2H3OA

Structure of merft, a membrane protein with two trans-membrane helices
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
44
structure length
44
Chain Sequence
LVILLGVVGLSALTGYLDYVLLPALAIFIGLTIYAIQRKRQADA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MerF
publication title Structure Determination of a Membrane Protein with Two Trans-membrane Helices in Aligned Phospholipid Bicelles by Solid-State NMR Spectroscopy.
pubmed doi rcsb
source organism Morganella morganii
molecule tags Membrane protein
total genus 11
structure length 44
sequence length 44
ec nomenclature
pdb deposition date 2006-05-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11431 Transport_MerF Membrane transport protein MerF
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.910 Mainly Alpha Orthogonal Bundle Helix Hairpins bacterial mercury transporter, merf 2h3oA00
1WAZA 2H3OA 2LJ2A
chains in the Genus database with same CATH superfamily
4X1KB 1V55C 3ABKC 4DV1B 2QWQB 4FZ0A 4JAAA 2VWKA 2V4DA 2B1IA 4LF6B 3ASOB 3ZN0A 1Y66A 2A9HA 1TVKA 5KAFZ 1L1FA 4FMTA 4XBFA 1GN6A 1VQLV 4FVMA 4JI8B 4ICGA 3W7UA 4DV6O 4FFKA 1K9MW 4FJCC 3H1LH 3ABUA 2Q7EA 2GTSA 2KG7A 4DR4B 2DN9A 3K08A 4DV0O 1SQVH 1H2KA 3JSNA 1K5QA 3CRAA 4DR5B 3ZBHA 4CH5A 3CRMA 1HNXO 2F4VB 4MTFA 1VMGA 3UT5A 1AVMA 4X62O 2CTWA 1SQBH 1QLEB 3ZS8C 5J9PC 1KKDA 4MT8A 4ZBMA 1N0JA 2H3OA 3ABTA 5ITZB 4NTXA 5B1AC 3CP1A 5JJJB 3E2EA 4IYIA 4JI2O 3K06A 4CS2A 3LSQA 4WFBV 3EFFK 3OMIB 3SYOA 2Q69A 3FKSG 3ICXA 2UXBO 2QGNA 4UUJC 1I0HA 1WNSA 1BHAA 1CP9A 4X9QA 4UVBA 3ZHUA 4R50A 3E22B 2UUAB 2K1EA 1R3JC 3JCZA 2HFEC 4IL6Z 1DLBA 1DF5A 1VQOV 3CX5F 5JCOA 1JR9A 4DV4B 1NR1A 1XBLA 5BMVA 3AG7A 4O4LB 4MW3A 1NJIW 2WA4A 4DV5B 3B77A 1N8RW 1Q43A 1MSDA 3AG1B 4NXNB 1WP7A 4DW0A 3QO7A 4O2AA 2QKSA 3AG2C 1TUEB 3FYEB 4I55A 4MTXA 4U7NA 3B8MA 5CMUA 2QTSA 5H6RA 3CC7V 1XNRB 3SPGA 3RYFA 2XAHA 2A7WA 1WA8B 3U0ZA 4B3TB 5KA6A 2A79B 1U96A 3PN1A 3CSXA 4F6RA 4DR6B 3H9VA 3UKMA 4JPRA 3RYHA 1K5SA 2ZT9B 5CN0A 3T2MA 3G71V 3A0HZ 2ZM6B 3CCSV 2E3CA 3ASNC 2P90A 5LMNB 5BZBA 1S5HC 1PD3A 4B3SB 2NLJC 1K73W 1TVKB 1NTKH 4RQFA 3AG4B 4X88A 4GYCB 2DW4A 1H2SB 4PDRA 2VWJA 4CS4A 3TK1A 2YICA 4MTOA 2ZDIC 3SPCA 5IYCO 2GV9A 2ZE5A 4UB8Z 3W7XA 1V54B 2N05A 4X8AA 4MVQA 1AR4A 1TA8A 2HVJC 2EX3A 2R72A 1OV9A 2WA3A 5AG2A 1M57C 5LXTA 2PI5A 5B3SB 1ROPA 5BR8B 2RNBA 2QSAA 5LMUO 3ZRVA 2CH7A 3B09A 4U3JA 5J2UA 3WG7C 5JVDA 5LL6Y 4CC6A 3N2KA 3RN4A 4J41A 2ZNIA 3SDLA 2Q0AA 2LO1A 3EVKA 4GX5A 1JOYA 3FB8C 2OCHA 4IYHA 2CTRA 3DC6A 2L6LA 3P32A 2Q68A 2XTAA 2IU3A 2Q8VA 4ASUG 1X59A 4J10A 5FLXN 1R3LC 1GKFA 4LF9B 3E8FA 3D3IA 1HP8A 4AHCA 5B1OA 3ETQA 3K57A 4JI6B 1P7BA 4OPHA 2RCVA 5DEDA 2JGDA 1HNZO 1JPXA 4I50B 3DGEA 4AQYO 3RWRD 4DR3B 1KD1W 1OCOC 1IBMO 4PI0A 4FPPA 5BMVB 3J80N 4MS2A 2A3QA 4H37A 5LBQA 5L3BA 1K4DC 2ZCEA 3TGUH 1ENVA 2P7TC 3ABLB 4U3FH 4DR1O 5L3EA 5LGTA 4LF4B 3I55V 1NS1A 3AK3A 4QPKA 4JI7B 4NR1A 4GKJO 1K4CC 3GWOA 4X62B 1YVWA 1SKVA 3SR2C 5JQGA 2B1GA 3ETGA 5GTIZ 1NQTA 1Y4MA 2FTKA 2CDYA 3G6BA 2QR4A 2EIJB 4F6RB 2VQEB 3FB5C 5BY1A 3UQ8A 2QWNB 1QNMA 3A8TA 2HHHB 2L35A 2QWPB 3RYHB 3SPIA 2UXBB 4PA4A 2LFSA 4R7CA 1FXKA 2JS5A 3QTCA 2QKCA 4U7OA 2C2AA 5E1AC 1ZL8A 2N74A 3K9SA 4EB6A 2YIBD 4X1YA 3JATB 4PA7A 4ZOLA 4CBCA 4FM1A 1WB8A 2KQXA 4O4HB 4NVPA 3UCSC 4B7EA 2K9PA 3U11A 3ABMC 4X65O 2Y4UA 3RYCA 3A0BZ 1OCZB 2IJJA 1KKCA 1RPRA 3ZX6A 5L3FA 5KHGA 1UPGA 3F5TA 4FFBA 1SQGA 3ZRSA 1EN5A 1PL0A 4DUYO 4FLWA 3P3NA 3DSQA 4KFMA 1JFFA 4WFEA 2RMKB 4JAUA 5LXTB 3T1HB 3TJTA 2CH7B 4F6EA 4JYAO 3JARB 4U3JB 5J2UB 4H44B 3N2KB 3VQYA 1IVSA 3LSSA 3GVMA 4G27B 1N4CA 1XDCA 4FLXA 3BCCH 4OPAA 1IZ3A 3CCUV 1GM9A 3P30A 2AHZA 3BAAA 4JYYA 1VQNV 1EN4A 3IAYA 1M9NA 3K3WA 5L3GA 2P22C 1NKDA 4O4IB 1OZ0A 3K04A 1K34A 1QVGU 4GLXA 1Y6XA 1S3JA 3JD2A 2FL4A 4JI1B 2LGWA 3F7VC 2A0LA 3WU2Z 2JIZG 1R1BA 3RT3C 1YJWV 2EULA 1H38A 1XI1A 2Q7HA 4X1KA 2ADPA 4JV5B 4DK0A 1N36B 1I7FA 1FXVA 1TUBA 4LH6A 4TUYA 4NXMO 4OX9B 3FAVA 5JQGB 2ZD9A 1IX9A 4CH4A 1MMMA 5C93A 1J5EB 4Z1VA 2H94A 3H1IH 1AROP 1XQ8A 3MDSA 1GN4A 1DTOA 5IDJA 3JD0A 2Y69B 3E89A 4NKGB 4JI4O 4K0KO 3SPHA 4BIZA 1SA0B 5EIBC 4LF5O 4XDLA 1FXKB 3HR0A 5L3DA 2IJIA 4IIJA 4EEQA 4I5SA 3CC4V 4L87A 4EB6B 3IGAC 4X1YB 1HNZB 1NVPD 2IH3C 4GX1A 4J7JA 4J80A 1N34O 1QR9A 4UCVA 2B9ZA 4C7UA 5H5NA 1NTMH 1W0JG 1AJQA 1WPXA 2HG5C 3W7WA 3CCVV 3RYCB 4DR7O 4RUEA 2R9RB 1VF6C 2IJHA 4FFBB 5ITZA 3OE7G 1W0KG 2ZKOA 2YEVB 4JI5O 1M56C 1R6NA 4DR1B 1Q3EA 1JFFB 3VQWA 3ZHRA 1YSCA 4YHHO 4HAMA 3E83A 4K8XA 4LFBO 3SGIA 1NBMG 3RGBA 1URFA 5DECA 3ZMVA 2HR3A 4LF7B 3E22A 1QBZA 3OR7C 1VF7A 2Y48A 3CHXA 2E76B 1HDJA 1XILA 5H2FZ 5DN6G 4TSFG 3CWBH 3I5DA 1DGSA 2EJ7A 4O4LA 3ZEDA 5H6QA 1S72V 4HYOA 1EZJA 3B40A 3F5WC 5LP6A 4ZHQA 4X64O 1YF2A 4GCZA 3QG5A 1IBKO 4W4KA 1HR0O 1AP5A 1I5YA 5IJ0A 4DV2O 3MHSC 2G38A 2Q0OC 4H13B 4QGPA 3OEEG 1WA8A 2CGNA 2JS3A 2HVKC 2FB5A 3SJAC 5J2TA 4DUYB 4DR2O 4FIPC 4B3MO 4MVOA 3E8HA 4ZKIA 1YHQV 2F43G 3RFRA 3THOA 1Q82W 2CK3G 4J9YB 4LFCB 3DXRA 1PNMA 1QLNA 4B3RB 3M8AA 2A06H 4QNHB 1OCRB 1BMFG 1KUQA 1TUBB 4TUYB 1W59A 4KL1A 3FAVB 4LC1A 5IY5C 4KP4A 3ZJZA 4N23A 5K1PA 1K7DA 1ZAUA 4PJ0Z 4CH3A 2Q9LA 1NTZH 5EC1C 1UJWB 1H2LA 5IJ9A 4B7KA 2UUBO 3KG2A 3LNNA 3I56V 4WF9V 2M6YA 3SYAA 5EBWC 4IIJB 2JK5C 3K59A 4FLTA 3QO5A 5DM6V 2R9IA 1PNKA 2ADQB 5JH7B 2IU0A 1S0VA 2BTQA 1AP6A 1FJGO 3NXSA 3AG3C 2FKXA 3FB6C 3L72H 2F93B 2AZ0A 2DQ3A 4NTYA 2KSDA 1NH2D 1QHTA 4GKKO 3L75H 1PV0A 1AI7A 4YJ2A 1BE3H 4KHPB 5LA6B 4I9WA 1VQ5V 1S5JA 4DO2A 3AK2A 4YJ3B 1Q81W 4WFHA 5LHGA 1NR7A 3R65A 2O57A 1GM8A 4DV7B 4K8ZA 1SESA 1VQKV 1AI4A 1HWYA 1EBOA 4I50A 1K8AW 4B08A 4MVMA 1R3KC 1RPOA 2Q4PA 2OT5A 4PDLA 1KMIZ 3CB2A 4MTGA 4K0KB 4LF5B 3O65A 2RDCA 4G28B 1GRJA 3N2GA 3BPZA 4X89A 2GTAA 1YCIA 3K0DA 1RP3B 1NVPB 5LP6B 4H33A 4ZHQB 2CTPA 1IXBA 5B1BB 4BIUA 3JAWA 3OMNB 5IJ0B 2GUZA 4J7KA 3OM3B 4CZZA 2PYLA 4UCUA 3ASOC 2DYRC 3G80A 4X20A 5GONB 1BZKA 4JYBA 2ZXWB 3OUFA 5KX5A 3K5NA 1FXHA 2ZE6A 4YY3O 3IC7A 5J2TB 5LGNA 1YTFD 3OR6C 3L9DA 1KB9F 1GO3F 3DXRB 4TWKA 1EN6A 1LR1A 2Y4TA 2E5LO 4JI3B 2WWWA 1JX9A 1SZXA 1P49A 1P4RA 4MVZA 2QDOA 3ZRWB 4LFBB 1YEWA 1R6KA 2VQFO 1XMQO 2EJRA 3JATA 5CBGA 3OTOO 2DYSB 4O2BA 4FM2A 1ORQC 1WP8A 4O4HA 4DV3O 4UCOA 1F4NA 1QLEC 3CEIA 2PZSA 2PTMA 1ZX3A 5IJ9B 4PA3A 3T1YB 4H0LB 3IC9A 1XMOO 2CE4A 3X2QB 5IYZA 1S77D 4LFAO 3K03A 1N32O 3BRCA 1NI8A 2YUAA 2WLKA 4QIWF 3MD0A 4DV2B 4I0XA 5IYBO 2YXYA 4J42A 1FYJA 1OCCB 1FAFA 4PA9A 3STLC 2BTQB 1JVMA 2XHBA 4JI0B 1A32A 4TV9A 3JARA 5EZYB 4LCUC 2Q7GA 2HLDG 2X7RB 2UXNA 3ZMUA 4FM0A 1GAXA 3JALA 2YDEA 3OT7A 3J7AU 2ITDC 3U10A 4YJ2B 5HFLA 3AG1C 3ABMB 1TAEA 3LNMB 2WLNA 4O4IA 4GT1A 3SJCC 3RYIA 4ZIBA 4UB6Z 2EILB 3CJHA 1T5EA 2DJVA 2QM8A 3M99B 3VQXA 3NR7A 5LHHA 3CMAV 4DV6B 4KUMA 1M5IA 4RUFA 2VRZA 2Z3YA 2FMLA 2W6IG 4UVCA 1BGYH 4CH6A 4DV0B 3N2GB 2P06A 3FX7A 4I4TA 3L74H 2QM7A 1WAZA 2BCCH 1VIBA 4UXNA 1EFRG 4P9PA 1GK9A 1HNXB 3JAWB 2QTOA 2MK3A 2YI9A 3T4ZA 2GUZB 1FJGB 3LDDA 3M7MX 4X20B 3T4DA 1XNQO 5KX5B 1OHHG 3LDEA 2UXDO 3AG4C 1JJ2U 3FB7C 1NH2B 4IHJA 4JI2B 2JEUA 1CPYA 3E8BA 4CC5A 2EIKB 5GW7A 1NU1H 1TGOA 2W0FC 5KHHA 1SA0A 1IBLO 4MVUA 1V54C 4D7SA 1PPJH 2EIMB 1KQSU 1IDSA 2JJ2G 4TV8A 1D5AA 4O2BB 5B3SC 1WLEA 2P6JA 4WFFA 1GMGA 1EM1A 3D36A 2WLIA 1RM1B 1OJHA 1VARA 1O9HA 2DQ0A 3H1JH 2V7QG 3D8CA 2YS8A 1L0NH 1NT2B 2D2CB 2Q67A 3CS5A 4TQDA 5H9CA 2ZR2A 1I08A 2P67A 5IYZB 2YEVA 3ETDA 1HNWO 2NR5A 5JJNB 1R6TA 1KU9A 1AI6A 1MSWD 3SJBC 2UU9O 4I0XB 2OWOA 3K0GA 1CXZB 2EINB 4LWSA 3ZCCA 2B5UA 1B3QA 4TV9B 1AR5A 4LF8O 5IWAO 2V1DA 1YTFB 3QO8A 5JCOC 4FLVA 3SPJA 3JALB 1SQXH 4GX2A 5KHJA 1UFIA 2P4KA 3HKDA 3ZHQA 4DV1O 1I94O 1D5NA 1L8DA 3K9AA 2HKOA 4CS3A 3JSLA 3Q4HA 4FLZA 3ABLC 1LUWA 2YIBA 5B5EZ 3LSUA 5EBLC 4P30A 3CCRV 4YIPA 2LP7A 3RYIB 4LBEC 2OCCB 3CJHB 1BQZA 4FLUA 1Y76B 4JI8O 3SJQC 1JMKC 1WN7A 3D3QA 2QWRB 3EHBB 2EIJC 2W0XA 1SF9A 4TOIA 4BR6A 2BOCC 3VQVA 5LYJA 2R9AA 2FYUH 1MG1A 5CA1A 4I4TB 2Z5UA 4DR5O 3EXAA 3KZIZ 5EC2C 1Q5OA 2F4VO 5EYPA 5LMUB 4HNAA 4NB5A 3ZN1A 4YXWG 2JRIA 2EZPA 3K5MA 1H2GA 5JWPA 1XEQA 1BQ0A 1H8HG 4IHJB 3T1CA 1D2DA 4HBNA 1H2NA 1Q6IA 1Z5VA 4DYLA 2XAFA 2ZE7A 2IJKA 2BTOA 2ZQMA 1THZA 1R73A 2AW9A 2IH1C 1DF4A 5LGUA 3CCMV 3HKEA 2DWEC 3ML0A 1QQCA 1SC5B 4TV8B 5D5QA 3QF7A 2UUAO 1VP7A 2IW5A 1JCHA 5JH7A 5E79Z 2JEXA 3CE2A 3CPWU 4AQYB 1RFYA 2H8PC 2WLIB 1VQ7V 5KUMA 1XHZA 1IBMB 1Y74A 3VBBA 3CCLV 1AI5A 2LW7A 1XL4A 3OGCC 3UO2A 3J81N 3RBZA 1V55B 2DE0X 3ABKB 5IT9N 1P84F 4NXNO 3CCQV 2Q73A 2NN4A 4Z2WA 3P3PA 5IY5B 2LQTA 3G4SV 5LA6A 4GUNA 3R66A 1F7YA 4GKJB 1KBHA 1GTOA 2F1MA 4JAVA 4YJ3A 4E4EA 2RJZA 1Q86W 4LWSB 3SYPA 1Z5WA 1SRYA 4B3TO 2ETNA 2M7WA 2ZDIA 4TQFA 5C8YB 1VF5B 1KP3A 3A0RA 4DR6O 1AR1B 2Y0IA 2P5OA 4ZI7A 3B8NA 1MA1A 4PD4F 3HKDB 2LFRA 4J9ZB 4MSWC 1IBLB 2LJ2A 2XAQA 3ZHVA 1Q8IA 2ZE8A 4AILC 3Q4HB 5LMNO 4LR3A 3OAAG 4JTAB 4LNUA 3E86A 1QR8A 5IYDO 4X65B 3S3WA 2UXXA 5B1AB 2JVDA 2ZINA 4JASA 3QVNA 2HP8A 2W6JG 4FK5C 4K3AA 5GONA 2XAJA 3L73H 3K5LA 3CYOA 2OIGA 1VQ8V 2YI8A 1COWG 2WLJA 2Y69C 4G2KA 1NZ6A 5B66Z 5LYJB 5CA1B 2RQ6A 4XDKA 1K97A 3MAQA 1FXKC 3HKCB 3APQA 2WLLB 1YXBA 5CBHA 3ZRWA 5BR8O 5EYPB 1BSMA 1VEWA 2QEXV 2JDIG 4HNAB 3WB1A 4P2ZA 1FS0G 4JYAB 3ZMZA 3OGIB 1PM9A 4LF8B 4JYCA 4QE7A 2XASA 1O9GA 3B2EE 4FZ1A 3AG2B 1I94B 3G67A 4BAYA 3QNEA 3LUTB 3CC2V 1GN2A 4LF9O 2EBOA 4RO2A 1F23A 4WFAV 2DYRB 3HKEB 2BSKB 4JI6O 4X1IA 3CRRA 3JD4A 3OD4A 4DR3O 1G8MA 3H1HH 4OGQB 2WSSG 1BT8A 1Y74B 1Q90D 1Q6UA 2GDSA 1LUVA 5EZYA 5GTHZ 2X6AA 2Y0PA 5TISZ 2Q6AA 4JZGA 3C3SA 3ASNB 5B1NA 4LF4O 2E74B 4DUZO 4JI7O 4L8JA 1B06A 2AZ2A 5KAIZ 1JJOA 2DMXA 3TETA 5CA0A 4NXMB 1WB7A 3ZHTA 3JD1A 1MZFA 1QVFU 3OMAB 2LGQA 1H8EG 1Q7YW 1M93A 3STZC 2ATKC 3SYCA 2VQEO 1M1KW 1H2MA 3KCYA 3CXHF 2HHHO 1HW7A 2AXTZ 4ZI7B 4JI4B 3CCEV 3RVYA 1L0LH 3E8GA 3OUSA 1F4MA 1M57B 2BE3A 3UM7A 4UV9A 4BW9A 3LDCA 2AHYA 1FFTB 1Z2GA 2OIEA 3WG7B 4LNUB 2NNUA 1E1QG 1N34B 1OCRC 4UCTA 2XAGA 1N33O 1K33A 1FFXA 3BEHA 4DXWA 2PF4E 3PJSK 4DR7B 4X66O 2IBZH 2XNDG 5D5PA 4IGGA 4ABMA 3BABA 2BOBC 2JJ1G 4PHZA 2PY5A 2ZR3A 1QCEA 3HPLC 5IE9A 3AEIA 5EIBD 4JI5B 1YDXA 3JD3A 4YHHB 4J11A 1QU7A 3IFXA 3KKYA 2YC0A 2WLMA 2PUSA 3O9OA 1YJNV 1P7GA 3T1HO 1OCOB 3HKBA 5CBFA 3OEHG 1AB3A 4D7TA 2XUMA 3CRCA 2WPDG 3ZMSA 4DW1A 1AILA 2QJ1A 1JQ0A 4QE9A 2RN9A 4RAIA 3OTFA 4JTCB 5F2VO 1X4TA 3ETEA 2GSMB 3ZIAG 1MOFA 1G1XB 3CCJV 3FFQA 1VQ4V 4X64B 4Q20A 3E35A 3ZRXA 1IBKB 5KA5A 4X1IB 1HR0B 4I9QA 3ZMTA 4DRXA 4JI1O 3BA8A 1SS3A 2X6CA 4YIOA 2QWOB 4UV8A 4DR2B 4B3MB 1AJPA 4PA6A 2KG7B 3A2FA 1DK1A 3HB3B 4WCEV 1VQPV 4BIOA 3OW2U 4JV5O 1N36O 3JCUZ 4JGSA 3UT5B 5CA0B 5LP6C 1BCCH 4OX9O 5A9GA 1CEZA 1PNLA 2P4VA 5B1BC 1IXMA 1J5EO 1VF6A 4NYKA 3C90A 3GB7C 1B6QA 3BVOA 4GZRB 4AI8A 2Z0AA 2ZXWC 5KUKA 1Y76A 2UUBB 2QE7G 1PP9H 4DK1A 1BS3A 2EZOA 3AK1A 2CTQA 3JYCA 4Z1MG 2KB1A 2GBOA 3RVZA 3K5OA 1JA8A 2ZIOA 1E1RG 4OXSA 1IURA 2PI4A 1ZLZA 3K58A 1FFXB 3KCXA 3B4SA 2Q5ZA 2DYSC 1Y67A 3BA9A 5FNVA 2CUGA 1PL4A 5K1XA 3OFNG 1SQPH 5LHIA 1R3IC 4O2AB 4BWAA 4GKKB 4LH7A 1Q6HA 4I55B 1FPOA 4DUZB 4TT3G 1M4UA 2ODMA 3VOUA 3X2QC 3JASA 4R8CA 1YIJV 3RYFB 3GWKC 1ZWIC 3HKBB 4LF7O 2CAZC 1OCCC 1MABG 3BY6A 3DC5A 1VQMV 2UUCO 1B04A 4IT5A 4BW5A 1KC8W 3H1KH 1J95A 3WB0A 2DWDC 2ITCC 3W7SA 2UXCO 4PDMA 1GN3A 5BXZA 1BL8A 1ZSPA 5KMGA 1U97A 1AJNA 1N33B 1K3EA 3JAMN 1XOUA 3MHHC 4DRXB 3S3XA 1KYOF 4X66B 1SQFA 3F7YC 2AGAA 2EILC 2YIDA 4YY3B 5FPOA 2F95B 4E2LA 1V9PA 5C8YA 5CB4A 4W4LA 4EFBA 4LFCO 4NTWA 1S76D 3H01A 2N04A 2WLHA 3APOA 2MW2B 4B3RO 2E5LB 2DOSA 4F4LA 4RQEA 4UCRA 3SYQA 4QJFB 5LOVA 4KXRA 4O4JA 2VQFB 1XMQB 4LF6O 3JAKA 5JVDB 1YJ9V 1GM7A 3OTOB 1YI2V 2JGUA 2E75B 2YXHA 4DV3B 1VQ6V 2D3OW 1F51A 1M56B 4WBNA 1WPBA 1XMOB 1SZTA 4DR4O 1WJZA 2CGOA 2YSUB 4LFAB 2EIKC 1N32B 4XDJA 2JGDB 1G4YB 1XL6A 4EKWA 3FD9A 3HKCA 2WLLA 5EK0A 4JTDB 1VQ9V 2EIMC 1KECA 4MVRA 3BHPA 2ZIMA 1RSOA 3TXQA 2HJFC 5FNVB 4J7ZA 1XREA 1RM1C 1K92A 4FLYA 4GX0A 3FYIB 1W2BU 5CA3A 1OCZC 4P9OA 1FD9A 4KHPO 4LP8A 4UFZA 1YZBA 1G6UA 2X6BA 3JASB 4PV1B 3ZHSA 4A5UB 5KLVH 2WAMA 4DV7O 2BSKA 1US6A 4UVAA 1MNGA 1YITV 2EINC 5A2QN 2R70A 1XHXA 4Q6GA 4DV4O 1LNQA 2OTLV 1EZVH 4DV5O 4EFEA 4PDVA 1ZL8B 2ARHA 4UCSA 3L71H 4ZOLB 3W7TA 4HZ3A 2PGGA 5KMGB 3CD6V 1ZTEA 3RW0A 1BHBA 4PELA 3WB2A 1PKXA 2X0LA 3CRQA 2XOKG 1XNRO 1FKAO 5KHIA 1I5XA 1N0NA 1XNQB 1SETA 2OCCC 4N21A 2YXLA 2UXDB 3BFRA 3IJ4A 4RWUA 2HEPA 2F66C 3UO3A 5CB4B 1SQQH 1XUQA 4MVSA 3K79A 4JI3O 2ILMA 5FPRA 5L3CA 2LW1A 2QM4A 2QA4V 2ZM6O 5JJEB 1KP2A 5LOVB 4O4JB 3JAKB 3AG3B 2IM9A 2F23A 4QPJA 2UUCB 1E79G 4B3SO 3L70H 5EBMC 4R6ZA 5KHKA 2GHYA 1GH6A 1MZEA 2QKAA 4WBNB 3T1YO 2UXCB 5FL7G 3CMEV 3G6EV 1HNWB 1ZUQA 4D6TH 3CXCU 4I7ZB 2VS0A 3C3TA 1SERA 2YIAA 4JZ2A 2OYQA 1M90W 2UU9B 1S5LZ 3WFVA 4JF3A 5HFMA 4JI0O 2PYJA 3TCUA 3TXSA 2KKWA 3N27A 4PI2A 2OTJV 2XT9A 4K35A 1RSOB 4MW8A 4WFGA 5IWAB 2ZNJA 3D36C 3DTUB 2HJDA
chains in the Genus database with same CATH topology
1WAZA 2H3OA 2LJ2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1WAZ A;  2H3O A;  2LJ2 A; 
#chains in the Genus database with same CATH topology
 4X1K B;  1V55 C;  3ABK C;  4DV1 B;  2QWQ B;  4FZ0 A;  4JAA A;  2VWK A;  2V4D A;  2B1I A;  4LF6 B;  3ASO B;  3ZN0 A;  1Y66 A;  2A9H A;  1TVK A;  5KAF Z;  1L1F A;  4FMT A;  4XBF A;  1GN6 A;  1VQL V;  4FVM A;  4JI8 B;  4ICG A;  3W7U A;  4DV6 O;  4FFK A;  1K9M W;  4FJC C;  3H1L H;  3ABU A;  2Q7E A;  2GTS A;  2KG7 A;  4DR4 B;  2DN9 A;  3K08 A;  4DV0 O;  1SQV H;  1H2K A;  3JSN A;  1K5Q A;  3CRA A;  4DR5 B;  3ZBH A;  4CH5 A;  3CRM A;  1HNX O;  2F4V B;  4MTF A;  1VMG A;  3UT5 A;  1AVM A;  4X62 O;  2CTW A;  1SQB H;  1QLE B;  3ZS8 C;  5J9P C;  1KKD A;  4MT8 A;  4ZBM A;  1N0J A;  2H3O A;  3ABT A;  5ITZ B;  4NTX A;  5B1A C;  3CP1 A;  5JJJ B;  3E2E A;  4IYI A;  4JI2 O;  3K06 A;  4CS2 A;  3LSQ A;  4WFB V;  3EFF K;  3OMI B;  3SYO A;  2Q69 A;  3FKS G;  3ICX A;  2UXB O;  2QGN A;  4UUJ C;  1I0H A;  1WNS A;  1BHA A;  1CP9 A;  4X9Q A;  4UVB A;  3ZHU A;  4R50 A;  3E22 B;  2UUA B;  2K1E A;  1R3J C;  3JCZ A;  2HFE C;  4IL6 Z;  1DLB A;  1DF5 A;  1VQO V;  3CX5 F;  5JCO A;  1JR9 A;  4DV4 B;  1NR1 A;  1XBL A;  5BMV A;  3AG7 A;  4O4L B;  4MW3 A;  1NJI W;  2WA4 A;  4DV5 B;  3B77 A;  1N8R W;  1Q43 A;  1MSD A;  3AG1 B;  4NXN B;  1WP7 A;  4DW0 A;  3QO7 A;  4O2A A;  2QKS A;  3AG2 C;  1TUE B;  3FYE B;  4I55 A;  4MTX A;  4U7N A;  3B8M A;  5CMU A;  2QTS A;  5H6R A;  3CC7 V;  1XNR B;  3SPG A;  3RYF A;  2XAH A;  2A7W A;  1WA8 B;  3U0Z A;  4B3T B;  5KA6 A;  2A79 B;  1U96 A;  3PN1 A;  3CSX A;  4F6R A;  4DR6 B;  3H9V A;  3UKM A;  4JPR A;  3RYH A;  1K5S A;  2ZT9 B;  5CN0 A;  3T2M A;  3G71 V;  3A0H Z;  2ZM6 B;  3CCS V;  2E3C A;  3ASN C;  2P90 A;  5LMN B;  5BZB A;  1S5H C;  1PD3 A;  4B3S B;  2NLJ C;  1K73 W;  1TVK B;  1NTK H;  4RQF A;  3AG4 B;  4X88 A;  4GYC B;  2DW4 A;  1H2S B;  4PDR A;  2VWJ A;  4CS4 A;  3TK1 A;  2YIC A;  4MTO A;  2ZDI C;  3SPC A;  5IYC O;  2GV9 A;  2ZE5 A;  4UB8 Z;  3W7X A;  1V54 B;  2N05 A;  4X8A A;  4MVQ A;  1AR4 A;  1TA8 A;  2HVJ C;  2EX3 A;  2R72 A;  1OV9 A;  2WA3 A;  5AG2 A;  1M57 C;  5LXT A;  2PI5 A;  5B3S B;  1ROP A;  5BR8 B;  2RNB A;  2QSA A;  5LMU O;  3ZRV A;  2CH7 A;  3B09 A;  4U3J A;  5J2U A;  3WG7 C;  5JVD A;  5LL6 Y;  4CC6 A;  3N2K A;  3RN4 A;  4J41 A;  2ZNI A;  3SDL A;  2Q0A A;  2LO1 A;  3EVK A;  4GX5 A;  1JOY A;  3FB8 C;  2OCH A;  4IYH A;  2CTR A;  3DC6 A;  2L6L A;  3P32 A;  2Q68 A;  2XTA A;  2IU3 A;  2Q8V A;  4ASU G;  1X59 A;  4J10 A;  5FLX N;  1R3L C;  1GKF A;  4LF9 B;  3E8F A;  3D3I A;  1HP8 A;  4AHC A;  5B1O A;  3ETQ A;  3K57 A;  4JI6 B;  1P7B A;  4OPH A;  2RCV A;  5DED A;  2JGD A;  1HNZ O;  1JPX A;  4I50 B;  3DGE A;  4AQY O;  3RWR D;  4DR3 B;  1KD1 W;  1OCO C;  1IBM O;  4PI0 A;  4FPP A;  5BMV B;  3J80 N;  4MS2 A;  2A3Q A;  4H37 A;  5LBQ A;  5L3B A;  1K4D C;  2ZCE A;  3TGU H;  1ENV A;  2P7T C;  3ABL B;  4U3F H;  4DR1 O;  5L3E A;  5LGT A;  4LF4 B;  3I55 V;  1NS1 A;  3AK3 A;  4QPK A;  4JI7 B;  4NR1 A;  4GKJ O;  1K4C C;  3GWO A;  4X62 B;  1YVW A;  1SKV A;  3SR2 C;  5JQG A;  2B1G A;  3ETG A;  5GTI Z;  1NQT A;  1Y4M A;  2FTK A;  2CDY A;  3G6B A;  2QR4 A;  2EIJ B;  4F6R B;  2VQE B;  3FB5 C;  5BY1 A;  3UQ8 A;  2QWN B;  1QNM A;  3A8T A;  2HHH B;  2L35 A;  2QWP B;  3RYH B;  3SPI A;  2UXB B;  4PA4 A;  2LFS A;  4R7C A;  1FXK A;  2JS5 A;  3QTC A;  2QKC A;  4U7O A;  2C2A A;  5E1A C;  1ZL8 A;  2N74 A;  3K9S A;  4EB6 A;  2YIB D;  4X1Y A;  3JAT B;  4PA7 A;  4ZOL A;  4CBC A;  4FM1 A;  1WB8 A;  2KQX A;  4O4H B;  4NVP A;  3UCS C;  4B7E A;  2K9P A;  3U11 A;  3ABM C;  4X65 O;  2Y4U A;  3RYC A;  3A0B Z;  1OCZ B;  2IJJ A;  1KKC A;  1RPR A;  3ZX6 A;  5L3F A;  5KHG A;  1UPG A;  3F5T A;  4FFB A;  1SQG A;  3ZRS A;  1EN5 A;  1PL0 A;  4DUY O;  4FLW A;  3P3N A;  3DSQ A;  4KFM A;  1JFF A;  4WFE A;  2RMK B;  4JAU A;  5LXT B;  3T1H B;  3TJT A;  2CH7 B;  4F6E A;  4JYA O;  3JAR B;  4U3J B;  5J2U B;  4H44 B;  3N2K B;  3VQY A;  1IVS A;  3LSS A;  3GVM A;  4G27 B;  1N4C A;  1XDC A;  4FLX A;  3BCC H;  4OPA A;  1IZ3 A;  3CCU V;  1GM9 A;  3P30 A;  2AHZ A;  3BAA A;  4JYY A;  1VQN V;  1EN4 A;  3IAY A;  1M9N A;  3K3W A;  5L3G A;  2P22 C;  1NKD A;  4O4I B;  1OZ0 A;  3K04 A;  1K34 A;  1QVG U;  4GLX A;  1Y6X A;  1S3J A;  3JD2 A;  2FL4 A;  4JI1 B;  2LGW A;  3F7V C;  2A0L A;  3WU2 Z;  2JIZ G;  1R1B A;  3RT3 C;  1YJW V;  2EUL A;  1H38 A;  1XI1 A;  2Q7H A;  4X1K A;  2ADP A;  4JV5 B;  4DK0 A;  1N36 B;  1I7F A;  1FXV A;  1TUB A;  4LH6 A;  4TUY A;  4NXM O;  4OX9 B;  3FAV A;  5JQG B;  2ZD9 A;  1IX9 A;  4CH4 A;  1MMM A;  5C93 A;  1J5E B;  4Z1V A;  2H94 A;  3H1I H;  1ARO P;  1XQ8 A;  3MDS A;  1GN4 A;  1DTO A;  5IDJ A;  3JD0 A;  2Y69 B;  3E89 A;  4NKG B;  4JI4 O;  4K0K O;  3SPH A;  4BIZ A;  1SA0 B;  5EIB C;  4LF5 O;  4XDL A;  1FXK B;  3HR0 A;  5L3D A;  2IJI A;  4IIJ A;  4EEQ A;  4I5S A;  3CC4 V;  4L87 A;  4EB6 B;  3IGA C;  4X1Y B;  1HNZ B;  1NVP D;  2IH3 C;  4GX1 A;  4J7J A;  4J80 A;  1N34 O;  1QR9 A;  4UCV A;  2B9Z A;  4C7U A;  5H5N A;  1NTM H;  1W0J G;  1AJQ A;  1WPX A;  2HG5 C;  3W7W A;  3CCV V;  3RYC B;  4DR7 O;  4RUE A;  2R9R B;  1VF6 C;  2IJH A;  4FFB B;  5ITZ A;  3OE7 G;  1W0K G;  2ZKO A;  2YEV B;  4JI5 O;  1M56 C;  1R6N A;  4DR1 B;  1Q3E A;  1JFF B;  3VQW A;  3ZHR A;  1YSC A;  4YHH O;  4HAM A;  3E83 A;  4K8X A;  4LFB O;  3SGI A;  1NBM G;  3RGB A;  1URF A;  5DEC A;  3ZMV A;  2HR3 A;  4LF7 B;  3E22 A;  1QBZ A;  3OR7 C;  1VF7 A;  2Y48 A;  3CHX A;  2E76 B;  1HDJ A;  1XIL A;  5H2F Z;  5DN6 G;  4TSF G;  3CWB H;  3I5D A;  1DGS A;  2EJ7 A;  4O4L A;  3ZED A;  5H6Q A;  1S72 V;  4HYO A;  1EZJ A;  3B40 A;  3F5W C;  5LP6 A;  4ZHQ A;  4X64 O;  1YF2 A;  4GCZ A;  3QG5 A;  1IBK O;  4W4K A;  1HR0 O;  1AP5 A;  1I5Y A;  5IJ0 A;  4DV2 O;  3MHS C;  2G38 A;  2Q0O C;  4H13 B;  4QGP A;  3OEE G;  1WA8 A;  2CGN A;  2JS3 A;  2HVK C;  2FB5 A;  3SJA C;  5J2T A;  4DUY B;  4DR2 O;  4FIP C;  4B3M O;  4MVO A;  3E8H A;  4ZKI A;  1YHQ V;  2F43 G;  3RFR A;  3THO A;  1Q82 W;  2CK3 G;  4J9Y B;  4LFC B;  3DXR A;  1PNM A;  1QLN A;  4B3R B;  3M8A A;  2A06 H;  4QNH B;  1OCR B;  1BMF G;  1KUQ A;  1TUB B;  4TUY B;  1W59 A;  4KL1 A;  3FAV B;  4LC1 A;  5IY5 C;  4KP4 A;  3ZJZ A;  4N23 A;  5K1P A;  1K7D A;  1ZAU A;  4PJ0 Z;  4CH3 A;  2Q9L A;  1NTZ H;  5EC1 C;  1UJW B;  1H2L A;  5IJ9 A;  4B7K A;  2UUB O;  3KG2 A;  3LNN A;  3I56 V;  4WF9 V;  2M6Y A;  3SYA A;  5EBW C;  4IIJ B;  2JK5 C;  3K59 A;  4FLT A;  3QO5 A;  5DM6 V;  2R9I A;  1PNK A;  2ADQ B;  5JH7 B;  2IU0 A;  1S0V A;  2BTQ A;  1AP6 A;  1FJG O;  3NXS A;  3AG3 C;  2FKX A;  3FB6 C;  3L72 H;  2F93 B;  2AZ0 A;  2DQ3 A;  4NTY A;  2KSD A;  1NH2 D;  1QHT A;  4GKK O;  3L75 H;  1PV0 A;  1AI7 A;  4YJ2 A;  1BE3 H;  4KHP B;  5LA6 B;  4I9W A;  1VQ5 V;  1S5J A;  4DO2 A;  3AK2 A;  4YJ3 B;  1Q81 W;  4WFH A;  5LHG A;  1NR7 A;  3R65 A;  2O57 A;  1GM8 A;  4DV7 B;  4K8Z A;  1SES A;  1VQK V;  1AI4 A;  1HWY A;  1EBO A;  4I50 A;  1K8A W;  4B08 A;  4MVM A;  1R3K C;  1RPO A;  2Q4P A;  2OT5 A;  4PDL A;  1KMI Z;  3CB2 A;  4MTG A;  4K0K B;  4LF5 B;  3O65 A;  2RDC A;  4G28 B;  1GRJ A;  3N2G A;  3BPZ A;  4X89 A;  2GTA A;  1YCI A;  3K0D A;  1RP3 B;  1NVP B;  5LP6 B;  4H33 A;  4ZHQ B;  2CTP A;  1IXB A;  5B1B B;  4BIU A;  3JAW A;  3OMN B;  5IJ0 B;  2GUZ A;  4J7K A;  3OM3 B;  4CZZ A;  2PYL A;  4UCU A;  3ASO C;  2DYR C;  3G80 A;  4X20 A;  5GON B;  1BZK A;  4JYB A;  2ZXW B;  3OUF A;  5KX5 A;  3K5N A;  1FXH A;  2ZE6 A;  4YY3 O;  3IC7 A;  5J2T B;  5LGN A;  1YTF D;  3OR6 C;  3L9D A;  1KB9 F;  1GO3 F;  3DXR B;  4TWK A;  1EN6 A;  1LR1 A;  2Y4T A;  2E5L O;  4JI3 B;  2WWW A;  1JX9 A;  1SZX A;  1P49 A;  1P4R A;  4MVZ A;  2QDO A;  3ZRW B;  4LFB B;  1YEW A;  1R6K A;  2VQF O;  1XMQ O;  2EJR A;  3JAT A;  5CBG A;  3OTO O;  2DYS B;  4O2B A;  4FM2 A;  1ORQ C;  1WP8 A;  4O4H A;  4DV3 O;  4UCO A;  1F4N A;  1QLE C;  3CEI A;  2PZS A;  2PTM A;  1ZX3 A;  5IJ9 B;  4PA3 A;  3T1Y B;  4H0L B;  3IC9 A;  1XMO O;  2CE4 A;  3X2Q B;  5IYZ A;  1S77 D;  4LFA O;  3K03 A;  1N32 O;  3BRC A;  1NI8 A;  2YUA A;  2WLK A;  4QIW F;  3MD0 A;  4DV2 B;  4I0X A;  5IYB O;  2YXY A;  4J42 A;  1FYJ A;  1OCC B;  1FAF A;  4PA9 A;  3STL C;  2BTQ B;  1JVM A;  2XHB A;  4JI0 B;  1A32 A;  4TV9 A;  3JAR A;  5EZY B;  4LCU C;  2Q7G A;  2HLD G;  2X7R B;  2UXN A;  3ZMU A;  4FM0 A;  1GAX A;  3JAL A;  2YDE A;  3OT7 A;  3J7A U;  2ITD C;  3U10 A;  4YJ2 B;  5HFL A;  3AG1 C;  3ABM B;  1TAE A;  3LNM B;  2WLN A;  4O4I A;  4GT1 A;  3SJC C;  3RYI A;  4ZIB A;  4UB6 Z;  2EIL B;  3CJH A;  1T5E A;  2DJV A;  2QM8 A;  3M99 B;  3VQX A;  3NR7 A;  5LHH A;  3CMA V;  4DV6 B;  4KUM A;  1M5I A;  4RUF A;  2VRZ A;  2Z3Y A;  2FML A;  2W6I G;  4UVC A;  1BGY H;  4CH6 A;  4DV0 B;  3N2G B;  2P06 A;  3FX7 A;  4I4T A;  3L74 H;  2QM7 A;  1WAZ A;  2BCC H;  1VIB A;  4UXN A;  1EFR G;  4P9P A;  1GK9 A;  1HNX B;  3JAW B;  2QTO A;  2MK3 A;  2YI9 A;  3T4Z A;  2GUZ B;  1FJG B;  3LDD A;  3M7M X;  4X20 B;  3T4D A;  1XNQ O;  5KX5 B;  1OHH G;  3LDE A;  2UXD O;  3AG4 C;  1JJ2 U;  3FB7 C;  1NH2 B;  4IHJ A;  4JI2 B;  2JEU A;  1CPY A;  3E8B A;  4CC5 A;  2EIK B;  5GW7 A;  1NU1 H;  1TGO A;  2W0F C;  5KHH A;  1SA0 A;  1IBL O;  4MVU A;  1V54 C;  4D7S A;  1PPJ H;  2EIM B;  1KQS U;  1IDS A;  2JJ2 G;  4TV8 A;  1D5A A;  4O2B B;  5B3S C;  1WLE A;  2P6J A;  4WFF A;  1GMG A;  1EM1 A;  3D36 A;  2WLI A;  1RM1 B;  1OJH A;  1VAR A;  1O9H A;  2DQ0 A;  3H1J H;  2V7Q G;  3D8C A;  2YS8 A;  1L0N H;  1NT2 B;  2D2C B;  2Q67 A;  3CS5 A;  4TQD A;  5H9C A;  2ZR2 A;  1I08 A;  2P67 A;  5IYZ B;  2YEV A;  3ETD A;  1HNW O;  2NR5 A;  5JJN B;  1R6T A;  1KU9 A;  1AI6 A;  1MSW D;  3SJB C;  2UU9 O;  4I0X B;  2OWO A;  3K0G A;  1CXZ B;  2EIN B;  4LWS A;  3ZCC A;  2B5U A;  1B3Q A;  4TV9 B;  1AR5 A;  4LF8 O;  5IWA O;  2V1D A;  1YTF B;  3QO8 A;  5JCO C;  4FLV A;  3SPJ A;  3JAL B;  1SQX H;  4GX2 A;  5KHJ A;  1UFI A;  2P4K A;  3HKD A;  3ZHQ A;  4DV1 O;  1I94 O;  1D5N A;  1L8D A;  3K9A A;  2HKO A;  4CS3 A;  3JSL A;  3Q4H A;  4FLZ A;  3ABL C;  1LUW A;  2YIB A;  5B5E Z;  3LSU A;  5EBL C;  4P30 A;  3CCR V;  4YIP A;  2LP7 A;  3RYI B;  4LBE C;  2OCC B;  3CJH B;  1BQZ A;  4FLU A;  1Y76 B;  4JI8 O;  3SJQ C;  1JMK C;  1WN7 A;  3D3Q A;  2QWR B;  3EHB B;  2EIJ C;  2W0X A;  1SF9 A;  4TOI A;  4BR6 A;  2BOC C;  3VQV A;  5LYJ A;  2R9A A;  2FYU H;  1MG1 A;  5CA1 A;  4I4T B;  2Z5U A;  4DR5 O;  3EXA A;  3KZI Z;  5EC2 C;  1Q5O A;  2F4V O;  5EYP A;  5LMU B;  4HNA A;  4NB5 A;  3ZN1 A;  4YXW G;  2JRI A;  2EZP A;  3K5M A;  1H2G A;  5JWP A;  1XEQ A;  1BQ0 A;  1H8H G;  4IHJ B;  3T1C A;  1D2D A;  4HBN A;  1H2N A;  1Q6I A;  1Z5V A;  4DYL A;  2XAF A;  2ZE7 A;  2IJK A;  2BTO A;  2ZQM A;  1THZ A;  1R73 A;  2AW9 A;  2IH1 C;  1DF4 A;  5LGU A;  3CCM V;  3HKE A;  2DWE C;  3ML0 A;  1QQC A;  1SC5 B;  4TV8 B;  5D5Q A;  3QF7 A;  2UUA O;  1VP7 A;  2IW5 A;  1JCH A;  5JH7 A;  5E79 Z;  2JEX A;  3CE2 A;  3CPW U;  4AQY B;  1RFY A;  2H8P C;  2WLI B;  1VQ7 V;  5KUM A;  1XHZ A;  1IBM B;  1Y74 A;  3VBB A;  3CCL V;  1AI5 A;  2LW7 A;  1XL4 A;  3OGC C;  3UO2 A;  3J81 N;  3RBZ A;  1V55 B;  2DE0 X;  3ABK B;  5IT9 N;  1P84 F;  4NXN O;  3CCQ V;  2Q73 A;  2NN4 A;  4Z2W A;  3P3P A;  5IY5 B;  2LQT A;  3G4S V;  5LA6 A;  4GUN A;  3R66 A;  1F7Y A;  4GKJ B;  1KBH A;  1GTO A;  2F1M A;  4JAV A;  4YJ3 A;  4E4E A;  2RJZ A;  1Q86 W;  4LWS B;  3SYP A;  1Z5W A;  1SRY A;  4B3T O;  2ETN A;  2M7W A;  2ZDI A;  4TQF A;  5C8Y B;  1VF5 B;  1KP3 A;  3A0R A;  4DR6 O;  1AR1 B;  2Y0I A;  2P5O A;  4ZI7 A;  3B8N A;  1MA1 A;  4PD4 F;  3HKD B;  2LFR A;  4J9Z B;  4MSW C;  1IBL B;  2LJ2 A;  2XAQ A;  3ZHV A;  1Q8I A;  2ZE8 A;  4AIL C;  3Q4H B;  5LMN O;  4LR3 A;  3OAA G;  4JTA B;  4LNU A;  3E86 A;  1QR8 A;  5IYD O;  4X65 B;  3S3W A;  2UXX A;  5B1A B;  2JVD A;  2ZIN A;  4JAS A;  3QVN A;  2HP8 A;  2W6J G;  4FK5 C;  4K3A A;  5GON A;  2XAJ A;  3L73 H;  3K5L A;  3CYO A;  2OIG A;  1VQ8 V;  2YI8 A;  1COW G;  2WLJ A;  2Y69 C;  4G2K A;  1NZ6 A;  5B66 Z;  5LYJ B;  5CA1 B;  2RQ6 A;  4XDK A;  1K97 A;  3MAQ A;  1FXK C;  3HKC B;  3APQ A;  2WLL B;  1YXB A;  5CBH A;  3ZRW A;  5BR8 O;  5EYP B;  1BSM A;  1VEW A;  2QEX V;  2JDI G;  4HNA B;  3WB1 A;  4P2Z A;  1FS0 G;  4JYA B;  3ZMZ A;  3OGI B;  1PM9 A;  4LF8 B;  4JYC A;  4QE7 A;  2XAS A;  1O9G A;  3B2E E;  4FZ1 A;  3AG2 B;  1I94 B;  3G67 A;  4BAY A;  3QNE A;  3LUT B;  3CC2 V;  1GN2 A;  4LF9 O;  2EBO A;  4RO2 A;  1F23 A;  4WFA V;  2DYR B;  3HKE B;  2BSK B;  4JI6 O;  4X1I A;  3CRR A;  3JD4 A;  3OD4 A;  4DR3 O;  1G8M A;  3H1H H;  4OGQ B;  2WSS G;  1BT8 A;  1Y74 B;  1Q90 D;  1Q6U A;  2GDS A;  1LUV A;  5EZY A;  5GTH Z;  2X6A A;  2Y0P A;  5TIS Z;  2Q6A A;  4JZG A;  3C3S A;  3ASN B;  5B1N A;  4LF4 O;  2E74 B;  4DUZ O;  4JI7 O;  4L8J A;  1B06 A;  2AZ2 A;  5KAI Z;  1JJO A;  2DMX A;  3TET A;  5CA0 A;  4NXM B;  1WB7 A;  3ZHT A;  3JD1 A;  1MZF A;  1QVF U;  3OMA B;  2LGQ A;  1H8E G;  1Q7Y W;  1M93 A;  3STZ C;  2ATK C;  3SYC A;  2VQE O;  1M1K W;  1H2M A;  3KCY A;  3CXH F;  2HHH O;  1HW7 A;  2AXT Z;  4ZI7 B;  4JI4 B;  3CCE V;  3RVY A;  1L0L H;  3E8G A;  3OUS A;  1F4M A;  1M57 B;  2BE3 A;  3UM7 A;  4UV9 A;  4BW9 A;  3LDC A;  2AHY A;  1FFT B;  1Z2G A;  2OIE A;  3WG7 B;  4LNU B;  2NNU A;  1E1Q G;  1N34 B;  1OCR C;  4UCT A;  2XAG A;  1N33 O;  1K33 A;  1FFX A;  3BEH A;  4DXW A;  2PF4 E;  3PJS K;  4DR7 B;  4X66 O;  2IBZ H;  2XND G;  5D5P A;  4IGG A;  4ABM A;  3BAB A;  2BOB C;  2JJ1 G;  4PHZ A;  2PY5 A;  2ZR3 A;  1QCE A;  3HPL C;  5IE9 A;  3AEI A;  5EIB D;  4JI5 B;  1YDX A;  3JD3 A;  4YHH B;  4J11 A;  1QU7 A;  3IFX A;  3KKY A;  2YC0 A;  2WLM A;  2PUS A;  3O9O A;  1YJN V;  1P7G A;  3T1H O;  1OCO B;  3HKB A;  5CBF A;  3OEH G;  1AB3 A;  4D7T A;  2XUM A;  3CRC A;  2WPD G;  3ZMS A;  4DW1 A;  1AIL A;  2QJ1 A;  1JQ0 A;  4QE9 A;  2RN9 A;  4RAI A;  3OTF A;  4JTC B;  5F2V O;  1X4T A;  3ETE A;  2GSM B;  3ZIA G;  1MOF A;  1G1X B;  3CCJ V;  3FFQ A;  1VQ4 V;  4X64 B;  4Q20 A;  3E35 A;  3ZRX A;  1IBK B;  5KA5 A;  4X1I B;  1HR0 B;  4I9Q A;  3ZMT A;  4DRX A;  4JI1 O;  3BA8 A;  1SS3 A;  2X6C A;  4YIO A;  2QWO B;  4UV8 A;  4DR2 B;  4B3M B;  1AJP A;  4PA6 A;  2KG7 B;  3A2F A;  1DK1 A;  3HB3 B;  4WCE V;  1VQP V;  4BIO A;  3OW2 U;  4JV5 O;  1N36 O;  3JCU Z;  4JGS A;  3UT5 B;  5CA0 B;  5LP6 C;  1BCC H;  4OX9 O;  5A9G A;  1CEZ A;  1PNL A;  2P4V A;  5B1B C;  1IXM A;  1J5E O;  1VF6 A;  4NYK A;  3C90 A;  3GB7 C;  1B6Q A;  3BVO A;  4GZR B;  4AI8 A;  2Z0A A;  2ZXW C;  5KUK A;  1Y76 A;  2UUB B;  2QE7 G;  1PP9 H;  4DK1 A;  1BS3 A;  2EZO A;  3AK1 A;  2CTQ A;  3JYC A;  4Z1M G;  2KB1 A;  2GBO A;  3RVZ A;  3K5O A;  1JA8 A;  2ZIO A;  1E1R G;  4OXS A;  1IUR A;  2PI4 A;  1ZLZ A;  3K58 A;  1FFX B;  3KCX A;  3B4S A;  2Q5Z A;  2DYS C;  1Y67 A;  3BA9 A;  5FNV A;  2CUG A;  1PL4 A;  5K1X A;  3OFN G;  1SQP H;  5LHI A;  1R3I C;  4O2A B;  4BWA A;  4GKK B;  4LH7 A;  1Q6H A;  4I55 B;  1FPO A;  4DUZ B;  4TT3 G;  1M4U A;  2ODM A;  3VOU A;  3X2Q C;  3JAS A;  4R8C A;  1YIJ V;  3RYF B;  3GWK C;  1ZWI C;  3HKB B;  4LF7 O;  2CAZ C;  1OCC C;  1MAB G;  3BY6 A;  3DC5 A;  1VQM V;  2UUC O;  1B04 A;  4IT5 A;  4BW5 A;  1KC8 W;  3H1K H;  1J95 A;  3WB0 A;  2DWD C;  2ITC C;  3W7S A;  2UXC O;  4PDM A;  1GN3 A;  5BXZ A;  1BL8 A;  1ZSP A;  5KMG A;  1U97 A;  1AJN A;  1N33 B;  1K3E A;  3JAM N;  1XOU A;  3MHH C;  4DRX B;  3S3X A;  1KYO F;  4X66 B;  1SQF A;  3F7Y C;  2AGA A;  2EIL C;  2YID A;  4YY3 B;  5FPO A;  2F95 B;  4E2L A;  1V9P A;  5C8Y A;  5CB4 A;  4W4L A;  4EFB A;  4LFC O;  4NTW A;  1S76 D;  3H01 A;  2N04 A;  2WLH A;  3APO A;  2MW2 B;  4B3R O;  2E5L B;  2DOS A;  4F4L A;  4RQE A;  4UCR A;  3SYQ A;  4QJF B;  5LOV A;  4KXR A;  4O4J A;  2VQF B;  1XMQ B;  4LF6 O;  3JAK A;  5JVD B;  1YJ9 V;  1GM7 A;  3OTO B;  1YI2 V;  2JGU A;  2E75 B;  2YXH A;  4DV3 B;  1VQ6 V;  2D3O W;  1F51 A;  1M56 B;  4WBN A;  1WPB A;  1XMO B;  1SZT A;  4DR4 O;  1WJZ A;  2CGO A;  2YSU B;  4LFA B;  2EIK C;  1N32 B;  4XDJ A;  2JGD B;  1G4Y B;  1XL6 A;  4EKW A;  3FD9 A;  3HKC A;  2WLL A;  5EK0 A;  4JTD B;  1VQ9 V;  2EIM C;  1KEC A;  4MVR A;  3BHP A;  2ZIM A;  1RSO A;  3TXQ A;  2HJF C;  5FNV B;  4J7Z A;  1XRE A;  1RM1 C;  1K92 A;  4FLY A;  4GX0 A;  3FYI B;  1W2B U;  5CA3 A;  1OCZ C;  4P9O A;  1FD9 A;  4KHP O;  4LP8 A;  4UFZ A;  1YZB A;  1G6U A;  2X6B A;  3JAS B;  4PV1 B;  3ZHS A;  4A5U B;  5KLV H;  2WAM A;  4DV7 O;  2BSK A;  1US6 A;  4UVA A;  1MNG A;  1YIT V;  2EIN C;  5A2Q N;  2R70 A;  1XHX A;  4Q6G A;  4DV4 O;  1LNQ A;  2OTL V;  1EZV H;  4DV5 O;  4EFE A;  4PDV A;  1ZL8 B;  2ARH A;  4UCS A;  3L71 H;  4ZOL B;  3W7T A;  4HZ3 A;  2PGG A;  5KMG B;  3CD6 V;  1ZTE A;  3RW0 A;  1BHB A;  4PEL A;  3WB2 A;  1PKX A;  2X0L A;  3CRQ A;  2XOK G;  1XNR O;  1FKA O;  5KHI A;  1I5X A;  1N0N A;  1XNQ B;  1SET A;  2OCC C;  4N21 A;  2YXL A;  2UXD B;  3BFR A;  3IJ4 A;  4RWU A;  2HEP A;  2F66 C;  3UO3 A;  5CB4 B;  1SQQ H;  1XUQ A;  4MVS A;  3K79 A;  4JI3 O;  2ILM A;  5FPR A;  5L3C A;  2LW1 A;  2QM4 A;  2QA4 V;  2ZM6 O;  5JJE B;  1KP2 A;  5LOV B;  4O4J B;  3JAK B;  3AG3 B;  2IM9 A;  2F23 A;  4QPJ A;  2UUC B;  1E79 G;  4B3S O;  3L70 H;  5EBM C;  4R6Z A;  5KHK A;  2GHY A;  1GH6 A;  1MZE A;  2QKA A;  4WBN B;  3T1Y O;  2UXC B;  5FL7 G;  3CME V;  3G6E V;  1HNW B;  1ZUQ A;  4D6T H;  3CXC U;  4I7Z B;  2VS0 A;  3C3T A;  1SER A;  2YIA A;  4JZ2 A;  2OYQ A;  1M90 W;  2UU9 B;  1S5L Z;  3WFV A;  4JF3 A;  5HFM A;  4JI0 O;  2PYJ A;  3TCU A;  3TXS A;  2KKW A;  3N27 A;  4PI2 A;  2OTJ V;  2XT9 A;  4K35 A;  1RSO B;  4MW8 A;  4WFG A;  5IWA B;  2ZNJ A;  3D36 C;  3DTU B;  2HJD A; 
#chains in the Genus database with same CATH homology
 1WAZ A;  2H3O A;  2LJ2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...