2H3OA

Structure of merft, a membrane protein with two trans-membrane helices
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
44
structure length
44
Chain Sequence
LVILLGVVGLSALTGYLDYVLLPALAIFIGLTIYAIQRKRQADA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MerF
publication title Structure Determination of a Membrane Protein with Two Trans-membrane Helices in Aligned Phospholipid Bicelles by Solid-State NMR Spectroscopy.
pubmed doi rcsb
source organism Morganella morganii
molecule tags Membrane protein
total genus 11
structure length 44
sequence length 44
ec nomenclature
pdb deposition date 2006-05-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11431 Transport_MerF Membrane transport protein MerF
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.910 Mainly Alpha Orthogonal Bundle Helix Hairpins bacterial mercury transporter, merf 2h3oA00
1WAZA 2LJ2A 2H3OA
chains in the Genus database with same CATH superfamily
5HFLA 2HHHO 2DWEC 2YUAA 3H01A 1KD1W 4JYYA 2HHHB 1PL4A 1WP8A 4FJCC 3NR7A 3I55V 1XQ8A 1S3JA 2QE7G 3BAAA 2UUAO 3STLC 1K9MW 3HKBB 5EYPA 5KA5A 2UUAB 5IWAO 3C90A 3M7MX 4FLZA 2ZNIA 5IWAB 4WFFA 3FYEB 4DR3B 4CH6A 1W0KG 3T2MA 1VQ6V 1FPOA 3K0GA 3I5DA 3B4SA 4OXSA 2CK3G 2UXBO 2UXCO 4ICGA 3ZX6A 3RYCB 2UXBB 2UXCB 3SYOA 5KUMA 2GHYA 2HG5C 2YXLA 4C7UA 4KFMA 3OE7G 4DV5O 2WLKA 3RYHB 4TSFG 4DV5B 5IJ0B 3N2KB 4DO2A 3JAKB 4DV7B 3VQWA 3FAVA 1BHBA 1MNGA 4NVPA 1E79G 3HPLC 3CE2A 1WAZA 2WWWA 5LXTB 2RNBA 1SA0B 2ZDIA 4GX0A 4J42A 4TV9A 1W59A 2EILC 2IW5A 5B1OA 1QLNA 5IJ9A 1Y4MA 4Q20A 1JX9A 3K9SA 4FFBA 1GMGA 2IJJA 5JQGA 1JMKC 3K5LA 1VF5B 5JWPA 5JVDA 4FIPC 4X89A 4JZ2A 2QDOA 2V1DA 4JI0O 1NS1A 3Q4HA 2EINB 2ODMA 4FLVA 4JI0B 1SESA 1TAEA 2Q7GA 4RQFA 3OT7A 1HNZO 1LUWA 1K73W 3AEIA 3P30A 4OX9B 1Y76A 2OCCB 1YZBA 3CCQV 1YIJV 3ASNC 4JI7O 2WLIB 3W7SA 2Q0OC 1IDSA 2ZXWB 3JSNA 1Q7YW 4JI7B 1TUEB 1MSDA 2ITCC 5L3BA 1PNMA 3EXAA 3H9VA 5CA0B 2BOCC 3WG7B 2BTQB 3OGCC 3L9DA 5BY1A 3CCEV 2R9IA 2LFRA 4PI0A 3SYCA 1N4CA 3RN4A 1K4CC 4EKWA 3P3NA 1EBOA 4LH6A 1WB7A 4LNUA 4PA6A 2WA3A 3E8GA 4MVMA 1Y66A 1ZX3A 5B3SC 3K5NA 3OUFA 3SPIA 1NTMH 1R3JC 2HJFC 1OCZB 1K8AW 5DEDA 2YI8A 3B77A 3E35A 4OGQB 1QBZA 4RQEA 5C93A 4FLWA 4IL6Z 2DJVA 2ZM6O 1K7DA 3OGIB 3W7XA 2ZM6B 2Q69A 1M9NA 2FB5A 3RYIA 2VWKA 3ICXA 1H2MA 1SZTA 2VWJA 4O2BB 4YXWG 1RM1C 2ZINA 1JFFA 2X6CA 3CCRV 4I50B 1H2LA 1Y6XA 5KHIA 4I5SA 4MVZA 3OD4A 3T4ZA 1K34A 2ZQMA 3PN1A 3WFVA 4FK5C 1AR1B 2QM7A 1GN2A 1N32O 1OZ0A 4KXRA 3ML0A 4TUYB 4CS2A 3APOA 1N32B 3ZMSA 2CE4A 3HR0A 4E4EA 4JV5O 2UXXA 2X6AA 4JV5B 2QWOB 4WFGA 3RT3C 4DV2O 4UCOA 3ZN0A 3CJHB 3CSXA 1FXKB 1YEWA 4DV2B 2Q0AA 2OYQA 3LSSA 2EIJB 3EVKA 4K3AA 1XMQO 4MVUA 1AVMA 4I4TB 2N05A 4FMTA 1L0LH 1QQCA 3AG7A 3ETQA 2WLNA 4UV9A 3K57A 2LGQA 3K04A 4DR5O 3MHSC 3CRQA 1SC5B 4H37A 1Z2GA 4IIJB 1I94O 4DR5B 3NXSA 2A0LA 4TQDA 5EIBD 1I94B 3K08A 2CTQA 2QKCA 3J81N 4X1IA 4YIOA 1K5QA 1YDXA 1URFA 2HVKC 5IYZB 1BQZA 3B8MA 2IJHA 1WA8B 1KU9A 4X1YA 3VOUA 3K79A 2E5LO 4LFCO 1N34O 3S3XA 2E5LB 1R6NA 4LFCB 2YEVA 3R65A 2QWPB 3E86A 1N34B 3AG3C 5JJNB 2ARHA 2F95B 1FD9A 3E8HA 4A5UB 1BE3H 4NYKA 5K1XA 1K4DC 1ZWIC 1P84F 5FPRA 3HKEA 2EJRA 3RFRA 2R70A 5IY5B 2B9ZA 2VQEO 3G4SV 3ZRVA 4TV8B 4NXMB 4DR7B 4LR3A 1EZVH 2L6LA 4JYCA 2YIAA 4GKKO 5LGNA 1BGYH 1I5XA 1SQXH 4QPJA 2DYRB 2JK5C 2OWOA 3STZC 3ZMZA 3CCLV 4LH7A 2Q68A 5FNVB 3N2GB 3J7AU 3PJSK 3H1LH 2WLLB 2P90A 4TT3G 2HEPA 1EN5A 1OCOC 4F4LA 1FJGO 2CGOA 1KMIZ 5LOVA 2ZKOA 4O4HB 1TVKA 2JGDB 3KKYA 4YHHO 2BSKB 4ZOLB 1SERA 4FM2A 4YHHB 3D36C 4BIUA 3RYFB 3TCUA 3L70H 1SQQH 1I0HA 2ADPA 2HJDA 1KQSU 1PNLA 3ZRSA 3O9OA 4LF6O 1CXZB 5LA6A 2R9AA 5LGTA 4LF6B 3JD1A 1S5HC 1VQ4V 2X6BA 1KKCA 1VARA 4DUZO 2WPDG 2GUZB 3TGUH 1G1XB 2F4VB 3QO7A 4O2AB 4PA9A 1N0NA 1PNKA 4QE9A 1XUQA 2Q5ZA 2HLDG 5KAIZ 5B66Z 1B3QA 2Q8VA 4BW5A 1H2SB 2DOSA 4JGSA 2GTSA 3M99B 3L75H 4DR1O 3DC6A 4QIWF 1GO3F 4DR6B 5LL6Y 4DR1B 3K9AA 1AI5A 2KSDA 4NR1A 3FKSG 2CTWA 2A9HA 3TK1A 4LWSB 3UT5A 2Z5UA 1M57B 3ZS8C 4U7OA 2X0LA 2QEXV 4LFAO 4MVRA 4GLXA 1P7GA 4LFAB 5ITZA 4B3SO 4W4KA 1EFRG 3TXQA 4B3SB 4GZRB 1ZSPA 4IHJA 5B1AB 5BMVA 2E3CA 3ZMTA 4I55A 1OCCB 4EB6A 3U10A 1EM1A 3CCSV 2H3OA 3IC7A 5CA1B 2XAJA 1Q81W 2IJKA 5CA3A 2HP8A 1JJ2U 3H1IH 2CTPA 5J2UB 4P2ZA 3FYIB 4X8AA 3E89A 1OHHG 4O4LA 2Y69B 4N21A 1TUBB 4JI5B 1MZEA 1QHTA 3BHPA 1PL0A 2LFSA 3FB5C 1ZTEA 4JAAA 4YJ3A 3L72H 3K03A 2AZ0A 3ZHRA 4F6RB 2KQXA 2QKAA 3E8BA 4WFBV 4LFBB 2PY5A 1IXMA 4WBNA 3K5MA 1WP7A 2GDSA 4GUNA 4QGPA 4U7NA 1GM9A 4CH3A 2CGNA 1BMFG 4WFAV 4MW8A 2Z3YA 5LHIA 1YVWA 4Z1VA 2VRZA 3DSQA 3CWBH 2AHYA 3SJAC 4DV3O 1NR7A 4DR2O 4DV3B 4DR2B 2QJ1A 4MVSA 1Q90D 4JYBA 4J9YB 1THZA 2AZ2A 1BHAA 1KB9F 4CZZA 4KUMA 2JS5A 1G8MA 1MZFA 4DYLA 4CC5A 1VP7A 3DXRA 1GAXA 3EHBB 5JH7B 3ABKB 5H2FZ 4X20A 4J9ZB 5KAFZ 4YIPA 1J5EO 2IH1C 2IU3A 1EZJA 1MG1A 1LNQA 1N33B 2H94A 3OMIB 3OTFA 4HNAB 1DLBA 1IBKB 1WLEA 1MABG 3SPGA 5H9CA 5IYBO 4I0XB 3RW0A 2LJ2A 1NTZH 2PI4A 4IYHA 2PYLA 1VQ7V 1ZL8B 1CPYA 3JAWB 1RPRA 5B1BC 2AXTZ 3TETA 2OIEA 2NNUA 5FLXN 3I56V 4DR3O 3K0DA 1NZ6A 2D3OW 4ZI7B 4CBCA 2HR3A 3MD0A 4H44B 1V9PA 2HVJC 1COWG 4UCVA 3JAKA 5D5QA 1X4TA 3H1JH 1MMMA 4Z1MG 5EZYA 4XDLA 1F4NA 1ZAUA 2LW1A 2EIMB 2XT9A 3LDDA 5LMUO 4DV7O 5AG2A 2KKWA 2B5UA 5EYPB 2DYSB 1AJNA 5LMUB 4LC1A 3VQXA 5C8YA 5LP6C 4FM1A 4JI2O 3QF7A 4BIOA 1L0NH 4D6TH 5IE9A 1LUVA 4JI2B 4PV1B 5LP6A 2Q9LA 3RGBA 2DE0X 3CRMA 2D2CB 3BPZA 5J2TA 5KLVH 4L8JA 1ZLZA 4W4LA 4J11A 1GH6A 4UV8A 4UCSA 4X9QA 4UXNA 3A0BZ 3SR2C 4MS2A 5B1NA 4DV6O 1H8HG 1JOYA 4DV6B 3JD0A 3FAVB 1IBLO 3ZHQA 3FFQA 1FAFA 1XNQB 1IBLB 4GCZA 4DUYO 3WG7C 2YIDA 4LF5B 4JF3A 1BSMA 4DUYB 4OX9O 1HDJA 3KCXA 5EBMC 1NI8A 4TV9B 1H38A 4K35A 5IJ9B 1RPOA 4X62O 3C3TA 4JI6B 2EILB 1YTFB 1E1RG 2QTOA 4R50A 4X62B 1XL6A 3B40A 4UCRA 1F7YA 4FFBB 1SS3A 5JQGB 4FFKA 2JGUA 5JVDB 4GT1A 1PKXA 2W6JG 1RSOA 2YIBA 3AG2C 5EK0A 3Q4HB 3KG2A 4ZHQA 2QM8A 1S0VA 1B6QA 1GM7A 4PDLA 1DGSA 3UM7A 4LCUC 4O4JA 4X66B 1S76D 4MTFA 2KB1A 1P49A 2NR5A 1Y76B 2N04A 1YTFD 1SQFA 1ROPA 3F5WC 4FLTA 2Q6AA 4WCEV 1EN6A 5B5EZ 3ASNB 3CRAA 3JAMN 2QSAA 4TOIA 3A0HZ 1V54C 1M56B 3MDSA 1IZ3A 1HWYA 1P7BA 3X2QC 5FPOA 2Q73A 1Z5WA 1OCRC 3JD2A 5TISZ 4I9QA 1SQBH 4DW1A 3RWRD 1T5EA 2PF4E 5BZBA 1IBMO 4LNUB 4PD4F 4UVAA 1FFXA 1IBMB 3AK3A 1M1KW 1FXKC 4PELA 2GV9A 2EIJC 4IYIA 1J95A 2OTLV 3CXHF 2Q67A 3AG1C 2R9RB 4DK0A 4DV1B 4LF8B 1DF5A 2XAGA 3OUSA 3SPHA 3TJTA 1O9GA 4ASUG 3BFRA 3CCUV 1EN4A 1H2KA 4UCUA 3RYIB 4GX2A 3L73H 2LQTA 3E22A 4B7EA 3ABLC 4J80A 2JEUA 3JCUZ 1JFFB 1PV0A 3KZIZ 4X64O 1RM1B 3IFXA 2EIKB 1R6TA 4X64B 2QWQB 2PI5A 3RBZA 3K06A 3UO2A 1XBLA 1Q3EA 5CN0A 1LR1A 1DK1A 3ZHSA 1FFTB 2WLHA 2IBZH 1GRJA 5BR8O 1I7FA 3M8AA 1K5SA 4FLYA 5BR8B 1NH2D 3CEIA 1SETA 2WAMA 2ADQB 1HW7A 1VQ5V 1V55C 1SKVA 1U97A 2NLJC 1W2BU 4N23A 1VQPV 3BVOA 5GONA 5A2QN 2F43G 1FYJA 3VQVA 3JALB 3ABUA 4B7KA 4JTDB 4B08A 2A06H 1R3KC 5KHJA 2ZE6A 2EX3A 1Z5VA 4X1IB 3OR7C 2PZSA 1HR0O 4NXMO 5KHKA 4DR7O 1PM9A 1UFIA 1HR0B 1KECA 3P3PA 4ZIBA 5LGUA 2UU9O 3JCZA 1JCHA 2PGGA 4X1YB 2LGWA 3WU2Z 3GWOA 3T1CA 4FLUA 2UU9B 1WNSA 1KYOF 5IYCO 2QA4V 2YEVB 5IT9N 3QO8A 2K1EA 1WJZA 4X88A 3IAYA 3QVNA 3ZMVA 3ABMC 3HKCB 2YS8A 4JI4O 3HKEB 3JATA 4JI4B 2CUGA 4FM0A 4P9PA 2CH7A 4EEQA 1M90W 5KA6A 5CB4A 1GTOA 4JI3O 3JARA 4LF7O 2XHBA 4H0LB 1P4RA 4JI3B 3W7TA 4LF7B 1FXVA 3D36A 2EULA 2Y48A 4K0KB 3IC9A 5IDJA 4LP8A 3ZN1A 2YXYA 4JTCB 4MTXA 1S5JA 4DRXA 4H13B 4JI8B 1XILA 2F4VO 3JSLA 3ASOC 3SPCA 5LOVB 1QR9A 4U3JA 4MSWC 1OCOB 1ZUQA 1TVKB 3F7VC 3ZRWA 3ZMUA 2ILMA 1AR4A 3SYAA 2P22C 1YJWV 5KMGA 5LHHA 4DR6O 1H2NA 1AI7A 1JA8A 2Q7HA 4DV4B 1AI4A 4AILC 2H8PC 2RJZA 4DR4O 3CXCU 5LA6B 3WB2A 4DR4B 2FKXA 5JJJB 1I08A 3JASA 3A8TA 3OMNB 3ZHUA 1HNWO 4OPHA 3H1KH 2W0FC 1HNWB 1NQTA 2RMKB 2WSSG 4PA3A 2CAZC 1VQMV 4FVMA 5LYJA 2UUBB 3IJ4A 3D8CA 2LP7A 2Y69C 3BEHA 3UKMA 1AJQA 1XHXA 1YITV 4K8XA 2VQFO 5GTHZ 3KCYA 4BAYA 4PHZA 4CH5A 1H8EG 2VQFB 1HP8A 5EC2C 2P5OA 2WLMA 5E79Z 5L3FA 5GW7A 1Y67A 3ZHVA 3UT5B 4LF4O 1AROP 1MSWD 4JI5O 4PDMA 1PPJH 3S3WA 4LF4B 4JI1O 5ITZB 1BQ0A 5J9PC 3W7WA 4JI1B 5DECA 1BT8A 2UXDO 4X1KA 4IHJB 5BMVB 2WLJA 2UXDB 3QNEA 5LHGA 4I55B 4EB6B 1Y74A 3CP1A 1R3IC 2YICA 4GYCB 5F2VO 3FX7A 3AK1A 4O4IA 2IJIA 4AHCA 4LFBO 4RO2A 4HZ3A 5CBHA 1R73A 2C2AA 4B3MO 1XL4A 5EBLC 5KX5A 1F23A 1YF2A 3HKDA 1XHZA 4LF9B 3APQA 4B3MB 2ZE8A 5H6RA 4O4LB 2YDEA 1G6UA 3K5OA 2PUSA 1S77D 2L35A 2ETNA 1KKDA 2DQ0A 3TXSA 3A0RA 4I7ZB 4YJ3B 1VMGA 5EC1C 3E83A 2XOKG 4YJ2A 3CCVV 2CTRA 2XNDG 4NKGB 5K1PA 1O9HA 1YSCA 4WBNB 3LSQA 4TWKA 5LBQA 4MW3A 5CBFA 4BW9A 1BL8A 2KG7A 2DW4A 4K8ZA 4BR6A 3BA9A 4MT8A 3MAQA 4JAVA 1AR5A 4F6EA 3OM3B 5JJEB 2W6IG 1N33O 1G4YB 1VQ8V 3J80N 1IBKO 1M4UA 2YC0A 3K3WA 1K97A 4GX5A 3HKBA 1M5IA 1JPXA 5FL7G 3SJCC 2F1MA 1YJNV 1AP6A 1N0JA 1XOUA 1VF6C 2IM9A 2ZR3A 1S72V 1VF6A 3BY6A 2DQ3A 3DXRB 2BOBC 1M93A 4X20B 3RYCA 4TQFA 2Q4PA 1QLEB 4FZ1A 3CMEV 2DYSC 1AI6A 1D5NA 3RYHA 3R66A 1XEQA 3U11A 3SDLA 5IJ0A 3N2KA 1SRYA 1KP3A 1GKFA 1NR1A 3AG4B 2EBOA 1S5LZ 1X59A 4FLXA 4RAIA 3ETDA 4PA7A 3G6EV 4QE7A 3K59A 4UB8Z 5LXTA 1SA0A 3FB7C 3OMAB 2OIGA 4PA4A 4FPPA 4PDVA 5B1BB 1Q5OA 2BCCH 2EZPA 1YI2V 3P32A 5CMUA 3BA8A 2F23A 5GTIZ 5L3DA 3CHXA 1B06A 4UB6Z 4EFEA 2O57A 1L1FA 3E2EA 4JASA 5D5PA 2EINC 1KP2A 1WPBA 1R1BA 2DN9A 4ABMA 3LNNA 3LNMB 2ZIMA 2W0XA 5EZYB 1VF7A 3GWKC 3ZEDA 2ZDIC 4ZBMA 3T1HO 2OCCC 2QR4A 4D7SA 3JD4A 1GN3A 3UCSC 1NTKH 5L3GA 3T1HB 3A2FA 4D7TA 1XNQO 5C8YB 1KUQA 2ZXWC 4EFBA 1I5YA 4LF5O 2XUMA 2WLIA 3LUTB 4J41A 5LP6B 2P67A 2MK3A 3F5TA 3N27A 2P6JA 5CA0A 5J2TB 2AGAA 2BTQA 2ZIOA 4JI6O 1VEWA 2GTAA 1F51A 3QO5A 1N8RW 3SJBC 4MTOA 1MA1A 2GBOA 1QVGU 3SYQA 2ZCEA 5CBGA 1PP9H 1ENVA 3F7YC 3E8FA 1JJOA 1HNZB 4QPKA 3L71H 1CEZA 3ETGA 4J7ZA 4J10A 2LO1A 1E1QG 2ZNJA 1Q6HA 2E74B 3SPJA 2QWRB 1JVMA 1WB8A 1OCZC 4P30A 4X66O 2RDCA 2P4KA 3D3IA 5JCOC 1FKAO 1M56C 3CB2A 3OAAG 3LDEA 1VIBA 2ZD9A 1VQKV 4JZGA 5JCOA 1TGOA 1US6A 1YJ9V 2M7WA 1SQGA 1RFYA 3MHHC 3IGAC 4CS4A 3FB8C 1PD3A 2B1GA 2PYJA 3QTCA 3EFFK 1IXBA 1JR9A 4KL1A 1RSOB 4RWUA 3OFNG 2BTOA 4O2BA 2JS3A 1SQVH 4ZHQB 4I50A 3AK2A 3AG2B 3U0ZA 3T1YO 1N36O 2XASA 1VQNV 2MW2B 3BCCH 2NN4A 4O4JB 2IH3C 3T1YB 2QTSA 4XBFA 1N36B 1BCCH 5EIBC 1XNRO 4TUYA 2ZE5A 4AQYO 4DV0O 2CDYA 3OR6C 1XNRB 2WA4A 2Z0AA 4AQYB 4DV0B 2F66C 3SJQC 2A3QA 3VQYA 3CJHA 5B3SB 2YIBD 1FXKA 2RCVA 4DV1O 3GB7C 4OPAA 1Q82W 4LF8O 4JPRA 1GN6A 4I4TA 1V54B 3DGEA 3CX5F 2EIKC 4G27B 4CC6A 5L3EA 3BRCA 4WFEA 3X2QB 2OTJV 3H1HH 1GK9A 1OCRB 4BWAA 3ETEA 1OV9A 4B3RO 4IIJA 1UPGA 2ATKC 4B3RB 1FFXB 1NH2B 2EZOA 2UUCO 4J7KA 2AHZA 4Q6GA 2UUCB 1GM8A 2ZE7A 2QWNB 3ZIAG 2JRIA 5KUKA 5IYZA 3HB3B 3CD6V 1F4MA 3K58A 4NTYA 1WA8A 1FS0G 1XMQB 3AG1B 2Y4UA 2YI9A 2OT5A 5H6QA 2XAQA 3B09A 2RQ6A 4PJ0Z 3E22B 5EBWC 3JALA 5IY5C 4P9OA 3ABLB 4JTAB 2XAHA 3W7UA 1Q43A 4TV8A 1Q6IA 3CMAV 2P7TC 2DYRC 2ITDC 5E1AC 3G67A 1VQOV 1AB3A 2V4DA 2P4VA 1Q8IA 2VS0A 5FNVA 3N2GA 3HKCA 4CH4A 2WLLA 4LBEC 1IURA 2R72A 1Q86W 4UUJC 1V55B 1A32A 4O4HA 4E2LA 2JGDA 3AG3B 5GONB 2N74A 2BSKA 2YXHA 4ZOLA 2VQEB 1NJIW 3UO3A 3DTUB 5BXZA 5A9GA 3CS5A 3RYFA 4MTGA 3RVYA 4GKKB 3UQ8A 5KHGA 1XREA 2OCHA 3JYCA 1U96A 1BZKA 2Q7EA 3JD3A 5IYDO 2JJ1G 4K0KO 3ZRXA 2HFEC 2GUZA 4KHPO 1NT2B 3C3SA 1IVSA 5DM6V 4O2AA 4KHPB 1FJGB 2PTMA 3BABA 4QJFB 4JYAO 1SZXA 1AJPA 4QNHB 1H2GA 4AI8A 4JI8O 4JYAB 3JATB 2V7QG 4X65O 4R7CA 3GVMA 4FZ0A 3ABMB 2ZT9B 4R6ZA 2JDIG 2Y0IA 4X65B 2JIZG 4DXWA 4HAMA 3CCJV 2CH7B 2B1IA 1YXBA 1XDCA 3LSUA 1K33A 5CB4B 2M6YA 1QVFU 1QU7A 4MVOA 1BS3A 3JARB 2FMLA 4DV4O 1GN4A 1M57C 4BIZA 4U3FH 4XDKA 4H33A 4YY3O 2E75B 2JJ2G 4LWSA 4R8CA 3CRRA 4HYOA 4YY3B 3QG5A 4DUZB 1K92A 1UJWB 1NVPB 4UVBA 2DMXA 3OTOO 3VBBA 4NB5A 4CS3A 2K9PA 5B1AC 1Q6UA 4GX1A 4DRXB 3OTOB 3T4DA 3G71V 3CPWU 2YSUB 1OCCC 4U3JB 1IX9A 4G2KA 1R6KA 3ZRWB 3ASOB 3RVZA 2UUBO 2F93B 3CYOA 3THOA 1NU1H 5CA1A 5KMGB 1K3EA 1R3LC 1SF9A 1NVPD 5J2UA 4UFZA 3SGIA 4NXNO 1D2DA 4NXNB 3CC4V 3G6BA 1TUBA 3JASB 1QCEA 3ABTA 2DWDC 4IGGA 4RUEA 1QNMA 1YCIA 2GSMB 4PI2A 4JAUA 4F6RA 3FB6C 1L8DA 3DC5A 5LYJB 2JEXA 1JQ0A 3LDCA 1ORQC 2FTKA 3CRCA 2P06A 2UXNA 1XMOO 3WB0A 1OJHA 1VQLV 1XMOB 4UCTA 4B3TO 4LF9O 1CP9A 2QKSA 3ZBHA 4B3TB 4G28B 4DW0A 2Y4TA 2QGNA 2XTAA 2IU0A 2A79B 1KBHA 4IT5A 1VQ9V 3D3QA 1TA8A 1WN7A 2HKOA 4Z2WA 1WPXA 4X1KB 1DTOA 4L87A 4XDJA 3O65A 4J7JA 1Y74B 3G80A 3ABKC 4O4IB 4RUFA 2BE3A 3OW2U 5KHHA 4DK1A 5JH7A 2X7RB 4MVQA 4HBNA 3L74H 5LMNO 2A7WA 5L3CA 5LMNB 3CC2V 5KX5B 3HKDB 2FL4A 5HFMA 5H5NA 4HNAA 1XI1A 3FD9A 4NTWA 4PDRA 2EJ7A 1SQPH 1NBMG 1YHQV 3SYPA 1AP5A 2Y0PA 4KP4A 4I0XA 2ZR2A 4UVCA 3CC7V 1B04A 3B2EE 3B8NA 1ZL8A 4GKJO 3JAWA 4NTXA 2XAFA 2QM4A 1KC8W 4GKJB 2RN9A 1NKDA 1QR8A 2AW9A 3ZJZA 1AILA 4YJ2B 3ZCCA 3OEHG 4I9WA 1QLEC 2LW7A 2G38A 4ZKIA 1FXHA 1MOFA 2JVDA 3WB1A 1DF4A 3ZHTA 4WF9V 3CCMV 4ZI7A 3OEEG 1W0JG 2KG7B 1J5EB 1RP3B 1HNXO 1D5AA 5DN6G 2FYUH 3AG4C 1HNXB 2E76B 2EIMC 4WFHA
chains in the Genus database with same CATH topology
1WAZA 2LJ2A 2H3OA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1WAZ A;  2LJ2 A;  2H3O A; 
#chains in the Genus database with same CATH topology
 5HFL A;  2HHH O;  2DWE C;  2YUA A;  3H01 A;  1KD1 W;  4JYY A;  2HHH B;  1PL4 A;  1WP8 A;  4FJC C;  3NR7 A;  3I55 V;  1XQ8 A;  1S3J A;  2QE7 G;  3BAA A;  2UUA O;  3STL C;  1K9M W;  3HKB B;  5EYP A;  5KA5 A;  2UUA B;  5IWA O;  3C90 A;  3M7M X;  4FLZ A;  2ZNI A;  5IWA B;  4WFF A;  3FYE B;  4DR3 B;  4CH6 A;  1W0K G;  3T2M A;  1VQ6 V;  1FPO A;  3K0G A;  3I5D A;  3B4S A;  4OXS A;  2CK3 G;  2UXB O;  2UXC O;  4ICG A;  3ZX6 A;  3RYC B;  2UXB B;  2UXC B;  3SYO A;  5KUM A;  2GHY A;  2HG5 C;  2YXL A;  4C7U A;  4KFM A;  3OE7 G;  4DV5 O;  2WLK A;  3RYH B;  4TSF G;  4DV5 B;  5IJ0 B;  3N2K B;  4DO2 A;  3JAK B;  4DV7 B;  3VQW A;  3FAV A;  1BHB A;  1MNG A;  4NVP A;  1E79 G;  3HPL C;  3CE2 A;  1WAZ A;  2WWW A;  5LXT B;  2RNB A;  1SA0 B;  2ZDI A;  4GX0 A;  4J42 A;  4TV9 A;  1W59 A;  2EIL C;  2IW5 A;  5B1O A;  1QLN A;  5IJ9 A;  1Y4M A;  4Q20 A;  1JX9 A;  3K9S A;  4FFB A;  1GMG A;  2IJJ A;  5JQG A;  1JMK C;  3K5L A;  1VF5 B;  5JWP A;  5JVD A;  4FIP C;  4X89 A;  4JZ2 A;  2QDO A;  2V1D A;  4JI0 O;  1NS1 A;  3Q4H A;  2EIN B;  2ODM A;  4FLV A;  4JI0 B;  1SES A;  1TAE A;  2Q7G A;  4RQF A;  3OT7 A;  1HNZ O;  1LUW A;  1K73 W;  3AEI A;  3P30 A;  4OX9 B;  1Y76 A;  2OCC B;  1YZB A;  3CCQ V;  1YIJ V;  3ASN C;  4JI7 O;  2WLI B;  3W7S A;  2Q0O C;  1IDS A;  2ZXW B;  3JSN A;  1Q7Y W;  4JI7 B;  1TUE B;  1MSD A;  2ITC C;  5L3B A;  1PNM A;  3EXA A;  3H9V A;  5CA0 B;  2BOC C;  3WG7 B;  2BTQ B;  3OGC C;  3L9D A;  5BY1 A;  3CCE V;  2R9I A;  2LFR A;  4PI0 A;  3SYC A;  1N4C A;  3RN4 A;  1K4C C;  4EKW A;  3P3N A;  1EBO A;  4LH6 A;  1WB7 A;  4LNU A;  4PA6 A;  2WA3 A;  3E8G A;  4MVM A;  1Y66 A;  1ZX3 A;  5B3S C;  3K5N A;  3OUF A;  3SPI A;  1NTM H;  1R3J C;  2HJF C;  1OCZ B;  1K8A W;  5DED A;  2YI8 A;  3B77 A;  3E35 A;  4OGQ B;  1QBZ A;  4RQE A;  5C93 A;  4FLW A;  4IL6 Z;  2DJV A;  2ZM6 O;  1K7D A;  3OGI B;  3W7X A;  2ZM6 B;  2Q69 A;  1M9N A;  2FB5 A;  3RYI A;  2VWK A;  3ICX A;  1H2M A;  1SZT A;  2VWJ A;  4O2B B;  4YXW G;  1RM1 C;  2ZIN A;  1JFF A;  2X6C A;  3CCR V;  4I50 B;  1H2L A;  1Y6X A;  5KHI A;  4I5S A;  4MVZ A;  3OD4 A;  3T4Z A;  1K34 A;  2ZQM A;  3PN1 A;  3WFV A;  4FK5 C;  1AR1 B;  2QM7 A;  1GN2 A;  1N32 O;  1OZ0 A;  4KXR A;  3ML0 A;  4TUY B;  4CS2 A;  3APO A;  1N32 B;  3ZMS A;  2CE4 A;  3HR0 A;  4E4E A;  4JV5 O;  2UXX A;  2X6A A;  4JV5 B;  2QWO B;  4WFG A;  3RT3 C;  4DV2 O;  4UCO A;  3ZN0 A;  3CJH B;  3CSX A;  1FXK B;  1YEW A;  4DV2 B;  2Q0A A;  2OYQ A;  3LSS A;  2EIJ B;  3EVK A;  4K3A A;  1XMQ O;  4MVU A;  1AVM A;  4I4T B;  2N05 A;  4FMT A;  1L0L H;  1QQC A;  3AG7 A;  3ETQ A;  2WLN A;  4UV9 A;  3K57 A;  2LGQ A;  3K04 A;  4DR5 O;  3MHS C;  3CRQ A;  1SC5 B;  4H37 A;  1Z2G A;  4IIJ B;  1I94 O;  4DR5 B;  3NXS A;  2A0L A;  4TQD A;  5EIB D;  1I94 B;  3K08 A;  2CTQ A;  2QKC A;  3J81 N;  4X1I A;  4YIO A;  1K5Q A;  1YDX A;  1URF A;  2HVK C;  5IYZ B;  1BQZ A;  3B8M A;  2IJH A;  1WA8 B;  1KU9 A;  4X1Y A;  3VOU A;  3K79 A;  2E5L O;  4LFC O;  1N34 O;  3S3X A;  2E5L B;  1R6N A;  4LFC B;  2YEV A;  3R65 A;  2QWP B;  3E86 A;  1N34 B;  3AG3 C;  5JJN B;  2ARH A;  2F95 B;  1FD9 A;  3E8H A;  4A5U B;  1BE3 H;  4NYK A;  5K1X A;  1K4D C;  1ZWI C;  1P84 F;  5FPR A;  3HKE A;  2EJR A;  3RFR A;  2R70 A;  5IY5 B;  2B9Z A;  2VQE O;  3G4S V;  3ZRV A;  4TV8 B;  4NXM B;  4DR7 B;  4LR3 A;  1EZV H;  2L6L A;  4JYC A;  2YIA A;  4GKK O;  5LGN A;  1BGY H;  1I5X A;  1SQX H;  4QPJ A;  2DYR B;  2JK5 C;  2OWO A;  3STZ C;  3ZMZ A;  3CCL V;  4LH7 A;  2Q68 A;  5FNV B;  3N2G B;  3J7A U;  3PJS K;  3H1L H;  2WLL B;  2P90 A;  4TT3 G;  2HEP A;  1EN5 A;  1OCO C;  4F4L A;  1FJG O;  2CGO A;  1KMI Z;  5LOV A;  2ZKO A;  4O4H B;  1TVK A;  2JGD B;  3KKY A;  4YHH O;  2BSK B;  4ZOL B;  1SER A;  4FM2 A;  4YHH B;  3D36 C;  4BIU A;  3RYF B;  3TCU A;  3L70 H;  1SQQ H;  1I0H A;  2ADP A;  2HJD A;  1KQS U;  1PNL A;  3ZRS A;  3O9O A;  4LF6 O;  1CXZ B;  5LA6 A;  2R9A A;  5LGT A;  4LF6 B;  3JD1 A;  1S5H C;  1VQ4 V;  2X6B A;  1KKC A;  1VAR A;  4DUZ O;  2WPD G;  2GUZ B;  3TGU H;  1G1X B;  2F4V B;  3QO7 A;  4O2A B;  4PA9 A;  1N0N A;  1PNK A;  4QE9 A;  1XUQ A;  2Q5Z A;  2HLD G;  5KAI Z;  5B66 Z;  1B3Q A;  2Q8V A;  4BW5 A;  1H2S B;  2DOS A;  4JGS A;  2GTS A;  3M99 B;  3L75 H;  4DR1 O;  3DC6 A;  4QIW F;  1GO3 F;  4DR6 B;  5LL6 Y;  4DR1 B;  3K9A A;  1AI5 A;  2KSD A;  4NR1 A;  3FKS G;  2CTW A;  2A9H A;  3TK1 A;  4LWS B;  3UT5 A;  2Z5U A;  1M57 B;  3ZS8 C;  4U7O A;  2X0L A;  2QEX V;  4LFA O;  4MVR A;  4GLX A;  1P7G A;  4LFA B;  5ITZ A;  4B3S O;  4W4K A;  1EFR G;  3TXQ A;  4B3S B;  4GZR B;  1ZSP A;  4IHJ A;  5B1A B;  5BMV A;  2E3C A;  3ZMT A;  4I55 A;  1OCC B;  4EB6 A;  3U10 A;  1EM1 A;  3CCS V;  2H3O A;  3IC7 A;  5CA1 B;  2XAJ A;  1Q81 W;  2IJK A;  5CA3 A;  2HP8 A;  1JJ2 U;  3H1I H;  2CTP A;  5J2U B;  4P2Z A;  3FYI B;  4X8A A;  3E89 A;  1OHH G;  4O4L A;  2Y69 B;  4N21 A;  1TUB B;  4JI5 B;  1MZE A;  1QHT A;  3BHP A;  1PL0 A;  2LFS A;  3FB5 C;  1ZTE A;  4JAA A;  4YJ3 A;  3L72 H;  3K03 A;  2AZ0 A;  3ZHR A;  4F6R B;  2KQX A;  2QKA A;  3E8B A;  4WFB V;  4LFB B;  2PY5 A;  1IXM A;  4WBN A;  3K5M A;  1WP7 A;  2GDS A;  4GUN A;  4QGP A;  4U7N A;  1GM9 A;  4CH3 A;  2CGN A;  1BMF G;  4WFA V;  4MW8 A;  2Z3Y A;  5LHI A;  1YVW A;  4Z1V A;  2VRZ A;  3DSQ A;  3CWB H;  2AHY A;  3SJA C;  4DV3 O;  1NR7 A;  4DR2 O;  4DV3 B;  4DR2 B;  2QJ1 A;  4MVS A;  1Q90 D;  4JYB A;  4J9Y B;  1THZ A;  2AZ2 A;  1BHA A;  1KB9 F;  4CZZ A;  4KUM A;  2JS5 A;  1G8M A;  1MZF A;  4DYL A;  4CC5 A;  1VP7 A;  3DXR A;  1GAX A;  3EHB B;  5JH7 B;  3ABK B;  5H2F Z;  4X20 A;  4J9Z B;  5KAF Z;  4YIP A;  1J5E O;  2IH1 C;  2IU3 A;  1EZJ A;  1MG1 A;  1LNQ A;  1N33 B;  2H94 A;  3OMI B;  3OTF A;  4HNA B;  1DLB A;  1IBK B;  1WLE A;  1MAB G;  3SPG A;  5H9C A;  5IYB O;  4I0X B;  3RW0 A;  2LJ2 A;  1NTZ H;  2PI4 A;  4IYH A;  2PYL A;  1VQ7 V;  1ZL8 B;  1CPY A;  3JAW B;  1RPR A;  5B1B C;  2AXT Z;  3TET A;  2OIE A;  2NNU A;  5FLX N;  3I56 V;  4DR3 O;  3K0D A;  1NZ6 A;  2D3O W;  4ZI7 B;  4CBC A;  2HR3 A;  3MD0 A;  4H44 B;  1V9P A;  2HVJ C;  1COW G;  4UCV A;  3JAK A;  5D5Q A;  1X4T A;  3H1J H;  1MMM A;  4Z1M G;  5EZY A;  4XDL A;  1F4N A;  1ZAU A;  2LW1 A;  2EIM B;  2XT9 A;  3LDD A;  5LMU O;  4DV7 O;  5AG2 A;  2KKW A;  2B5U A;  5EYP B;  2DYS B;  1AJN A;  5LMU B;  4LC1 A;  3VQX A;  5C8Y A;  5LP6 C;  4FM1 A;  4JI2 O;  3QF7 A;  4BIO A;  1L0N H;  4D6T H;  5IE9 A;  1LUV A;  4JI2 B;  4PV1 B;  5LP6 A;  2Q9L A;  3RGB A;  2DE0 X;  3CRM A;  2D2C B;  3BPZ A;  5J2T A;  5KLV H;  4L8J A;  1ZLZ A;  4W4L A;  4J11 A;  1GH6 A;  4UV8 A;  4UCS A;  4X9Q A;  4UXN A;  3A0B Z;  3SR2 C;  4MS2 A;  5B1N A;  4DV6 O;  1H8H G;  1JOY A;  4DV6 B;  3JD0 A;  3FAV B;  1IBL O;  3ZHQ A;  3FFQ A;  1FAF A;  1XNQ B;  1IBL B;  4GCZ A;  4DUY O;  3WG7 C;  2YID A;  4LF5 B;  4JF3 A;  1BSM A;  4DUY B;  4OX9 O;  1HDJ A;  3KCX A;  5EBM C;  1NI8 A;  4TV9 B;  1H38 A;  4K35 A;  5IJ9 B;  1RPO A;  4X62 O;  3C3T A;  4JI6 B;  2EIL B;  1YTF B;  1E1R G;  2QTO A;  4R50 A;  4X62 B;  1XL6 A;  3B40 A;  4UCR A;  1F7Y A;  4FFB B;  1SS3 A;  5JQG B;  4FFK A;  2JGU A;  5JVD B;  4GT1 A;  1PKX A;  2W6J G;  1RSO A;  2YIB A;  3AG2 C;  5EK0 A;  3Q4H B;  3KG2 A;  4ZHQ A;  2QM8 A;  1S0V A;  1B6Q A;  1GM7 A;  4PDL A;  1DGS A;  3UM7 A;  4LCU C;  4O4J A;  4X66 B;  1S76 D;  4MTF A;  2KB1 A;  1P49 A;  2NR5 A;  1Y76 B;  2N04 A;  1YTF D;  1SQF A;  1ROP A;  3F5W C;  4FLT A;  2Q6A A;  4WCE V;  1EN6 A;  5B5E Z;  3ASN B;  3CRA A;  3JAM N;  2QSA A;  4TOI A;  3A0H Z;  1V54 C;  1M56 B;  3MDS A;  1IZ3 A;  1HWY A;  1P7B A;  3X2Q C;  5FPO A;  2Q73 A;  1Z5W A;  1OCR C;  3JD2 A;  5TIS Z;  4I9Q A;  1SQB H;  4DW1 A;  3RWR D;  1T5E A;  2PF4 E;  5BZB A;  1IBM O;  4LNU B;  4PD4 F;  4UVA A;  1FFX A;  1IBM B;  3AK3 A;  1M1K W;  1FXK C;  4PEL A;  2GV9 A;  2EIJ C;  4IYI A;  1J95 A;  2OTL V;  3CXH F;  2Q67 A;  3AG1 C;  2R9R B;  4DK0 A;  4DV1 B;  4LF8 B;  1DF5 A;  2XAG A;  3OUS A;  3SPH A;  3TJT A;  1O9G A;  4ASU G;  3BFR A;  3CCU V;  1EN4 A;  1H2K A;  4UCU A;  3RYI B;  4GX2 A;  3L73 H;  2LQT A;  3E22 A;  4B7E A;  3ABL C;  4J80 A;  2JEU A;  3JCU Z;  1JFF B;  1PV0 A;  3KZI Z;  4X64 O;  1RM1 B;  3IFX A;  2EIK B;  1R6T A;  4X64 B;  2QWQ B;  2PI5 A;  3RBZ A;  3K06 A;  3UO2 A;  1XBL A;  1Q3E A;  5CN0 A;  1LR1 A;  1DK1 A;  3ZHS A;  1FFT B;  2WLH A;  2IBZ H;  1GRJ A;  5BR8 O;  1I7F A;  3M8A A;  1K5S A;  4FLY A;  5BR8 B;  1NH2 D;  3CEI A;  1SET A;  2WAM A;  2ADQ B;  1HW7 A;  1VQ5 V;  1V55 C;  1SKV A;  1U97 A;  2NLJ C;  1W2B U;  4N23 A;  1VQP V;  3BVO A;  5GON A;  5A2Q N;  2F43 G;  1FYJ A;  3VQV A;  3JAL B;  3ABU A;  4B7K A;  4JTD B;  4B08 A;  2A06 H;  1R3K C;  5KHJ A;  2ZE6 A;  2EX3 A;  1Z5V A;  4X1I B;  3OR7 C;  2PZS A;  1HR0 O;  4NXM O;  5KHK A;  4DR7 O;  1PM9 A;  1UFI A;  1HR0 B;  1KEC A;  3P3P A;  4ZIB A;  5LGU A;  2UU9 O;  3JCZ A;  1JCH A;  2PGG A;  4X1Y B;  2LGW A;  3WU2 Z;  3GWO A;  3T1C A;  4FLU A;  2UU9 B;  1WNS A;  1KYO F;  5IYC O;  2QA4 V;  2YEV B;  5IT9 N;  3QO8 A;  2K1E A;  1WJZ A;  4X88 A;  3IAY A;  3QVN A;  3ZMV A;  3ABM C;  3HKC B;  2YS8 A;  4JI4 O;  3HKE B;  3JAT A;  4JI4 B;  2CUG A;  4FM0 A;  4P9P A;  2CH7 A;  4EEQ A;  1M90 W;  5KA6 A;  5CB4 A;  1GTO A;  4JI3 O;  3JAR A;  4LF7 O;  2XHB A;  4H0L B;  1P4R A;  4JI3 B;  3W7T A;  4LF7 B;  1FXV A;  3D36 A;  2EUL A;  2Y48 A;  4K0K B;  3IC9 A;  5IDJ A;  4LP8 A;  3ZN1 A;  2YXY A;  4JTC B;  4MTX A;  1S5J A;  4DRX A;  4H13 B;  4JI8 B;  1XIL A;  2F4V O;  3JSL A;  3ASO C;  3SPC A;  5LOV B;  1QR9 A;  4U3J A;  4MSW C;  1OCO B;  1ZUQ A;  1TVK B;  3F7V C;  3ZRW A;  3ZMU A;  2ILM A;  1AR4 A;  3SYA A;  2P22 C;  1YJW V;  5KMG A;  5LHH A;  4DR6 O;  1H2N A;  1AI7 A;  1JA8 A;  2Q7H A;  4DV4 B;  1AI4 A;  4AIL C;  2H8P C;  2RJZ A;  4DR4 O;  3CXC U;  5LA6 B;  3WB2 A;  4DR4 B;  2FKX A;  5JJJ B;  1I08 A;  3JAS A;  3A8T A;  3OMN B;  3ZHU A;  1HNW O;  4OPH A;  3H1K H;  2W0F C;  1HNW B;  1NQT A;  2RMK B;  2WSS G;  4PA3 A;  2CAZ C;  1VQM V;  4FVM A;  5LYJ A;  2UUB B;  3IJ4 A;  3D8C A;  2LP7 A;  2Y69 C;  3BEH A;  3UKM A;  1AJQ A;  1XHX A;  1YIT V;  4K8X A;  2VQF O;  5GTH Z;  3KCY A;  4BAY A;  4PHZ A;  4CH5 A;  1H8E G;  2VQF B;  1HP8 A;  5EC2 C;  2P5O A;  2WLM A;  5E79 Z;  5L3F A;  5GW7 A;  1Y67 A;  3ZHV A;  3UT5 B;  4LF4 O;  1ARO P;  1MSW D;  4JI5 O;  4PDM A;  1PPJ H;  3S3W A;  4LF4 B;  4JI1 O;  5ITZ B;  1BQ0 A;  5J9P C;  3W7W A;  4JI1 B;  5DEC A;  1BT8 A;  2UXD O;  4X1K A;  4IHJ B;  5BMV B;  2WLJ A;  2UXD B;  3QNE A;  5LHG A;  4I55 B;  4EB6 B;  1Y74 A;  3CP1 A;  1R3I C;  2YIC A;  4GYC B;  5F2V O;  3FX7 A;  3AK1 A;  4O4I A;  2IJI A;  4AHC A;  4LFB O;  4RO2 A;  4HZ3 A;  5CBH A;  1R73 A;  2C2A A;  4B3M O;  1XL4 A;  5EBL C;  5KX5 A;  1F23 A;  1YF2 A;  3HKD A;  1XHZ A;  4LF9 B;  3APQ A;  4B3M B;  2ZE8 A;  5H6R A;  4O4L B;  2YDE A;  1G6U A;  3K5O A;  2PUS A;  1S77 D;  2L35 A;  2ETN A;  1KKD A;  2DQ0 A;  3TXS A;  3A0R A;  4I7Z B;  4YJ3 B;  1VMG A;  5EC1 C;  3E83 A;  2XOK G;  4YJ2 A;  3CCV V;  2CTR A;  2XND G;  4NKG B;  5K1P A;  1O9H A;  1YSC A;  4WBN B;  3LSQ A;  4TWK A;  5LBQ A;  4MW3 A;  5CBF A;  4BW9 A;  1BL8 A;  2KG7 A;  2DW4 A;  4K8Z A;  4BR6 A;  3BA9 A;  4MT8 A;  3MAQ A;  4JAV A;  1AR5 A;  4F6E A;  3OM3 B;  5JJE B;  2W6I G;  1N33 O;  1G4Y B;  1VQ8 V;  3J80 N;  1IBK O;  1M4U A;  2YC0 A;  3K3W A;  1K97 A;  4GX5 A;  3HKB A;  1M5I A;  1JPX A;  5FL7 G;  3SJC C;  2F1M A;  1YJN V;  1AP6 A;  1N0J A;  1XOU A;  1VF6 C;  2IM9 A;  2ZR3 A;  1S72 V;  1VF6 A;  3BY6 A;  2DQ3 A;  3DXR B;  2BOB C;  1M93 A;  4X20 B;  3RYC A;  4TQF A;  2Q4P A;  1QLE B;  4FZ1 A;  3CME V;  2DYS C;  1AI6 A;  1D5N A;  3RYH A;  3R66 A;  1XEQ A;  3U11 A;  3SDL A;  5IJ0 A;  3N2K A;  1SRY A;  1KP3 A;  1GKF A;  1NR1 A;  3AG4 B;  2EBO A;  1S5L Z;  1X59 A;  4FLX A;  4RAI A;  3ETD A;  4PA7 A;  3G6E V;  4QE7 A;  3K59 A;  4UB8 Z;  5LXT A;  1SA0 A;  3FB7 C;  3OMA B;  2OIG A;  4PA4 A;  4FPP A;  4PDV A;  5B1B B;  1Q5O A;  2BCC H;  2EZP A;  1YI2 V;  3P32 A;  5CMU A;  3BA8 A;  2F23 A;  5GTI Z;  5L3D A;  3CHX A;  1B06 A;  4UB6 Z;  4EFE A;  2O57 A;  1L1F A;  3E2E A;  4JAS A;  5D5P A;  2EIN C;  1KP2 A;  1WPB A;  1R1B A;  2DN9 A;  4ABM A;  3LNN A;  3LNM B;  2ZIM A;  2W0X A;  5EZY B;  1VF7 A;  3GWK C;  3ZED A;  2ZDI C;  4ZBM A;  3T1H O;  2OCC C;  2QR4 A;  4D7S A;  3JD4 A;  1GN3 A;  3UCS C;  1NTK H;  5L3G A;  3T1H B;  3A2F A;  4D7T A;  1XNQ O;  5C8Y B;  1KUQ A;  2ZXW C;  4EFB A;  1I5Y A;  4LF5 O;  2XUM A;  2WLI A;  3LUT B;  4J41 A;  5LP6 B;  2P67 A;  2MK3 A;  3F5T A;  3N27 A;  2P6J A;  5CA0 A;  5J2T B;  2AGA A;  2BTQ A;  2ZIO A;  4JI6 O;  1VEW A;  2GTA A;  1F51 A;  3QO5 A;  1N8R W;  3SJB C;  4MTO A;  1MA1 A;  2GBO A;  1QVG U;  3SYQ A;  2ZCE A;  5CBG A;  1PP9 H;  1ENV A;  3F7Y C;  3E8F A;  1JJO A;  1HNZ B;  4QPK A;  3L71 H;  1CEZ A;  3ETG A;  4J7Z A;  4J10 A;  2LO1 A;  1E1Q G;  2ZNJ A;  1Q6H A;  2E74 B;  3SPJ A;  2QWR B;  1JVM A;  1WB8 A;  1OCZ C;  4P30 A;  4X66 O;  2RDC A;  2P4K A;  3D3I A;  5JCO C;  1FKA O;  1M56 C;  3CB2 A;  3OAA G;  3LDE A;  1VIB A;  2ZD9 A;  1VQK V;  4JZG A;  5JCO A;  1TGO A;  1US6 A;  1YJ9 V;  2M7W A;  1SQG A;  1RFY A;  3MHH C;  3IGA C;  4CS4 A;  3FB8 C;  1PD3 A;  2B1G A;  2PYJ A;  3QTC A;  3EFF K;  1IXB A;  1JR9 A;  4KL1 A;  1RSO B;  4RWU A;  3OFN G;  2BTO A;  4O2B A;  2JS3 A;  1SQV H;  4ZHQ B;  4I50 A;  3AK2 A;  3AG2 B;  3U0Z A;  3T1Y O;  1N36 O;  2XAS A;  1VQN V;  2MW2 B;  3BCC H;  2NN4 A;  4O4J B;  2IH3 C;  3T1Y B;  2QTS A;  4XBF A;  1N36 B;  1BCC H;  5EIB C;  1XNR O;  4TUY A;  2ZE5 A;  4AQY O;  4DV0 O;  2CDY A;  3OR6 C;  1XNR B;  2WA4 A;  2Z0A A;  4AQY B;  4DV0 B;  2F66 C;  3SJQ C;  2A3Q A;  3VQY A;  3CJH A;  5B3S B;  2YIB D;  1FXK A;  2RCV A;  4DV1 O;  3GB7 C;  4OPA A;  1Q82 W;  4LF8 O;  4JPR A;  1GN6 A;  4I4T A;  1V54 B;  3DGE A;  3CX5 F;  2EIK C;  4G27 B;  4CC6 A;  5L3E A;  3BRC A;  4WFE A;  3X2Q B;  2OTJ V;  3H1H H;  1GK9 A;  1OCR B;  4BWA A;  3ETE A;  1OV9 A;  4B3R O;  4IIJ A;  1UPG A;  2ATK C;  4B3R B;  1FFX B;  1NH2 B;  2EZO A;  2UUC O;  4J7K A;  2AHZ A;  4Q6G A;  2UUC B;  1GM8 A;  2ZE7 A;  2QWN B;  3ZIA G;  2JRI A;  5KUK A;  5IYZ A;  3HB3 B;  3CD6 V;  1F4M A;  3K58 A;  4NTY A;  1WA8 A;  1FS0 G;  1XMQ B;  3AG1 B;  2Y4U A;  2YI9 A;  2OT5 A;  5H6Q A;  2XAQ A;  3B09 A;  2RQ6 A;  4PJ0 Z;  3E22 B;  5EBW C;  3JAL A;  5IY5 C;  4P9O A;  3ABL B;  4JTA B;  2XAH A;  3W7U A;  1Q43 A;  4TV8 A;  1Q6I A;  3CMA V;  2P7T C;  2DYR C;  2ITD C;  5E1A C;  3G67 A;  1VQO V;  1AB3 A;  2V4D A;  2P4V A;  1Q8I A;  2VS0 A;  5FNV A;  3N2G A;  3HKC A;  4CH4 A;  2WLL A;  4LBE C;  1IUR A;  2R72 A;  1Q86 W;  4UUJ C;  1V55 B;  1A32 A;  4O4H A;  4E2L A;  2JGD A;  3AG3 B;  5GON B;  2N74 A;  2BSK A;  2YXH A;  4ZOL A;  2VQE B;  1NJI W;  3UO3 A;  3DTU B;  5BXZ A;  5A9G A;  3CS5 A;  3RYF A;  4MTG A;  3RVY A;  4GKK B;  3UQ8 A;  5KHG A;  1XRE A;  2OCH A;  3JYC A;  1U96 A;  1BZK A;  2Q7E A;  3JD3 A;  5IYD O;  2JJ1 G;  4K0K O;  3ZRX A;  2HFE C;  2GUZ A;  4KHP O;  1NT2 B;  3C3S A;  1IVS A;  5DM6 V;  4O2A A;  4KHP B;  1FJG B;  2PTM A;  3BAB A;  4QJF B;  4JYA O;  1SZX A;  1AJP A;  4QNH B;  1H2G A;  4AI8 A;  4JI8 O;  4JYA B;  3JAT B;  2V7Q G;  4X65 O;  4R7C A;  3GVM A;  4FZ0 A;  3ABM B;  2ZT9 B;  4R6Z A;  2JDI G;  2Y0I A;  4X65 B;  2JIZ G;  4DXW A;  4HAM A;  3CCJ V;  2CH7 B;  2B1I A;  1YXB A;  1XDC A;  3LSU A;  1K33 A;  5CB4 B;  2M6Y A;  1QVF U;  1QU7 A;  4MVO A;  1BS3 A;  3JAR B;  2FML A;  4DV4 O;  1GN4 A;  1M57 C;  4BIZ A;  4U3F H;  4XDK A;  4H33 A;  4YY3 O;  2E75 B;  2JJ2 G;  4LWS A;  4R8C A;  3CRR A;  4HYO A;  4YY3 B;  3QG5 A;  4DUZ B;  1K92 A;  1UJW B;  1NVP B;  4UVB A;  2DMX A;  3OTO O;  3VBB A;  4NB5 A;  4CS3 A;  2K9P A;  5B1A C;  1Q6U A;  4GX1 A;  4DRX B;  3OTO B;  3T4D A;  3G71 V;  3CPW U;  2YSU B;  1OCC C;  4U3J B;  1IX9 A;  4G2K A;  1R6K A;  3ZRW B;  3ASO B;  3RVZ A;  2UUB O;  2F93 B;  3CYO A;  3THO A;  1NU1 H;  5CA1 A;  5KMG B;  1K3E A;  1R3L C;  1SF9 A;  1NVP D;  5J2U A;  4UFZ A;  3SGI A;  4NXN O;  1D2D A;  4NXN B;  3CC4 V;  3G6B A;  1TUB A;  3JAS B;  1QCE A;  3ABT A;  2DWD C;  4IGG A;  4RUE A;  1QNM A;  1YCI A;  2GSM B;  4PI2 A;  4JAU A;  4F6R A;  3FB6 C;  1L8D A;  3DC5 A;  5LYJ B;  2JEX A;  1JQ0 A;  3LDC A;  1ORQ C;  2FTK A;  3CRC A;  2P06 A;  2UXN A;  1XMO O;  3WB0 A;  1OJH A;  1VQL V;  1XMO B;  4UCT A;  4B3T O;  4LF9 O;  1CP9 A;  2QKS A;  3ZBH A;  4B3T B;  4G28 B;  4DW0 A;  2Y4T A;  2QGN A;  2XTA A;  2IU0 A;  2A79 B;  1KBH A;  4IT5 A;  1VQ9 V;  3D3Q A;  1TA8 A;  1WN7 A;  2HKO A;  4Z2W A;  1WPX A;  4X1K B;  1DTO A;  4L87 A;  4XDJ A;  3O65 A;  4J7J A;  1Y74 B;  3G80 A;  3ABK C;  4O4I B;  4RUF A;  2BE3 A;  3OW2 U;  5KHH A;  4DK1 A;  5JH7 A;  2X7R B;  4MVQ A;  4HBN A;  3L74 H;  5LMN O;  2A7W A;  5L3C A;  5LMN B;  3CC2 V;  5KX5 B;  3HKD B;  2FL4 A;  5HFM A;  5H5N A;  4HNA A;  1XI1 A;  3FD9 A;  4NTW A;  4PDR A;  2EJ7 A;  1SQP H;  1NBM G;  1YHQ V;  3SYP A;  1AP5 A;  2Y0P A;  4KP4 A;  4I0X A;  2ZR2 A;  4UVC A;  3CC7 V;  1B04 A;  3B2E E;  3B8N A;  1ZL8 A;  4GKJ O;  3JAW A;  4NTX A;  2XAF A;  2QM4 A;  1KC8 W;  4GKJ B;  2RN9 A;  1NKD A;  1QR8 A;  2AW9 A;  3ZJZ A;  1AIL A;  4YJ2 B;  3ZCC A;  3OEH G;  4I9W A;  1QLE C;  2LW7 A;  2G38 A;  4ZKI A;  1FXH A;  1MOF A;  2JVD A;  3WB1 A;  1DF4 A;  3ZHT A;  4WF9 V;  3CCM V;  4ZI7 A;  3OEE G;  1W0J G;  2KG7 B;  1J5E B;  1RP3 B;  1HNX O;  1D5A A;  5DN6 G;  2FYU H;  3AG4 C;  1HNX B;  2E76 B;  2EIM C;  4WFH A; 
#chains in the Genus database with same CATH homology
 1WAZ A;  2LJ2 A;  2H3O A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...