQ A;  1X3M A;  3H46 O;  3CXC M;  4FL9 A;  1ZC6 A;  1XC3 A;  2ZWH A;  3U9D A;  1VQ5 N;  4IDH A;  4BRI A;  3I33 A;  3EKU A;  2RE2 A;  3ZX2 A;  1U2V A;  4JKA A;  4YOR A;  5AQU A;  1MWM A;  4ILG B;  1BG3 A;  3WEE B;  5AQJ A;  4F9O A;  2VGM A;  3WXL A;  2GWK A;  3CJA A;  1HX1 A;  4FWM A;  4BC3 A;  3ATU A;  1BA1 A;  3MWT A;  4YDU C;  3HTV A;  4B9Q A;  4CZJ A;  4DCH A;  1YXQ A;  3K9K A;  5AQL A;  4WFB L;  3VF6 A;  3VER A;  5BPL A;  1M90 O;  1P8Z A;  4YOT A;  4JKG B;  1VQL N;  1NGC A;  1NGB A;  5HOO A;  3PIO L;  2P9N A;  4PL8 A;  5EY4 A;  4B1U B;  3NVK A;  3O8M A;  3LDO A;  3EN9 A;  1M1K O;  1QQM A;  3W3D A;  2I7N A;  4CZL A;  5BPM A;  5GAE P;  2E1Z A;  5KPZ A;  2KHO A;  3BEX A;  1TYQ A;  5AQF A;  3DAW A;  3O9R A;  4PKH A;  1YHQ N;  3ZEU A;  2QWN A;  4H5W A;  3O6W A;  5BR9 A;  5M1K A;  1EO1 A;  4CZK A;  3MX5 A;  5BN8 A;  5LJV A;  5FPD A;  4YOY A;  1E4F T;  3P38 A;  4YDU A;  4BRC A;  4A2B A;  2BUP A;  3MWP A;  4JKB A;  5MLC Q;  3G4S N;  5JLF A;  4IOC L;  3CJ7 A;  4RWT A;  1IG8 A;  3VEZ A;  4OPA A;  5E26 A;  4QS7 A;  2YX6 A;  4O8U A;  4A62 A;  4OO1 J;  4CBW A;  2RHK A;  5E84 A;  4GV9 A;  3IFR A;  5AQH A;  2IVN A;  4BC4 A;  4EHU A;  1JJ2 M;  1VQ9 N;  3O9T A;  1VQ4 N;  1VQP N;  1NWK A;  2NZT A;  2ZGZ A;  3P4I A;  3RSE A;  2ASO A;  4CBU A;  1JCG A;  3CF5 L;  3OBY A;  3G6E N;  2OTL N;  2E8A A;  5B8H A;  3T69 A;  2P9K B;  3GG4 A;  3O1B A;  4FPA A;  4IOX A;  1RDW X;  4M7Y A;  4WFN L;  1LCU A;  2CGK A;  2YHY A;  3E9P A;  5KPT A;  4FVU A;  2E2Q A;  3G71 N;  3UKU B;  1OKJ A;  2QWQ A;  5GIO A;  2QW9 A;  3ATV A;  2FSK A;  4BRO A;  1R59 O;  2P9P A;  1GLF O;  1NGG A;  1K9M O;  4H0Y B;  2NRV A;  1K8K B;  2HBK A;  2VGN A;  3M6G A;  3VEN A;  3FZL A;  2IVO A;  4GV3 A;  3CC2 N;  2NRH A;  3FZH A;  1YJ9 N;  1MA9 B;  2OAN A;  3CPE A;  3F2K A;  3GE1 A;  3R3L A;  4BRM A;  3SAG A;  3EZW A;  3JS6 A;  3ULE B;  3CQX A;  3ZET B;  2W41 A;  3CI5 A;  3M1F A;  3ULE A;  1QQN A;  4K25 A;  4I6M B;  1NBW A;  1NGA A;  5BRE A;  2PBD A;  2FSJ A;  5CE3 A;  4M63 C;  5I9E B;  3H1V X;  5JLH A;  2KKZ A;  3O1W A;  4BRQ A;  5ADX A;  2OTJ N;  3VEO A;  2P9U B;  5AQP A;  3KHY A;  4JKC A;  4BRP A;  2A42 A;  3BUZ B;  3IUC A;  4IWV A;  3WXI A;  1ATS A;  3D2F A;  3VGL A;  3CCM N;  4ISF A;  3LDL A;  4IOA L;  4ISE A;  1SS6 A;  4H5V A;  4U67 L;  5AQZ A;  4CZF A;  1VQO N;  4K41 A;  4C1N I;  2Q36 A;  2JWK A;  1ESV A;  2A40 A;  3CJ1 A;  5AQT A;  4IO8 A;  4AF1 A;  4B1X B;  4YOX A;  5JVH L;  4XEI A;  4A57 A;  3CCS N;  4WQ5 C;  3ZEU B;  5DM7 L;  1S22 A;  4G9Z A;  2W40 A;  3CJB A;  2E2N A;  3G25 A;  1DT9 A;  3WEE A;  2VYP A;  3ZX3 A;  3VTI A;  1Z05 A;  1NLV A;  1KAZ A;  3CHW A;  4FWR A;  4IJA A;  5EVZ A;  3A5O C;  4MO5 A;  1BDG A;  3GBT A;  3QML A;  2D0P A;  5EX5 A;  1E4G T;  1Y64 A;  4WQ4 A;  3KWG A;  4KH4 A;  3KK7 A;  3AAQ A;  5GAG P;  2QWP A;  5F2R A;  2P9N B;  5AZJ B;  1W97 L;  4JKH A;  2YCH A;  1VQM N;  1DGK N;  3C0B A;  2NNW A;  4MDA A;  2FSN A;  3VTH A;  4KH6 A;  3P31 A;  2AA4 A;  4WFA L;  4H5N A;  3N4P A;  2Q0U A;  4A5B A;  2NLX A;  2QEX N;  2D1K A;  3C7N B;  4CJ7 A;  1EQY A;  5AQI A;  3AGK A;  5JIC A;  2KLA A;  1X9J A;  1BUP A;  4NLB A;  2NRX A;  2P9L B;  3W0L A;  1QVG M;  2A5X A;  1OVY A;  2HST A;  3O9U A;  3MN9 A;  4A59 A;  3ID8 A;  4BRG A;  2YJF A;  2F9W A;  3AGR A;  3D2E A;  4Z94 A;  1HKB A;  2QWO A;  3FGU A;  4AM7 A;  4B1Z A;  2CH6 A;  4XH1 A;  4EAH D;  3A5M C;  5C2F A;  1K73 O;  2P9P B;  3EL2 A;  1YIT N;  2E88 A;  2PAV A;  4I6M A;  3H45 C;  3HI0 A;  5AQW A;  3H6E A;  3VGK A;  1HLU A;  3H3O B;  4C1N K;  3BF1 A;  4ILJ A;  3TTD A;  1SQK A;  4JKE A;  2P9S A;  3L6Q A;  3VEV A;  3CD6 N;  5C2D A;  1ILY A;  2E2O A;  4WF9 L;  4PKG A;  1D4X A;  2P9S B;  3R8E A;  5CHI A;  3QDK A;  3CCU N;  2HBL A;  2BH1 A;  4CZM A;  5M1N A;  5BRH A;  1GLC G;  2YHW A;  3CC4 N;  3CCJ N;  1QHA A;  1YF5 L;  4FWP A;  5C12 A;  3O08 A;  2A3Z A;  3VEY A;  3EE8 A;  5AFU A;  4DHY A;  5GAH P;  3MN7 A;  4DKW A;  2A41 A;  4U7B A;  3A5L C;  3CCV N;  3N4Q A;  1C0G A;  4KH5 A;  1S3X A;  2A6A A;  4FOI A;  1DKG D;  2FF6 A;  3H1Q A;  3M5R A;  4O5F A;  5AZI A;  3I55 N;  2GTD A;  2P9I A;  2QXL A;  3B8A X;  3FR0 A;  4C23 A;  3O9Q A;  3O9S A;  4XH5 A;  3L4I A;  1TYQ B;  5GAD P;  5AQV A;  4PHT X;  5AFU H;  5AQK A;  2WUS A;  4PKI A;  4FWK A;  4K42 A;  5AQY A;  4CD1 A;  4FWL A;  5EXW A;  3L4Q A;  1NMD A;  3SK3 A;  3QIC A;  3EO3 A;  4O8K A;  4H5T A;  3QFP A;  4IO9 L;  4BVO A;  2HBJ A;  1N8R O;  4RCH A;  1HKG A;  5BPN A;  3VEW A;  5AZJ A;  1QQO A;  2P9L A;  3UKU A;  2IVP A;  4WQ4 C;  3CJ9 A;  5M1Q A;  1JCF A;  3Q7C A;  4IJN A;  1YAG A;  3DXK A;  1U6Z A;  3ENH A;  1KC8 O;  2HF4 A;  3CCL N;  1T3V A;  5BN9 A;  1BWF O;  1RDU A;  1V4S A;  3VOV A;  4BRE A;  4BG9 A;  1MWK A;  3FZF A;  1Q82 O;  3UKR A;  3HZ6 A;  3LM2 A;  3MX2 A;  1NGH A;  3DXM B;  3HRG A;  5AR0 A;  3MN5 A;  4UY8 O;  3WQU A;  3SLC A;  3FE1 A;  4QS9 A;  3TTF A;  3HSC A;  3P39 A;  3LM9 A;  4BC5 A;  3S41 A;  2Q0R A;  3NMU A;  5KPR A;  4OPH A;  4JK7 A;  4YOV A;  4EHT A;  3VF4 A;  4A61 A;  4JK9 A;  2Q31 A;  4PL7 A;  3E1Y A;  1V4T A;  1KAY A;  1NGE A;  3QFU A;  2P9K A;  2HMP A;  2D4W A;  2NRZ A;  3ID6 A;  5M1P A;  4JNE A;  4H5R A;  4BRL A;  3K9J A;  1SZ2 A;  2QI2 A;  4JKD A;  4BR4 A;  3FZM A;  3IDH A;  3OHR A;  1ATN A;  2F7T A;  3E66 A;  4FWO A;  1RFQ A;  2QWR A;  4BQL A;  5GIP A;  2FXU A;  4CZG A;  4H03 B;  1VQ7 N;  2QWM A;  2WBN A;  3ZX0 A;  2CH5 A;  1BOT O;  2P9U A;  4WYB A;  3R6M A;  5KQ8 A;  3WXK A;  4BRA A;  4JN4 A;  3U4L A;  1DEJ A;  2GX9 A;  4JKG A;  5ELZ A;  1K8K A;  4JD2 B;  3SBG A;  3T7Z A;  3F9M A;  1YVN A;  5CR4 A;  3WUH A;  1NM1 A;  4H0P A;  3EE9 A;  3I8B A;  3VEX A;  5AZI B;  1HKC A;  5JMV A;  2GUP A;  2NRW A;  2UYT A;  3L0Q A;  4QS8 A;  5BRF A;  2I7P A;  2JWL A;  1NGD A;  4R79 A;  5FPM A;  4BRK A;  2GWJ A;  2ZJQ L;  1U2V B;  5AQR A;  4JK8 A;  4BRN A;  1QZ6 A;  3A5N C;  3QB0 A;  2V7Z A;  3VMF B;  2F9T A;  3IKM A;  4K43 A;  3RVC A;  5ADX H;  3KZB A;  2DPN A;  1YI2 N;  3SMS A;  2YI1 A;  3U8X A;  1BA0 A;  2CGJ A;  1YIJ N;  4CBX A;  3LDN A;  5M1O A;  2VWB A;  5AQS A;  1YUW A;  3PIP L;  4MDB A;  3J8A A;  3SJH A;  2ZJP L;  1TUU A;  1ZXO A;  2QWL A;  4MO4 A;  3E9L A;  4FPB A;  4BGB A;  4Y0W A;  4FWS A;  4CD3 A;  3UE5 A;  3D2E B;  3OA9 A;  3D7E O;  1HJO A;  1MDU B;  3ENB A;  1SAZ A;  2ASM A;  2BTF A;  4FWN A;  4DB3 A;  1P90 A;  1GLD G;  2IIR A;  3SMP A;  4E1J A;  2NRT A;  3O5B A;  3HM8 A;  1BU6 O;  2HBM A;  5HL7 L;  4IFE A;  3F5T A;  4CI6 A;  3FZK A;  2V7Y A;  4FO0 A;  1WUA A;  4L3Q A;  3E9O A;  4BQZ A;  3HOT A;  3HBT A;  5AQM A;  2ZF5 O;  1C0F A;  3GOI A;  1IJJ A;  1X3N A;  1T44 A;  2D0O A;  4LC9 B;  4NO7 A;  3WXM B;  3CC7 N;  3C6A A;  4YOU A;  5BRD A;  5TKW A;  5GIN A;  2E1Y A;  3MCP A;  1GLE G;  4ISG A;  5AQQ A;  3I56 N;  1NJI O;  1VQ8 N;  4BY9 C;  4KBO A;  3CPW M;  3H3N O;  4M7X A;  4XH4 A;  2ASP A;  2NRR A;  3D6R A;  3A0I X;  2AP1 A;  3LL3 A;  4IXC A;  4MLH A;  1O13 A;  4YOW A;  3BP8 A;  4GV6 A;  3Q7B A;  1ZBS A;  1Q7Y O;  2Q2R A;  3SBT A;  1S72 N;  2YHX A;  1WOQ A;  3CQY A;  1J6Z A;  1GLJ O;  5C15 A;  1NGJ A;  1QZ5 A;  3M3Z A;  5TKY A;  3TSU A;  1JCE A;  2QA4 N;  1HUX A;  3VES A;  2E2P A;  1VQK N; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...