2H3HA

Crystal structure of the liganded form of thermotoga maritima glucose binding protein
Total Genus 112
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
112
sequence length
313
structure length
313
Chain Sequence
MLTIGVIGKSVHPYWSQVEQGVKAAGKALGVDTKFFVPQKEDINAQLQMLESFIAEGVNGIAIAPSDPTAVIPTIKKALEMGIPVVTLDTDSPDSGRYVYIGTDNYQAGYTAGLIMKELLGGKGKVVIGTGSLTAMNSLQRIQGFKDAIKDSEIEIVDILNDEEDGARAVSLAEAALNAHPDLDAFFGVYAYNGPAQALVVKNAGKVGKVKIVCFDTTPDILQYVKEGVIQATMGQRPYMMGYLSVTVLYLMNKIGVQNTLMMLPKVKVDGKVDYVIDTGVDVVTPENLDEYLKKMEELGIPIKFGSHHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure-based design of robust glucose biosensors using a Thermotoga maritima periplasmic glucose-binding protein.
pubmed doi rcsb
source organism Thermotoga maritima
molecule tags Sugar binding protein
molecule keywords Sugar ABC transporter, periplasmic sugar-binding protein
total genus 112
structure length 313
sequence length 313
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-05-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13407 Peripla_BP_4 Periplasmic binding protein domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2h3hA02
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2h3hA01
2V0NA 2FMFA 1NXXA 3HDGA 1PNTA 2GI4A 4ETNA 1JYEA 1ZY2A 3BRQA 3H5TA 3D8UA 5FWYB 4MR9B 1Z18A 2QSJA 5F64A 2M1ZA 4N0QA 3HM9A 1JHZA 4O5AA 1JFVA 4ZYLA 5BRJA 4KQCA 4YRZA 3MMNA 4MRMA 1XHEA 4F12A 6CHYA 3QEMB 2HQBA 4G0ZA 3G85A 3SY8A 4JASB 1LK0A 5TQ0B 3OO1A 3OO0A 4KVFA 2QW1A 1MVOA 1USGA 1Z16A 3NNNA 4FE4A 4Q6WA 2E4UA 2BGGA 2X7XA 3Q7SA 3W9SA 1U8TA 3GT7A 1K66A 1NATA 3N53A 5FBKA 2P4UA 3RVKA 2NZVG 4Z4HA 1L5ZA 4EYKA 3JTEA 2CHFA 3OQNA 2PLNA 2HJ9A 4WXMA 3QEMA 3HUTA 4S04A 1VRVA 1DCMA 1OXKB 3UKJA 4PZ0A 2JCGA 4E7OA 3O2JA 5CNKA 2PUCA 1Z2EA 1RNLA 1TVMA 1DCKA 1TJYA 4L85A 4B09A 1YIOA 5EWLA 4N03A 4HYEA 1ZGGA 3JVIA 1YMVA 3KJXA 3TB6A 2MSWA 3HS3A 2FW0A 3IDOA 3HO1A 4WT7A 3EGCA 5GOTA 3R0JA 3LUGA 3QLVC 5FBHA 3VNAA 2A9QA 4NV3A 1RXIA 1PEYA 3CZ5A 4UHJA 2O20A 4W5RA 1RZRA 5T7BA 1SXIA 2FLKA 3OQOA 1E6LA 3HSYA 1QP4A 3EODA 4MPTA 3I42A 4EY3A 2FTKE 1JYFA 1ZN2A 3BBLA 1BVHA 3C97A 3GBPA 4RK7A 3D02A 4QYWA 4KRFA 2CHEA 3E3MA 2E4XA 4RZSA 1DRJA 3GV0A 3ROFA 5KC8A 5KQMA 3K9CA 1EWKA 3B2NA 3A3KA 3N6VA 3O75A 4E7PA 1I3CA 5EWMB 1FFGA 2NT4A 3LUAA 4FB4A 1EAYA 1URPA 3Q7RA 2FVYA 3GA5A 2WY2D 4RV5A 3RVRA 1BDIA 2PE5A 2FEKA 2NT3A 3KYJB 4S05A 3H6HA 2M98A 1HEYA 1ABEA 1R8JA 1Z15A 3UUGA 3KTOA 4KPYA 2JVIA 1ZAYA 2R25B 3N0XA 1UDRA 3KYIB 4RS3A 5KQLA 1D1QA 2VUIB 3LUCA 4MS1B 5DTEA 1DZ3A 4MS3A 3OMXA 3RVQA 3FFTA 3O1IC 4NICA 2PMCA 1FQWA 2PAFA 3M9WA 3JY6A 2QU7A 3LKVA 5EWJA 5TQJA 3H5WA 4IF4A 4YWHA 2R4QA 1DBPA 1CYEA 3H5IA 5HQJA 4DADA 4F8JA 2FLWA 1YVUA 4EYOA 4MR9A 4N0PA 5TQ0A 2HQRA 1DC7A 3TMYA 4DN6A 2W42A 1KRXA 4IILA 3FGZA 4G97A 2P9HA 2L17A 2PL1A 2JK1A 3CHYA 3URMA 1EFAA 3JPYA 3H5LA 3OLZA 2L18A 3LMKA 3M9XA 4H3KB 4LE0A 4GPAA 2L2QA 1L5YA 4W5TA 1USKA 1M2EA 2MYNA 3IP5A 4OLBA 1F51E 2FEWB 1TLFA 1U2QA 4MS1A 3C3KA 2LUOA 3SG0A 3LUHA 3RVPA 4F11A 3I45A 3IP9A 1KRWA 1QO0D 2NZUG 3N0RA 4KMRA 5KI6A 5TPZA 1B00A 2JBAA 3O2SB 4KZKA 3RVMA 3HCWA 1JL3A 1C4WA 3L6UA 1M2FA 1ZESA 4XLTA 4RWEA 2R47A 3OM1A 4IGAA 1QKKA 3K4HA 2MYTA 1JH9A 4N41A 4RY9A 3T8YA 4TLLB 1APBA 2HPHA 2WB4A 1PEAA 5IUKC 4G0OA 4KNYA 3CFYA 1S8NA 2FMHA 3OMWA 3JPWA 1NXVA 2MYPA 5D2CA 4WXEA 1QPZA 1Z2DA 3C3MA 1SRRA 1JDNA 3LTEA 5IBQA 4Z4GA 3Q15C 1DJMA 2GX6A 5IUJC 4RKRA 1Y1LA 2AYZA 1FFSA 3H1FA 5C5CA 2GWRA 3EAFA 3OLWA 2DRIA 2IKSA 1EHCA 3N75A 4Z99A 2PL9A 5IX8A 4GNRA 4MGEA 4RU1A 4RSMA 5DLEA 3KLNA 1BA2A 1U2PA 2E4WA 1LJUA 3QX8A 4JAVC 5CNJA 4MR7A 4N47A 3EULA 3CRNA 3BILA 3GYBA 1P2FA 4YP9A 3F6CA 3KKEA 4F06A 1J56A 4D6XA 1ABFA 4CBVA 3EQ2A 3LUJA 4TMYA 4LE2A 5DCLA 4W5NA 3CG0A 1JF8A 4HNSA 2B4AA 1NXTA 3NHMA 3QEKA 2ID7A 2QVCA 1DP4A 4MYRA 2PJUA 3F73A 1RXEA 1XWWA 4G0MA 4WZZA 2N9UA 2CWDA 4IMIB 4LRQA 5EWLB 2FMIA 3TO5A 4Z4CA 4D6YA 3MYYA 4XXHA 5HKOA 1ZH2A 2MSKA 3HUUA 4YGXB 2QVGA 4O1IA 3DGEC 1K68A 3MIZA 3RQIA 5B3JC 1LBIA 3EJWA 5IEBA 1C0EA 2H0AA 4XARA 3OLVA 2KYRA 4Z9BA 4JB0A 4YV7A 4Z9AA 2PKXA 9ABPA 4RK5A 4KV7A 1LBHA 2FSPA 1NTRA 3MF4A 1FFWA 2IPLA 1QNLA 2E4VA 1DG9A 2FMKA 3KHTA 4JB2A 2XDYA 3CKMA 3N8IA 5IEJA 2JRLA 2LIVA 3RVJA 1ZH4A 2H3HA 3SM9A 2L19A 4W5OA 4ML3A 2JB9A 3EDCA 4QICA 5CNIA 1CEYA 1M5TA 4RK6A 1EWTA 5JNVA 3SAJA 3N0WA 2FEPA 1CHNA 4RXMA 4G0YA 4OBBA 1Z17A 1JWLA 1DCFA 2NUBA 2LBPA 4LDZA 1DC8A 1GCAA 1T34A 3F7NA 1E6MA 1ZITA 1QMPA 3VNBA 1SD5A 1A0OA 2QV0A 2RJNA 4H60A 5JS2A 2F8SA 1YS6A 5FWYA 4LZLA 4MQFA 2FN8A 3C6QA 4IMJB 1W25A 4RDCA 4OTZA 5B3JA 3CZCA 3QLUA 5EWJB 1PHRA 1MB0A 1D5WA 4JA2A 5TPWA 3M6MD 3A0RB 3HVRA 3IP6A 2LP4Y 3IP7A 3CLKA 3OM0A 2FN9A 2GBPA 3HJFA 3DGFC 4MS3B 4FE7A 4MLDA 4MQFB 1P6UA 4MR8B 4XASA 2Q5CA 5TE9A 7ABPA 5E3JA 3F6PA 4QPJC 3GWGA 2ZWMA 4WWHA 5BR1A 4Q6BA 1MIHA 3A10A 3H6GA 4KQ9A 3KS9A 1LJLA 1QP0A 4EGSA 2A9RA 2WJWA 1RPJA 4G0PA 3FDFA 1JFTA 1JX6A 4LDAA 2OQRA 2VUHB 4EVQA 1YK0A 3H5VA 4RY8A 4H3HB 3A0UA 5PNTA 3IPCA 3LKBA 2PUFA 4EYQA 3KCNA 1EWVA 4KFCA 1NXPA 3DLBA 1BAPA 4MQEA 2PUBA 5HSGA 5KC9A 4NCAA 2F8TA 1VKRA 1Z12A 1ISSA 2E4ZA 1ISRA 1NXWA 5I4CA 1PUXA 2JBAB 3LUKA 1D4ZA 1U04A 1DBWA 2FXIA 3KLOA 4KK3A 3O2QB 5BRAA 1SXGA 3H75A 1ZDMA 3LUFA 4G86A 4WUTA 5JS1A 4Q7EA 1OXBB 2ZAYA 3G1WA 1ZVVA 4P1ZA 1E6KA 4XFKA 5TQ2B 1JLKA 2QR3A 3O1HB 1MAVA 1AB5A 3DZDA 3LOPA 1D2AA 4YO7A 1GCGA 4EVRA 2IDMA 3L49A 5ED4A 4MS4B 2RJOA 4OG2A 6ABPA 5JNWA 4ZJPA 1JDPA 5T3YA 3RVLA 5CNMA 4Z4EA 3NNDA 3HEBA 5C5EA 4F3TA 1JBEA 1GLGA 2ID9A 3TX6A 3BREA 1YTUA 1M5UA 1IIBA 1P8AA 2PUGA 1U0SY 2QZJA 3Q41A 2PUEA 3T95A 5IUNC 4KK4A 4L4UA 3NBMA 1ZGZA 4ZPJA 3I5AA 2FQXA 3OLXA 5GQSA 1GUBA 3MA0A 1PNRA 2B1JA 4N76A 5IULC 1YS7A 5IC5A 4YS6A 1DBQA 1AB6A 5JNSA 2VK2A 4JP1A 4OATA 1BDHA 1E2BA 5JNRA 4PYRA 4RK0A 4Y9TA 4RXUA 3QX9A 3DLHA 3Q9SA 3QELA 4Z4IA 1JFSA 1MB3A 3QLUC 2WJAA 5TPZD 1WETA 1Z25A 2TMYA 1BDJA 2RGYA 3GRCA 2GKGA 4RY0A 2YHBA 3Q7TA 3QLVA 3H5OA 3MQ4A 3T6KA 1USIA 2FQYA 4EVSA 4NCBA 1NXOA 4ZMRA 2MSLA 3UK0A 3O1JC 1A04A 3FFXA 3HXMA 5DKFA 4TLMB 3IPAA 2MYUA 5JNUA 1YK1A 5KQGA 3ROTA 1ZHHA 1TMYA 4PEVA 1SXHA 3CS3A 3E61A 4OLAA 2CD7A 3HV2A 3KSMA 5CHYA 3RVOA 4MS4A 1P6QA 3ILYA 4RXTA 2LPMA 2PUAA 3OLYA 3HZHA 5KWSA 3GL9A 1KMIY 2JVJA 3C3WA 4G0XA 5FWXA 4ZMSA 1QQBA 2IPNA 3LFTA 1D1PA 2A9OA 4UHKA 3CU5A 3CTPA 3O21A 1NXSA 3SQNA 1F4VA 3JVDA 2IYNA 3LUDA 4YCSA 4RK4A 4O1HA 1QP7A 1FSPA 4Z0NA 3OQMA 4ETIA 4YLEA 2IPAB 4QYMA 3RH0A 2E4YA 4YR7A 2I6FA 4MR7B 3P9YA 4MAAA 1XHFA 3KG2A 5TQ2A 2HQOA 1KGSA 1QQAA 3EQZA 4PE5B 5FWXB 1VLZA 3RVNA 2WRZA 4HNQA 1TM2A 4KREA 1YMUA 3HDVA 3JS5A 1VPWA 3HK2A 3H1EA 4IRXA 2WWVD 3FFWA 4ETMA 3CG4A 5HM6A 2A9PA 3NNSA 4MQEB 4Z4FA 4NQRA 4LE1A 4P98A 4LX8A 2R48A 3QK7A 3RVSA 4MLCA 4PICA 3I09A 3DBIA 3QLTA 1Z13A 3T38A 3MM4A 3TD9A 4DQDA 2WMYA 3CNBA 5EWMA 1Z26A 3BRSA 2IOYA 3FMVA 2FKAA 1DRKA 2HSGA 4RK1A 1RZRD 4M88A 2J48A 1H9CA 4W5QA 4TN5A 1GUDA 2VYCA 5TPWB 4EUKA 4XAQA 3ILHA 3QELB 3S99A 5KQPA 1A2OA 1W9HA 4EYGA 4MR8A 3SNKA 2FQWA 2RDMA 4D74A 4JOQA 5ABPA 2IPMA 3H1GA 2YHAA 4RKQA 2JVKA 2PUDA 3O74A 3GBVA 2OENG 4G0QA 5BQ3A 4HNRA 4MRMB 1NY5A 2QXYA 5JNTA 3NHZA 5DGCA 8ABPA 1QO0A 2AYXA
chains in the Genus database with same CATH superfamily
3QXXA 4XYGA 4BLPA 2VT3A 3H7AA 2F3SA 1AUQA 3TW0A 5FJJA 3B6IA 2KBEA 3N39C 4LQLA 4DIKA 1HOXA 1NW6A 1AF4A 3OG9A 3H5TA 4IJWA 3D8UA 3W3AA 2ZQYA 4CETA 1Q7GA 4OBXA 3C3EA 3HM9A 4BC1A 2AW5A 4WCFA 2BFFB 4YN3A 4YDHB 3V33A 1SOAA 4ZI7A 3LPNA 3UUFA 2D1RA 1GXSB 2JKZA 2K2QB 1TDJA 1U0GA 2OXTA 4H6PA 4IUDS 5F21A 3SNHA 2QAGB 1P9NA 3O9ZA 3WYBA 2F3QA 1YQ9A 3CLRD 1RWQA 4IQ0A 1ZI6A 2A1TR 5CW2A 3W7VA 2W2MA 3IJRA 3PNLA 1QANA 2A7XA 2QMZA 5KMGA 1NW7A 2CBXA 2VSNA 2XDQB 4GRDA 5BOVA 4PLVA 1HY3A 1KOFA 3F2VA 3GP3A 1T8PA 4D42A 3QFHA 5FLXA 3F6BX 4ID9A 3UT0A 1AA6A 3LM8A 4FHEA 5KOJA 4IBOA 4WNCA 3OQNA 5HYVA 4QNNA 2B3TA 1RWMA 2QRVA 5KU1A 2POQX 2EBFX 4LJ5A 1VE1A 2QK4A 2KWIA 3MMXA 1P80A 1DAEA 1W46A 2CUTA 2ZB2A 4GI2A 4BIIA 4QJ3A 4XPZA 1ODFA 2YV1A 2N47A 3GAFA 4E7OA 5F7OA 1LSOA 2IXGA 3PUJA 2I87A 4AMVA 5ALPA 5JAOA 1OJ7A 4U02A 4GDMA 4S12A 5C4GB 4HWSA 4YAIA 5AKGA 4HTAA 3RIEA 3PGJA 3L0PA 2R00A 3DTYA 1XNHA 1FVHA 5CM8B 4FJ1A 2RONA 2E49A 1W2HA 3H3FA 1L4MA 3B85A 4JBHA 3WY9A 1Y9AA 1W0JD 2ZBQA 4JUDX 1GFSA 4ZQHA 2B30A 3PYLA 3K8QA 4C87A 4ESOA 1Z63A 4LZNA 4KIGA 3UHAA 4MYCA 3R0JA 3EXHA 3FROA 2PSEA 5JFTA 4BP3A 2IYTA 1M34A 1BEZA 1P5FA 1V6SA 2RHMA 1AHHA 2UZ1B 3D6TB 3LIIA 3ZLVA 5AKYA 1RZRA 4DABA 4L08A 4P3YA 3OHSX 1Y7IA 5TC4A 2A9KA 1W0JA 1IB0A 4EY3A 1DX9A 1JYFA 3RIHA 3W79A 1KBQA 2ZZKA 1KTVA 1L7VC 4NH4A 1TKAA 1XD9A 4E13A 3A1CA 1J22A 3LDUA 1HR0B 4MVYA 1U7TA 1Y5LA 3GV0A 3LX6A 3VKVA 4YCNA 3B5IA 3OTWA 4NXNB 2VLBA 1F14A 3MGBA 2BGJA 9GPBA 3ND8A 3ZBTA 5D3KA 4W4TA 4E7PA 2QXTA 2X2OA 1LSUA 3HM2A 4U5QA 3NUQA 1Z6QA 1OZ0A 3IE2A 1U94A 3NASA 3O4IA 4NARA 3QM1A 3TPZA 1RTKA 1XROA 2RH5A 3AF4A 3G5TA 3HDTA 2H4FA 1OZFA 3EXHC 2ZYAA 3PL5A 4JZKA 2IS2A 2AVDA 2VCYA 3C5VA 2Y05A 3GIWA 2IDZA 2YVQA 4MICA 3VJKA 2LCIA 3VOSA 5JXHA 3I2HA 4KXVA 1O77A 2F6RA 1F3OA 3GGOA 3PU6A 4DMHA 2PX6A 2WOOA 3P0RA 1PVDA 4ZQCB 2ZBEA 1RU3A 4PLTA 1JPUA 4U7JA 1C14A 1R8YA 1TM4E 2CYCA 3AVQA 4HMQA 3G0IA 4D3FA 5EWJA 1AO0A 2OV6A 5CBKA 2QLLA 1WUTA 2R4QA 1CYEA 2JIBA 2ODPA 4OV6B 3M6AA 3KQNA 3S27A 1PZXA 3KALA 2O1WA 1EA5A 2ZYDA 4FDTA 1DC7A 3FNFA 5CX4A 3L5OA 1II8A 4IILA 4WXRA 3WAKA 3ZVKA 1V8DA 1ADYA 1O5OA 2DR0A 3CHYA 3OHMA 3O9VA 4WSOA 3SZOA 4WZAA 4QBFA 1C7FA 1NRJB 4DMCA 1OX4A 2R6CA 3IP5A 4V2IA 1Z7EA 3JD2A 4HDMA 1GPYA 1S4MA 3EPLA 1KFKB 2UXBB 2EWMA 3OCJA 4DLRA 3DAOA 5I8ZA 2W8BB 2WYHA 3IDAA 1SMKA 2E9SA 3NOXA 3DHWC 3WE7A 4EI8A 3DCJA 4EO4A 3KEFA 2IIQA 5JFGA 2REOA 3E7DA 3V4OA 3LBIA 5BXQC 4GW3A 4KPFC 4GZ3A 3M2PA 1RRFA 2P9EA 3I30X 2EC5A 3GFOA 4A8PA 1AOXA 1ZIOA 4B7ZA 3UA4A 4TLLB 2GSWA 3SYLA 2J3EA 1Y5RA 4FLMA 3ZK8A 4B3DA 4R1PA 1XFAA 1KJJA 1Q6ZA 2V55B 2NTYC 4JU9A 1FXSA 1US8A 1OYYA 2YMLA 4G0OA 4V0RA 1HV8A 4FYMA 1SUSA 4K88A 1Z82A 4DC9A 3JPWA 4BVFA 1FW6A 1YQXA 1YJCA 1R3UA 2VRCA 1TUIA 1F9EA 1EVYA 1UBOS 3KQOA 1R0SA 4IVRA 4KGVA 3EWIA 3O84A 1Y82A 3NETA 3U49A 4OFWA 5FL3A 3FVWA 3GEDA 5IUJC 2HK8A 3PEYA 4BO4A 4I2VA 1WS6A 2K87A 4I1VA 5LD2B 2WAXA 3LKDA 3JQEA 3GLHE 1V8FA 4KIFA 4CTMA 1RYYA 2IKSA 1GNSA 5ITWA 2W00A 3CT6A 2WPNA 3I58A 3DHNA 3ZNOA 1KY5A 5C3UA 3TQSA 1QFJA 1HQYE 1OF1A 3TTVA 4ZT7A 2EX0A 2OCKA 3ZZNA 4FHFA 4RSMA 2OZKA 2I1WA 3EF0A 3PF9A 1AN9A 4XUEA 2WI8A 1QIDA 4NBUA 1FXWF 3VZPA 2G9NA 1QNFA 3VNSA 1SCDA 2WTNA 3LUJA 4K28A 3VU1A 5IG2A 3W9YA 5CA0A 2GZAA 5JCZA 3B48A 1YUNA 2VAVA 5FPTA 3SXJA 3ZY3A 3IVXA 2P0EA 4Q9DA 2O8BA 1NBHA 3QHPA 1YA4A 2WIKA 2X15A 2B36A 5GWXA 1OAOC 4G0MA 2W90A 1W85A 1W4RA 4IXTA 3QWBA 1K2WA 4H7HA 1HLPA 4MV3A 1TPYA 2X8JB 5ERYA 2E55A 5AT1A 1V5IA 2QRNA 2HCFA 1G63A 2LDBA 3NI2A 2HL6A 2QL5A 3R24A 3JQ8B 1WNFA 5SY6A 4OHWA 1F7UA 1LBQA 2V7UA 3DMFA 4PQEA 4PYIA 5EFOA 5IEBA 2PNJA 4E33A 2B4YA 4YJFA 2ILVA 5K0SA 5KTRA 4X62B 3ZTTA 5C7IO 5ICMA 2Q46A 2QY6A 2YASA 4ZAWA 4KR9A 5EJ8A 2IH5A 1HOTA 1GARA 1GXSA 1JLMA 2FH5B 2GHRA 3HCFA 3W2IA 2KSQA 2H1OA 1RMQA 1OGJA 3I9JA 3GJSA 4HUQB 4S1OA 5JEDA 3W8EA 1WDLA 3AM3A 3HI4A 3W5DA 1UMBB 1VKZA 2JH8A 2TECE 4CMEA 4JT2A 3GLFE 3E9YA 1Z0DA 1RKQA 2HU8A 3GH1A 3AQ4A 2EKLA 1G64A 2R6R1 1V39A 4M9CA 1U02A 4LRSB 3RGGA 2DPLA 4MITA 3MCVA 3AU8A 3NT2A 2J6CA 3VX3A 4P7GA 1A9YA 1PW7A 2DHDA 3QWFA 3PVCA 1T0HB 4CLXA 1XZGA 3MS2A 4F21A 1VJDA 4ZCMA 5DN6D 4Y2HA 4K40A 1R3DA 4O2BF 5JCXA 1OXUA 1ZISA 1CUVA 4BO8A 5CM2Z 5EP2A 2OT3B 5LM3A 1Z6GA 2CWWA 5ALMA 1XAGA 2J5KA 5IVDA 3T5BA 4DM3A 5CD9A 2IH2A 1RLUA 4ALJA 3ZTYA 3BE6A 5ANRB 3K1ZA 4MVJP 3NAMA 1ZNQO 4IG9A 4KMSA 2EKDA 2MINA 3CURA 3M0EA 3ND9A 3VH3A 3MCZA 4KI0A 4KTVE 3BMQA 2P5UA 2HBZA 4N0MA 2NU8B 4REMA 2PBRA 5EE0A 1YAHA 3EOBI 4OUDA 1QWSA 1N5IA 3SXPA 1SWWA 2PIDA 1NV9A 1K63A 3PPYA 3AGQA 5EIOA 1NZDA 2CYBA 3B13B 3EQ6A 3OECA 4W9RA 4EGQA 4R8RA 3WNCA 4E5KA 2C97A 1ISFA 7ABPA 3F6PA 4JLUA 4MWOA 4RZ2A 2ZPTX 1MORA 5FI0B 3ZD8A 1QYVA 1RCFA 1S2DA 1CUAA 4H18A 2OECA 4Q3NA 5J5AA 4YASA 3RUDA 4Q21A 1CRWG 3RYFB 1LFAA 1U6IA 4BEJA 3D43A 1UDWA 1DG3A 2IITA 2PX5A 4XWTA 2AWOA 3M1YA 2XD4A 2B4QA 4D44A 4OXKA 3PYMA 2FPPA 4Y2JA 1BC5A 3G2QA 3KZKA 3QOWA 1E3JA 2Z4TA 4LS3A 1MV5A 1PFWA 2BBSA 3LGSA 1XO1A 3PL1A 5K6AC 3KCNA 3QEJA 2I7DA 1SBCA 2SECE 4HXGA 1FSSA 3CISA 5K0CA 4NCAA 4MRNA 4RSHA 2IYFA 3EXIB 3PE6A 1ISRA 1U2DA 4YREA 3CNHA 3KEQA 1JMKC 1P72A 4PLGA 1JU9A 1XTKA 3GCDA 1PV2A 4F6LA 5I45A 3H5NA 4QRDA 4YJHB 1CIVA 1LLCA 1V8BA 2AXPA 2XTNA 3LUFA 3N8GA 4H59A 2ZAYA 5HQTA 1EWYA 2ZRBA 1R88A 4RTKA 1BXRA 3DZDA 1W6UA 2UAGA 4IVQA 4V0KA 2W2NA 1VB3A 4IDEA 1EPUA 2NZ2A 3H1AA 4PNHA 3ILXA 3UAZA 1XNQB 1T9ZA 2JI7A 1KMHB 1Z5VA 1VL5A 2VK1A 3ACCA 3WGTA 4F2DA 3RJZA 2XE8A 1FVFA 4WD3A 2GHIA 4I8XA 3ADOA 4GQAA 1HE2A 2WJPA 3QJGA 1W19A 3LLMA 3Q72A 3TX6A 3ZHYA 1UC9A 4E0BA 3I83A 3QOYA 4QPZA 3S7TA 2HT1A 2DGDA 2VF4X 4QFDA 4W9MC 2Z83A 1SHTX 1PV4A 3BGOS 2QUIA 1EG7A 3CRMA 3OA2A 4JI2B 2GM9A 1C4XA 3O82A 4FDAA 2EBWA 1VJGA 4M21A 3RCBA 1MB9A 3I6IA 4UNRA 4D8WA 5G02A 3RT9A 4FW9A 4OGKA 5J4HA 3ZDRA 5TVKA 3M3HA 1GUBA 3X1DA 1PNRA 1TIKA 2NNWB 3B20A 5EJ5A 4YS6A 1IXYA 1PE0A 1C5KA 1WD5A 2PX8A 4JLBA 1GEEA 3DP9A 1EVZA 1JI0A 1N5MA 1I0ZA 1NYRA 2OCDA 2QTCA 3KOYA 1FNNA 4FMCB 4X44A 1V45E 1KDVA 3ZU6A 3QX9A 2GPSA 1TU3A 2FWJA 3NANA 3FAKA 3W34A 2A7QA 3FPBA 1MO4A 1VG9B 4JMLA 3S0JA 1UOPA 2CXTA 1II9A 2GKGA 1KZ9A 1GPMA 1C1HA 1IY0A 1XLVA 4QJ4A 4ONEA 3SJZA 3IO5A 2C58A 5J5CA 1CEQA 2IZ7A 1U0RA 3ABSB 3RF6A 2VYVA 1ZNXA 5LP6C 1Q84A 4PWZA 4PYKA 4BPBA 1SQFA 4FQ8A 5LOVB 5AHXA 1U1FA 4LHZA 5JNUA 2QN3A 5KQGA 3W5UA 3E9DA 3WWOA 1G59A 1LUAA 5ELLA 1WXFA 2O7NA 5FBRB 4GPTA 4EG3A 3K30A 3HKCB 3ONNA 4UUMA 2OA0A 1GNLA 2LDXA 2ODTX 1MIOA 5TJHA 1VL2A 1I4WA 1KJNA 1QVWA 1QH1A 5AO9A 5JJLA 4O4LB 2XHEA 4RF2A 2NTVA 4QJIA 2P6MA 2VHWA 1JFFA 2A2ZA 3AEQA 4TTVA 2WZDA 1USUA 5KNDD 4QKQA 4G0WA 4JLJA 2FETA 1BJRE 3TM5A 1OROA 3WL7A 3UC5A 3G0BA 2G06A 5HRUA 3RLFA 2IUUA 4ETIA 1PT5A 3TPCA 4YP6A 3OWHA 4HDMB 4DCJA 1O9HA 2EQAA 1WNTA 3EMDA 5JI3E 1EESA 2UZ3A 3KAJA 1QYDA 3KE9A 2WRZA 3Q12A 4LBVA 2VYFA 1TQ2A 4HNQA 4LJ9A 2IU6A 1FU7A 4M98A 4X8OA 1PL0A 2H16A 3Q5DA 3UB4A 2Q1WA 4KE7A 1GM5A 2HSDA 2RKOA 2XUOA 2PXCA 2ZSJA 4TQUS 4Y6GB 3QVGB 2BGRA 2I4TA 3DCYA 3PRKE 3TFOA 3EXIA 3M33A 1QBGA 3N2ZB 4ETMA 3T3OA 4DDUA 4I55A 2FQ1A 4D82A 1TZJA 3OBBA 3C39A 2JEZA 1NMEA 1VI6A 2W6NA 3K0AB 5UKDA 4UNQA 1T3GA 2Q1TA 3SIRA 3MOIA 1WBDA 2PXXA 4LISA 4YMIA 4OM7A 4GVXA 2AH5A 1ZIXA 3CUWA 4Z8XA 4PLHA 2QJTA 2O19A 3SHFA 1CS0B 1NPYA 1RYMA 2QRQA 3ZTWA 4DA8A 4HAXA 1EX6A 3O6VA 3I9MA 3PHGA 4KYUA 4XUGB 4AIRA 2YVKA 4QQKA 4F56A 3BD9A 2YVUA 3HPQA 3V00A 1ODCA 1ULAA 4M1QA 3ABQB 1CUWA 4PLZA 2QM0A 4RE5A 3A9VA 1JJ7A 1RABA 2E85A 2VHCA 2CLKB 4PVCA 3ZR4B 1VJ5A 2JATA 4HNRA 3R7DA 5KWIA 3SFTA 1WCYA 3OOHA 4A0FA 4ZREA 5BSHA 2PPVA 4ESVA 4QU9A 4XX0A 1MOPA 4EITA 1U28C 1KEPA 1L7DA 3FOFC 5AI5A 3KOWA 1PZEA 4IIGA 4LJ7A 2I78A 1DTWA 2WV7A 3GARA 3IT2A 2BGLA 3MT8A 2E6KA 4ETNA 3P7MA 1PP4A 5FNVF 3Q9LA 2O8CA 3PDIA 2E37A 4ALIA 2QSJA 3NDJA 5EIBC 2BR4A 2X2FA 4DUZB 4UCQA 3NRCA 1MT3A 1VCMA 3NALA 4R7GA 3NHWA 4UPVA 1QRSA 1JALA 2QN6A 4LY0A 2IC5A 3EMVA 5HG0A 2BTQB 2WWGA 4UULA 3OD1A 2QTZA 4JVMA 1M76A 3UKOA 3CW2A 1XHEA 3GGSA 4F2PA 1F4PA 4F4UA 1FK8A 3CNNA 1J1UA 3CVOA 4PC2A 4H17A 4M1OA 4JBWA 4EMSA 5KYTA 5CB6A 2ZVPX 4Y1RB 3FTDA 4HGQA 1E3MA 4AUEA 2NZXA 5JSZB 3OA0A 1OBFO 3KETA 1GTVA 1KMNA 3ZWYA 4OUKX 2GWHA 4DQUA 1E9BA 1L7QA 2E82A 1QLJA 2QPOA 2XWBF 3W04A 3ZQJA 2M6LA 3TSWA 1NVAA 3FTCA 3NVMB 4LSMA 1FU4A 5ECYA 3C3XA 4JVNA 1E1DA 4FONA 1RMTA 2POCA 1E1QA 5IABA 1MAHA 1YQWA 2M6KA 2F00A 2CC2A 5HXAA 1HFWA 1WHSB 2Y76A 3SFZA 1IY8A 1WTAA 4NPCA 5CP8A 1AU9A 1YCGA 3WLNA 4C7OA 1KHTA 3DV0A 3RC8A 5AVOA 3ABIA 4C9BA 3DOIA 4QX6A 1Z2EA 1KVQA 2ZTSA 3L93A 1EDBA 2PJDA 1X8KA 3PHHA 5KQSA 5G0SA 1I5OA 1SBTA 3ZXIA 5A4DA 2CV1A 2VHYA 3EFEA 3D8RA 4AJIA 4ZJYA 1LTHR 1IUPA 4IIJA 3DO8A 4OXYA 1HUQA 3TLJA 4MK4A 3RU2A 4YCCA 4AZSA 1B7GO 1MW9X 2AD5A 3I9KA 2Z1NA 2Z1DA 1X15A 4HTFB 4DR7B 1MG5A 4N82A 4C2AA 4B7XA 2YICA 5A6SB 3DEHA 3E4CA 1I5EA 2RC6A 1BW9A 1OBHA 1P0MA 1GGEA 2PZFA 1YONA 1SC1A 3BJIC 3FGOA 4MB2A 4BQOA 4URHA 1Q0RA 2D6FA 3CZ5A 1XTJA 4H9GA 3RFVA 3MAJA 2HJVA 4TMTA 4L16A 4A26A 3IEUA 4BNMA 5GINE 2HLPA 3UXHA 5JROA 1PJ4A 1BVHA 3K94A 2HY7A 2QX4A 3C4VA 3KJGA 4JJ4A 3BCHA 1FJ2A 5GONB 1XCOA 2YWRA 5K20A 3H99A 4RANA 2DFTA 3ID6C 3V1UA 4GPD1 2GJAA 3U7GA 2W71A 2R8OA 3SKYA 3M82A 3O75A 3AI7A 3NHKA 4ZAYA 3HEAA 1NAHA 1TEVA 5CB4A 1RHQA 4Q01A 3KB2A 3UUEA 2GMWA 2Y9MB 3GC6A 1ADBA 1C8KA 4E3ZA 3IE1A 2CNWA 1HLDA 2DUNA 3LX4A 4ZO8A 1T15A 1KZ6A 2KBFA 3FY4A 4EG0A 4S05A 3PZRA 2B94A 3KTOA 4RUKA 5E4FA 4C0AC 2H5EA 4F5DA 1A5ZA 2ZIEA 3NCHA 4NULA 1NVVQ 3ZHBA 1BGXT 3QY9A 4PYJA 3RJ9A 2GOYA 2EARA 3OJFA 5KOHB 4LRTB 2OAQ1 4MEAA 5D00A 2PS3A 1FQWA 4MJLA 4BUZA 5ERXA 5F9MA 1AQJA 4JKYA 1KO1A 2I1QA 3LKVA 1TCAA 2YINC 4YAKA 1IPHA 2ZDQA 3NEPX 3FBWA 4G84A 1GPUA 1T3LA 3HO6A 4ZQEA 3TG8A 1BMFA 1XRJA 2ZE6A 1CR4A 4HYYA 2GYYA 1JDUA 3BWEA 4NEGA 4V3CA 4DV4B 1EVJA 4QYXA 3NAGA 4Z7NB 5C1OA 4FGSA 4M8LA 3ESDA 4AKHA 3HJNA 1BQEA 1P0IA 3RC1A 1YV9A 3T3DA 3G3EA 3I73A 1M8FA 2P75A 3V6LA 4BTLA 2EYQA 4PNEA 1V2HE 4O29A 2VQDA 2W6IA 1E2FA 3IT3A 1GR1A 2Y1WA 4K0RA 3WGKA 1ANKA 3GJ3A 5IXSA 2V54A 1B6RA 1U65A 4R5MA 2JRCA 3U4QB 2YWXA 3V42A 1WPRA 1PJTA 3NKLA 3Q3EA 3UAXA 6LDHA 1UF9A 3PP8A 4BZWA 3LDGA 3R5XA 4GWLA 3VTAA 1G8HA 4CCWA 3LLVA 4UE3S 2XYHA 2FRDC 2I03A 1K4YA 2WSBA 3C2QA 1D2EA 1E9EA 1UBUS 1IIRA 1ZESA 2A92A 1HC7A 1CJSA 4KFUA 2RAPA 4PO3X 4ZZ2A 1QO7A 4D9BA 4FYKA 1AO3A 1XQ9A 4AROA 2GZMA 1XZCA 3PC3A 4BZXA 4EA8A 3OLQA 3AVWA 2E5FA 2XVYA 4AP9A 4JI5B 5E8RA 1PL7A 5K8UA 4EX6A 1KK0A 2EIHA 1FFBA 1JIKA 1X92A 1C7JA 1I8TA 1MB4A 3UIEA 3PWTA 3ER9A 4YVFA 3WGHA 2FSUA 4MVWA 3CX8A 4DDHA 2C83A 3BB3A 3RSSA 2IV7A 4LMRA 4HVLA 3HXPA 3PEEA 1TMOA 4KO2S 3WFJA 1G21B 4D5GA 2X1HA 4V0OA 1HSOA 1UKVY 2PLRA 3DJYA 1A4IA 3MFQA 4L6CA 3I2YX 3V34A 2JNWA 1MPTA 1MJNA 4Y6LA 1XK7A 1EHCA 2C9DA 1TW3A 5G0TA 1Z47A 1Z2AA 1BX1A 1YH3A 1XMSA 2XAAA 4MCHA 1KWKA 3E9EA 3DE1X 1V1RA 2RHWA 5TMPA 4FTWA 3R9KA 4LTNA 3SHOA 4BL5A 4MV8A 1DQNA 3HEMA 4RVFA 5DLEA 5JVDF 2V45A 1G2PA 1T8SA 3GCWA 4XVHA 4CT5A 4REQA 3CNLA 2VJKA 5C18A 3BILA 4H7KA 4OXIA 1T6YA 3CKLA 5ALFA 5B1YA 1SQ5A 2GBFA 1MJGM 2PWAA 1WCIA 3C3AA 1OLXB 3EBLA 4TMYA 4LE2A 3I52A 3WNVA 4TSFD 5CXXA 3CG0A 3TMAA 2ZJ1A 4XGIA 5KYYA 2YFQA 3ESYA 1P39A 3QKRA 1VL6A 2QVBA 5DN9A 4UTRA 1XU9A 2PK3A 2ZIXB 1XN1A 2QVCA 3LL4A 4LRUA 1W29A 4O1MA 4CDGA 2AQIA 2DWOA 2PJUA 3MUFA 5EHGA 4UEKA 5JYBA 5D7NA 4MWCA 1EK2A 4GX5A 4C21A 1G0NA 1RXSA 4K6HA 5CT8A 2V74B 4ENSA 4U63A 4GOND 1ZD2P 2ZIAA 1DWUA 1E6EA 1JLRA 2AR7A 2J5RA 3GGGA 3MYYA 3SBDA 1T0UA 4MWZA 1L1QA 3FE2A 4ZYWA 2WWXA 3HJUA 2GVNA 3EC2A 3DB1A 3MIZA 3R5JA 1CJUC 1GFIA 2MSCB 2OLKA 3UHFA 1UWLA 3ZDYB 3C41J 4DDVA 2IQ5A 1SCQA 2LWIA 2HMVA 4UZSA 2O8BB 1NBWB 3OJEA 3OZTA 4Z9AA 5JAUA 2PKXA 3EA5A 3F67A 5IDXA 4DV7B 1ORRA 1EE1A 5HS6A 2Q1UA 1FFWA 4EFKA 4MH0R 3A3PA 3IB6A 2ZRCA 3N8IA 4S0XA 1L6IA 3MERA 3DONA 1QGYA 1XAIA 2KPOA 1HURA 2Q7DA 3PTZA 1U1GA 3NEJA 4NK5A 2D3WA 4O2BB 3O4GA 1JSXA 1SHLA 3FZGA 4HWRA 1KMQA 2QRHA 1QOPB 3LXMA 5AXAA 1BEUB 4E1BA 3WICA 3EGEA 4MVXA 3SAJA 3AUTA 3CR3C 3VSCA 4ZT6A 4EJ6A 1OYVA 2ADMA 5G40A 1DCFA 5H9WA 1QG6A 2ABWA 3EFBA 4D8TA 2J3JA 3D5QA 4WL0A 1PSZA 4QG3A 5TS3A 2DUMA 4H7PA 4KKVA 2AC2A 3L1KA 1VE5A 4HGNA 2A0KA 1U1EA 4QASA 3ZCXA 3Q8LA 3DE4X 1ZR4A 1FP7A 1SD5A 1RAHA 1Y4ZA 1JEQA 1DBIA 2P27A 3ZIUA 3PHLA 1YQQA 3CUKA 1J2YA 1DQZA 1KJIA 2F4NA 2H92A 1M72A 3ITKA 1Y9ZA 1W25A 5BN1A 3PE3A 1N2EA 1WEKA 2EX4A 4NAHA 4TTIA 1YNSA 1PHRA 3D8HA 1A96A 2W8ZA 3G2IA 2P1RA 2QX9A 4IHAA 4XA8A 2ZREA 4IIUA 4QUEA 5CYFA 2FAXA 1XALA 1PFUA 4FK8A 3SK0A 2AMYA 2QGZA 2HIMA 2SHKA 4B0PA 5E7QA 3GAMA 3QQPA 4C6RA 3MB5A 4IG4A 5JVDA 1LB1B 1P6UA 3TZHA 4YX9A 1WVIA 1NRWA 3NONA 3QXSA 1QB8A 4HP8A 1K98A 3ML1A 4OKIA 2YIMA 4J0CA 2D59A 3QY0A 4Y6QA 3HB4X 3WO1A 4B6JA 2A9RA 3T1OA 2WJWA 2YJ5A 3KJQA 2RGRA 1B0ZA 2Y0BA 1JX6A 4DLLA 3K9LA 2OQRA 1D04A 3CXRA 4MGHA 4YMSA 2GTIA 3KWMA 2O1EA 2Y1FA 4BKMA 3MFYA 4NFSA 2JLQA 1YACA 2W4MA 2X4LA 1I10A 1Q14A 4RNCA 4S24A 4U9UA 5ULLA 5JAMA 4XM2A 2TS1A 3CUEF 3UV3A 2V97A 4BJ3A 2PUBA 2GCOB 2FZVA 3Q6NA 1JWAB 3GFSA 4U9IS 4D3DA 2W58A 1T4BA 4IEIA 2YMQA 2EF1A 2H2HA 2DWCA 2PLFA 1NKSA 1EJ2A 5AKLA 1B93A 2XB8A 3ZW8A 1JQ5A 3RS0A 5IP5A 1KL7A 3L8MA 1Q22A 4IIFA 4A91A 4Q7EA 1OXBB 1U8XX 4U39A 1CE8B 3MJHA 5EJIA 2ACEA 1DFIA 4DLWA 5F2OA 3UXYA 4LOAA 3U44A 2X0IA 4J1TC 3VC7A 3KCQA 4FN5A 1S9DA 4PZDA 4YO7A 1IHUA 3UJHA 1U3DA 3BEDA 5KOIA 1AX9A 3NDBB 4A0RA 3UHJA 2ONJA 3ZK9A 3HCBA 3CLUD 3ROZA 1W36B 4XJVA 4B2YA 1K97A 4RA9A 3T7EA 4NP6A 3ZJ5A 2FY8A 1IZZA 4MV5A 3QUCA 1JBEA 5I7HA 2B99A 2GAJA 3IKVA 4IH9A 5EC8A 2PFKA 3K0CC 4BNJA 5IAKA 2HN9A 1AJEA 3ENZA 3OWXA 2F62A 3BIXA 4FFPA 4M37A 2OC9A 5D7BA 2JFYA 2H7XA 3FPEA 5K3FB 1QVAA 4K1XA 3P27A 1QYWA 3KRTA 3JAKB 3G0CA 4NU5A 4ZVSA 3RSLA 5KJFA 1WPGA 2VUSA 2YXNA 4TTSA 1D0VA 5NLLA 4FJ0A 2VPWA 5FAKA 1KH3A 3SR0A 5JYEA 4FHCA 1KK1A 4IZHA 1AXGA 4DUGA 4YDSA 3R7FA 2XQIA 4KBGA 2JH9A 3HN2A 1XCLA 2PZGA 1QJCA 3L7KA 4W6QA 2QTHA 1WUYA 5HJ7A 4N8EA 4OP3A 3SX2A 1V71A 4K6OA 3TIIA 4GZ5A 3KZ1E 5GGXA 4B6RA 3NHFA 4LUCA 4I5DA 3E1KA 4B17A 5BNIA 6YASA 2C2GA 2VPYA 3GK3A 2CXRA 3NWEA 4M0MA 3B7WA 4C0LA 4IVNA 3SC2A 2J87A 1G5QA 4MGZR 4Z54A 4TN1A 1MGOA 2A3NA 4XWGA 3CS3A 9LDTA 5L3QB 2VTBB 1YMQA 1TT7A 3OOSA 2VF7A 7REQA 4UHEA 3W6PA 1W48A 1WB9A 3O3MB 1UAGA 4GPZA 1GUZA 4X20A 3HZHA 4FR5A 3GVCA 2JVJA 5EJ4A 5HHTA 3GRAA 1FS5A 4QBKA 2I4OA 2GZHA 2A9FA 4QAJA 1U2SA 1XRRA 5DHFA 3SQNA 4WBXC 1F4VA 3R9XA 4GE0A 4WLFA 1ZD4A 4G63A 4KXXA 1ST3A 3M49A 2XKBA 4H77A 2O5RA 1IBKB 2QG6A 5JEEA 1JIVA 1QF7A 4HDKA 4UBMA 3H3XA 3RJTA 1KYXA 3KLBA 4MQMA 3U80A 3FRHA 2J32A 3CINA 3H8JA 1B3BA 2TYSB 2P2GA 4KPGA 3L7DA 1QIKA 3D1VA 4GYJA 3VAAA 3R7WA 3LY8A 1N2OA 4C2TA 3SBOA 1EZ4A 1L7NA 2ZYHA 3AVYA 4RVSA 4KDCA 2E48A 3WB0A 1XGKA 4O4JF 4X65B 3INTA 1XCJA 4L07A 4Z4FA 3H5AA 5JO0A 1OKKD 3H11B 4QDXA 1WY7A 4WI1A 3LS2A 2B5WA 3U4MA 3DKVA 2ZT8A 1Z3CA 2JJ1D 2IHJA 2I2DA 3LY5A 1TEZA 2C31A 1POWA 3RFFA 1AKWA 4B4OA 2BZ1A 2PX3A 1GPNA 3IB3A 1SHKA 4E3WA 3DLIA 1NULA 1E9VA 1Z26A 1I0LA 2FKAA 4F93B 5G4KB 4UMFA 4AP5A 4EKNB 4X90A 5E6SA 2OZEA 4WEQA 1F17A 4QBIA 1XZPA 1K27A 1X2BA 3PQ7A 5L8VA 2QT0A 5EZQA 4R9RA 1GKLA 3CVVA 3S99A 2GZ3A 5IAGA 1KOLA 2ZZNA 4L28A 4MR8A 1Z7WA 3WLOA 4JI3B 4H1WA 2ZSIA 2YWBA 3D7RA 2PL3A 4YBZA 1QTNA 1XXHB 3OQVA 4N5NA 4GNKA 4NJEA 1XPRA 2ATCA 1RXYA 2VJLA 3UOWA 1EDZA 2I2FA 1RHJA 2NUAA 5DLDA 3T7KA 5CBPA 3GZJA 1JZQA 4GOXA 1L5NA 3W6ZA 1K5DA 2GCPA 2G5PA 2XOXA 4CM4A 3O4FA 4FDLA 1XMOB 3F6RA 3IR7A 1KYTA 4NYJR 1UPAA 1KDPA 4R0VA 2WABA 1AGYA 1C1DA 4ZOLF 4DRXB 3RWBA 4JMPA 4UM7A 4D80A 4EUFA 1GNPA 2CLFB 3TX2A 2RHOA 2I9PA 2MSDB 4L4XA 2DFKB 4G9BA 2XNDD 2X2PA 3OZXA 1P62B 1G7SA 2M1ZA 4MOWA 4RD0A 5KNBH 4A16A 3H9EO 1BJKA 2WF6A 1W4BA 4L1KA 1KF0A 2W93A 2QUZA 3C8UA 4X1YA 3SC3A 1P19A 1EUDA 2EWWA 2TSYB 3JSAA 1E79D 2H2GA 4I8DA 1T91A 4ND8A 3SI7A 2ZRJA 3KVYA 3L4EA 1HDEA 2BT4A 5DBFA 5JY6A 1ZOPA 1VBNA 3GLKA 1VE9A 1USGA 5JDIA 1K8XB 1FXUA 2LE0A 3JQFC 3PCXA 1BNCA 2X7XA 5GOZA 5ELXA 3MGCA 3QVSA 1Y8QB 3OZIA 3GT7A 4M46A 1YE8A 1JSRA 3T61A 1I6WA 2BOVA 4WDQA 4BO0A 1FDIA 4HOYA 1QIJA 3GY0A 4JWKA 5K9ZA 3AG5A 5MF6A 10MHA 1SG9A 2WD7A 2QYHA 3GQBA 1RRMA 2WA1A 4L4YA 2PLNA 1TIPA 3JWEA 4D9CA 4NOMA 1ZHOA 5G0UA 1JQEA 3A7DA 2ZTUA 1YZUA 1LF5A 2PXAA 1M1NB 5IJAA 7AT1A 1N6IA 1Z6YA 2ZLBA 2OQVA 3C15C 1YJQA 4PFKA 1UOQA 3DDOA 3TL3A 5L6MB 1IY9A 3O2JA 2ZANA 3G8DA 1M33A 2PGAA 4UNSA 5AH0A 4C3OB 3KXDA 4PCLA 2NQTA 1RNLA 2HLNA 2VVTA 3OIGA 1IVNA 4EI7A 1XRNA 2IYRA 3KJEA 3SZRA 1Z6PA 1E7SA 2Q9BA 4AD8A 3UN1A 3HUEA 4KVAA 2IBTA 1C7IA 2FRDA 2O8VA 4MVJA 4K9OA 4CMBA 2BKXA 4CMIB 5HCNA 3KSAC 3RADC 1SXQA 1GSIA 5LYJB 1EFVB 1E2KA 1KY4A 2OHHA 2O9JA 4A4DA 3K0CA 3TRIA 4I08A 4G4SP 5DLQC 3TS1A 1YDHA 3DP7A 3HQ4O 3WLEA 3KPJA 2QKYA 5JISA 2AS0A 4FCCA 1LPBB 2OHXA 3EYWA 4K9PA 4UUBA 5AKJA 5TMBA 1VPTA 2WNIA 5JFOA 3DSRA 2BFPA 3FSEA 3GLUA 3S29A 1KI8A 2OAEA 4ZVRA 3OQOA 1TC1A 1E6LA 4UTPA 1Y6QA 4TQGA 4HVTA 3N9IA 3FUUA 4F9GA 1KEEB 3W06A 3L0YA 1XAJA 3GU3A 5FB3A 3ECAA 4C4PA 2I91A 2OBBA 4DJJA 1E7YA 4HAIA 1FFYA 1U0LA 1YJ5A 1JU3A 3PTLA 2ZB8A 2P6OA 1GZHB 1K7CA 4R84A 3A2NA 3LW8A 5AW6A 1FFGA 4LC9A 3K2QA 3ZHRA 4BC0A 1SG0A 4IRMA 2FA9A 2ODWA 3AR4A 2CLIB 2J7PA 3L8FA 3QKSB 1M6VA 4UASA 3W2FA 4BFVA 4IINA 1T2FA 2ZJBA 4MW5A 3P9ZA 3J81A 3C16C 3PYXA 2ZS8A 2V6FA 3ZVRA 4YRKA 1RRCA 3H6HA 2YUTA 1ABEA 2VDWA 3LNCA 3WHKA 4D43A 1ZAYA 1FB5A 4ZU1X 1BMQA 1ZCBA 4RS3A 4UUAA 5EZYB 1H2RS 3UW3A 3GD5A 4PYQA 3MTJA 1C8LA 5DM1A 2J9ZB 1BU5A 4MWGA 4FFOA 4ZT3A 3CF6R 4MUAA 5DX8A 1ZLXA 4FMCF 2MMCA 2PAFA 1SRQA 1QHHA 1U8YA 3AHJA 4GZLA 4W8GA 3GJ7A 3TLMA 3UWSA 3MAGA 5D6NA 1FX0B 5JJ5A 2W5UA 3M8KA 1N2HA 2AFHE 2XIJA 3K70B 1PTJC 1LEHA 1JDSA 3C7CB 3GJQA 3HHEA 2R8RA 3MJEA 4EYOA 4HC4A 1S3SA 4JUAA 5C52B 2FKNA 1HDCA 3KZCA 2C98A 3R75A 1KP9A 2PL1A 1C29B 1OILA 2K4MA 4HJXA 1ZICA 2NXNA 2HSZA 1AKYA 1F5NA 2FPGA 3JPYA 2ZXEA 4LE0A 4NBKA 5B3AA 1TZKA 3DHEA 3RV3A 3O4JA 2AC4A 2D4HA 3OH8A 3N2YA 5EGSA 3FYCA 2NM0A 4EY6A 1F51E 2D1YA 2GJ9A 3NHAA 4ZO7A 5E1OA 1TCBA 2AMFA 3QKRB 4KVGA 4ZI5A 3K16A 5AXCA 1L8QA 5I3CA 4Y0NA 4ZZ3A 2LUOA 3HJRA 4PQRA 3SG0A 3D2AA 3I45A 1NF8A 1H23A 4RDXA 2RHRA 1SUWA 3NBYC 1AK1A 3VKGA 1EQAA 2DY0A 4HRVA 3GGPA 1L1FA 2YTZA 4FFLA 1IMOA 4XJXA 4MIKA 1CERA 3FR8A 4KZKA 3T94A 2GN4A 2WQ7A 3IUEA 3LC1O 4ZVTA 1ZH0A 2OCBA 3O8DA 4CW7A 2OLEA 3OM1A 1UOEA 1WSDA 2DECA 1T5BA 4MAFA 4KLNA 5H70A 2CNKA 2WPDD 4S2EA 3OFND 4K9SA 3HWX1 1RPAA 1QDLB 1ADCA 3H2ZA 4O4HB 5CLGA 4CKCA 1P2TA 4J0DA 1JQKA 4UAGA 4BAGA 3OJWA 4FFDA 3IGFA 2YFYA 1TTPB 4OK3A 1SA0A 2R2GA 2BZSA 3FI0A 2F8LA 3V4FA 1JDBC 3I37X 4Q7JB 3N7AA 5AI9A 1I94B 1Z2DA 8GPBA 1Y1QA 3DDNA 2XH8A 1CS4C 1TL7C 4DA6A 1ZVQA 2ZR7A 4AULA 2N42A 3BHNA 5A4JA 5A3RA 4C7KA 1Q0TA 4QXAA 2R97A 3EIQA 5LWHA 2IODA 1A9QA 1Z74A 4LXIA 2IUYA 4Q3OA 4AQDA 2WJJA 2X0DA 2ZTMA 4R68A 4AJHA 2PRZA 3PC8A 3MXOA 4G4IA 2Z2KA 4HB0A 4WK0B 1OB2A 3LRXA 1ZXXA 2CGEA 4HRXA 2WFZA 1JEYA 4K2HA 5I4CA 5CNJA 4HLDA 2OAGA 5K4AA 1DMSA 5FUWA 3OF3A 3NHRA 5CH3A 2PXHA 2OXIA 4QTYA 2QN9A 1G6OA 4CBVA 1E60A 3SHQA 1CWUA 1TZMA 3DXXA 4NHOA 1JF8A 4BX0A 1WP9A 3WBJA 3ROGA 1P0QA 1KI2A 2B4AA 4GGPA 4ER0A 1IUNA 3ZI0A 4CIAA 4YY3B 3ZV6A 3EQ9A 2P2DA 3PGA1 1YCDA 4ITRC 5FHRA 4NE2A 1XVTA 1A27A 2FZLA 2GK4A 2H51A 2VG8A 2X3UA 1ML3A 3AR6A 5CTJA 4D6PA 1XZLA 2N9UA 1AHNA 1IFXA 4NEQA 1R0LA 2X14A 4PYOA 1ZNZA 2DBZA 4Y2RA 2XX3A 5B2EA 2I55A 4LIPD 3A1NA 3VOAA 2NZJA 2HPVA 2HA2A 2I3DA 3I34X 1I7LA 1NF2A 4JUFA 3EJWA 4QO7A 1CR2A 1C0EA 3BDVA 1AE1A 1RI3A 1TYAE 3EXG2 3G5LA 4TXLA 3RYHB 3GJ0A 3WWYA 4M83A 1PKEA 5DGDA 3TGLA 4PONA 3PZBA 3O8CA 4X66B 4OJTA 1JQJC 2EL7A 3B9BA 1T4CB 5A9RA 4EKIA 4NMWA 5LZ9A 3S81A 2ZUFA 2W6CX 1V8ZA 4EOGA 4JJ8A 2O2XA 1AKUA 2ROQA 2E4VA 2FMKA 421PA 3KJIA 3CKMA 5BYBA 5IEJA 2FW8A 2R8EA 1D2CA 2H31A 3NM4A 4M8NE 1FU8A 4NCNA 4KQGA 3BXGA 1EUZA 1JJVA 4YUWA 1U2TA 5DXAA 1SH7A 1GL3A 1U7DA 3EIOA 3I3OA 3GVHA 4TLEA 1M5TA 5CNIA 1TGVA 4G1UC 4O25A 4RY2A 3MJ4A 5FHQA 1JG3A 3WB2A 5IFKA 1VSTA 4Y2SA 4L22A 1STOA 1M7GA 2W2XA 1TT5A 2C95A 4QIHA 5JZVA 4JV5B 4LX0A 3VAYA 3IXLA 5J4YA 3QMPA 4KXLA 3AHFA 3VNVA 2ZBPA 1UBJS 1BN7A 4J4BA 1NV8A 5I4IA 3TF5A 3RHFA 2G1KA 4H60A 1NIJA 2P1DA 4MWBA 4Q4CA 2IHYA 3ZHUA 5FWYA 1HO3A 1WVMA 2OK8A 5JAHA 3IXMA 2W6ZA 4X93A 3FPHA 3ZEAA 4NNOA 2G9UA 3ZJYA 4EFDA 1ONNA 4LTMA 4IP0A 3SU8A 2FPIB 5CRIA 2FX2A 3ROMA 3S2IA 2Z6AA 3HBLA 2B9EA 4NJOA 1CUYA 4A0GA 3DGFC 1BE8A 4FE7A 3DFUA 3EZNA 3JD3A 4MQFB 3V97A 2NV2B 5JAPA 4JLSA 1U5BB 3NOVA 5I9LA 5E9WA 3L7BA 3PD0A 2XGMA 1OFUA 3WP1B 1BFUA 3LPCA 4MPPA 2JA1A 1FNDA 5ADUS 4FUQA 1H4VB 4OHBA 4C06A 4CIVA 1FXWA 2NOAA 3BZWA 3FCEA 3HN7A 1T25A 1SG6A 2BF7A 3ME5A 5EIFA 2Z8YA 3WG9A 1HNXB 1HTTA 3E3NA 5EE3A 1QAQA 1XTUA 2QLMA 3DMRA 4IH1A 4EGJA 2DP4E 1VGVA 1PW5A 1PQ4A 2OLJA 3MBKA 2VOJA 3OE1A 4GP7A 5P21A 3V8VA 3C3DA 5FUQA 3IBFA 5CLHA 5AOVA 2JZCA 4G25A 1TX4B 2H52A 1BAPA 2B1QA 2DCUA 1W1IA 3B1XA 2Q3MA 5LOVA 2ALJA 3OIYA 4KYTA 2AFIE 1GWNA 4Y67A 4F1JA 3E5MA 5BT8A 3LQFA 4MCIA 4LRYA 5FTJA 4GKAA 2JGEA 1CJKC 5GM2A 3DT6A 1TAQA 2ZYGA 2EW1A 1PTJA 2VJMA 3PHJA 4KXMA 3A9SA 1QBKC 4OB6A 3GP8A 1E6KA 3ZW7A 2B9VA 2BVNA 3ND5A 4XVUA 3G59A 4G5FA 4C4AA 1JR2A 1X42A 1J70A 2JFVA 2Q0XA 1P1KA 1N6PA 5TVGA 1BX0A 1Z75A 1G5HA 2OP0A 4OG2A 4QGBA 3EGXB 2OXEA 2PEYA 3GJZA 4ZJPA 3AW8A 1F8GA 3QSGA 4QOHA 2YNMD 1H3FA 1B8OA 4GL4A 3KQPA 5EP1A 2SKEA 2QTMA 2OC4A 4UMVA 4RSRA 1J8YF 1PEDA 4TQ9A 1WE2A 4FM9A 4JYCA 4LPKA 2C9YA 4RTQA 3SVLA 1TCVA 4QTUB 4NU6A 3JASB 4JX9A 3TZLA 4DJEC 1IN1A 2B2NA 5KTNA 3NUZA 2H4HA 3NBMA 1E64A 2HU2A 3I6MA 3R5TA 1FJGB 4AZVA 1V8PA 2LVBA 1Q0HA 2XWSA 3BWVA 3PLRA 1YE3A 2DYKA 2J30A 4UU0A 2HNKA 3UWPA 2Q4EA 1FVOA 4GOOD 2CNOA 1J8VA 4HRAA 9LDBA 1GUFA 4ARBA 1Y6JA 3LLUA 2QTNA 1JAYA 4XPIB 5HIJA 3WKCA 3S8YA 3GLGB 1F1BA 3FFBA 1YRYE 3ZE7A 3QLUC 1NR1A 4M0KA 4C6TA 1G42A 4QC2A 2R6DA 5JNLA 3L40A 3DM9B 4XCQA 4EVSA 3KXKA 2XT0A 4ER5A 2AV6A 5AKEA 2ZGVA 1VPEA 4WACA 3UZUA 2WE7A 1N78A 2WMNB 4PS1A 4QDJA 1LSJA 2JJ2D 4MXDA 1Y7HA 5DZSA 1N2CA 1YB6A 2JAPA 3BIWA 4TT3A 1V4BA 5EUQB 1Y5MA 2Y1DA 3BMOA 1LC3A 3AOEC 4GRAA 4PCVA 4QYTA 5C1IA 5A5VA 1UPTA 1NJGA 2XUIA 4HLUA 3KSMA 1OT3A 3HA3A 5T4HA 4KFRA 2NO7A 1KVRA 1H6BA 1U31A 2Q3FA 1IHOA 1WW2A 2HDNB 3CEJA 3G8AA 1OTYA 1YFKA 4MNTA 1E5TA 2B98A 2VS1A 2QJOA 5DOZA 3I6BA 5IKXA 2WTMA 1E3WB 3WGIA 5C4IA 4FYHA 4IEEA 4TYWA 2CMHA 2C4MA 4PQFA 5DIZA 3RYFA 5KINB 4OAQA 1K5PA 4I46A 2RBKA 4ZQFA 1V0JA 2PR7A 4GLFA 3K1TA 4P33A 4Z0HO 1TMKA 1U5CA 1SJ9A 1X7XB 2WKQA 1N8NA 4CF4A 4DY6A 3GT3A 3G89A 4AS3A 1D03A 1M2OB 3Q3HA 4YRRA 2CUNA 2L69A 3RK4A 1GGMA 3LCUA 3WGOA 2TMDA 3NBXX 3V80A 1EFHA 1PQWA 1T5SA 3OFNA 3R0XA 3NXKA 4EKYA 3P9YA 3O47A 3KIPA 5IW8A 3EPPA 4F2HA 1XHFA 4UUQA 1P31A 4MINA 5LA6A 1S8FA 4W1PA 5JLJA 3IMCA 4E5PA 1FP4B 2WUGA 1KFJB 4OXRA 4F72A 1IWOA 1KSFX 5A5EA 1VPWA 2VP0A 3AFNA 3HDJA 3A06A 1C3XA 4PZAA 3JW8A 3PDWA 1KGDA 3FB4A 3IHLA 4IJ5A 4C20A 2GD6A 1GNQA 3QIAA 4IGKA 2BMWA 4K6FA 4EFNA 4NQRA 1ULTA 4LE1A 1G1AA 1S5PA 2NW6A 4RGYA 3AJRA 2QS9A 3IEIA 4JNCA 1U8CB 3QK7A 3JQ7B 3GFGA 4G8BA 5TEVA 2WT4A 1NF9A 3OFVA 2PM8A 4HF7A 2BEJA 4NMMA 4P5EA 3DMTA 1SU7A 3TD9A 3P9QA 4PU0A 1T1JA 2P35A 2OYRA 5DTQA 1T9GR 5JAZA 4DKXA 4DSTA 4TT3D 4X97A 4OHVA 4KR6A 4I1RA 3ZWKA 2LW7A 4J94A 3KU1A 1KIFA 2Q5OA 1XEWX 3PFNA 2EGUA 3MHPA 1E5XA 1SURA 5LKRA 4U5XA 3L92A 1Y0BA 3FLAA 2C4TA 2Q6VA 2KS6A 2ZPAA 4P5DA 4UUOA 3KXPA 4C0JA 2QROA 2X9LA 3IILA 3OHPA 4HN4B 1PWZA 1ADFA 1KARA 3NO4A 4E30A 3H1GA 3LBHA 1PLLA 1SC4A 2WLSA 4J1SA 4Y2XA 5G4LA 2VTKA 3DE6X 3AM5A 3W8DA 2HM7A 1LA2A 1NX9A 3LCRA 3A8TA 5DGCA 2CFRA 3BFPA 1GN8A 1SQSA 2C2XA 4QDKA 5C37A 2FMFA 2KI5A 1PSWA 3M5CA 3PWKA 4XW2A 5DSXA 4A9AA 2NSHA 1JYEA 1WM1A 2IQIA 3VDRA 2WHQA 1CRZA 3LVQE 5JDCA 1Z18A 4KDFA 2HA4A 2FPKA 3U4CA 3OQIB 5JT1A 3OCZA 5F9HA 2B1RA 4GXRA 1T36B 1Z5OA 4P9NA 1E9DA 5MFPA 3U4GA 2WTUA 1RJ9A 3BS4A 4UDNA 4MRMA 2JI9A 2VF2A 2XQVA 3TLGA 4Z0PA 3I9NA 1NW9B 4UXJA 4JASB 1XZHA 3KEMA 4RH1A 3CLSD 5CDFA 4HV4A 2VHVA 1XCBA 4OKSA 2NP6A 3PNVA 1XDDA 1UWCA 4Y6SA 1EMDA 2ODEA 3AHEA 2CL5A 2R6FA 2EQBA 5FR1A 4QULA 2HCBA 4OKNA 1TKBA 2NZ8A 1G8MA 3N53A 1Z4IA 4W8HA 4MKHA 1K6EA 1RYHA 2Q5JA 1G8KA 2DHCA 4W1SA 2BFNA 4OMFG 5E95A 3LPDA 4N9WA 4RVUA 1RFGE 1I9CA 2JARA 3OJCA 2G17A 3X1WA 2IYUA 1OYOA 4OEHA 2CZCA 3AF6A 4KKXB 2NU7B 2RK4A 1J5XA 1ZVMA 3FX2A 3MRSA 3UV7A 3VO8A 5GTDA 3LRTA 1WXIA 1U8UA 2X3YA 1BJTA 3B5JA 3DPSA 4P4UA 1UPFA 4RLQA 4ALMA 3EVTA 5BW5A 1JBQA 1N92A 2G71A 2O0HA 4IOLA 3T12A 1U8ZA 3HI6A 4PO8A 3AR9A 1CY1A 2G3YA 4AG3A 4JVSB 1RZUA 3DEFA 2HGSA 4F85A 4UPEA 5I7VA 2C4KA 4BNKA 1FFAA 2G77B 3C8HA 1GNVA 2EAUA 3G2OA 3GPCA 4WLNA 1RWWA 4YT4A 1E2NA 2C5GA 3WL5A 1G291 3CPSA 2C5AA 2H1FA 3LUGA 4NIMA 3GELA 2F9MA 1X1RA 4ISCA 5ALJA 1TRHA 1EXDA 3ANLA 1NVGA 1NSTA 2R8BA 1DXHA 3GUUA 1J6UA 3HSYA 3PX3A 4GX0A 4TGLA 3C74A 4CL0A 5FJIA 3SZLA 2HHAA 1JLLB 1N8TA 1JTFA 4RPCA 4ZIRB 3AF1A 4ENPA 1MGPA 2JJ1A 2VSQA 4KQIA 2FE4A 3MUNA 1P1IA 1CFZA 4BLSA 5KSZA 5IK2D 3SQXA 1DOAA 3HJHA 1RE0A 3V8NA 3DKIA 3BH0A 2XMRA 3K31A 1SD1A 2CB9A 4IOJA 3N6VA 1X1TA 4GI7A 4IXDA 4YAJA 2QW0X 5EJ2A 4KLRA 2VR1A 1XJ0A 1WV1A 1I24A 2BJWA 1NJ8A 1HGXA 2WZCA 3PXDA 4FDVA 5FTWA 3ZKWA 1R4AA 3W2HA 2WMDA 3RLIA 1BDIA 4K8OA 2HHCA 4YLYA 3R9IA 1Q1GA 4ZZIA 3CRQA 1R8JA 2QD2A 2NU7A 2YHUA 4G9EA 3M6FA 1F0NA 2JHAA 3ND7A 1VE3A 1VPDA 3KYIB 4KQ6A 3RGWS 5GJWC 4L3OA 1D1QA 5E2BA 1TGYA 1QKJA 3V3KA 1KXZA 2W2KB 3PE4A 4D4KA 1FZTA 4E4RA 1YOBA 3BXZA 4PTZA 1WAMA 2OGUA 1ZC3A 3D2LA 3TDKA 4N48A 1AQYA 1Y5IA 3M9WA 3KFLA 4L9AA 2R4TA 3K5HA 4LHVA 3SICE 4QHTA 1FIUA 2FMTA 3LHIA 4HGYA 1KK2A 2HWYA 3D8BA 3PTAA 4BVBA 3OVMA 2IXFA 5HQJA 5KTPA 5BR8B 1CUHA 4XSHA 4ZCLA 3OX3A 3T3MB 4F8JA 2CHUA 2JDIA 1WZUA 3TMYA 3LIPA 4EAAA 1IE3A 2Z98A 5DGIA 1ECPA 1JILA 2YVAA 2C2HA 4LI0A 1MR3F 5L4SA 4NATA 4BXOA 3OLZA 2PGLA 2L2QA 1BCRA 2BONA 5FA6A 3EVFA 3RYCA 1J20A 1M2EA 2A86A 1L0BA 1KH1A 1HZJA 1GTL1 1Z68A 4C78A 3DHYA 4GG1A 2I65A 4I4TA 6GPBA 2I2XB 3C1UA 2SKCA 2FPMA 4RA6B 5LPNA 3IESA 4JQZA 4AUNA 3HGMA 3L4BC 4P6VF 1KRWA 2NZUG 2VJDA 1JKIA 1H1LB 2DBRA 3HFRA 2QWXA 4RESA 5AW9A 3CSUA 2JBAA 3H2HA 1W36C 2ZAOA 4JI0B 2OBLA 1ZUWA 2HTEA 1DB3A 2XMGA 3ETNA 2JI4A 3L6UA 4CUKA 1KPIA 2AMJA 1CK4A 4CLRB 3FPLA 2I71A 1P4SA 1PS9A 4MV0A 5J3JA 4RL6A 4TWAA 5A0FA 3NTVA 1SZJG 4A1FA 4DCTA 2WHPA 3H86A 4HYQA 3C6ZA 4F71A 5DNWA 2Z2JA 3CX4A 2HF2A 1T5TA 4HDCA 3RSFA 1JT2A 4GKVA 4UQPA 3CVJA 1S8NA 3PCTA 5JH7B 2QENA 4LA4A 1M6VB 4J1NA 2F67A 5P8WA 1G17A 1Y8RB 2FUEA 2R6ZA 3C5CA 3CCFA 1NMQA 4JXJA 4XVRA 4PO1A 5DJ5A 1DC4A 2P0YA 4B3XA 5FX2A 2GEDA 1J23A 3V4SA 2F8MA 5LLSA 2I8CA 4B7CA 4C3ZA 3CN7A 4ND3A 1P4GA 4F46A 1E94E 1VHLA 3EAFA 3OE7D 4EVIA 5CDSA 4ISBA 2OYSA 1KZ4A 4FGKA 3N75A 2HO5A 3SSNA 3L5KA 1V26A 1ZCFA 1AMNA 1AV7A 2FPLA 4CMGA 3GDGA 1UK9A 1TMGE 3JQPA 1XMQB 4BU0A 4LSZA 1E6UA 1VFPA 2DC1A 3CMMA 4EIWA 3C3YA 1EM6A 1O1YA 5AVKA 1N2GA 3VMFA 5CB4F 3OJLA 1I4TD 2C3UA 3DHVA 2WEKA 1ZJJA 2ZSDA 3THSA 3GPIA 1J56A 3O4HA 4BMYA 1T4CA 3F96A 4PGHA 1GFZA 2PUTA 4Y2QA 5L6LB 3BXFA 4B6EA 2ZM6B 3FLBA 3CEMA 3WDSA 1WU8A 1OREA 2C82A 1TK9A 4KWTA 3UEOA 5KU7A 1P4RA 2AHOA 4LYHA 5IAEA 2X9VA 2G4CA 2RHLA 5KWVA 5FYDA 1SN7A 1RWXA 4IIBA 1U0OC 2I80A 3VZDA 4HAZA 5CYPA 4Y98A 1Q15A 1QK5A 3EEYA 2WJGA 5FLKA 3H87A 3RASA 1GPBA 5BRNA 4BCBA 2Q99A 4E1VA 3RQIA 3QPVA 4B76A 1TVKB 4JENA 4JS0A 1TAGA 5BWMA 2XADA 3ICPA 1G6HA 2HHLA 4DPLA 3KKPA 1XZQA 1PO7A 3QLJA 3GQBB 1QKIA 2ZIFA 5E4YA 5F5LA 3OIDA 2C5SA 4EKGA 4BNTA 2QT1A 1CUXA 1LBHA 1L5GB 4R8VA 3IVRA 2XMPA 5DYTA 3QVLA 3EPRA 3R76A 1CIJA 2HAEA 3RBAA 4ERNA 1THTA 3O7MA 4ZFNA 5KYXB 1XDSA 3M89A 1LDBA 3T15A 4G0NA 4Y2YA 1A8UA 1GR0A 1GTSA 1B42A 1EZZA 1T8TA 4JJIA 4WKNA 4DVJA 5C1PA 3U19A 2AVNA 1QLHA 1J2EA 2ZU0C 1H1DA 1M75A 4RZHA 5DHAA 3I9FA 3BSSA 4NFYA 4UHFA 3BGDA 4OHXA 4RXMA 3VC3A 4BNYA 1Z17A 2JIZD 4OIFA 1A2KC 1WMSA 1X8LA 3ZZUA 3ZHOA 1I3KA 3HKEB 3VR0A 5AVZA 4M87A 1C0IA 2J7PD 2P5YA 3B3GA 3UXMA 1T34A 3GFPA 4OGFA 4UBNA 4IDBA 1HBJA 2X5XA 5AVQA 1KJWA 4YR9A 2QV0A 1A0OA 5CK4A 2QB5A 2I0FA 3HFJA 5BSKA 2B5OA 3ZHTA 4TRMA 2ZXUA 1AD2A 5HPYB 4N39A 2VL7A 4HXYA 3C7KA 3C6QA 3ONFA 2JFBA 2XBLA 4KE8A 5T41A 4BV3A 3CUUA 1ACMA 4O2AF 2QJFA 1X94A 4M1YA 1OIXA 4KLCA 4WADA 3UICA 5AJTA 2IXDA 2DX7A 3HP4A 1JG2A 3OOEA 4QVIA 1WRBA 4F4IA 2QM7A 5JMTA 3THXB 3EGOA 1XKQA 3RI3A 2B6HA 3QFTA 4LF7B 3IUPA 2WTXA 3GRZA 2W4QA 4Z9XA 5NULA 1EUCA 3VR6H 5DTIA 3ABOB 4X3OA 1VL8A 3NYWA 5THXA 3I8XA 2CL0X 2COUA 2ASVA 3VM6A 3KS9A 2FWMX 1PR2A 2O57A 3Q0TA 5BN4B 3HNOA 1BW9B 2X8WA 3LQQA 3ZQKA 4HMPA 4EY7A 1JFTA 4LDAA 3AHGA 4R1LA 4NS1A 4UREA 1N0UA 1A8PA 4F9TA 2V7TA 2ZXFA 2QYTA 4BV8A 1O5TA 1I1NA 1V1JA 3ZE8A 5FLEX 4F60A 5INTA 2DLDA 2BP7B 5H68A 3ZCPA 1ABBA 1IN7A 4J76A 4TLDA 2BDTA 5B36A 5GONF 4MQEA 3P9IA 5FV7A 4EA6A 4FNGA 3SEAA 4OI1A 3FYUB 4C0WA 1QXSA 4RMHA 4CKEA 1IQPA 2JBAB 3OICA 3SSAA 1DVRA 1JAHA 1JG7A 1RHKA 4YAFA 1ZJ6A 3RIGA 3ABRB 2WF8A 2QRUA 5BRAA 5LQJA 2NO0A 3V55A 1PSDA 4NV0A 4KDRA 2E7ZA 1L5QA 1MNQA 3I9V1 4ASUA 3G2LA 3O1HB 4H7EA 4KQEA 5AW3A 4P81A 1GCGA 1JJIA 1NMXA 3R0IA 3PITA 1UEIA 3H2SA 3NW9A 2FDRA 2X4DA 5ALKA 5BV2P 5F2NA 1R1DA 2XQGA 4ZCRA 5CNMA 1RQXA 2WJIA 4OHPA 4B8YA 1RZ3A 3DUFB 1BCSA 1Z37A 5ALSA 1UBMS 4JYAB 1RIFA 1XZIA 2H11A 2COKA 1GKYA 2ID9A 3BGIA 4RZ3A 1CSEE 3BREA 4LJAA 3BHIA 4NYIQ 2A0XA 1H8ED 2CKDA 3OZGA 1S2GA 3L3BA 2HV9A 3E82A 4TYYA 1U6KA 3H13A 3HUFA 3AB7A 3LRPA 4QFMA 5FEUA 1E0KA 3U7HB 1SZPA 1NWHA 1SCAA 1N4DA 3VR6D 1GRNA 3SDBA 3WDMA 2P2SA 1DKUA 2XF2A 1RRKA 1Z29A 4ZVQA 1AB6A 121PA 4TS9A 1MFZA 5A9TA 1VSVA 2C29D 2HREA 4YMLA 1WEHA 3C7AA 3JQBC 1X0VA 1K7YA 5HCUA 1R18A 1LZKA 3JD1A 3L6RA 4GM4A 1RYZA 2M6SA 3FMFA 5ILGA 1AHPA 2A1UB 3AR3A 1L9XA 1YT5A 4JWTA 3GRVA 5EVCA 1YB7A 2C0QA 4TL6A 3TW4A 3DWEX 1B2LA 1YBMA 2NSJA 3DL4A 2B3DA 4GPEA 3VPSA 4MP6A 2HH9A 1XUOA 3ENQA 3FTNA 3HSSA 1D6MA 2F7SA 3I64A 3S1AA 2MSLA 3U31A 4R1NA 1P0PA 4NCKA 4INOA 3IKJA 3IPAA 2ATEA 3GLTA 3UGTA 1N3BA 2FN4A 3CKYA 2GHTA 1UKCA 1JSCA 3CRVA 5JHGB 3KUUA 4ICIA 1H8EA 5BR4A 5MGNA 3ZCTA 2VQSA 1C7EA 2CJWB 5CFOA 2O2EA 3HU5A 5M7EA 4B8ZA 2ZRMA 1MVNA 1T5LA 3NEAA 3RUIA 1BWPA 1QZUA 4JI7B 4JBIA 3A4YA 4WKPA 3EH1A 2Q07A 4AKEA 2H07A 2D1TA 1GFWA 3OLYA 1RACA 2F1IA 1BMFD 2WFLB 3P5BA 3UC9A 5KWSA 1GZ7A 2H06A 4KR0A 1YQGA 4XDHA 3LZ6A 4HWTA 2ORWA 1D1PA 3IBCA 3L7MA 5EG5A 2AUNA 2ZBGA 1HE5A 4RA9B 1BS9A 3F6EX 1T3ZA 4XQCA 3TTSA 3HRKA 1ZOOA 4AMUA 3P0IA 2GEBA 3AHIA 3VTFA 1MV8A 1ZLYA 2NO5A 2OV2A 1FEZA 4LWQA 1JG1A 3SPXA 4KC0A 3GXOA 2DSNA 1V37A 3U44B 3P52A 4LI3X 1V47A 1E2EA 5HX7A 1J33A 2GYWA 2XVMA 1WF6A 3GUHA 2HNAA 3DQPA 4XGQA 3T9CA 1TYDE 5GY7A 1EUDB 4Z4CA 3ETEA 4KX5A 4WBNA 3GOHA 4XLZA 1V9CA 1SXPA 1U3FA 1EVEA 2A5LA 2HFJA 4PPNA 5TXGA 4V0QA 1Z62A 3PDCA 3SVZA 4NHEA 1I3MA 1Z2NX 4L8LA 2GCOA 4CR8A 4ACBA 4OJYA 4BP9A 2WWIA 1L8OA 3EAQA 3EBPA 1GPWB 4RD1A 3YASA 1CUCA 1SIUA 3R2JA 2BBWA 3R77A 3RG2A 1LK7A 4DLPA 2IUFA 3BTOA 4GP6A 4PICA 3SJBA 1FLDA 2ZRGA 2VCHA 1Z13A 4ILEA 4HSEA 1I01A 3CNBA 1P45A 1QRUA 4K0KB 1L1EA 1XAHA 2H4WA 1R6TA 2YBEA 2OFFA 2P78A 2QUJA 3R20A 4YUAA 3PHIA 3UK2A 4PIMA 3RUEA 2WE8A 5C5IA 3S7ZA 3GPBA 3Q6MA 1PZMA 4UM9D 3RC2A 4ATNA 2XHZA 4K86A 4QM7A 4F9EA 5E1BA 1U8FO 2VJQA 3ZWMA 1I30A 1Q21A 2XMQA 4G4SO 4GOJA 4LKRA 4J7CA 4RTRA 5J23A 3Q3JB 1PBNA 5TJ9A 4D74A 5U1PA 4YMUA 1CJTC 3L7JA 3K9NA 1U3TA 3DAPA 3D4OA 2FP4A 3GYGA 3MELA 2BMJA 3L7OA 4E2ZA 1QE0A 2QXYA 1LLFA 2YQZA 3FYHA 4F5EA 4QEZA 2QMHA 5EJ6A 1C3OA 3M3DA 1T1IA 3FWKA 4O08A 1AUPA 4ME6A 3QTLA 5LXTB 3T5AA 1F20A 4ZYZA 5F3WB 2WILA 3GDFA 1E1QD 1F2VA 1CR6A 4M0LA 5FWYB 3RIMA 4DQKA 3ZVMA 5EPEA 5DCUA 2DZDA 1RC0A 4X3CA 3SBXA 5B7QA 3HBFA 2HNBA 5H3HA 4I6GA 2EHJA 1CC1S 3L4KA 2O23A 2YNMC 5KNCH 3NR2A 1GG9A 3HL0A 2GFHA 2VK8A 5BWLA 2UVQA 2GK6A 4YK7A 1B4DA 3X2SA 1Z4LA 1A4UA 1NDUA 1TPZA 2XGGA 5EPOA 4BMXA 1FRFS 1XF1A 5LYYA 2C4VA 4BB0A 4BBJA 3UAYA 2FZGA 1RJDA 3G82C 3EW9A 4FE4A 2G28A 4FILA 3T0GA 4R1UA 1EKXA 5H0IA 1AN0A 4JUIA 3KR2A 4OQZA 3MEQA 4KB5A 4ENWA 2NZVG 2BTOA 1O87A 4OSEA 1X7YA 2FF5A 1BX3A 3S2ZA 1J90A 2M32A 4QPPA 2UKDA 3X1MA 3BH6A 3IVCA 3EXEB 4X20B 1DCMA 1AUXA 3E03A 4U2FA 1RC8A 4CQMD 2YW9A 1G18A 1RWOA 4TPKA 5H83A 5HFNA 5H9VA 3VPGA 4P38A 4MP8A 3FCAA 4BECA 1GQFA 2ZRLA 1IWBB 1DKRA 2ZB7A 4C0BA 1FRVA 2Z4SA 3AESB 4ZDIA 1KS9A 4RPHA 5AM0A 4JLVA 3VDMA 4CM9D 1GKUB 3TVDA 4F86A 4YI5A 5JSZA 5A7HA 5KSYA 1J0CA 1OX5A 2X8AA 1JPNA 4HYEA 4EG6A 5HQ3A 1EK5A 1QONA 1K3UB 1O9BA 4P7FA 3VGPA 2J9GA 1BIFA 2Y1CA 5A3JA 3GA0A 4ZGWA 1GTJ1 3ZCRA 2FPIA 3TDMA 3AFOA 2YJ3A 1F4LA 1VE7A 3DNFA 2FGKA 4M0UA 1FQJA 3D0RA 4IUCS 2A9QA 1E32A 4UOEA 3IRUA 1ZJ4A 4DGSA 1ACJA 2C84A 1SXIA 4B3IA 2JGFA 4Q12A 2CNDA 2FPUA 3FZEA 3QUAA 2X76A 3VU9A 1VLMA 4OH1A 2YMMA 1FNSA 1G8YA 1SZCA 2QTFA 3QXHA 1FUYB 3VU3A 3AI3A 4NESA 5CDUA 1DRJA 3LCJA 3A4LA 5FD8A 1B1AA 5BSTA 3U48A 5KC8A 4X7MA 2QGNA 2A9JA 1SVKA 1FMTA 4TSRA 3WISA 2CKMA 1KC3A 2P62A 5GV8A 2XMBA 3H04A 4TZKA 1I3CA 5AJXA 5HZGA 4ZVUA 3ZWWA 4U00A 5JJKA 2XT6A 5FOWA 2JW5A 4MVJM 2QRPA 3HY6A 3IEPA 3VNRA 4QOSA 2X6QA 3OJOA 2QEQA 4MJ3A 1Z4NA 1S3FA 2FZKA 4QRIA 5GV7A 1HX7A 4B4UA 4OGWA 4LJYA 4KPUB 5IWCA 3PRHA 2XMCA 2K5UA 3L79A 1PJSA 3STWA 1Y3BE 5IJ0B 4F5YA 4N12A 1IY2A 3CE6A 3EWAA 1ECCA 2YYZA 1W8IA 2OCGA 1A72A 3DTVA 4FE3A 4RVDA 4YJGB 3N59A 2KLHA 1WZEA 1A98A 2WD9A 3TBFA 3DC7A 4BRWA 5B6JA 3R9WA 2O5EA 2XB6A 1EVKA 1N6HA 5KQRA 4NICA 5AXBA 4EHAA 1CY4A 4ZEVA 4OXNA 1W581 1A2BA 4GX2A 1KU0A 3E23A 4P80A 4ANFA 5KYUB 1MDBA 2LV8A 3H18A 3I28A 4WFIA 3W7AA 1Z88A 3IBGA 4WN9B 3WLTA 3VFDA 4RZQA 4EJSA 3H5IA 4AN1A 2AZXA 3QLEA 5ARBA 1WQ1R 4XGNA 1L4FA 1CY7A 2GASA 2PSDA 3IVAA 1JDZA 1QHYA 4QGAA 2EF0A 2PZJA 3L8HA 4L2IB 2NVUA 4X8LA 1EFAA 2YRXA 1ND6A 1KDZA 4D9MA 4F9FA 4O4IF 4YRLA 3OU6A 5DRTA 3O31A 5DTRA 1KO7A 3HB1A 4X1KA 1GSAA 5CH8A 3AYZB 3T1NA 4BB6A 1UL1X 5K6AA 1NOKA 1ZYUA 4IDOA 4Q16A 1XP5A 1DTSA 2C2MA 2C9BA 3T7IA 4IEFB 2QN1A 1YZKA 2FZ5A 4TUYA 3ZY6A 2PA3A 4O4IB 3C3PA 2SCUB 4BQNA 4GXQA 4KMRA 1Y3CE 2GCEA 5EHQA 1QSGA 3OEWA 1B00A 3DMTC 2NTEA 4BZPA 4C03A 3HCWA 2QMYA 2NYRA 3VHXB 1MJ5A 2XNHA 1PUIA 3UG7A 2ZVQX 5F2EA 3ZOZA 2I67A 5DVZA 1FP6A 3V9AA 1A8HA 3OF2A 5JZBA 4ZYUA 1X9IA 1GVHA 4QLOA 2J0UA 2XAUA 4TWIA 4HATA 4DG9A 5JQGB 4RORA 3UQZA 4MVCA 3WWZA 3EGDB 1Z9BA 4X7RA 1UPUA 3E7WA 5C80A 4ZOCA 4B3MB 3OMWA 2AOTA 1EFTA 1YVDA 2C88A 1ZA2A 5BWOA 3ZDXB 4J1TA 2GAOA 4GXNA 4LY6A 5AM4A 4EA9A 5CJJA 4U8HA 4L7VA 1IUOA 5JQGF 4Q93A 5LBUA 1T2VA 5ENDA 2XJ9A 4YUXA 5B64A 1Y3AA 2PUHA 1IZ0A 2DULA 1PT8A 2I6XA 2IYAA 3FGNA 4PGFA 4UOQA 1Q92A 3SYNA 4UM9B 4R6WA 3GD7A 4H1UA 4G23A 5G1OA 2BGMA 2I2CA 1T13A 1G55A 2K6GA 3I32A 5G3YA 1WMDA 2DTXA 3RHTA 2J3DA 4O02B 3UWDA 3PXUA 2D7DA 3H4VA 3DCNA 3DE5X 4G5XA 2WSSA 5IN5A 2ZFUA 2ZWIA 4MGEA 2IXAA 5EP4A 1P1HA 1V3VA 2QLNA 3FB1A 1LJUA 1PGJA 5JBQA 1EXNA 4X1IB 1PFVA 4CLDA 4XSGA 1P1JA 4TWZA 1YJAA 5A1JA 2QNIA 4OX9Y 4WTOA 3GLQA 4FX5A 3A3OA 2JFQA 4JP8A 4B1FA 1OBCA 1B41A 2ACVA 2ANCA 3ISTA 4PWYA 2ZIZA 1K8ZB 1M73E 4UJ3A 1WULS 2IHZA 1YRBA 4X85A 2Q45A 3BDIA 1TK2A 4OREX 4Z53A 1T8RA 2AG5A 4MYRA 3VXKA 4DVGA 3RYCB 1RXEA 3BKWA 4L74A 2P6UA 4U6QA 4LRQA 2P9FA 1Z4PX 2QRGA 3OX4A 1D4AA 4TXJA 5DU2A 3FYUC