2H3OA

Structure of merft, a membrane protein with two trans-membrane helices
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
44
structure length
44
Chain Sequence
b'LVILLGVVGLSALTGYLDYVLLPALAIFIGLTIYAIQRKRQADA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MerF
molecule tags Membrane protein
source organism Morganella morganii
publication title Structure Determination of a Membrane Protein with Two Trans-membrane Helices in Aligned Phospholipid Bicelles by Solid-State NMR Spectroscopy.
pubmed doi rcsb
total genus 11
structure length 44
sequence length 44
ec nomenclature
pdb deposition date 2006-05-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11431 Transport_MerF Membrane transport protein MerF
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.910 Mainly Alpha Orthogonal Bundle Helix Hairpins bacterial mercury transporter, merf 2h3oA00
2H3OA 2LJ2A 1WAZA
chains in the Genus database with same CATH superfamily
2X6CA 2XUMA 3LDEA 4LNUB 1MNGA 4JI1O 2V7QG 1VF6C 2VWKA 3E8HA 3JSNA 3M99B 2WLLA 1YF2A 4PDVA 5IE9A 1IVSA 5LBQA 3K0GA 3ZIAG 4X62B 3STLC 4LWSB 3CWBH 4PELA 3WB2A 3WB0A 2E5LB 2DJVA 5LOVA 4J7JA 4JAUA 3ASOB 3CCMV 3MAQA 2XT9A 2P5OA 3BPZA 1UFIA 3JD0A 4U7OA 4X1KA 4JGSA 3ABMC 3P32A 3VQVA 5L3EA 3U10A 4D7SA 3ABLC 1Y66A 3ZEDA 4GKKO 1XNQB 4LP8A 3PN1A 5B1NA 2ETNA 3EVKA 2VWJA 1XHZA 1P4RA 1Q5OA 4RUFA 3OAAG 3OGIB 1NH2B 4MVMA 2WA4A 3DGEA 2W0XA 5KMGA 4KXRA 2UU9B 1IDSA 4UCSA 1I5XA 1SQFA 1QLNA 5B1AB 2P6JA 3VOUA 4LFBO 1YDXA 4LH6A 4K3AA 1V55C 3T2MA 1XREA 3L75H 4PA6A 1NTZH 3H1KH 5DM6V 1OCZC 2GTAA 3QO8A 4YJ2B 5BXZA 3I55V 1BQ0A 4IHJB 3A0RA 2A0LA 2FKXA 4J9ZB 3RWRD 2UXBB 2LW1A 3X2QB 3ZMTA 3AEIA 4B3MB 3J81N 3CJHB 2Q67A 4P9PA 1ORQC 4MSWC 4X64O 2F23A 4O4HA 1M93A 4JI3O 1WN7A 1N0NA 3W7SA 4DR4B 5ITZB 5BMVB 1SESA 3N2GA 2CDYA 1XMQB 1Q6IA 2O57A 1BZKA 2Q68A 1U97A 2K1EA 5FPOA 1LUVA 2YXHA 4NB5A 4TQDA 1P7BA 2JGUA 4AILC 2HVJC 1P49A 4O2AA 1WNSA 1N4CA 1XOUA 2WLIB 2ZINA 2P4VA 4IHJA 5LMUB 1BT8A 4B7EA 4CS2A 3KKYA 3DSQA 1WPBA 2DQ3A 2GBOA 2P90A 2DWDC 3HKCA 2ZNJA 4P30A 2FB5A 4FM1A 5EZYA 1L0NH 2ARHA 3STZC 3FB8C 1BSMA 1LUWA 3HKEB 5H2FZ 1QR9A 3ZN1A 4GX0A 2YEVB 2IJIA 3AK1A 4JPRA 5IYBO 2XAFA 4NKGB 1R3LC 2GSMB 2LGWA 2QM7A 1OCOB 2UUAB 1VF7A 4H13B 1KP2A 2ZE7A 1K73W 2ZNIA 4ZIBA 2VQEO 4FLUA 4GZRB 4YY3O 1TVKB 2IU3A 4MVUA 1BQZA 1K7DA 2AZ2A 3CEIA 5J2UA 4DV6O 3G4SV 2XTAA 4EFEA 5C93A 4LH7A 2ILMA 4RAIA 4C7UA 2UXXA 1JFFA 2YIBD 4KUMA 4LBEC 2M7WA 2YS8A 4JYCA 4ZHQB 2QA4V 2B9ZA 2RNBA 5CA0B 5E79Z 4LNUA 2QKSA 4UUJC 3FX7A 5CMUA 2ZCEA 1VQLV 4TV8B 2BTOA 2ZDIA 2H94A 1SC5B 3DXRA 2EIMC 1PV0A 4OX9O 2IU0A 2H3OA 3BA9A 1JJOA 4I55A 4I4TB 2AW9A 1VQNV 5KHGA 2WLHA 1S5LZ 5B66Z 2Y69B 1ZTEA 4DV0B 5LP6A 2LFSA 1EBOA 1RSOA 2W6IG 1M5IA 4I50B 1OV9A 1NTMH 1XL4A 3AG2C 2Q7HA 2Q7EA 1RFYA 4J80A 1KU9A 4HYOA 2UU9O 4N23A 1AJPA 3FAVB 4O2BB 5CBFA 4UCTA 4YJ2A 2ZQMA 2LGQA 2DYRB 3CP1A 1HNWO 1ENVA 4IYHA 4I55B 5H9CA 4YXWG 1NBMG 3CS5A 4WFHA 3FFQA 3SYCA 4IIJA 3ETGA 2Q6AA 3KCYA 1X59A 1PL4A 2EIJB 3ABKB 4XDJA 1AP6A 4P2ZA 2Q9LA 5CA3A 1Y76B 4JI6B 1FXKB 1QQCA 4G28B 3E83A 2AXTZ 5FNVB 5LP6C 2PZSA 4LF8O 4DR4O 4ZHQA 3SDLA 4X1YA 3Q4HA 1VQ7V 1NT2B 3RYHA 4F4LA 4PA3A 5HFLA 5CA1A 1CP9A 4JI2B 1SZTA 2ZE5A 2DWEC 3APOA 5LGNA 4JYBA 1K97A 2PYLA 3UO2A 3CMEV 1MSDA 3SPIA 3QG5A 4X20B 5B5EZ 3CCLV 4ZOLA 3FB7C 3IAYA 2V4DA 2P7TC 2EX3A 5J2TA 3A0HZ 3ETDA 1AI5A 4FFKA 4X88A 4DR7B 2F66C 1HNZO 3K03A 3QF7A 1IX9A 2QTOA 1NKDA 2B1GA 4O4JB 3K04A 1K9MW 3H1JH 4B08A 1YHQV 4WF9V 3AG4C 2L6LA 1GTOA 3L73H 1Q86W 5JCOA 2XAJA 2BTQA 2HJFC 1S77D 4QE9A 2WWWA 4NVPA 4PD4F 2XASA 4NTXA 1COWG 1UPGA 3C3TA 3E22A 5LXTB 3I56V 1K33A 4DR2B 1BL8A 1WAZA 2IJJA 5LHGA 1Z5WA 3E89A 2Y0IA 4DV4B 1KP3A 1T5EA 3QNEA 4DO2A 4DV1O 4DR6B 2E74B 2EJ7A 4DV3O 4GUNA 1BHBA 1MMMA 4LF9B 3JARB 1HW7A 2GHYA 3CRRA 2WAMA 3RT3C 1RPOA 3GB7C 1NZ6A 4WBNA 3KG2A 2BTQB 1EFRG 3M7MX 1VQKV 1N34O 4KHPO 2IJKA 1NS1A 3CX5F 4W4KA 4FMTA 4F6EA 2R9RB 4YJ3B 2N04A 4DR5B 3LSQA 3L74H 1MABG 4NTWA 3T1YO 5LGTA 3WFVA 1YITV 3EXAA 3JAWA 3E2EA 4PDLA 5KLVH 1URFA 4JI0B 3WG7C 3ZBHA 2UXCO 1FXVA 1PD3A 2EJRA 1GN2A 2YICA 1I08A 3GWOA 4I7ZB 1R3KC 1F23A 5KUMA 5JVDA 2Z5UA 1AILA 3D8CA 1FXKA 1VQPV 1R6KA 1J5EO 2Q73A 1NJIW 1Q90D 1D2DA 1QHTA 2WLJA 4OGQB 3UT5A 1Y67A 4JI4O 3CB2A 1F4MA 1GK9A 3EHBB 1GM7A 2EIMB 4EB6A 1YVWA 1FFXA 5IJ9B 3CCEV 3SPCA 1I94B 3CC2V 2VQFB 1V54C 4X1YB 3B8MA 3LSUA 3JALB 4Z2WA 3ABKC 4O4LA 2JJ2G 1CPYA 2X6AA 4FZ0A 4H44B 3JD4A 3LDCA 4I50A 2ZR3A 1B3QA 5FNVA 3OM3B 5IWAO 3JD2A 3HKCB 4X62O 2GTSA 2EZOA 3JASB 1SA0B 2Y48A 1THZA 2HP8A 1K92A 1YJWV 5DEDA 1FYJA 2A3QA 2WLIA 1V54B 2ADPA 4JAVA 1BMFG 4JASA 2B5UA 2JGDB 2RJZA 3ETQA 1SQQH 3D36A 4HNAB 3K58A 1GAXA 3W7WA 4DW1A 4CS3A 5B1AC 3BA8A 4DR7O 3K59A 1HNZB 4GKKB 3UO3A 1S5JA 4QNHB 1AR5A 1SERA 2AHYA 2BSKB 2NR5A 3JD3A 5BR8O 4A5UB 2RCVA 3SPHA 5IJ9A 5LP6B 2DQ0A 5CB4A 3B4SA 1R3JC 1WJZA 1GN3A 3OMNB 5GTIZ 3BHPA 1WA8B 1HNXB 1KKCA 4H33A 5C8YA 2UXBO 3OW2U 4B3MO 1QVFU 5TISZ 4PA7A 3CCVV 3CHXA 1SQBH 5FL7G 4BW5A 1YJNV 2CGOA 4X64B 4DV1B 3OEEG 3AG4B 4DR6O 1ZWIC 1GH6A 3CRAA 3ETEA 5H6QA 4QPKA 3BCCH 3BY6A 3Q4HB 5FLXN 1TAEA 1H38A 3CXCU 1XMOB 2QWNB 4JYAO 4UCVA 3TK1A 2F4VB 1H2SB 1KMIZ 1R6TA 3SYOA 4BR6A 4Z1MG 2QSAA 1OCCB 5EZYB 1L1FA 3D3IA 3ABUA 4UXNA 3ZHRA 1KYOF 1EZVH 5A9GA 2HG5C 1SQXH 5LHIA 3CCUV 3JALA 1SZXA 4DV2B 1JJ2U 4DR5O 1RPRA 2F95B 1I7FA 3ML0A 4NXNB 1K8AW 3SYPA 4TV9A 1DLBA 3ZJZA 1QU7A 2ZXWC 3NR7A 1OHHG 1WB8A 5D5QA 3P3NA 1VQ4V 4B7KA 3CRQA 3E8FA 4IL6Z 1KECA 1XQ8A 3OEHG 2HKOA 3NXSA 3P3PA 1E1RG 5IT9N 1QLEC 4J11A 4WFBV 4JZGA 2ZM6B 2UUAO 1EM1A 3SJQC 1P7GA 4NR1A 5LXTA 2CTWA 4TOIA 4W4LA 1D5NA 1MOFA 2EULA 5AG2A 3JD1A 4LFCO 3FYIB 3WB1A 2LW7A 4X89A 3MHHC 2HR3A 4I9WA 4TWKA 2BE3A 1QLEB 1YTFB 4FIPC 2DYRC 2P06A 4CC6A 4UCRA 2VQFO 1M1KW 4DW0A 3IJ4A 2CUGA 2UUCB 2OWOA 5CA0A 2YIBA 2OCHA 1JCHA 3ASNB 3ZRVA 5LHHA 5IWAB 3K5LA 2PTMA 1YZBA 1IXMA 3IGAC 2RN9A 3G71V 4LF6B 2QWQB 4KP4A 4QJFB 5EBLC 3QTCA 4IT5A 5K1PA 1O9GA 1ROPA 3B40A 3I5DA 4MTGA 4ABMA 5CBHA 4B3RB 3S3WA 3CCRV 1GM8A 2C2AA 4DV0O 2EIKC 3J80N 3PJSK 3CCSV 1GM9A 1GO3F 5EBWC 1K4CC 1JPXA 2CE4A 2WLNA 3JCUZ 3OMIB 3QVNA 4UVBA 4LF4O 4I4TA 2YSUB 4N21A 2QJ1A 2ITDC 2JGDA 3DXRB 1W0JG 5GW7A 4ZI7A 1F4NA 2EIKB 1FXKC 1AI6A 4LFAO 1HWYA 3JAWB 3UKMA 2ZIOA 4R6ZA 1Q7YW 1HNWB 2PI5A 3W7XA 1YSCA 1E1QG 5EBMC 4O4LB 4GX5A 1IXBA 3K0DA 4BIUA 4JI6O 3HB3B 4R50A 3HR0A 1XNRB 1NI8A 1VMGA 3HKDA 2WA3A 3ZHQA 4LF8B 3K08A 1F7YA 1XMOO 2R70A 2FTKA 1R3IC 1XL6A 4JYAB 3N2GB 1XHXA 1MG1A 5KA5A 4X65B 3H1IH 2CTRA 1J95A 3RYFA 4CZZA 2QKAA 3G6BA 4J7KA 4UV9A 1S72V 1FXHA 2KSDA 3FKSG 4PHZA 1H2NA 4XBFA 4JI2O 2JRIA 4FZ1A 4DRXA 1G4YB 3ZS8C 4DV2O 3OD4A 4R8CA 3AK2A 3AG1C 1W0KG 2IW5A 2GUZB 2GDSA 1JOYA 4EEQA 3CC7V 1DK1A 2ZE6A 5B1OA 1JMKC 4UCOA 4G27B 5KHKA 3AG7A 4UV8A 1PP9H 3ABTA 3K5MA 3RVZA 1GMGA 1TUBB 4CH4A 4ZKIA 2BCCH 2LO1A 3K9SA 2ZM6O 2R9IA 2Y4TA 2OCCB 2CK3G 3LNMB 2CTPA 4FFBB 5KHJA 4FLWA 1XEQA 1SA0A 1AI4A 3OTOB 3WU2Z 3LSSA 1Q43A 2AGAA 1VQ9V 2UXNA 2ITCC 3BABA 4CS4A 4DYLA 1M57C 1FD9A 1JQ0A 2X7RB 2IJHA 4DV5B 2CH7A 1XI1A 2E76B 4EB6B 3RYIA 4CH3A 4J7ZA 4DR2O 5JJJB 2F93B 2UUCO 4GX1A 3SPJA 3SGIA 2IH3C 1SQPH 3BFRA 1QBZA 5JCOC 3ZHTA 5GTHZ 1YJ9V 1G1XB 4FPPA 3UT5B 4PA4A 1DGSA 1Q6UA 2NN4A 3JAMN 4DUZO 4AQYO 4LF6O 1B04A 4LCUC 5KUKA 3T1HB 4ICGA 3H01A 3U11A 4CBCA 1PM9A 2EINC 3L9DA 2JK5C 1P84F 5E1AC 4I5SA 2DE0X 1WLEA 4BWAA 2JIZG 2EZPA 2P4KA 5L3BA 4ZI7B 1VQ5V 1SQVH 1HR0O 3GWKC 1AR1B 3HKBA 3JAKB 1US6A 4D7TA 1BE3H 5GONA 2QWOB 2X0LA 3FB6C 3T1YB 1N36B 4LF4B 2OTJV 3FB5C 1N0JA 4EFBA 4ZOLB 4YJ3A 3FAVA 4O2BA 4JI0O 3K79A 5ITZA 1H2MA 2D3OW 2LP7A 2W0FC 4LFAB 3CXHF 3SYAA 1O9HA 1SS3A 4MVZA 4GLXA 1WA8A 3AG2B 2YDEA 5IYDO 3L70H 1PNMA 2NLJC 4WFAV 1QR8A 5EIBC 1OJHA 3KCXA 3ZHVA 5LL6Y 5IY5C 2WSSG 3SPGA 4FFBA 4JI4B 1ZX3A 1OCRC 2PF4E 2FMLA 4UFZA 1SKVA 1TUBA 1EN6A 2QM8A 4X65O 4OPAA 4NXMO 2A06H 4TV8A 1E79G 3BRCA 1EN4A 3JSLA 2QWRB 3M8AA 3OR6C 4LC1A 3N2KA 4XDLA 2Q5ZA 1OCRB 2W6JG 4J10A 4HAMA 1YIJV 1K3EA 4GKJB 5DN6G 3JASA 4F6RB 3SJCC 4O4JA 3OGCC 4B3TB 4BIZA 4MT8A 5IDJA 3TJTA 1H2LA 3D36C 1B06A 1VARA 5L3FA 2CGNA 3RGBA 3B77A 1TVKA 5GONB 3UM7A 4PV1B 2MK3A 1FFXB 4BAYA 4E4EA 5F2VO 1AROP 1JVMA 5EC2C 3RYCA 1M56B 1VEWA 1ZAUA 3ZMVA 3OUSA 1LNQA 4JTDB 2X6BA 4TV9B 5BR8B 3F5TA 1KD1W 3MHSC 2FL4A 2RMKB 1R6NA 3CYOA 3OTOO 1VQ8V 2HHHB 4MW8A 5L3DA 1W59A 2XAHA 4DK1A 2HFEC 3ZHSA 2XAQA 4D6TH 1PNLA 1HNXO 5D5PA 1AJNA 1H8HG 4ZBMA 3C3SA 1OCOC 5H5NA 4K8ZA 2JS5A 1I0HA 1HP8A 2Q0AA 1DF5A 5J2TB 4RQEA 5KAFZ 4JI8O 4K0KB 3JATB 5JJEB 5IYZB 1Q81W 1XILA 1VF5B 1Z2GA 3T1HO 2PYJA 2NNUA 1RP3B 3GVMA 1BHAA 5J2UB 1VQMV 3ZX6A 2F4VO 2L35A 3C90A 1IZ3A 3T4DA 4LWSA 3CRMA 5C8YB 3CCJV 4IIJB 1GN4A 5B3SB 1NVPB 3BEHA 5B1BC 3A2FA 4WBNB 4B3SO 3IC9A 2F1MA 1VF6A 2WLLB 3ASNC 2UUBO 5JH7A 2FYUH 3F5WC 1KQSU 3ZHUA 1I5YA 1IBKO 1HR0B 1TUEB 2YI8A 2YUAA 3JARA 4DXWA 3DC6A 1M4UA 4JV5O 2OCCC 3B8NA 3L72H 2IH1C 1Q6HA 5EYPB 5JQGB 4NXNO 4HBNA 2A9HA 1R73A 3VQXA 4QE7A 2N74A 4I9QA 2DW4A 4U3JB 2KG7A 2PUSA 4TSFG 3ZRSA 2CTQA 2Q8VA 1Y76A 1R1BA 2ZR2A 2WLKA 3VBBA 4KFMA 4CC5A 5LGUA 3THOA 2XOKG 5BZBA 1L0LH 3SYQA 5IYCO 3QO7A 3SJAC 3WG7B 1F51A 4X66O 3RYFB 1YXBA 2HJDA 3G6EV 4LFCB 3J7AU 4JF3A 3RVYA 4OPHA 3TGUH 1M90W 4X1KB 1FKAO 4LR3A 1YEWA 3IFXA 5KAIZ 1N8RW 1JA8A 4X1IA 1NR1A 5LMNO 3K06A 1XNQO 2ADQB 2Q4PA 3OUFA 2WPDG 1MZFA 4UB6Z 3MDSA 2LJ2A 3ZMSA 1PKXA 1KC8W 3APQA 4O4IA 1JFFB 2QEXV 4NXMB 3ABMB 3HKBB 4X9QA 4J41A 4YIPA 1NH2D 3OE7G 4DR3B 4X1IB 3ZMUA 3ZRWA 1VIBA 4YHHO 3ABLB 3KZIZ 5IJ0B 3FD9A 4FLTA 2GV9A 4X20A 3RFRA 3RW0A 5EK0A 1IBLB 2RDCA 2QWPB 1MZEA 5KA6A 2R72A 3CPWU 4WFGA 4MTXA 5CA1B 4JI7O 1Q3EA 2KQXA 2XNDG 4MTFA 2VS0A 3DTUB 3F7YC 4MW3A 4PA9A 3RYHB 3CCQV 4J9YB 4B3RO 2V1DA 3R65A 4JI3B 4FVMA 3HPLC 4JZ2A 2B1IA 4YIOA 4FM0A 4JYYA 2DYSC 1SETA 2YIAA 1GKFA 1XMQO 1MA1A 2EBOA 5EIBD 3SR2C 1FJGB 1QNMA 1IURA 4TUYB 4AHCA 1YCIA 1TGOA 5IY5B 2QR4A 4O2AB 2LFRA 1NTKH 2XAGA 2D2CB 5LMUO 2DYSB 2QM4A 2ZT9B 2K9PA 1CXZB 4FLZA 2H8PC 2G38A 5K1XA 1M56C 1NU1H 5CB4B 1AB3A 4Q6GA 3W7UA 4U7NA 2QTSA 3CD6V 1ZUQA 4K8XA 4JI8B 1NQTA 3W7TA 2YEVA 1XNRO 4U3FH 1LR1A 3JYCA 1AVMA 2QE7G 4GYCB 2BSKA 2UXDB 3CSXA 1OCZB 4QGPA 3CJHA 1ZL8B 3K57A 3LUTB 1BCCH 3ICXA 4BIOA 5KX5A 1DF4A 3X2QC 1N32O 1PPJH 2YIDA 2PY5A 2VQEB 4WCEV 2ATKC 4YY3B 2AZ0A 4B3SB 2ZXWB 1RM1C 3FYEB 2UUBB 4DV6B 2YXYA 3UCSC 4RWUA 2VRZA 3TXSA 4Q20A 4I0XB 4JV5B 1GN6A 3CC4V 4LF7O 2JVDA 2Q0OC 4DK0A 1K4DC 1AI7A 1DTOA 4UCUA 1IBMO 2JEUA 1QVGU 5CN0A 5JWPA 5KHHA 3BVOA 1KUQA 5B3SC 1WP8A 3CMAV 3HKDB 3EFFK 2DMXA 5IYZA 4DUYB 4E2LA 1M57B 4X8AA 3JATA 3B09A 4IYIA 3B2EE 4JI5O 2DN9A 3ZN0A 5BY1A 3JAKA 3QO5A 2YC0A 4ASUG 4OX9B 2ODMA 3AK3A 2PI4A 1AR4A 5EC1C 4PI2A 4X66B 4MVOA 4NTYA 1B6QA 2Z0AA 4UB8Z 2QKCA 1QCEA 1KBHA 4TQFA 3F7VC 3OT7A 5L3GA 1Q82W 3E8BA 3ZCCA 5LMNB 1Y6XA 1L8DA 2AHZA 2P22C 5JVDB 4DV5O 1TA8A 1KKDA 4BW9A 1H8EG 3L71H 4DV7O 2KKWA 2IM9A 1VP7A 4EKWA 1S5HC 2F43G 2EINB 3HKEA 1FFTB 4OXSA 5KX5B 2KG7B 3RYIB 2E75B 4PDMA 4FLVA 3JCZA 4JAAA 3RBZA 4P9OA 4DR3O 1K5QA 1Q8IA 3G80A 4FM2A 4YHHB 2CH7B 4DUZB 2HLDG 4GX2A 2Y69C 4AQYB 5EYPA 4RQFA 1IBLO 4LF5O 1PNKA 4DR1O 4L8JA 2BOBC 4WFEA 1N33O 4QIWF 4FLXA 2PGGA 3OFNG 4G2KA 4F6RA 3UQ8A 3K9AA 1WP7A 4JI7B 4J42A 1V55B 3N2KB 4TT3G 4R7CA 2OIEA 1Y74B 3ASOC 5H6RA 4TUYA 1N36O 3A0BZ 4O4HB 1FJGO 2HVKC 1UJWB 3ZRXA 1S0VA 4JI1B 3G67A 3LDDA 1OZ0A 1RSOB 2ZD9A 3BAAA 2OYQA 3E22B 2HEPA 2JS3A 2QGNA 2GUZA 1ZLZA 1U96A 3OR7C 4RO2A 4KL1A 2ZKOA 3T4ZA 1NR7A 3T1CA 5L3CA 3MD0A 2RQ6A 5HFMA 1PL0A 2E5LO 3S3XA 1EZJA 3DC5A 5KMGB 1GRJA 1VQOV 1H2GA 2E3CA 4GT1A 1JX9A 2MW2B 3D3QA 3H9VA 2UXDO 5JH7B 2CAZC 3N27A 1CEZA 5J9PC 2JDIG 1SRYA 5A2QN 1BS3A 1N32B 2EIJC 2BOCC 5KHIA 2M6YA 2JEXA 1S3JA 3H1HH 4H37A 4UVAA 4PI0A 2OTLV 1S76D 3VQYA 2IBZH 4O4IB 3LNNA 1G6UA 4LFBB 2A7WA 4MVRA 4CH5A 2XHBA 5LOVB 1HDJA 2Y0PA 1AP5A 2YXLA 1KB9F 4LF7B 2QDOA 1WPXA 4GKJO 3R66A 4B3TO 4GCZA 3E8GA 4I0XA 1IBMB 4L87A 1X4TA 1NVPD 1V9PA 1OCCC 1ZSPA 2ZDIC 1Y4MA 2Q7GA 3AG3C 4FK5C 4DV4O 1FAFA 4UVCA 4DUYO 3O65A 4JI5B 1RM1B 4DV3B 4H0LB 1WB7A 3AG1B 3P30A 4QPJA 4LF9O 3CE2A 1D5AA 1YTFD 1XBLA 2ZE8A 2JJ1G 3H1LH 1FS0G 4U3JA 2Z3YA 5FPRA 4FJCC 5LA6B 1M9NA 5IJ0A 2EILC 2OIGA 1W2BU 5JJNB 3ZRWB 2OT5A 3AG3B 2P67A 4JTAB 3VQWA 1Z5VA 2N05A 3SJBC 4XDKA 2KB1A 1K34A 3RYCB 3U0ZA 4HZ3A 4MVQA 1N34B 4KHPB 2LQTA 2HHHO 4DRXB 3A8TA 3TXQA 1K5SA 5LYJB 4DV7B 4FLYA 2EILB 3K5NA 2Y4UA 5B1BB 1BGYH 4JTCB 1XDCA 1SF9A 5DECA 1AJQA 4WFFA 3K5OA 5BMVA 2YI9A 2UXCB 3OTFA 1SQGA 4K0KO 1G8MA 3OMAB 3CRCA 4AI8A 5LYJA 1MSWD 4CH6A 2WLMA 1YI2V 1A32A 4HNAA 4LF5B 2Q69A 4DR1B 1N33B 1EN5A 2R9AA 1J5EB 1H2KA 3O9OA 4RUEA 1XUQA 2ZIMA 3RN4A 3E35A 4Z1VA 4K35A 3TETA 1JR9A 5LA6A 4MTOA 1ZL8A 5CBGA 1VQ6V 1IBKB 3K3WA 4IGGA 4PJ0Z 3IC7A 2A79B 5JQGA 4MS2A 1FPOA 4NYKA 3TCUA 2DOSA 4MVSA 1Y74A 4PDRA 3ZMZA 1I94O 3E86A
chains in the Genus database with same CATH topology
2H3OA 2LJ2A 1WAZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2H3O A;  2LJ2 A;  1WAZ A; 
#chains in the Genus database with same CATH topology
 2X6C A;  2XUM A;  3LDE A;  4LNU B;  1MNG A;  4JI1 O;  2V7Q G;  1VF6 C;  2VWK A;  3E8H A;  3JSN A;  3M99 B;  2WLL A;  1YF2 A;  4PDV A;  5IE9 A;  1IVS A;  5LBQ A;  3K0G A;  3ZIA G;  4X62 B;  3STL C;  4LWS B;  3CWB H;  4PEL A;  3WB2 A;  3WB0 A;  2E5L B;  2DJV A;  5LOV A;  4J7J A;  4JAU A;  3ASO B;  3CCM V;  3MAQ A;  2XT9 A;  2P5O A;  3BPZ A;  1UFI A;  3JD0 A;  4U7O A;  4X1K A;  4JGS A;  3ABM C;  3P32 A;  3VQV A;  5L3E A;  3U10 A;  4D7S A;  3ABL C;  1Y66 A;  3ZED A;  4GKK O;  1XNQ B;  4LP8 A;  3PN1 A;  5B1N A;  2ETN A;  3EVK A;  2VWJ A;  1XHZ A;  1P4R A;  1Q5O A;  4RUF A;  3OAA G;  3OGI B;  1NH2 B;  4MVM A;  2WA4 A;  3DGE A;  2W0X A;  5KMG A;  4KXR A;  2UU9 B;  1IDS A;  4UCS A;  1I5X A;  1SQF A;  1QLN A;  5B1A B;  2P6J A;  3VOU A;  4LFB O;  1YDX A;  4LH6 A;  4K3A A;  1V55 C;  3T2M A;  1XRE A;  3L75 H;  4PA6 A;  1NTZ H;  3H1K H;  5DM6 V;  1OCZ C;  2GTA A;  3QO8 A;  4YJ2 B;  5BXZ A;  3I55 V;  1BQ0 A;  4IHJ B;  3A0R A;  2A0L A;  2FKX A;  4J9Z B;  3RWR D;  2UXB B;  2LW1 A;  3X2Q B;  3ZMT A;  3AEI A;  4B3M B;  3J81 N;  3CJH B;  2Q67 A;  4P9P A;  1ORQ C;  4MSW C;  4X64 O;  2F23 A;  4O4H A;  1M93 A;  4JI3 O;  1WN7 A;  1N0N A;  3W7S A;  4DR4 B;  5ITZ B;  5BMV B;  1SES A;  3N2G A;  2CDY A;  1XMQ B;  1Q6I A;  2O57 A;  1BZK A;  2Q68 A;  1U97 A;  2K1E A;  5FPO A;  1LUV A;  2YXH A;  4NB5 A;  4TQD A;  1P7B A;  2JGU A;  4AIL C;  2HVJ C;  1P49 A;  4O2A A;  1WNS A;  1N4C A;  1XOU A;  2WLI B;  2ZIN A;  2P4V A;  4IHJ A;  5LMU B;  1BT8 A;  4B7E A;  4CS2 A;  3KKY A;  3DSQ A;  1WPB A;  2DQ3 A;  2GBO A;  2P90 A;  2DWD C;  3HKC A;  2ZNJ A;  4P30 A;  2FB5 A;  4FM1 A;  5EZY A;  1L0N H;  2ARH A;  3STZ C;  3FB8 C;  1BSM A;  1LUW A;  3HKE B;  5H2F Z;  1QR9 A;  3ZN1 A;  4GX0 A;  2YEV B;  2IJI A;  3AK1 A;  4JPR A;  5IYB O;  2XAF A;  4NKG B;  1R3L C;  2GSM B;  2LGW A;  2QM7 A;  1OCO B;  2UUA B;  1VF7 A;  4H13 B;  1KP2 A;  2ZE7 A;  1K73 W;  2ZNI A;  4ZIB A;  2VQE O;  4FLU A;  4GZR B;  4YY3 O;  1TVK B;  2IU3 A;  4MVU A;  1BQZ A;  1K7D A;  2AZ2 A;  3CEI A;  5J2U A;  4DV6 O;  3G4S V;  2XTA A;  4EFE A;  5C93 A;  4LH7 A;  2ILM A;  4RAI A;  4C7U A;  2UXX A;  1JFF A;  2YIB D;  4KUM A;  4LBE C;  2M7W A;  2YS8 A;  4JYC A;  4ZHQ B;  2QA4 V;  2B9Z A;  2RNB A;  5CA0 B;  5E79 Z;  4LNU A;  2QKS A;  4UUJ C;  3FX7 A;  5CMU A;  2ZCE A;  1VQL V;  4TV8 B;  2BTO A;  2ZDI A;  2H94 A;  1SC5 B;  3DXR A;  2EIM C;  1PV0 A;  4OX9 O;  2IU0 A;  2H3O A;  3BA9 A;  1JJO A;  4I55 A;  4I4T B;  2AW9 A;  1VQN V;  5KHG A;  2WLH A;  1S5L Z;  5B66 Z;  2Y69 B;  1ZTE A;  4DV0 B;  5LP6 A;  2LFS A;  1EBO A;  1RSO A;  2W6I G;  1M5I A;  4I50 B;  1OV9 A;  1NTM H;  1XL4 A;  3AG2 C;  2Q7H A;  2Q7E A;  1RFY A;  4J80 A;  1KU9 A;  4HYO A;  2UU9 O;  4N23 A;  1AJP A;  3FAV B;  4O2B B;  5CBF A;  4UCT A;  4YJ2 A;  2ZQM A;  2LGQ A;  2DYR B;  3CP1 A;  1HNW O;  1ENV A;  4IYH A;  4I55 B;  5H9C A;  4YXW G;  1NBM G;  3CS5 A;  4WFH A;  3FFQ A;  3SYC A;  4IIJ A;  3ETG A;  2Q6A A;  3KCY A;  1X59 A;  1PL4 A;  2EIJ B;  3ABK B;  4XDJ A;  1AP6 A;  4P2Z A;  2Q9L A;  5CA3 A;  1Y76 B;  4JI6 B;  1FXK B;  1QQC A;  4G28 B;  3E83 A;  2AXT Z;  5FNV B;  5LP6 C;  2PZS A;  4LF8 O;  4DR4 O;  4ZHQ A;  3SDL A;  4X1Y A;  3Q4H A;  1VQ7 V;  1NT2 B;  3RYH A;  4F4L A;  4PA3 A;  5HFL A;  5CA1 A;  1CP9 A;  4JI2 B;  1SZT A;  2ZE5 A;  2DWE C;  3APO A;  5LGN A;  4JYB A;  1K97 A;  2PYL A;  3UO2 A;  3CME V;  1MSD A;  3SPI A;  3QG5 A;  4X20 B;  5B5E Z;  3CCL V;  4ZOL A;  3FB7 C;  3IAY A;  2V4D A;  2P7T C;  2EX3 A;  5J2T A;  3A0H Z;  3ETD A;  1AI5 A;  4FFK A;  4X88 A;  4DR7 B;  2F66 C;  1HNZ O;  3K03 A;  3QF7 A;  1IX9 A;  2QTO A;  1NKD A;  2B1G A;  4O4J B;  3K04 A;  1K9M W;  3H1J H;  4B08 A;  1YHQ V;  4WF9 V;  3AG4 C;  2L6L A;  1GTO A;  3L73 H;  1Q86 W;  5JCO A;  2XAJ A;  2BTQ A;  2HJF C;  1S77 D;  4QE9 A;  2WWW A;  4NVP A;  4PD4 F;  2XAS A;  4NTX A;  1COW G;  1UPG A;  3C3T A;  3E22 A;  5LXT B;  3I56 V;  1K33 A;  4DR2 B;  1BL8 A;  1WAZ A;  2IJJ A;  5LHG A;  1Z5W A;  3E89 A;  2Y0I A;  4DV4 B;  1KP3 A;  1T5E A;  3QNE A;  4DO2 A;  4DV1 O;  4DR6 B;  2E74 B;  2EJ7 A;  4DV3 O;  4GUN A;  1BHB A;  1MMM A;  4LF9 B;  3JAR B;  1HW7 A;  2GHY A;  3CRR A;  2WAM A;  3RT3 C;  1RPO A;  3GB7 C;  1NZ6 A;  4WBN A;  3KG2 A;  2BTQ B;  1EFR G;  3M7M X;  1VQK V;  1N34 O;  4KHP O;  2IJK A;  1NS1 A;  3CX5 F;  4W4K A;  4FMT A;  4F6E A;  2R9R B;  4YJ3 B;  2N04 A;  4DR5 B;  3LSQ A;  3L74 H;  1MAB G;  4NTW A;  3T1Y O;  5LGT A;  3WFV A;  1YIT V;  3EXA A;  3JAW A;  3E2E A;  4PDL A;  5KLV H;  1URF A;  4JI0 B;  3WG7 C;  3ZBH A;  2UXC O;  1FXV A;  1PD3 A;  2EJR A;  1GN2 A;  2YIC A;  1I08 A;  3GWO A;  4I7Z B;  1R3K C;  1F23 A;  5KUM A;  5JVD A;  2Z5U A;  1AIL A;  3D8C A;  1FXK A;  1VQP V;  1R6K A;  1J5E O;  2Q73 A;  1NJI W;  1Q90 D;  1D2D A;  1QHT A;  2WLJ A;  4OGQ B;  3UT5 A;  1Y67 A;  4JI4 O;  3CB2 A;  1F4M A;  1GK9 A;  3EHB B;  1GM7 A;  2EIM B;  4EB6 A;  1YVW A;  1FFX A;  5IJ9 B;  3CCE V;  3SPC A;  1I94 B;  3CC2 V;  2VQF B;  1V54 C;  4X1Y B;  3B8M A;  3LSU A;  3JAL B;  4Z2W A;  3ABK C;  4O4L A;  2JJ2 G;  1CPY A;  2X6A A;  4FZ0 A;  4H44 B;  3JD4 A;  3LDC A;  4I50 A;  2ZR3 A;  1B3Q A;  5FNV A;  3OM3 B;  5IWA O;  3JD2 A;  3HKC B;  4X62 O;  2GTS A;  2EZO A;  3JAS B;  1SA0 B;  2Y48 A;  1THZ A;  2HP8 A;  1K92 A;  1YJW V;  5DED A;  1FYJ A;  2A3Q A;  2WLI A;  1V54 B;  2ADP A;  4JAV A;  1BMF G;  4JAS A;  2B5U A;  2JGD B;  2RJZ A;  3ETQ A;  1SQQ H;  3D36 A;  4HNA B;  3K58 A;  1GAX A;  3W7W A;  4DW1 A;  4CS3 A;  5B1A C;  3BA8 A;  4DR7 O;  3K59 A;  1HNZ B;  4GKK B;  3UO3 A;  1S5J A;  4QNH B;  1AR5 A;  1SER A;  2AHY A;  2BSK B;  2NR5 A;  3JD3 A;  5BR8 O;  4A5U B;  2RCV A;  3SPH A;  5IJ9 A;  5LP6 B;  2DQ0 A;  5CB4 A;  3B4S A;  1R3J C;  1WJZ A;  1GN3 A;  3OMN B;  5GTI Z;  3BHP A;  1WA8 B;  1HNX B;  1KKC A;  4H33 A;  5C8Y A;  2UXB O;  3OW2 U;  4B3M O;  1QVF U;  5TIS Z;  4PA7 A;  3CCV V;  3CHX A;  1SQB H;  5FL7 G;  4BW5 A;  1YJN V;  2CGO A;  4X64 B;  4DV1 B;  3OEE G;  3AG4 B;  4DR6 O;  1ZWI C;  1GH6 A;  3CRA A;  3ETE A;  5H6Q A;  4QPK A;  3BCC H;  3BY6 A;  3Q4H B;  5FLX N;  1TAE A;  1H38 A;  3CXC U;  1XMO B;  2QWN B;  4JYA O;  4UCV A;  3TK1 A;  2F4V B;  1H2S B;  1KMI Z;  1R6T A;  3SYO A;  4BR6 A;  4Z1M G;  2QSA A;  1OCC B;  5EZY B;  1L1F A;  3D3I A;  3ABU A;  4UXN A;  3ZHR A;  1KYO F;  1EZV H;  5A9G A;  2HG5 C;  1SQX H;  5LHI A;  3CCU V;  3JAL A;  1SZX A;  4DV2 B;  1JJ2 U;  4DR5 O;  1RPR A;  2F95 B;  1I7F A;  3ML0 A;  4NXN B;  1K8A W;  3SYP A;  4TV9 A;  1DLB A;  3ZJZ A;  1QU7 A;  2ZXW C;  3NR7 A;  1OHH G;  1WB8 A;  5D5Q A;  3P3N A;  1VQ4 V;  4B7K A;  3CRQ A;  3E8F A;  4IL6 Z;  1KEC A;  1XQ8 A;  3OEH G;  2HKO A;  3NXS A;  3P3P A;  1E1R G;  5IT9 N;  1QLE C;  4J11 A;  4WFB V;  4JZG A;  2ZM6 B;  2UUA O;  1EM1 A;  3SJQ C;  1P7G A;  4NR1 A;  5LXT A;  2CTW A;  4TOI A;  4W4L A;  1D5N A;  1MOF A;  2EUL A;  5AG2 A;  3JD1 A;  4LFC O;  3FYI B;  3WB1 A;  2LW7 A;  4X89 A;  3MHH C;  2HR3 A;  4I9W A;  4TWK A;  2BE3 A;  1QLE B;  1YTF B;  4FIP C;  2DYR C;  2P06 A;  4CC6 A;  4UCR A;  2VQF O;  1M1K W;  4DW0 A;  3IJ4 A;  2CUG A;  2UUC B;  2OWO A;  5CA0 A;  2YIB A;  2OCH A;  1JCH A;  3ASN B;  3ZRV A;  5LHH A;  5IWA B;  3K5L A;  2PTM A;  1YZB A;  1IXM A;  3IGA C;  2RN9 A;  3G71 V;  4LF6 B;  2QWQ B;  4KP4 A;  4QJF B;  5EBL C;  3QTC A;  4IT5 A;  5K1P A;  1O9G A;  1ROP A;  3B40 A;  3I5D A;  4MTG A;  4ABM A;  5CBH A;  4B3R B;  3S3W A;  3CCR V;  1GM8 A;  2C2A A;  4DV0 O;  2EIK C;  3J80 N;  3PJS K;  3CCS V;  1GM9 A;  1GO3 F;  5EBW C;  1K4C C;  1JPX A;  2CE4 A;  2WLN A;  3JCU Z;  3OMI B;  3QVN A;  4UVB A;  4LF4 O;  4I4T A;  2YSU B;  4N21 A;  2QJ1 A;  2ITD C;  2JGD A;  3DXR B;  1W0J G;  5GW7 A;  4ZI7 A;  1F4N A;  2EIK B;  1FXK C;  1AI6 A;  4LFA O;  1HWY A;  3JAW B;  3UKM A;  2ZIO A;  4R6Z A;  1Q7Y W;  1HNW B;  2PI5 A;  3W7X A;  1YSC A;  1E1Q G;  5EBM C;  4O4L B;  4GX5 A;  1IXB A;  3K0D A;  4BIU A;  4JI6 O;  3HB3 B;  4R50 A;  3HR0 A;  1XNR B;  1NI8 A;  1VMG A;  3HKD A;  2WA3 A;  3ZHQ A;  4LF8 B;  3K08 A;  1F7Y A;  1XMO O;  2R70 A;  2FTK A;  1R3I C;  1XL6 A;  4JYA B;  3N2G B;  1XHX A;  1MG1 A;  5KA5 A;  4X65 B;  3H1I H;  2CTR A;  1J95 A;  3RYF A;  4CZZ A;  2QKA A;  3G6B A;  4J7K A;  4UV9 A;  1S72 V;  1FXH A;  2KSD A;  3FKS G;  4PHZ A;  1H2N A;  4XBF A;  4JI2 O;  2JRI A;  4FZ1 A;  4DRX A;  1G4Y B;  3ZS8 C;  4DV2 O;  3OD4 A;  4R8C A;  3AK2 A;  3AG1 C;  1W0K G;  2IW5 A;  2GUZ B;  2GDS A;  1JOY A;  4EEQ A;  3CC7 V;  1DK1 A;  2ZE6 A;  5B1O A;  1JMK C;  4UCO A;  4G27 B;  5KHK A;  3AG7 A;  4UV8 A;  1PP9 H;  3ABT A;  3K5M A;  3RVZ A;  1GMG A;  1TUB B;  4CH4 A;  4ZKI A;  2BCC H;  2LO1 A;  3K9S A;  2ZM6 O;  2R9I A;  2Y4T A;  2OCC B;  2CK3 G;  3LNM B;  2CTP A;  4FFB B;  5KHJ A;  4FLW A;  1XEQ A;  1SA0 A;  1AI4 A;  3OTO B;  3WU2 Z;  3LSS A;  1Q43 A;  2AGA A;  1VQ9 V;  2UXN A;  2ITC C;  3BAB A;  4CS4 A;  4DYL A;  1M57 C;  1FD9 A;  1JQ0 A;  2X7R B;  2IJH A;  4DV5 B;  2CH7 A;  1XI1 A;  2E76 B;  4EB6 B;  3RYI A;  4CH3 A;  4J7Z A;  4DR2 O;  5JJJ B;  2F93 B;  2UUC O;  4GX1 A;  3SPJ A;  3SGI A;  2IH3 C;  1SQP H;  3BFR A;  1QBZ A;  5JCO C;  3ZHT A;  5GTH Z;  1YJ9 V;  1G1X B;  4FPP A;  3UT5 B;  4PA4 A;  1DGS A;  1Q6U A;  2NN4 A;  3JAM N;  4DUZ O;  4AQY O;  4LF6 O;  1B04 A;  4LCU C;  5KUK A;  3T1H B;  4ICG A;  3H01 A;  3U11 A;  4CBC A;  1PM9 A;  2EIN C;  3L9D A;  2JK5 C;  1P84 F;  5E1A C;  4I5S A;  2DE0 X;  1WLE A;  4BWA A;  2JIZ G;  2EZP A;  2P4K A;  5L3B A;  4ZI7 B;  1VQ5 V;  1SQV H;  1HR0 O;  3GWK C;  1AR1 B;  3HKB A;  3JAK B;  1US6 A;  4D7T A;  1BE3 H;  5GON A;  2QWO B;  2X0L A;  3FB6 C;  3T1Y B;  1N36 B;  4LF4 B;  2OTJ V;  3FB5 C;  1N0J A;  4EFB A;  4ZOL B;  4YJ3 A;  3FAV A;  4O2B A;  4JI0 O;  3K79 A;  5ITZ A;  1H2M A;  2D3O W;  2LP7 A;  2W0F C;  4LFA B;  3CXH F;  3SYA A;  1O9H A;  1SS3 A;  4MVZ A;  4GLX A;  1WA8 A;  3AG2 B;  2YDE A;  5IYD O;  3L70 H;  1PNM A;  2NLJ C;  4WFA V;  1QR8 A;  5EIB C;  1OJH A;  3KCX A;  3ZHV A;  5LL6 Y;  5IY5 C;  2WSS G;  3SPG A;  4FFB A;  4JI4 B;  1ZX3 A;  1OCR C;  2PF4 E;  2FML A;  4UFZ A;  1SKV A;  1TUB A;  1EN6 A;  2QM8 A;  4X65 O;  4OPA A;  4NXM O;  2A06 H;  4TV8 A;  1E79 G;  3BRC A;  1EN4 A;  3JSL A;  2QWR B;  3M8A A;  3OR6 C;  4LC1 A;  3N2K A;  4XDL A;  2Q5Z A;  1OCR B;  2W6J G;  4J10 A;  4HAM A;  1YIJ V;  1K3E A;  4GKJ B;  5DN6 G;  3JAS A;  4F6R B;  3SJC C;  4O4J A;  3OGC C;  4B3T B;  4BIZ A;  4MT8 A;  5IDJ A;  3TJT A;  1H2L A;  3D36 C;  1B06 A;  1VAR A;  5L3F A;  2CGN A;  3RGB A;  3B77 A;  1TVK A;  5GON B;  3UM7 A;  4PV1 B;  2MK3 A;  1FFX B;  4BAY A;  4E4E A;  5F2V O;  1ARO P;  1JVM A;  5EC2 C;  3RYC A;  1M56 B;  1VEW A;  1ZAU A;  3ZMV A;  3OUS A;  1LNQ A;  4JTD B;  2X6B A;  4TV9 B;  5BR8 B;  3F5T A;  1KD1 W;  3MHS C;  2FL4 A;  2RMK B;  1R6N A;  3CYO A;  3OTO O;  1VQ8 V;  2HHH B;  4MW8 A;  5L3D A;  1W59 A;  2XAH A;  4DK1 A;  2HFE C;  3ZHS A;  2XAQ A;  4D6T H;  1PNL A;  1HNX O;  5D5P A;  1AJN A;  1H8H G;  4ZBM A;  3C3S A;  1OCO C;  5H5N A;  4K8Z A;  2JS5 A;  1I0H A;  1HP8 A;  2Q0A A;  1DF5 A;  5J2T B;  4RQE A;  5KAF Z;  4JI8 O;  4K0K B;  3JAT B;  5JJE B;  5IYZ B;  1Q81 W;  1XIL A;  1VF5 B;  1Z2G A;  3T1H O;  2PYJ A;  2NNU A;  1RP3 B;  3GVM A;  1BHA A;  5J2U B;  1VQM V;  3ZX6 A;  2F4V O;  2L35 A;  3C90 A;  1IZ3 A;  3T4D A;  4LWS A;  3CRM A;  5C8Y B;  3CCJ V;  4IIJ B;  1GN4 A;  5B3S B;  1NVP B;  3BEH A;  5B1B C;  3A2F A;  4WBN B;  4B3S O;  3IC9 A;  2F1M A;  1VF6 A;  2WLL B;  3ASN C;  2UUB O;  5JH7 A;  2FYU H;  3F5W C;  1KQS U;  3ZHU A;  1I5Y A;  1IBK O;  1HR0 B;  1TUE B;  2YI8 A;  2YUA A;  3JAR A;  4DXW A;  3DC6 A;  1M4U A;  4JV5 O;  2OCC C;  3B8N A;  3L72 H;  2IH1 C;  1Q6H A;  5EYP B;  5JQG B;  4NXN O;  4HBN A;  2A9H A;  1R73 A;  3VQX A;  4QE7 A;  2N74 A;  4I9Q A;  2DW4 A;  4U3J B;  2KG7 A;  2PUS A;  4TSF G;  3ZRS A;  2CTQ A;  2Q8V A;  1Y76 A;  1R1B A;  2ZR2 A;  2WLK A;  3VBB A;  4KFM A;  4CC5 A;  5LGU A;  3THO A;  2XOK G;  5BZB A;  1L0L H;  3SYQ A;  5IYC O;  3QO7 A;  3SJA C;  3WG7 B;  1F51 A;  4X66 O;  3RYF B;  1YXB A;  2HJD A;  3G6E V;  4LFC B;  3J7A U;  4JF3 A;  3RVY A;  4OPH A;  3TGU H;  1M90 W;  4X1K B;  1FKA O;  4LR3 A;  1YEW A;  3IFX A;  5KAI Z;  1N8R W;  1JA8 A;  4X1I A;  1NR1 A;  5LMN O;  3K06 A;  1XNQ O;  2ADQ B;  2Q4P A;  3OUF A;  2WPD G;  1MZF A;  4UB6 Z;  3MDS A;  2LJ2 A;  3ZMS A;  1PKX A;  1KC8 W;  3APQ A;  4O4I A;  1JFF B;  2QEX V;  4NXM B;  3ABM B;  3HKB B;  4X9Q A;  4J41 A;  4YIP A;  1NH2 D;  3OE7 G;  4DR3 B;  4X1I B;  3ZMU A;  3ZRW A;  1VIB A;  4YHH O;  3ABL B;  3KZI Z;  5IJ0 B;  3FD9 A;  4FLT A;  2GV9 A;  4X20 A;  3RFR A;  3RW0 A;  5EK0 A;  1IBL B;  2RDC A;  2QWP B;  1MZE A;  5KA6 A;  2R72 A;  3CPW U;  4WFG A;  4MTX A;  5CA1 B;  4JI7 O;  1Q3E A;  2KQX A;  2XND G;  4MTF A;  2VS0 A;  3DTU B;  3F7Y C;  4MW3 A;  4PA9 A;  3RYH B;  3CCQ V;  4J9Y B;  4B3R O;  2V1D A;  3R65 A;  4JI3 B;  4FVM A;  3HPL C;  4JZ2 A;  2B1I A;  4YIO A;  4FM0 A;  4JYY A;  2DYS C;  1SET A;  2YIA A;  1GKF A;  1XMQ O;  1MA1 A;  2EBO A;  5EIB D;  3SR2 C;  1FJG B;  1QNM A;  1IUR A;  4TUY B;  4AHC A;  1YCI A;  1TGO A;  5IY5 B;  2QR4 A;  4O2A B;  2LFR A;  1NTK H;  2XAG A;  2D2C B;  5LMU O;  2DYS B;  2QM4 A;  2ZT9 B;  2K9P A;  1CXZ B;  4FLZ A;  2H8P C;  2G38 A;  5K1X A;  1M56 C;  1NU1 H;  5CB4 B;  1AB3 A;  4Q6G A;  3W7U A;  4U7N A;  2QTS A;  3CD6 V;  1ZUQ A;  4K8X A;  4JI8 B;  1NQT A;  3W7T A;  2YEV A;  1XNR O;  4U3F H;  1LR1 A;  3JYC A;  1AVM A;  2QE7 G;  4GYC B;  2BSK A;  2UXD B;  3CSX A;  1OCZ B;  4QGP A;  3CJH A;  1ZL8 B;  3K57 A;  3LUT B;  1BCC H;  3ICX A;  4BIO A;  5KX5 A;  1DF4 A;  3X2Q C;  1N32 O;  1PPJ H;  2YID A;  2PY5 A;  2VQE B;  4WCE V;  2ATK C;  4YY3 B;  2AZ0 A;  4B3S B;  2ZXW B;  1RM1 C;  3FYE B;  2UUB B;  4DV6 B;  2YXY A;  3UCS C;  4RWU A;  2VRZ A;  3TXS A;  4Q20 A;  4I0X B;  4JV5 B;  1GN6 A;  3CC4 V;  4LF7 O;  2JVD A;  2Q0O C;  4DK0 A;  1K4D C;  1AI7 A;  1DTO A;  4UCU A;  1IBM O;  2JEU A;  1QVG U;  5CN0 A;  5JWP A;  5KHH A;  3BVO A;  1KUQ A;  5B3S C;  1WP8 A;  3CMA V;  3HKD B;  3EFF K;  2DMX A;  5IYZ A;  4DUY B;  4E2L A;  1M57 B;  4X8A A;  3JAT A;  3B09 A;  4IYI A;  3B2E E;  4JI5 O;  2DN9 A;  3ZN0 A;  5BY1 A;  3JAK A;  3QO5 A;  2YC0 A;  4ASU G;  4OX9 B;  2ODM A;  3AK3 A;  2PI4 A;  1AR4 A;  5EC1 C;  4PI2 A;  4X66 B;  4MVO A;  4NTY A;  1B6Q A;  2Z0A A;  4UB8 Z;  2QKC A;  1QCE A;  1KBH A;  4TQF A;  3F7V C;  3OT7 A;  5L3G A;  1Q82 W;  3E8B A;  3ZCC A;  5LMN B;  1Y6X A;  1L8D A;  2AHZ A;  2P22 C;  5JVD B;  4DV5 O;  1TA8 A;  1KKD A;  4BW9 A;  1H8E G;  3L71 H;  4DV7 O;  2KKW A;  2IM9 A;  1VP7 A;  4EKW A;  1S5H C;  2F43 G;  2EIN B;  3HKE A;  1FFT B;  4OXS A;  5KX5 B;  2KG7 B;  3RYI B;  2E75 B;  4PDM A;  4FLV A;  3JCZ A;  4JAA A;  3RBZ A;  4P9O A;  4DR3 O;  1K5Q A;  1Q8I A;  3G80 A;  4FM2 A;  4YHH B;  2CH7 B;  4DUZ B;  2HLD G;  4GX2 A;  2Y69 C;  4AQY B;  5EYP A;  4RQF A;  1IBL O;  4LF5 O;  1PNK A;  4DR1 O;  4L8J A;  2BOB C;  4WFE A;  1N33 O;  4QIW F;  4FLX A;  2PGG A;  3OFN G;  4G2K A;  4F6R A;  3UQ8 A;  3K9A A;  1WP7 A;  4JI7 B;  4J42 A;  1V55 B;  3N2K B;  4TT3 G;  4R7C A;  2OIE A;  1Y74 B;  3ASO C;  5H6R A;  4TUY A;  1N36 O;  3A0B Z;  4O4H B;  1FJG O;  2HVK C;  1UJW B;  3ZRX A;  1S0V A;  4JI1 B;  3G67 A;  3LDD A;  1OZ0 A;  1RSO B;  2ZD9 A;  3BAA A;  2OYQ A;  3E22 B;  2HEP A;  2JS3 A;  2QGN A;  2GUZ A;  1ZLZ A;  1U96 A;  3OR7 C;  4RO2 A;  4KL1 A;  2ZKO A;  3T4Z A;  1NR7 A;  3T1C A;  5L3C A;  3MD0 A;  2RQ6 A;  5HFM A;  1PL0 A;  2E5L O;  3S3X A;  1EZJ A;  3DC5 A;  5KMG B;  1GRJ A;  1VQO V;  1H2G A;  2E3C A;  4GT1 A;  1JX9 A;  2MW2 B;  3D3Q A;  3H9V A;  2UXD O;  5JH7 B;  2CAZ C;  3N27 A;  1CEZ A;  5J9P C;  2JDI G;  1SRY A;  5A2Q N;  1BS3 A;  1N32 B;  2EIJ C;  2BOC C;  5KHI A;  2M6Y A;  2JEX A;  1S3J A;  3H1H H;  4H37 A;  4UVA A;  4PI0 A;  2OTL V;  1S76 D;  3VQY A;  2IBZ H;  4O4I B;  3LNN A;  1G6U A;  4LFB B;  2A7W A;  4MVR A;  4CH5 A;  2XHB A;  5LOV B;  1HDJ A;  2Y0P A;  1AP5 A;  2YXL A;  1KB9 F;  4LF7 B;  2QDO A;  1WPX A;  4GKJ O;  3R66 A;  4B3T O;  4GCZ A;  3E8G A;  4I0X A;  1IBM B;  4L87 A;  1X4T A;  1NVP D;  1V9P A;  1OCC C;  1ZSP A;  2ZDI C;  1Y4M A;  2Q7G A;  3AG3 C;  4FK5 C;  4DV4 O;  1FAF A;  4UVC A;  4DUY O;  3O65 A;  4JI5 B;  1RM1 B;  4DV3 B;  4H0L B;  1WB7 A;  3AG1 B;  3P30 A;  4QPJ A;  4LF9 O;  3CE2 A;  1D5A A;  1YTF D;  1XBL A;  2ZE8 A;  2JJ1 G;  3H1L H;  1FS0 G;  4U3J A;  2Z3Y A;  5FPR A;  4FJC C;  5LA6 B;  1M9N A;  5IJ0 A;  2EIL C;  2OIG A;  1W2B U;  5JJN B;  3ZRW B;  2OT5 A;  3AG3 B;  2P67 A;  4JTA B;  3VQW A;  1Z5V A;  2N05 A;  3SJB C;  4XDK A;  2KB1 A;  1K34 A;  3RYC B;  3U0Z A;  4HZ3 A;  4MVQ A;  1N34 B;  4KHP B;  2LQT A;  2HHH O;  4DRX B;  3A8T A;  3TXQ A;  1K5S A;  5LYJ B;  4DV7 B;  4FLY A;  2EIL B;  3K5N A;  2Y4U A;  5B1B B;  1BGY H;  4JTC B;  1XDC A;  1SF9 A;  5DEC A;  1AJQ A;  4WFF A;  3K5O A;  5BMV A;  2YI9 A;  2UXC B;  3OTF A;  1SQG A;  4K0K O;  1G8M A;  3OMA B;  3CRC A;  4AI8 A;  5LYJ A;  1MSW D;  4CH6 A;  2WLM A;  1YI2 V;  1A32 A;  4HNA A;  4LF5 B;  2Q69 A;  4DR1 B;  1N33 B;  1EN5 A;  2R9A A;  1J5E B;  1H2K A;  3O9O A;  4RUE A;  1XUQ A;  2ZIM A;  3RN4 A;  3E35 A;  4Z1V A;  4K35 A;  3TET A;  1JR9 A;  5LA6 A;  4MTO A;  1ZL8 A;  5CBG A;  1VQ6 V;  1IBK B;  3K3W A;  4IGG A;  4PJ0 Z;  3IC7 A;  2A79 B;  5JQG A;  4MS2 A;  1FPO A;  4NYK A;  3TCU A;  2DOS A;  4MVS A;  1Y74 A;  4PDR A;  3ZMZ A;  1I94 O;  3E86 A; 
#chains in the Genus database with same CATH homology
 2H3O A;  2LJ2 A;  1WAZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...