2H3OA

Structure of merft, a membrane protein with two trans-membrane helices
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
44
structure length
44
Chain Sequence
LVILLGVVGLSALTGYLDYVLLPALAIFIGLTIYAIQRKRQADA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure Determination of a Membrane Protein with Two Trans-membrane Helices in Aligned Phospholipid Bicelles by Solid-State NMR Spectroscopy.
pubmed doi rcsb
molecule keywords MerF
molecule tags Membrane protein
source organism Morganella morganii
total genus 11
structure length 44
sequence length 44
ec nomenclature
pdb deposition date 2006-05-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11431 Transport_MerF Membrane transport protein MerF
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.910 Mainly Alpha Orthogonal Bundle Helix Hairpins bacterial mercury transporter, merf 2h3oA00
2LJ2A 2H3OA 1WAZA
chains in the Genus database with same CATH superfamily
2W0XA 4FM0A 1I5XA 4IL6Z 4B7KA 2VS0A 3DSQA 1I0HA 1HWYA 5J2TB 2IH3C 1JJ2U 3L72H 3BA8A 4I4TB 1MSDA 2Y69C 4BWAA 1VQ6V 1MOFA 3HR0A 2GUZA 3CE2A 1NI8A 4MTOA 3AG2C 3CCUV 3ASOC 2EJ7A 4HYOA 3HKEB 3ASNB 1ZWIC 4PA3A 4B08A 3QF7A 2Q67A 3PN1A 2D2CB 5FLXN 4LNUB 5JVDB 5CN0A 4OGQB 5JQGA 1NH2B 2Q7HA 4JI3B 1WAZA 2CH7B 5EIBD 2ZE8A 1H2NA 2EIKB 3K0DA 1TUBA 2GHYA 2IM9A 4ZOLA 4ZHQA 1XQ8A 2ARHA 4JI2O 5J2UB 3NR7A 4H13B 2CUGA 5HFLA 2DWEC 4LCUC 3JASA 4NR1A 4WCEV 4UVAA 3ZMUA 3S3WA 3QVNA 4X1KB 1UPGA 2IH1C 3LSUA 5B1OA 4MTGA 3P3PA 3N27A 3OM3B 3F5WC 4OX9O 2Q6AA 1B04A 1K3EA 4HAMA 1FFTB 1NVPB 1R3LC 3RYHB 1QVGU 1OCCB 4W4KA 2OWOA 3G4SV 3LNMB 3VOUA 3CJHB 4X89A 4CS4A 2CAZC 3T4DA 1KC8W 3QO5A 2OYQA 2HHHO 4QE9A 1SQXH 3T4ZA 4JI2B 3ABKB 4X1YA 5KMGB 5JCOA 1Q5OA 3T1HB 4WBNA 3O9OA 3ZMTA 1QNMA 2ZT9B 3UCSC 4X62O 5CA0A 1VP7A 3N2KB 4F6EA 5LXTA 3HKBB 5L3FA 4BIUA 1AI6A 2RQ6A 2IJJA 3G6EV 4O4LA 3ZHVA 4UXNA 1V54C 1BGYH 1PKXA 5EK0A 3JARB 4OX9B 5LL6Y 1BS3A 3FKSG 3HB3B 3G71V 2YUAA 2W6IG 2EIKC 3FX7A 4DV6O 3QO8A 1R3IC 4LF6O 3TETA 2L6LA 1X4TA 1ZUQA 1S76D 1E1QG 1SQQH 2BTQA 1K73W 5LBQA 4O4IA 5IYBO 1NTZH 1M57B 2AHZA 1GN6A 1YJWV 4RO2A 1XNQO 5EBLC 1VF6A 4MW8A 1Y74A 1AI4A 4X62B 2DWDC 1L8DA 2AXTZ 1VIBA 4JV5O 2Z0AA 1Z5VA 1R6KA 2WLIB 3APQA 1GM8A 4JAVA 2CGNA 1OCCC 4DR6O 1NZ6A 1VF5B 2QM4A 4I55A 3J81N 1H2SB 5LMNO 3AEIA 3K57A 3WB1A 1L1FA 2JVDA 5CB4B 1VMGA 4LF6B 3HKDB 2AZ2A 4KL1A 2DYSB 4MVZA 2QKCA 2N05A 5KHHA 2ZDIA 1K7DA 1AI7A 1PV0A 3ZRVA 5LHHA 4O2AB 3LDEA 3SPJA 4TV9A 3ZN1A 2DJVA 3GWKC 1XMOO 2AHYA 1NT2B 1YSCA 3SPGA 1V55B 5L3CA 2EJRA 4LWSA 3OUFA 4JV5B 1GO3F 1G1XB 4TOIA 4LF4O 3FAVA 4TUYB 1GM7A 5GTIZ 2QDOA 4DR6B 1BSMA 1PNLA 2UXBB 2IJKA 4BW9A 2QWPB 3OAAG 5LMNB 2PYLA 1M90W 1XMQO 1Y66A 3OEEG 3G80A 1BZKA 4UB8Z 1SRYA 4YJ2B 1OCZC 1KBHA 4DXWA 5BR8O 2R9RB 2EX3A 1YJNV 1N8RW 4UFZA 4MTXA 3RWRD 1P49A 3CC2V 4FLTA 3I55V 5B1NA 1NTMH 3OR6C 4DV3B 2ZR3A 4ASUG 4C7UA 4YIPA 3LSSA 1P4RA 1RPOA 1D2DA 3OT7A 3SJCC 3FB6C 4QIWF 3Q4HA 4NVPA 1GN3A 3OMAB 2VQEO 2C2AA 4U7NA 3H1JH 2G38A 1P7BA 4TV8B 1K9MW 1XMQB 4CBCA 2BSKB 3DTUB 4LF7O 2FL4A 4X20A 2BOBC 2LGWA 4IGGA 1HR0O 2QWOB 1E79G 1NBMG 2HJDA 2ZE6A 5BR8B 5JH7A 1CPYA 3E8HA 4E4EA 3N2GA 4DV0O 5IE9A 4MVMA 2WSSG 1IBLO 1RSOA 2YDEA 1KU9A 2M7WA 3OTFA 2YI9A 2RCVA 2JIZG 3OTOO 4UCVA 4OPHA 2CE4A 3ETQA 3K9SA 2WWWA 4X9QA 3T2MA 3DGEA 1RP3B 3ICXA 4O2BB 2ADPA 2Q4PA 1B3QA 2EULA 3JAMN 2VQEB 1RM1C 1GMGA 1K97A 3F7YC 4QGPA 2AGAA 3D36C 2YS8A 2H3OA 2D3OW 4DR7O 1EZVH 4LF8O 2PZSA 5J9PC 4LF7B 4JYCA 1HR0B 4JI0B 2IBZH 3PJSK 3P3NA 4TQFA 1W2BU 2CTWA 4I50B 1AR1B 3GWOA 1IBLB 5J2TA 1Y4MA 4I4TA 4WFFA 4ZI7B 3OTOB 2YIBA 4LF9O 1HDJA 3S3XA 1SQBH 4NTYA 1PM9A 2LFSA 2JJ2G 5B5EZ 5LYJB 3CMEV 5FPOA 3HKEA 1QHTA 1JOYA 3I56V 2DW4A 4FM2A 2QR4A 4XDKA 4LNUA 1YTFD 5JVDA 5H6QA 1UFIA 3JD0A 5DEDA 2PTMA 2CH7A 4D7TA 4LBEC 1BCCH 5IJ9B 3WU2Z 4DR7B 2Q68A 1SS3A 3ABMC 4LF8B 5L3BA 3UKMA 1EN6A 3K79A 2Y0IA 1CP9A 5J2UA 4JI6O 3RYCB 4PDRA 2UXXA 2VQFO 1H8EG 3ZHSA 4JGSA 2FKXA 2OIGA 4X1KA 3D3IA 2WAMA 2PYJA 3OW2U 2F93B 3ZCCA 4AQYB 5KX5B 4F6RB 3VQYA 1F4MA 5IYCO 3OEHG 1MG1A 1ENVA 2YEVB 3CRRA 3CD6V 1XILA 3RYHA 2YXYA 3H1KH 1YIJV 2UUAO 1MMMA 4PELA 4J9YB 3BCCH 4JI7O 2WLMA 5FL7G 2Q0OC 3HPLC 5FNVB 1EM1A 2XAJA 2XOKG 2JS5A 4WFEA 1YJ9V 3R65A 4I0XB 3K5NA 2MW2B 3IC7A 1ZAUA 4UV9A 4JI6B 2Q9LA 5LOVB 5IY5C 5KMGA 4DUZO 1PNMA 2VQFB 2JGDB 2BOCC 2ZKOA 2EILC 3N2KA 1N32O 3HKBA 3AG2B 1Q90D 3P30A 2GSMB 3JARA 4LFAO 3SDLA 1AJQA 1XNRO 1SZXA 2UUAB 4CZZA 2UXDO 1TAEA 4JI7B 2DQ0A 1KUQA 4CS2A 4O4JB 1YTFB 3AG1C 3RBZA 4PA9A 3UO3A 1IXMA 4BIOA 1OZ0A 4EFEA 3RYIB 1ZL8A 1ZLZA 2GDSA 3CCLV 1MSWD 3K9AA 1E1RG 3RW0A 2HEPA 1VQNV 2P67A 1XL4A 1IX9A 5KA5A 3JCZA 1FPOA 4H44B 1TA8A 4WF9V 4PDVA 1N36O 4DW0A 4MVOA 4J7KA 2WLIA 2E76B 1S5HC 4FFBB 4LFAB 1O9GA 2WPDG 3LNNA 4EEQA 3G6BA 4MS2A 4B3TO 5IJ0A 2X6AA 1QR8A 3M7MX 4DV4O 1XNRB 1P7GA 4TT3G 3ZRSA 1YHQV 5CB4A 2FB5A 4FLWA 5LHIA 1MABG 4GZRB 4RUFA 1H2LA 3DXRB 1I7FA 3QG5A 1FXKC 4GX5A 2PGGA 4DR3B 3CCRV 3CCQV 5KHGA 4O2AA 1ORQC 4JPRA 1HNZO 2Q7EA 3BVOA 1SA0B 4NYKA 4EB6B 4WFAV 2X0LA 1XBLA 1IBKO 4R7CA 2R9IA 1R3JC 1V54B 2XNDG 4LP8A 4X66O 1IURA 2RNBA 2HLDG 3RFRA 3DC6A 2N74A 4TUYA 4MVUA 1KB9F 5C93A 4PI0A 1NS1A 3ETGA 1YXBA 1JPXA 2FTKA 5IDJA 3B8NA 4B3TB 1H2MA 3CEIA 1TUEB 4DV4B 1F7YA 5EYPA 2P4KA 2KB1A 4JTAB 4IYIA 3EVKA 4D6TH 2XAGA 5HFMA 1S5JA 5BY1A 3OGIB 4YJ2A 3FB7C 2OIEA 2A3QA 1JVMA 2QA4V 1I5YA 3BPZA 4IIJB 3IAYA 2AW9A 4E2LA 1HNZB 4X8AA 3F5TA 1GN4A 1QU7A 2R70A 4L8JA 1CEZA 3CRAA 1YITV 4YHHO 2QSAA 1FKAO 3F7VC 4J7ZA 5D5PA 5TISZ 2E74B 2X7RB 3SR2C 2H94A 4X66B 4RQFA 3UO2A 3OE7G 4KXRA 3ZJZA 2DQ3A 1W0KG 2QTSA 3KZIZ 3SGIA 3AK1A 2JEXA 3K59A 5E79Z 4TV8A 1NQTA 2BSKA 3AG4B 1HP8A 3CCMV 3CWBH 5BMVB 3W7TA 4FZ0A 3CB2A 4J80A 4LH6A 2L35A 1TVKB 2ZNIA 4X88A 4J7JA 3C3TA 3K3WA 4P9OA 1WP7A 2XHBA 5CBFA 4ABMA 2JS3A 2HKOA 3CP1A 3CRMA 4O4HB 1F51A 5LHGA 1JFFA 4NTWA 2LP7A 2GV9A 1BQ0A 4DRXA 4O2BA 3RVZA 3ABUA 1QLEC 3KCYA 2CTPA 4YY3O 2Q73A 2HHHB 4U3FH 3BAAA 2P5OA 2E75B 4BIZA 3SYAA 1OCZB 3ZEDA 4MVSA 3IJ4A 2A79B 1TGOA 2P06A 5EBWC 1K5SA 4I50A 1DK1A 2Y4UA 1VEWA 1VQ7V 3AG3C 1VQ8V 4H33A 2YIAA 3WB2A 4DR1O 4DR5O 2ODMA 4G28B 3E8GA 4DV6B 3P32A 4PV1B 5LYJA 5LA6B 4CH3A 5DM6V 3AG4C 3GVMA 1Q86W 4YY3B 1AR4A 1KECA 5B1BB 3A2FA 3IGAC 2WLKA 1XNQB 2OCCB 3BA9A 5IJ9A 1L0NH 2DE0X 1YZBA 5B1AC 4R6ZA 2P90A 1KKDA 3K0GA 4DV2O 3RYCA 5H9CA 2VRZA 2BTOA 4PJ0Z 4DR2O 1H8HG 4ZBMA 2JJ1G 4JAUA 3VBBA 3U11A 1Y6XA 2RMKB 3OGCC 2ILMA 4UCSA 1BHAA 4DR1B 5ITZB 4DR5B 2F1MA 3J7AU 5KX5A 4F6RA 1A32A 1I94O 4EFBA 2YEVA 1ZX3A 1K34A 1R6NA 1RM1B 1X59A 2XT9A 5DECA 4BR6A 4NB5A 1M1KW 2ZIMA 2ZE5A 1GTOA 1ZSPA 4DYLA 3TGUH 4ZHQB 1GRJA 4JF3A 5FNVA 3T1YO 5CA3A 1XMOB 2LW1A 2ZR2A 4I0XA 5LMUO 3E8BA 5LOVA 4MVRA 4DV2B 1U97A 1THZA 4J10A 3L70H 4I9WA 1XUQA 4LF4B 1N0JA 1IBMO 1XI1A 1ZTEA 1SESA 2JGUA 2QWNB 3W7WA 1R6TA 5B1BC 2EZOA 1XOUA 2DOSA 2FMLA 3L74H 4L87A 4K8ZA 3BFRA 1LNQA 2OCCC 3MD0A 1NKDA 3E22A 5IT9N 1Q6HA 3ABMB 4DUYO 4TQDA 1VQKV 1GAXA 1US6A 4O4JA 2QJ1A 5LGUA 3T1YB 4FPPA 4CC6A 4J11A 3MAQA 3RYIA 1F23A 5LMUB 1Q3EA 4FLZA 5EZYB 3X2QC 1OCRB 2GTSA 1U96A 4R8CA 1N34O 5EC1C 2YC0A 4GX1A 3E8FA 2JEUA 4KHPO 1VQMV 3L71H 3ZMSA 3UQ8A 1K92A 4WFGA 1S0VA 2HVJC 2IU0A 4FFBA 1COWG 2ZE7A 3WFVA 1KYOF 2N04A 2NNUA 3E2EA 3ZHQA 2EIJB 5IYZB 2Y48A 4DV0B 4O4IB 3JAWB 4DUYB 2F66C 3UT5B 4K8XA 4MVQA 3ZHRA 5KAIZ 4QPJA 5KLVH 2ATKC 5IY5B 2Q5ZA 4LR3A 4IYHA 4EB6A 1LUWA 1YVWA 3K5LA 2EILB 2RN9A 1DGSA 4KHPB 2F23A 2QKSA 2OTLV 3ZHUA 4FZ1A 1XEQA 2B1IA 3B09A 4JASA 2PI4A 3WB0A 5IWAO 4X65O 2HVKC 4RUEA 3SPCA 5LGTA 3THOA 3G67A 2Q69A 4HNAB 1DTOA 3STZC 4FLYA 3E83A 1AJPA 3B4SA 4XDJA 5E1AC 2UUCO 4JI1O 4YIOA 1H38A 1D5AA 2IJIA 2PF4E 3AG1B 1OCRC 3NXSA 3MHSC 1M93A 4CC5A 2QTOA 4IIJA 1Y76B 2PY5A 1B06A 1K4CC 2KSDA 4W4LA 2QGNA 1OJHA 1BHBA 4LF9B 3SPHA 2Z5UA 1YDXA 3E35A 4UB6Z 1JA8A 4NXMO 2P22C 4FJCC 3JALB 2ZXWC 4ZIBA 3CYOA 3EXAA 3FAVB 4P30A 3ZMVA 1G4YB 3LSQA 2MK3A 5JJEB 2GTAA 4YXWG 5GTHZ 2IJHA 4RWUA 2EINC 2UU9O 5IWAB 4X65B 2EIJC 3OD4A 4NXNO 3CJHA 3BHPA 4MSWC 4K0KO 2UUCB 3L73H 1FXKB 4JI1B 5BMVA 4HZ3A 4DV1O 1OCOC 4U3JB 3VQVA 1QQCA 2LJ2A 3ABLB 1QR9A 1L0LH 2A06H 1B6QA 2QWQB 2YXLA 5KUKA 4LF5O 2NR5A 1JCHA 4I9QA 3CCSV 3FD9A 2CTRA 1PL0A 1FFXB 4KFMA 4JZGA 1YI2V 2XUMA 2JK5C 3A0HZ 2QKAA 3OMIB 2UU9B 1VARA 1CXZB 1JMKC 3TCUA 2ZDIC 4NXNB 1VQ4V 1OV9A 5GONB 4OXSA 3JD1A 2DYRC 4P2ZA 3W7UA 4DUZB 2ZM6O 1DF4A 4DV1B 2EIMB 5FPRA 1JX9A 1DF5A 1N32B 3UM7A 4KP4A 2H8PC 4LF5B 5JJJB 3FFQA 2RJZA 1Q6IA 4I5SA 1XDCA 3BRCA 4U7OA 5LGNA 3FYIB 3FYEB 3JATB 2UXDB 3HKDA 5LA6A 2UXCO 2WLJA 2QWRB 1IZ3A 1WB8A 1KD1W 4DR4O 4DK0A 1PL4A 2Z3YA 1I08A 3OUSA 1YF2A 3ABLC 2ZM6B 3K06A 1WA8B 3JD4A 2LQTA 1GK9A 4IHJB 4UV8A 5K1PA 3HKCB 4D7SA 1N36B 2A9HA 3DC5A 5CBHA 3RYFB 4PI2A 2Q8VA 5H2FZ 1KMIZ 2P7TC 3AG7A 4GYCB 1WLEA 1URFA 4JZ2A 2UXNA 1AR5A 3EHBB 3JYCA 5ITZA 3L75H 3EFFK 2OCHA 2ZQMA 3JAKB 2W6JG 1QLEB 4GT1A 4AHCA 2UXCB 1F4NA 5CA1B 2WLNA 4X1IB 4GX0A 1EFRG 3ZIAG 2EIMC 1LR1A 3D36A 4UVBA 1T5EA 4DR4B 4CH5A 3B8MA 1Q81W 1NU1H 4GCZA 1BMFG 1AP5A 3RVYA 2XTAA 3T1HO 4BAYA 1IBKB 3D8CA 4J41A 4G27B 4IT5A 1Z5WA 1VQLV 3AG3B 1K8AW 2KG7B 3SYPA 1VQOV 1QVFU 3CCEV 3B2EE 4QJFB 1GM9A 4B3SO 5C8YB 4NKGB 1EZJA 4PD4F 1HNWO 3SJAC 1H2KA 2O57A 4XDLA 1Q82W 2CK3G 2YSUB 3AK2A 4HBNA 1S77D 2ZD9A 3ZX6A 5LP6B 2PUSA 3ZRXA 5B66Z 2R72A 3CHXA 1SQFA 2WLLB 1YCIA 5KAFZ 2F4VO 5B1AB 4PDLA 2HG5C 3J80N 4JYYA 2WA4A 1V9PA 4KUMA 5GW7A 1VQ9V 4YHHB 1FYJA 1PP9H 3ZMZA 3BY6A 4RAIA 5EZYA 3H9VA 3ZRWB 4QE7A 3B77A 1QCEA 2V4DA 3ASNC 3CSXA 3JD3A 4B3SB 2XAHA 4YJ3B 2EBOA 3FB8C 1HNWB 2K1EA 3K58A 1J5EO 2CDYA 3O65A 1BT8A 4Z1MG 3KCXA 4FM1A 4DK1A 4MT8A 5D5QA 1M9NA 4FVMA 4R50A 3CC4V 2Q7GA 4UUJC 5IYZA 4I7ZB 1Q6UA 2W0FC 3JAWA 2F4VB 1WNSA 3UT5A 1VQPV 3RGBA 1AP6A 1R3KC 1ZL8B 1WB7A 4FK5C 1SERA 4GX2A 1HW7A 4ZI7A 5A9GA 1WPXA 1OHHG 2EZPA 1G8MA 2F95B 4PA6A 4ZKIA 4Q20A 2YIDA 4H37A 5EC2C 2M6YA 3E89A 2X6BA 4LH7A 1FAFA 5LP6C 1ROPA 5L3EA 1YEWA 1J5EB 2ZIOA 2UXBO 2WLHA 1N4CA 3ZHTA 5IJ0B 2CGOA 1VQ5V 1PPJH 4CH6A 3GB7C 3VQXA 4HNAA 4J9ZB 3JSNA 3ZN0A 3ABKC 3TK1A 3ETEA 4AI8A 1N33O 3WG7B 3LDDA 2V7QG 1D5NA 4WFHA 1XHZA 2VWKA 3VQWA 2Q0AA 1FD9A 1MZEA 1Q43A 2CTQA 2GUZB 4P9PA 3SPIA 3X2QB 4TSFG 2DMXA 1Y76A 4XBFA 2XAFA 4DV3O 4AILC 4JAAA 4K35A 3C90A 4K3AA 1LUVA 2R9AA 2ITDC 4QNHB 1NR7A 2Y4TA 3JALA 4NTXA 1MZFA 5JQGB 3BEHA 1UJWB 1P84F 1TUBB 4UCUA 4Q6GA 5CMUA 3IFXA 4ZOLB 4UVCA 5B3SB 2DN9A 1AB3A 5EYPB 5EIBC 1NTKH 1JR9A 1M57C 1K33A 2LO1A 3JASB 3I5DA 2YXHA 1M56B 3JCUZ 3H1LH 1N33B 1FXKA 2OT5A 4FLXA 4U3JA 4DR2B 1XL6A 2JGDA 3K03A 2B9ZA 2YI8A 3SJQC 3CXCU 3U10A 1Y67A 4UCRA 1RPRA 1WPBA 1AI5A 1I94B 3W7SA 1J95A 3KKYA 3A0RA 3H01A 4A5UB 4DV7O 3TJTA 2ZNJA 1FFXA 4LFBO 5AG2A 4B3RO 1AJNA 3QO7A 4F4LA 1M5IA 1FS0G 1EBOA 2IU3A 2DYSC 3C3SA 3LDCA 3WG7C 2PI5A 1MNGA 2HFEC 4X1YB 4PDMA 5GONA 3SJBC 4WBNB 1KP2A 1W59A 4JI0O 1K4DC 1AROP 1S3JA 3K04A 3B40A 2HJFC 4JYAO 5CA0B 3OFNG 2NN4A 1V55C 5LXTB 3QNEA 4O4LB 4JTCB 1DLBA 1IBMB 3K08A 2GBOA 3L9DA 1SC5B 1GH6A 3RT3C 5F2VO 2AZ0A 2X6CA 2XASA 2ZXWB 1JFFB 1Q7YW 5KHKA 4N23A 4DV7B 5B3SC 1EN4A 4B3MO 4LFBB 2EINB 4B3RB 3ML0A 2V1DA 4DRXB 2BE3A 2JRIA 1K5QA 5DN6G 3JATA 4FIPC 5KUMA 3CRQA 3OR7C 2BTQB 5JJNB 1KP3A 1M56C 2YICA 3DXRA 1G6UA 1KKCA 4ICGA 4DW1A 4FLUA 4GKJO 1OCOB 1Y74B 5A2QN 2ITCC 2ETNA 1SA0A 1EN5A 1PNKA 1N34B 4JYAB 3H1IH 2E3CA 1H2GA 1XREA 4B7EA 1WP8A 5KA6A 1WA8A 3M99B 5H5NA 3M8AA 4Z2WA 1IXBA 2KQXA 4IHJA 3HKCA 5JWPA 1R73A 4J42A 2A0LA 3STLC 4I55B 2LW7A 3ABTA 3RYFA 3MHHC 4AQYO 4WFBV 4BW5A 1FXVA 1JJOA 3FB5C 3D3QA 1KQSU 2QM8A 3K5OA 1GKFA 3U0ZA 4B3MB 4JI5O 4GUNA 3JAKA 5JCOC 3R66A 4DV5O 1BE3H 2HP8A 5K1XA 4FFKA 4LC1A 5CA1A 3ETDA 1QBZA 4OPAA 4TV9B 4X1IA 2QE7G 3CRCA 4QPKA 3AK3A 2DYRB 4MW3A 4GKJB 3K5MA 1AVMA 3CCVV 1NJIW 1SETA 1SQVH 5BXZA 4MTFA 4LWSB 4JTDB 1BL8A 1Z2GA 2B5UA 2OTJV 3SYCA 2KG7A 1WJZA 1SQPH 3APOA 4CH4A 1N0NA 2ADQB 3JSLA 5C8YA 2E5LO 3RN4A 3TXQA 4TWKA 2UUBO 4FMTA 3CPWU 2VWJA 2JDIG 3QTCA 3T1CA 5KHJA 2NLJC 4H0LB 4JI5B 4FLVA 2RDCA 4UCTA 2LGQA 1IDSA 1VF6C 3A0BZ 4DO2A 4DV5B 5LP6A 1S5LZ 1TVKA 3JD2A 2WLLA 2YIBD 3E86A 1XHXA 1PD3A 4CS3A 1R1BA 2LFRA 2Y0PA 4GKKO 3CC7V 4UCOA 1HNXO 2HR3A 3SYQA 1SZTA 5IYDO 4EKWA 3TXSA 4NXMB 4Z1VA 5BZBA 2WA3A 4O4HA 2Y69B 3OMNB 3LUTB 3Q4HB 1JQ0A 3ZRWA 1NH2D 4RQEA 2P6JA 5L3DA 1S72V 2B1GA 4JI8O 1SKVA 3ZBHA 2E5LB 3ASOB 1W0JG 3KG2A 4YJ3A 4JI4O 3W7XA 1M4UA 2UUBB 5KHIA 3SYOA 4LFCO 1SF9A 2QM7A 1FJGO 2BCCH 2FYUH 3ZS8C 3CMAV 1RFYA 4X20B 4PA4A 4X64O 3CCJV 4K0KB 5CBGA 3E22B 5JH7B 3N2GB 1GN2A 5L3GA 4PHZA 4JYBA 1SQGA 4DR3O 1RSOB 2KKWA 2IW5A 2ZINA 4G2KA 1WN7A 2P4VA 3CS5A 1BQZA 4GKKB 2K9PA 1HNXB 1QLNA 3H1HH 1NVPD 2ZCEA 1Q8IA 1VF7A 3MDSA 2A7WA 2XAQA 2F43G 4GLXA 2QEXV 4N21A 4JI8B 5H6RA 4PA7A 4JI4B 4JI3O 1AILA 4LFCB 1MA1A 3CXHF 1FJGB 1NR1A 1FXHA 5EBMC 4X64B 1IVSA 3CX5F 1O9HA 3A8TA 3IC9A 3BABA
chains in the Genus database with same CATH topology
2LJ2A 2H3OA 1WAZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LJ2 A;  2H3O A;  1WAZ A; 
#chains in the Genus database with same CATH topology
 2W0X A;  4FM0 A;  1I5X A;  4IL6 Z;  4B7K A;  2VS0 A;  3DSQ A;  1I0H A;  1HWY A;  5J2T B;  2IH3 C;  1JJ2 U;  3L72 H;  3BA8 A;  4I4T B;  1MSD A;  2Y69 C;  4BWA A;  1VQ6 V;  1MOF A;  3HR0 A;  2GUZ A;  3CE2 A;  1NI8 A;  4MTO A;  3AG2 C;  3CCU V;  3ASO C;  2EJ7 A;  4HYO A;  3HKE B;  3ASN B;  1ZWI C;  4PA3 A;  4B08 A;  3QF7 A;  2Q67 A;  3PN1 A;  2D2C B;  5FLX N;  4LNU B;  5JVD B;  5CN0 A;  4OGQ B;  5JQG A;  1NH2 B;  2Q7H A;  4JI3 B;  1WAZ A;  2CH7 B;  5EIB D;  2ZE8 A;  1H2N A;  2EIK B;  3K0D A;  1TUB A;  2GHY A;  2IM9 A;  4ZOL A;  4ZHQ A;  1XQ8 A;  2ARH A;  4JI2 O;  5J2U B;  3NR7 A;  4H13 B;  2CUG A;  5HFL A;  2DWE C;  4LCU C;  3JAS A;  4NR1 A;  4WCE V;  4UVA A;  3ZMU A;  3S3W A;  3QVN A;  4X1K B;  1UPG A;  2IH1 C;  3LSU A;  5B1O A;  4MTG A;  3P3P A;  3N27 A;  3OM3 B;  3F5W C;  4OX9 O;  2Q6A A;  1B04 A;  1K3E A;  4HAM A;  1FFT B;  1NVP B;  1R3L C;  3RYH B;  1QVG U;  1OCC B;  4W4K A;  2OWO A;  3G4S V;  3LNM B;  3VOU A;  3CJH B;  4X89 A;  4CS4 A;  2CAZ C;  3T4D A;  1KC8 W;  3QO5 A;  2OYQ A;  2HHH O;  4QE9 A;  1SQX H;  3T4Z A;  4JI2 B;  3ABK B;  4X1Y A;  5KMG B;  5JCO A;  1Q5O A;  3T1H B;  4WBN A;  3O9O A;  3ZMT A;  1QNM A;  2ZT9 B;  3UCS C;  4X62 O;  5CA0 A;  1VP7 A;  3N2K B;  4F6E A;  5LXT A;  3HKB B;  5L3F A;  4BIU A;  1AI6 A;  2RQ6 A;  2IJJ A;  3G6E V;  4O4L A;  3ZHV A;  4UXN A;  1V54 C;  1BGY H;  1PKX A;  5EK0 A;  3JAR B;  4OX9 B;  5LL6 Y;  1BS3 A;  3FKS G;  3HB3 B;  3G71 V;  2YUA A;  2W6I G;  2EIK C;  3FX7 A;  4DV6 O;  3QO8 A;  1R3I C;  4LF6 O;  3TET A;  2L6L A;  1X4T A;  1ZUQ A;  1S76 D;  1E1Q G;  1SQQ H;  2BTQ A;  1K73 W;  5LBQ A;  4O4I A;  5IYB O;  1NTZ H;  1M57 B;  2AHZ A;  1GN6 A;  1YJW V;  4RO2 A;  1XNQ O;  5EBL C;  1VF6 A;  4MW8 A;  1Y74 A;  1AI4 A;  4X62 B;  2DWD C;  1L8D A;  2AXT Z;  1VIB A;  4JV5 O;  2Z0A A;  1Z5V A;  1R6K A;  2WLI B;  3APQ A;  1GM8 A;  4JAV A;  2CGN A;  1OCC C;  4DR6 O;  1NZ6 A;  1VF5 B;  2QM4 A;  4I55 A;  3J81 N;  1H2S B;  5LMN O;  3AEI A;  3K57 A;  3WB1 A;  1L1F A;  2JVD A;  5CB4 B;  1VMG A;  4LF6 B;  3HKD B;  2AZ2 A;  4KL1 A;  2DYS B;  4MVZ A;  2QKC A;  2N05 A;  5KHH A;  2ZDI A;  1K7D A;  1AI7 A;  1PV0 A;  3ZRV A;  5LHH A;  4O2A B;  3LDE A;  3SPJ A;  4TV9 A;  3ZN1 A;  2DJV A;  3GWK C;  1XMO O;  2AHY A;  1NT2 B;  1YSC A;  3SPG A;  1V55 B;  5L3C A;  2EJR A;  4LWS A;  3OUF A;  4JV5 B;  1GO3 F;  1G1X B;  4TOI A;  4LF4 O;  3FAV A;  4TUY B;  1GM7 A;  5GTI Z;  2QDO A;  4DR6 B;  1BSM A;  1PNL A;  2UXB B;  2IJK A;  4BW9 A;  2QWP B;  3OAA G;  5LMN B;  2PYL A;  1M90 W;  1XMQ O;  1Y66 A;  3OEE G;  3G80 A;  1BZK A;  4UB8 Z;  1SRY A;  4YJ2 B;  1OCZ C;  1KBH A;  4DXW A;  5BR8 O;  2R9R B;  2EX3 A;  1YJN V;  1N8R W;  4UFZ A;  4MTX A;  3RWR D;  1P49 A;  3CC2 V;  4FLT A;  3I55 V;  5B1N A;  1NTM H;  3OR6 C;  4DV3 B;  2ZR3 A;  4ASU G;  4C7U A;  4YIP A;  3LSS A;  1P4R A;  1RPO A;  1D2D A;  3OT7 A;  3SJC C;  3FB6 C;  4QIW F;  3Q4H A;  4NVP A;  1GN3 A;  3OMA B;  2VQE O;  2C2A A;  4U7N A;  3H1J H;  2G38 A;  1P7B A;  4TV8 B;  1K9M W;  1XMQ B;  4CBC A;  2BSK B;  3DTU B;  4LF7 O;  2FL4 A;  4X20 A;  2BOB C;  2LGW A;  4IGG A;  1HR0 O;  2QWO B;  1E79 G;  1NBM G;  2HJD A;  2ZE6 A;  5BR8 B;  5JH7 A;  1CPY A;  3E8H A;  4E4E A;  3N2G A;  4DV0 O;  5IE9 A;  4MVM A;  2WSS G;  1IBL O;  1RSO A;  2YDE A;  1KU9 A;  2M7W A;  3OTF A;  2YI9 A;  2RCV A;  2JIZ G;  3OTO O;  4UCV A;  4OPH A;  2CE4 A;  3ETQ A;  3K9S A;  2WWW A;  4X9Q A;  3T2M A;  3DGE A;  1RP3 B;  3ICX A;  4O2B B;  2ADP A;  2Q4P A;  1B3Q A;  2EUL A;  3JAM N;  2VQE B;  1RM1 C;  1GMG A;  1K97 A;  3F7Y C;  4QGP A;  2AGA A;  3D36 C;  2YS8 A;  2H3O A;  2D3O W;  4DR7 O;  1EZV H;  4LF8 O;  2PZS A;  5J9P C;  4LF7 B;  4JYC A;  1HR0 B;  4JI0 B;  2IBZ H;  3PJS K;  3P3N A;  4TQF A;  1W2B U;  2CTW A;  4I50 B;  1AR1 B;  3GWO A;  1IBL B;  5J2T A;  1Y4M A;  4I4T A;  4WFF A;  4ZI7 B;  3OTO B;  2YIB A;  4LF9 O;  1HDJ A;  3S3X A;  1SQB H;  4NTY A;  1PM9 A;  2LFS A;  2JJ2 G;  5B5E Z;  5LYJ B;  3CME V;  5FPO A;  3HKE A;  1QHT A;  1JOY A;  3I56 V;  2DW4 A;  4FM2 A;  2QR4 A;  4XDK A;  4LNU A;  1YTF D;  5JVD A;  5H6Q A;  1UFI A;  3JD0 A;  5DED A;  2PTM A;  2CH7 A;  4D7T A;  4LBE C;  1BCC H;  5IJ9 B;  3WU2 Z;  4DR7 B;  2Q68 A;  1SS3 A;  3ABM C;  4LF8 B;  5L3B A;  3UKM A;  1EN6 A;  3K79 A;  2Y0I A;  1CP9 A;  5J2U A;  4JI6 O;  3RYC B;  4PDR A;  2UXX A;  2VQF O;  1H8E G;  3ZHS A;  4JGS A;  2FKX A;  2OIG A;  4X1K A;  3D3I A;  2WAM A;  2PYJ A;  3OW2 U;  2F93 B;  3ZCC A;  4AQY B;  5KX5 B;  4F6R B;  3VQY A;  1F4M A;  5IYC O;  3OEH G;  1MG1 A;  1ENV A;  2YEV B;  3CRR A;  3CD6 V;  1XIL A;  3RYH A;  2YXY A;  3H1K H;  1YIJ V;  2UUA O;  1MMM A;  4PEL A;  4J9Y B;  3BCC H;  4JI7 O;  2WLM A;  5FL7 G;  2Q0O C;  3HPL C;  5FNV B;  1EM1 A;  2XAJ A;  2XOK G;  2JS5 A;  4WFE A;  1YJ9 V;  3R65 A;  4I0X B;  3K5N A;  2MW2 B;  3IC7 A;  1ZAU A;  4UV9 A;  4JI6 B;  2Q9L A;  5LOV B;  5IY5 C;  5KMG A;  4DUZ O;  1PNM A;  2VQF B;  2JGD B;  2BOC C;  2ZKO A;  2EIL C;  3N2K A;  1N32 O;  3HKB A;  3AG2 B;  1Q90 D;  3P30 A;  2GSM B;  3JAR A;  4LFA O;  3SDL A;  1AJQ A;  1XNR O;  1SZX A;  2UUA B;  4CZZ A;  2UXD O;  1TAE A;  4JI7 B;  2DQ0 A;  1KUQ A;  4CS2 A;  4O4J B;  1YTF B;  3AG1 C;  3RBZ A;  4PA9 A;  3UO3 A;  1IXM A;  4BIO A;  1OZ0 A;  4EFE A;  3RYI B;  1ZL8 A;  1ZLZ A;  2GDS A;  3CCL V;  1MSW D;  3K9A A;  1E1R G;  3RW0 A;  2HEP A;  1VQN V;  2P67 A;  1XL4 A;  1IX9 A;  5KA5 A;  3JCZ A;  1FPO A;  4H44 B;  1TA8 A;  4WF9 V;  4PDV A;  1N36 O;  4DW0 A;  4MVO A;  4J7K A;  2WLI A;  2E76 B;  1S5H C;  4FFB B;  4LFA B;  1O9G A;  2WPD G;  3LNN A;  4EEQ A;  3G6B A;  4MS2 A;  4B3T O;  5IJ0 A;  2X6A A;  1QR8 A;  3M7M X;  4DV4 O;  1XNR B;  1P7G A;  4TT3 G;  3ZRS A;  1YHQ V;  5CB4 A;  2FB5 A;  4FLW A;  5LHI A;  1MAB G;  4GZR B;  4RUF A;  1H2L A;  3DXR B;  1I7F A;  3QG5 A;  1FXK C;  4GX5 A;  2PGG A;  4DR3 B;  3CCR V;  3CCQ V;  5KHG A;  4O2A A;  1ORQ C;  4JPR A;  1HNZ O;  2Q7E A;  3BVO A;  1SA0 B;  4NYK A;  4EB6 B;  4WFA V;  2X0L A;  1XBL A;  1IBK O;  4R7C A;  2R9I A;  1R3J C;  1V54 B;  2XND G;  4LP8 A;  4X66 O;  1IUR A;  2RNB A;  2HLD G;  3RFR A;  3DC6 A;  2N74 A;  4TUY A;  4MVU A;  1KB9 F;  5C93 A;  4PI0 A;  1NS1 A;  3ETG A;  1YXB A;  1JPX A;  2FTK A;  5IDJ A;  3B8N A;  4B3T B;  1H2M A;  3CEI A;  1TUE B;  4DV4 B;  1F7Y A;  5EYP A;  2P4K A;  2KB1 A;  4JTA B;  4IYI A;  3EVK A;  4D6T H;  2XAG A;  5HFM A;  1S5J A;  5BY1 A;  3OGI B;  4YJ2 A;  3FB7 C;  2OIE A;  2A3Q A;  1JVM A;  2QA4 V;  1I5Y A;  3BPZ A;  4IIJ B;  3IAY A;  2AW9 A;  4E2L A;  1HNZ B;  4X8A A;  3F5T A;  1GN4 A;  1QU7 A;  2R70 A;  4L8J A;  1CEZ A;  3CRA A;  1YIT V;  4YHH O;  2QSA A;  1FKA O;  3F7V C;  4J7Z A;  5D5P A;  5TIS Z;  2E74 B;  2X7R B;  3SR2 C;  2H94 A;  4X66 B;  4RQF A;  3UO2 A;  3OE7 G;  4KXR A;  3ZJZ A;  2DQ3 A;  1W0K G;  2QTS A;  3KZI Z;  3SGI A;  3AK1 A;  2JEX A;  3K59 A;  5E79 Z;  4TV8 A;  1NQT A;  2BSK A;  3AG4 B;  1HP8 A;  3CCM V;  3CWB H;  5BMV B;  3W7T A;  4FZ0 A;  3CB2 A;  4J80 A;  4LH6 A;  2L35 A;  1TVK B;  2ZNI A;  4X88 A;  4J7J A;  3C3T A;  3K3W A;  4P9O A;  1WP7 A;  2XHB A;  5CBF A;  4ABM A;  2JS3 A;  2HKO A;  3CP1 A;  3CRM A;  4O4H B;  1F51 A;  5LHG A;  1JFF A;  4NTW A;  2LP7 A;  2GV9 A;  1BQ0 A;  4DRX A;  4O2B A;  3RVZ A;  3ABU A;  1QLE C;  3KCY A;  2CTP A;  4YY3 O;  2Q73 A;  2HHH B;  4U3F H;  3BAA A;  2P5O A;  2E75 B;  4BIZ A;  3SYA A;  1OCZ B;  3ZED A;  4MVS A;  3IJ4 A;  2A79 B;  1TGO A;  2P06 A;  5EBW C;  1K5S A;  4I50 A;  1DK1 A;  2Y4U A;  1VEW A;  1VQ7 V;  3AG3 C;  1VQ8 V;  4H33 A;  2YIA A;  3WB2 A;  4DR1 O;  4DR5 O;  2ODM A;  4G28 B;  3E8G A;  4DV6 B;  3P32 A;  4PV1 B;  5LYJ A;  5LA6 B;  4CH3 A;  5DM6 V;  3AG4 C;  3GVM A;  1Q86 W;  4YY3 B;  1AR4 A;  1KEC A;  5B1B B;  3A2F A;  3IGA C;  2WLK A;  1XNQ B;  2OCC B;  3BA9 A;  5IJ9 A;  1L0N H;  2DE0 X;  1YZB A;  5B1A C;  4R6Z A;  2P90 A;  1KKD A;  3K0G A;  4DV2 O;  3RYC A;  5H9C A;  2VRZ A;  2BTO A;  4PJ0 Z;  4DR2 O;  1H8H G;  4ZBM A;  2JJ1 G;  4JAU A;  3VBB A;  3U11 A;  1Y6X A;  2RMK B;  3OGC C;  2ILM A;  4UCS A;  1BHA A;  4DR1 B;  5ITZ B;  4DR5 B;  2F1M A;  3J7A U;  5KX5 A;  4F6R A;  1A32 A;  1I94 O;  4EFB A;  2YEV A;  1ZX3 A;  1K34 A;  1R6N A;  1RM1 B;  1X59 A;  2XT9 A;  5DEC A;  4BR6 A;  4NB5 A;  1M1K W;  2ZIM A;  2ZE5 A;  1GTO A;  1ZSP A;  4DYL A;  3TGU H;  4ZHQ B;  1GRJ A;  4JF3 A;  5FNV A;  3T1Y O;  5CA3 A;  1XMO B;  2LW1 A;  2ZR2 A;  4I0X A;  5LMU O;  3E8B A;  5LOV A;  4MVR A;  4DV2 B;  1U97 A;  1THZ A;  4J10 A;  3L70 H;  4I9W A;  1XUQ A;  4LF4 B;  1N0J A;  1IBM O;  1XI1 A;  1ZTE A;  1SES A;  2JGU A;  2QWN B;  3W7W A;  1R6T A;  5B1B C;  2EZO A;  1XOU A;  2DOS A;  2FML A;  3L74 H;  4L87 A;  4K8Z A;  3BFR A;  1LNQ A;  2OCC C;  3MD0 A;  1NKD A;  3E22 A;  5IT9 N;  1Q6H A;  3ABM B;  4DUY O;  4TQD A;  1VQK V;  1GAX A;  1US6 A;  4O4J A;  2QJ1 A;  5LGU A;  3T1Y B;  4FPP A;  4CC6 A;  4J11 A;  3MAQ A;  3RYI A;  1F23 A;  5LMU B;  1Q3E A;  4FLZ A;  5EZY B;  3X2Q C;  1OCR B;  2GTS A;  1U96 A;  4R8C A;  1N34 O;  5EC1 C;  2YC0 A;  4GX1 A;  3E8F A;  2JEU A;  4KHP O;  1VQM V;  3L71 H;  3ZMS A;  3UQ8 A;  1K92 A;  4WFG A;  1S0V A;  2HVJ C;  2IU0 A;  4FFB A;  1COW G;  2ZE7 A;  3WFV A;  1KYO F;  2N04 A;  2NNU A;  3E2E A;  3ZHQ A;  2EIJ B;  5IYZ B;  2Y48 A;  4DV0 B;  4O4I B;  3JAW B;  4DUY B;  2F66 C;  3UT5 B;  4K8X A;  4MVQ A;  3ZHR A;  5KAI Z;  4QPJ A;  5KLV H;  2ATK C;  5IY5 B;  2Q5Z A;  4LR3 A;  4IYH A;  4EB6 A;  1LUW A;  1YVW A;  3K5L A;  2EIL B;  2RN9 A;  1DGS A;  4KHP B;  2F23 A;  2QKS A;  2OTL V;  3ZHU A;  4FZ1 A;  1XEQ A;  2B1I A;  3B09 A;  4JAS A;  2PI4 A;  3WB0 A;  5IWA O;  4X65 O;  2HVK C;  4RUE A;  3SPC A;  5LGT A;  3THO A;  3G67 A;  2Q69 A;  4HNA B;  1DTO A;  3STZ C;  4FLY A;  3E83 A;  1AJP A;  3B4S A;  4XDJ A;  5E1A C;  2UUC O;  4JI1 O;  4YIO A;  1H38 A;  1D5A A;  2IJI A;  2PF4 E;  3AG1 B;  1OCR C;  3NXS A;  3MHS C;  1M93 A;  4CC5 A;  2QTO A;  4IIJ A;  1Y76 B;  2PY5 A;  1B06 A;  1K4C C;  2KSD A;  4W4L A;  2QGN A;  1OJH A;  1BHB A;  4LF9 B;  3SPH A;  2Z5U A;  1YDX A;  3E35 A;  4UB6 Z;  1JA8 A;  4NXM O;  2P22 C;  4FJC C;  3JAL B;  2ZXW C;  4ZIB A;  3CYO A;  3EXA A;  3FAV B;  4P30 A;  3ZMV A;  1G4Y B;  3LSQ A;  2MK3 A;  5JJE B;  2GTA A;  4YXW G;  5GTH Z;  2IJH A;  4RWU A;  2EIN C;  2UU9 O;  5IWA B;  4X65 B;  2EIJ C;  3OD4 A;  4NXN O;  3CJH A;  3BHP A;  4MSW C;  4K0K O;  2UUC B;  3L73 H;  1FXK B;  4JI1 B;  5BMV A;  4HZ3 A;  4DV1 O;  1OCO C;  4U3J B;  3VQV A;  1QQC A;  2LJ2 A;  3ABL B;  1QR9 A;  1L0L H;  2A06 H;  1B6Q A;  2QWQ B;  2YXL A;  5KUK A;  4LF5 O;  2NR5 A;  1JCH A;  4I9Q A;  3CCS V;  3FD9 A;  2CTR A;  1PL0 A;  1FFX B;  4KFM A;  4JZG A;  1YI2 V;  2XUM A;  2JK5 C;  3A0H Z;  2QKA A;  3OMI B;  2UU9 B;  1VAR A;  1CXZ B;  1JMK C;  3TCU A;  2ZDI C;  4NXN B;  1VQ4 V;  1OV9 A;  5GON B;  4OXS A;  3JD1 A;  2DYR C;  4P2Z A;  3W7U A;  4DUZ B;  2ZM6 O;  1DF4 A;  4DV1 B;  2EIM B;  5FPR A;  1JX9 A;  1DF5 A;  1N32 B;  3UM7 A;  4KP4 A;  2H8P C;  4LF5 B;  5JJJ B;  3FFQ A;  2RJZ A;  1Q6I A;  4I5S A;  1XDC A;  3BRC A;  4U7O A;  5LGN A;  3FYI B;  3FYE B;  3JAT B;  2UXD B;  3HKD A;  5LA6 A;  2UXC O;  2WLJ A;  2QWR B;  1IZ3 A;  1WB8 A;  1KD1 W;  4DR4 O;  4DK0 A;  1PL4 A;  2Z3Y A;  1I08 A;  3OUS A;  1YF2 A;  3ABL C;  2ZM6 B;  3K06 A;  1WA8 B;  3JD4 A;  2LQT A;  1GK9 A;  4IHJ B;  4UV8 A;  5K1P A;  3HKC B;  4D7S A;  1N36 B;  2A9H A;  3DC5 A;  5CBH A;  3RYF B;  4PI2 A;  2Q8V A;  5H2F Z;  1KMI Z;  2P7T C;  3AG7 A;  4GYC B;  1WLE A;  1URF A;  4JZ2 A;  2UXN A;  1AR5 A;  3EHB B;  3JYC A;  5ITZ A;  3L75 H;  3EFF K;  2OCH A;  2ZQM A;  3JAK B;  2W6J G;  1QLE B;  4GT1 A;  4AHC A;  2UXC B;  1F4N A;  5CA1 B;  2WLN A;  4X1I B;  4GX0 A;  1EFR G;  3ZIA G;  2EIM C;  1LR1 A;  3D36 A;  4UVB A;  1T5E A;  4DR4 B;  4CH5 A;  3B8M A;  1Q81 W;  1NU1 H;  4GCZ A;  1BMF G;  1AP5 A;  3RVY A;  2XTA A;  3T1H O;  4BAY A;  1IBK B;  3D8C A;  4J41 A;  4G27 B;  4IT5 A;  1Z5W A;  1VQL V;  3AG3 B;  1K8A W;  2KG7 B;  3SYP A;  1VQO V;  1QVF U;  3CCE V;  3B2E E;  4QJF B;  1GM9 A;  4B3S O;  5C8Y B;  4NKG B;  1EZJ A;  4PD4 F;  1HNW O;  3SJA C;  1H2K A;  2O57 A;  4XDL A;  1Q82 W;  2CK3 G;  2YSU B;  3AK2 A;  4HBN A;  1S77 D;  2ZD9 A;  3ZX6 A;  5LP6 B;  2PUS A;  3ZRX A;  5B66 Z;  2R72 A;  3CHX A;  1SQF A;  2WLL B;  1YCI A;  5KAF Z;  2F4V O;  5B1A B;  4PDL A;  2HG5 C;  3J80 N;  4JYY A;  2WA4 A;  1V9P A;  4KUM A;  5GW7 A;  1VQ9 V;  4YHH B;  1FYJ A;  1PP9 H;  3ZMZ A;  3BY6 A;  4RAI A;  5EZY A;  3H9V A;  3ZRW B;  4QE7 A;  3B77 A;  1QCE A;  2V4D A;  3ASN C;  3CSX A;  3JD3 A;  4B3S B;  2XAH A;  4YJ3 B;  2EBO A;  3FB8 C;  1HNW B;  2K1E A;  3K58 A;  1J5E O;  2CDY A;  3O65 A;  1BT8 A;  4Z1M G;  3KCX A;  4FM1 A;  4DK1 A;  4MT8 A;  5D5Q A;  1M9N A;  4FVM A;  4R50 A;  3CC4 V;  2Q7G A;  4UUJ C;  5IYZ A;  4I7Z B;  1Q6U A;  2W0F C;  3JAW A;  2F4V B;  1WNS A;  3UT5 A;  1VQP V;  3RGB A;  1AP6 A;  1R3K C;  1ZL8 B;  1WB7 A;  4FK5 C;  1SER A;  4GX2 A;  1HW7 A;  4ZI7 A;  5A9G A;  1WPX A;  1OHH G;  2EZP A;  1G8M A;  2F95 B;  4PA6 A;  4ZKI A;  4Q20 A;  2YID A;  4H37 A;  5EC2 C;  2M6Y A;  3E89 A;  2X6B A;  4LH7 A;  1FAF A;  5LP6 C;  1ROP A;  5L3E A;  1YEW A;  1J5E B;  2ZIO A;  2UXB O;  2WLH A;  1N4C A;  3ZHT A;  5IJ0 B;  2CGO A;  1VQ5 V;  1PPJ H;  4CH6 A;  3GB7 C;  3VQX A;  4HNA A;  4J9Z B;  3JSN A;  3ZN0 A;  3ABK C;  3TK1 A;  3ETE A;  4AI8 A;  1N33 O;  3WG7 B;  3LDD A;  2V7Q G;  1D5N A;  4WFH A;  1XHZ A;  2VWK A;  3VQW A;  2Q0A A;  1FD9 A;  1MZE A;  1Q43 A;  2CTQ A;  2GUZ B;  4P9P A;  3SPI A;  3X2Q B;  4TSF G;  2DMX A;  1Y76 A;  4XBF A;  2XAF A;  4DV3 O;  4AIL C;  4JAA A;  4K35 A;  3C90 A;  4K3A A;  1LUV A;  2R9A A;  2ITD C;  4QNH B;  1NR7 A;  2Y4T A;  3JAL A;  4NTX A;  1MZF A;  5JQG B;  3BEH A;  1UJW B;  1P84 F;  1TUB B;  4UCU A;  4Q6G A;  5CMU A;  3IFX A;  4ZOL B;  4UVC A;  5B3S B;  2DN9 A;  1AB3 A;  5EYP B;  5EIB C;  1NTK H;  1JR9 A;  1M57 C;  1K33 A;  2LO1 A;  3JAS B;  3I5D A;  2YXH A;  1M56 B;  3JCU Z;  3H1L H;  1N33 B;  1FXK A;  2OT5 A;  4FLX A;  4U3J A;  4DR2 B;  1XL6 A;  2JGD A;  3K03 A;  2B9Z A;  2YI8 A;  3SJQ C;  3CXC U;  3U10 A;  1Y67 A;  4UCR A;  1RPR A;  1WPB A;  1AI5 A;  1I94 B;  3W7S A;  1J95 A;  3KKY A;  3A0R A;  3H01 A;  4A5U B;  4DV7 O;  3TJT A;  2ZNJ A;  1FFX A;  4LFB O;  5AG2 A;  4B3R O;  1AJN A;  3QO7 A;  4F4L A;  1M5I A;  1FS0 G;  1EBO A;  2IU3 A;  2DYS C;  3C3S A;  3LDC A;  3WG7 C;  2PI5 A;  1MNG A;  2HFE C;  4X1Y B;  4PDM A;  5GON A;  3SJB C;  4WBN B;  1KP2 A;  1W59 A;  4JI0 O;  1K4D C;  1ARO P;  1S3J A;  3K04 A;  3B40 A;  2HJF C;  4JYA O;  5CA0 B;  3OFN G;  2NN4 A;  1V55 C;  5LXT B;  3QNE A;  4O4L B;  4JTC B;  1DLB A;  1IBM B;  3K08 A;  2GBO A;  3L9D A;  1SC5 B;  1GH6 A;  3RT3 C;  5F2V O;  2AZ0 A;  2X6C A;  2XAS A;  2ZXW B;  1JFF B;  1Q7Y W;  5KHK A;  4N23 A;  4DV7 B;  5B3S C;  1EN4 A;  4B3M O;  4LFB B;  2EIN B;  4B3R B;  3ML0 A;  2V1D A;  4DRX B;  2BE3 A;  2JRI A;  1K5Q A;  5DN6 G;  3JAT A;  4FIP C;  5KUM A;  3CRQ A;  3OR7 C;  2BTQ B;  5JJN B;  1KP3 A;  1M56 C;  2YIC A;  3DXR A;  1G6U A;  1KKC A;  4ICG A;  4DW1 A;  4FLU A;  4GKJ O;  1OCO B;  1Y74 B;  5A2Q N;  2ITC C;  2ETN A;  1SA0 A;  1EN5 A;  1PNK A;  1N34 B;  4JYA B;  3H1I H;  2E3C A;  1H2G A;  1XRE A;  4B7E A;  1WP8 A;  5KA6 A;  1WA8 A;  3M99 B;  5H5N A;  3M8A A;  4Z2W A;  1IXB A;  2KQX A;  4IHJ A;  3HKC A;  5JWP A;  1R73 A;  4J42 A;  2A0L A;  3STL C;  4I55 B;  2LW7 A;  3ABT A;  3RYF A;  3MHH C;  4AQY O;  4WFB V;  4BW5 A;  1FXV A;  1JJO A;  3FB5 C;  3D3Q A;  1KQS U;  2QM8 A;  3K5O A;  1GKF A;  3U0Z A;  4B3M B;  4JI5 O;  4GUN A;  3JAK A;  5JCO C;  3R66 A;  4DV5 O;  1BE3 H;  2HP8 A;  5K1X A;  4FFK A;  4LC1 A;  5CA1 A;  3ETD A;  1QBZ A;  4OPA A;  4TV9 B;  4X1I A;  2QE7 G;  3CRC A;  4QPK A;  3AK3 A;  2DYR B;  4MW3 A;  4GKJ B;  3K5M A;  1AVM A;  3CCV V;  1NJI W;  1SET A;  1SQV H;  5BXZ A;  4MTF A;  4LWS B;  4JTD B;  1BL8 A;  1Z2G A;  2B5U A;  2OTJ V;  3SYC A;  2KG7 A;  1WJZ A;  1SQP H;  3APO A;  4CH4 A;  1N0N A;  2ADQ B;  3JSL A;  5C8Y A;  2E5L O;  3RN4 A;  3TXQ A;  4TWK A;  2UUB O;  4FMT A;  3CPW U;  2VWJ A;  2JDI G;  3QTC A;  3T1C A;  5KHJ A;  2NLJ C;  4H0L B;  4JI5 B;  4FLV A;  2RDC A;  4UCT A;  2LGQ A;  1IDS A;  1VF6 C;  3A0B Z;  4DO2 A;  4DV5 B;  5LP6 A;  1S5L Z;  1TVK A;  3JD2 A;  2WLL A;  2YIB D;  3E86 A;  1XHX A;  1PD3 A;  4CS3 A;  1R1B A;  2LFR A;  2Y0P A;  4GKK O;  3CC7 V;  4UCO A;  1HNX O;  2HR3 A;  3SYQ A;  1SZT A;  5IYD O;  4EKW A;  3TXS A;  4NXM B;  4Z1V A;  5BZB A;  2WA3 A;  4O4H A;  2Y69 B;  3OMN B;  3LUT B;  3Q4H B;  1JQ0 A;  3ZRW A;  1NH2 D;  4RQE A;  2P6J A;  5L3D A;  1S72 V;  2B1G A;  4JI8 O;  1SKV A;  3ZBH A;  2E5L B;  3ASO B;  1W0J G;  3KG2 A;  4YJ3 A;  4JI4 O;  3W7X A;  1M4U A;  2UUB B;  5KHI A;  3SYO A;  4LFC O;  1SF9 A;  2QM7 A;  1FJG O;  2BCC H;  2FYU H;  3ZS8 C;  3CMA V;  1RFY A;  4X20 B;  4PA4 A;  4X64 O;  3CCJ V;  4K0K B;  5CBG A;  3E22 B;  5JH7 B;  3N2G B;  1GN2 A;  5L3G A;  4PHZ A;  4JYB A;  1SQG A;  4DR3 O;  1RSO B;  2KKW A;  2IW5 A;  2ZIN A;  4G2K A;  1WN7 A;  2P4V A;  3CS5 A;  1BQZ A;  4GKK B;  2K9P A;  1HNX B;  1QLN A;  3H1H H;  1NVP D;  2ZCE A;  1Q8I A;  1VF7 A;  3MDS A;  2A7W A;  2XAQ A;  2F43 G;  4GLX A;  2QEX V;  4N21 A;  4JI8 B;  5H6R A;  4PA7 A;  4JI4 B;  4JI3 O;  1AIL A;  4LFC B;  1MA1 A;  3CXH F;  1FJG B;  1NR1 A;  1FXH A;  5EBM C;  4X64 B;  1IVS A;  3CX5 F;  1O9H A;  3A8T A;  3IC9 A;  3BAB A; 
#chains in the Genus database with same CATH homology
 2LJ2 A;  2H3O A;  1WAZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...