2H3QA

Solution structure of hiv-1 myrma bound to di-c4-phosphatidylinositol-(4,5)-bisphosphate
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
131
structure length
131
Chain Sequence
GARASVLSGGELDKWEKIRLRPGGKKQYKLKHIVWASRELERFAVNPGLLETSEGCRQILGQLQPSLQTGSEELRSLYNTIAVLYCVHQRIDVKDTKEALDKIEEEQNKSKKKAQQAAADTGNNSQVSQNY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for targeting HIV-1 Gag proteins to the plasma membrane for virus assembly.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Viral protein
molecule keywords Gag polyprotein
total genus 34
structure length 131
sequence length 131
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2006-05-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00540 Gag_p17 gag gene protein p17 (matrix protein)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.90 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase; domain 1 2h3qA01
1HIWA 2H3FA 1A6SA 1UPHA 1HEKA 2K4EA 1ECWA 4IC9A 4JMUA 2H3QA 2LYAA 1L6NA 2K4IA 1TAMA 2HMXA 2LYBA 2H3IA 4ICAA 2GOLA 2NV3A 2K4HA 2JMGA 1ED1A 2N1RA 2H3VA 2H3ZA
chains in the Genus database with same CATH superfamily
3CNHA 1L3UA 3OJSA 2R8HA 4ED7A 2D6FC 3PO4A 1ECWA 4F5QA 3L4PA 3K4GA 2G07A 4ELUA 3C29A 2M9NA 2RRDA 2AHOB 4O5CA 3I28A 3M9OB 3HP6A 4DCCA 2Y0SC 4KMOB 3WK6A 5J8YA 4RQNA 4J9NA 2BDUA 4QZ8A 2HI0A 2P6UA 3D2NA 4MEXA 4UAWA 2PFPA 3T79A 1FO4A 4DEZA 1V9PA 1SIJA 4YP3A 5ALOA 3LYSA 2FMQA 2ZIVB 1X40A 5KFNA 3RH4A 4M0AA 4OCZA 4UBCA 2N1RA 2HHXA 4P0QB 1XWLA 5KL8B 2VKQA 4C80A 2E1EA 2EDUA 3UMGA 5AI5A 2LKYA 2EZZA 4F8RA 4Z6DA 2LYBA 4QZIA 2EAMA 5J2JA 3OSPA 2G08A 1JIHA 2XO7A 4P0PB 5IINA 4TQRA 4DL5A 4R65A 2Q4TA 3H0LB 4PGYA 1N5XA 1X6IA 4ECWA 3ICXA 1TK0A 3HKZC 1KKXA 1UCVA 1JXEA 3BZKA 4F5NA 4IQTA 3RF9A 1S9FA 1SXDA 3NVWA 1U47A 4BXOB 4O3MA 3ALRA 2O6KA 5JU5A 1X9XA 2CXYA 3GDXA 4FO6A 3M8SA 3RAQA 1NI3A 5AI0A 2LPEA 4NWIA 5TZVA 3ISCA 2KEYA 2EAOA 1WUDA 3C5FA 1KW4A 1K1QA 2W7PA 2YY6A 3CP8A 1D9DA 5ALLA 4ICAA 8ICGA 2FLNA 3QX7A 2LMRA 4DSFA 4UB8U 2OH2A 5DB6A 4CGZA 5DGBA 2DWQA 1KLNA 4Q44A 2KJ5A 1QTMA 5C5JA 1QLNA 1SZHA 2A19A 2W3SA 3UMCA 4QWCA 2VANA 1B0XA 3MBYA 3TI0A 1TAUA 2LI6A 2E8MA 1ZQYA 3PO5A 5KFXA 4UARA 4UAYA 2ZJAA 4ECQA 2XCAA 1ZOLA 2JEIA 4EZ9A 3HJEA 9ICHA 4RU9A 2AQ4A 7ICTA 3F5EA 3TANA 1L6NA 1ZQWA 3D2QA 1KSPA 2XI9A 5E79U 3PX6A 1JN3A 4P4PA 1XS9D 3RJJA 2XIDA 2CRXA 5EE3A 4C4TA 4B9SA 4M9GA 9ICCA 2YMPA 2QB0A 4MFAA 5EE1A 2LM4A 1VLBA 5J2BA 5AK3A 3LWMA 3M7DA 2K4PA 2FE9A 2KMDA 3QZ8A 5HMMA 1Z1BA 1XSPA 1N60A 8ICWA 3AU2A 5KFVA 2HOIA 2Z7JA 5DB7A 5DQIA 4F5PA 2K89A 5J2AA 4JWNA 5KG4A 1LVHA 3ZDCA 4I2IA 4GIBA 3TACB 2HHQA 1N5WA 2OWOA 1BPBA 4Q43A 4YCXA 2NV3A 2YTUA 1DGSA 2FMPA 3QXGA 1A0PA 3EPIA 2YMQA 4JV0A 1QSYA 4FS1A 2HOFA 5AKYA 4B9TA 4CNQA 1ZQGA 4BGDA 2BCRA 4F2RA 4EBDA 2RHFA 3ISDA 1U45A 3QUBA 2Y1IA 3RRHA 4CCHA 4WJ3B 8ICIA 1PZNA 2WFAA 1ZQOA 1HUOA 2VIXA 1V38A 4ECVA 2Y0SF 4TUPA 3H40A 4TUQA 2JGAA 3BS7A 4DF8A 3GIIA 5KFGA 3MFIA 5JRTA 3VC8A 1XSLA 2CN1A 2Y9UA 2G0AA 1JMSA 2NRVA 3WK7A 3T5LA 1FFVA 5ALZA 2H3FA 2MA1A 5EE0A 5AM2A 2IHNA 3BS5B 1QH9A 3H7IA 2WB1C 3SYZA 4NXZA 1NJWA 4O3PA 9ICBA 2BCQA 2H3VA 3H8JA 2B0CA 2RLTA 2ZUBA 4DOBA 1A76A 1K5OA 3QU4A 2ODGA 4F91B 2A1JB 1J97A 5HP4A 5J2FA 1T8EA 4EYIB 2OYYA 4I2EA 2XGQA 4KLGA 1L7PA 4ED3A 1J2NA 2V4RA 3TFSA 2WF5A 4DLEA 7ICQA 3OTQA 2AGQA 7ICHA 3SAFA 1NK6A 5J0YA 3N7RC 1IV8A 1BPYA 4R66A 4RQ0A 2ZIXB 5K4LA 4NLBA 5AI4A 1ZQDA 1KN5A 3MR5A 4EYHB 1B22A 9ICVA 5J29A 2PKEA 4RNNA 5ALWA 5IIKA 5KG0A 2BQ3A 1D9FA 4DSJA 4Q8EA 7ICFA 2K60A 2UVUA 3NVYA 2MRLA 3KD3A 3QNMA 2HHSA 5AKIA 3N28A 7ICKA 4KLUA 1KQQA 3JPOA 1RG6A 2WF7A 4C8NA 1SV0C 1HIWA 4B6JA 2ZXHA 3H4BA 2QARB 1C7YA 2I9GA 2KSOA 1ZQNA 5AM4A 3EWAA 3FM9A 5J0UA 1SKWA 8ICYA 1YT3A 2PMZC 2DGZA 3QE9Y 2ZIWA 2DF4B 4USAA 5A0LA 3V6HA 3HPOA 2ALZA 5CHGA 4DOCA 1QCKA 1RYSA 4NLKA 5KNIA 3H4DA 3THVA 4DWIA 2KHQA 4NV0A 1X9WA 4OJOA 2YQEA 4K4IA 1RM6C 1SXEA 3Q8MA 1N48A 2ZG6A 3ZDDA 2IMWP 4YG2A 4XQ8A 1U4BA 7ICLA 1MN8A 4RQ2A 2C2DA 5ALQA 4Y2JA 4KN7A 4RPZA 3HILA 1BPEA 1ZQMA 2OHFA 9ICFA 3FYHA 1NKEA 1IM4A 4QZCA 1NJXA 4RQ8A 4EBEA 2VA3A 1GO3F 1ZD3A 4ED0A 4EENA 8ICBA 5J0QA 2FDRA 1ZETA 4DFMA 1L3SA 3O0FA 2HDOA 2NYVA 3IP4B 4QZEA 4X5VA 2W54A 4BWMA 5IIIA 3MGHA 8ICRA 2OCEA 4CF3A 4BWJA 3C2MA 1LKYA 3PW4A 1Z19A 5GTIU 5G5HA 2R8GA 2E8OA 2R18A 2NO4A 1WCLA 3C1YA 8ICEA 3B0XA 1TAQA 2D3DA 4PH5A 3I76A 2ESEA 1ZRNA 4EX6A 5EE9A 5CWRA 3UQ0A 1L8OA 4U7CA 2IOFK 2KJ8A 3KKAC 1MQ3A 4DQIA 3ZDEA 4EELA 2Q0ZX 3ORYA 1NK7A 4CRXA 1YZ6A 2KIWA 4ELVA 4OD0A 5J0RA 2W9MA 3AQEA 4UAUA 1IG6A 2JZBB 2P66A 1DXSA 5AK4A 7ICMA 4RQ5A 3RJKA 4F4ZA 4I2HA 4RUCA 4NL9C 1RDFA 8ICSA 1NKBA 4ECTA 3WK4A 3BQ0A 1VDVA 2HHTA 5AKKA 2ATLA 2LYHA 2DBYA 2W9CA 4KLHA 3PW5A 4I2JA 2YMLA 2KJ9A 3SENA 3RJFA 1KL9A 5ALHA 4JV2A 4HAIA 2HCFA 3B9JA 2W8LA 4FBUA 4M9NA 1D8LA 5AKXA 4NLCA 4Y2YA 1DK2A 4G9BA 3AM9A 5DBBA 4F3OA 9ICOA 2EQYA 5EWGA 3JPRA 3R9KA 1JI7A 7ICUA 2BCSA 5KG7A 4J9QA 8ICFA 4IC9A 4ACOA 1NZBA 3QEBZ 4YVZA 3GIKA 1SL0A 1X9SA 3V6KA 2IHMA 1JROA 5IIJA 5HHHA 1FEZA 1X42A 3TADC 2G5IB 3V7LA 5KT6A 1MQ2A 4LVSA 3UXNA 4UAVA 5AKHA 3IM1A 2I1QA 4O5EA 1U48A 2V9WA 3LDAA 1B43A 5AHXA 1COKA 2ZIVA 3MFHA 5KAIU 1SWVA 5KFMA 2F1IA 2PFOA 8ICOA 1N56A 8ICJA 4P0QA 5KFFA 4F71A 4PPXA 4US8A 5H2FU 2XY6A 1RXWA 2KHVA 2HBKA 2KP7A 1BPDA 2IBKA 1MC8A 1JALA 2FLLA 5JUMA 3PZPA 4CF4A 5ALEA 1ZJMA 4YMMA 1NJYA 7ICGA 2LBOA 2JH7A 4QZAA 3G6YA 1N61A 4KMUA 7ICPA 1Z3EB 1ZXIA 5AKJA 5AKGA 3PW7A 4IRDA 2K4EA 4R63A 3M9NB 1HJPA 3RJHA 3RH6A 3PV8A 1RYUA 2DL0A 5L1JA 3PX4A 4DL6A 5HMLA 4Q8FA 4QW8A 1ED1A 4FZLA 4C8KA 2HHVA 5DQGA 3AL0B 4OJLA 4MF8A 2R8KA 3N4MB 3M8RA 5ALDA 2B21A 1FIQA 5HR7A 3N7SC 3SEIA 2BQUA 2ZJ5A 1XU4A 1KEJA 3MABA 5KG1A 1ZQ1C 1F5SA 3QU7A 2K8CB 1JX4A 2QB0B 5AIBA 3IDWA 3KTQA 3IG5A 4IQUA 4KX3A 2D8CA 4QWBA 2AH5A 5BOLA 5KG2A 3PSPA 4ED2A 5AM3A 4UB1A 5KFOA 4EEYA 5J0PA 2NRXA 2Y9TA 4QWAA 9ICQA 3Q8SB 4AP9A 3QU9A 2WF9A 2ES6A 4ZOHC 4M2YA 4RT3A 1XO1A 2VJ4A 4FS2A 3WKAA 5AM0A 4ZH4A 3PVXA 1ZD4A 4UB3A 2KVCA 2ZTCA 4E0DA 1C20A 4YN4A 4I2GA 3AQFA 2J6SA 1UT5A 3RR7A 3C28A 4QWDA 4KX5A 5KT2A 3RBDA 1ZQIA 4ECYA 5J0OA 2ASDA 4O3RA 9ICXA 1Q8KA 2F3NA 5IIMA 3QEAZ 2W03A 4DSLA 3SAGA 4YXMA 3KFUF 3MC1A 2RQ5A 1D8YA 3KHGA 4K4HA 5KFJA 2OM6A 3K1ZA 4UATA 4QNLA 1ZQAA 3H8WA 2UVVA 3WKCA 3Q8PB 2JEFA 4Y2SA 1WYGA 4TUSA 2F8KA 4PGXA 2RDIA 5J2CA 1XNSA 4I29A 4DS5A 1NOMA 4DFKA 3RB4A 4EZ6A 2MAXA 3JPQA 4CF5A 1NK4A 5F9NA 2KIVA 4PHDA 3E2EA 1BPZA 2HW3A 3NVVA 4KLMA 4BX9C 5B66U 2W04A 4DL4A 5EOZA 5AK5A 5ALVA 2BGWA 3GILA 2HVHA 1L5UA 4FBTA 2A1JA 1S8OA 2XICA 1ZQJA 2EZYA 2E5SA 4OJ5A 2JHDA 3WK5A 5KG6A 4O3OA 5KFSA 3QZ7A 7ICSA 4R64A 3OJUA 4BUGA 3KKAA 3UM9A 1JUDA 3MGVA 4NY8A 3F5AA 1SL2A 1L3VA 4DSKA 3UPQA 1QSSA 1AQ6A 2HSZA 4AYBC 2C22A 3E0FA 7ICJA 9ICLA 2R8IA 4J9KA 9ICWA 1S76D 2KZ3A 2ZIXA 1PVPA 4K4GA 3SZ2A 3GFKB 5AM5A 3ZDAA 2VA2A 2G09A 4CDGA 2JEJA 2AGPA 1CEZA 1ZQZA 4J9LA 3AUOA 1RPLA 2ZUCA 9ICEA 4JMUA 2FPMA 3HWTA 1Q46A 5KFIA 3GIJA 2HMXA 2XC9A 3A0HU 4ED1A 4RZRA 3PR4A 8ICUA 2KFNA 3CRXA 5ALTA 9ICNA 5AI8A 1RQLA 9ICSA 8ICKA 3HT3A 2E8PA 3N97B 1IIPA 2G06A 3TFRA 4I2AA 1BNOA 4NL9A 4Z6CA 9ICGA 3PNCA 4PZNA 1AROP 1ZQFA 3PY8A 5HR6A 1HUZA 3SMVA 1QQ7A 2HHUA 3SD7A 2DFLA 2J6TA 5KG3A 5AICA 2GH1A 1N2XA 2PI5A 2ZJ8A 1KBUA 1S5LU 3OGUA 3BQ2A 5KFYA 4I2DA 2FPLA 2KK0A 3LVVA 4UAZA 3K75D 1A6SA 9ICRA 1KFTA 2XVTA 4G3IA 4UB2A 3M9MB 3GIMA 2ASJA 2FPKA 2WAQF 3CYMA 4R8UB 3KZIU 4DL2A 1SB3C 3OHBA 2E8NA 8ICCA 5F3XB 3EW9A 5DGAA 1SV0A 3AMZA 2W11A 3GZFA 3WKEA 1K1SA 4XA5A 2QARA 1NZPA 1ZQLA 1NK5A 5DQHA 7ICVA 3GV7B 2KICA 2ISPA 2FLPA 4PGQA 4Y2XA 4KLDA 4US9A 2W3RA 3ED5A 2PI4A 3GQCA 4KLEA 3NRWA 1ZQBA 3Q8LA 4KLJA 2BR0A 3QUTA 4M04A 3T3FA 1Z4NA 2DPIA 4DQQA 2EH9A 3F53A 3RAXA 3RB0A 4JWMA 3TARA 2K4HA 1N62A 1YZ7A 3V6JA 3V72A 4GXKA 5TISU 4YMNA 3M6KA 3LWLA 2F2AB 5DG7A 2PFQA 8ICAA 4LZDA 4ECXA 4F5RA 5ALXA 4M6WB 2GWSA 3NASA 2UVRA 2BCUA 3LK9A 8ICLA 4M9HA 3TAQA 1TAMA 2BQRA 4Y2PA 2KOBA 5CP2A 2JMGA 2KNJA 2W9CB 1LB2B 4RNOA 3NTUA 5J2IA 7ICEA 3JPSA 1IXRA 2W9BB 3OSNA 4F2SA 2PXIA 1L3TA 3G6VA 4EBCA 5KFWA 3D2SA 2C2RA 2P35A 4KLTA 3FDSA 3L5KA 2KV2A 2EAPA 3RH5A 1T94A 1QQ6A 2HHWA 2JH1A 5KT5A 2DUYA 1PK1A 1OUQA 1SKSA 4J9SA 4NM2A 3BQ1A 1SGGA 1Z4OA 2J6UA 4KLLA 3BDPA 1T3NA 2K8BB 1Z00B 4MHVA 2A1AA 5DDMA 5L1IA 1D8BA 2F1HA 4O5KA 3HRDD 2PFNA 1L8LA 4QW9A 5AI9A 3OHAA 5ALUA 4KLQA 5KAFU 4GFJA 4PJ0U 5J0TA 1Z1VA 4YMOA 3KZXA 3H0MB 3SV4A 5J2DA 4FE3A 5KT4A 1ZQHA 9ICKA 4DFJA 5AI6A 5KFEA 4UB6U 2KTQA 2BPFA 3RBEA 4MFFA 4O3QA 3DDHA 3IG8A 4GXIA 4Y2RA 7ICIA 3MGIA 5KFZA 5B5EU 3U26A 5AKLA 1CUKA 1VJ5A 4M47A 1KRPA 7ICRA 4J9MA 3H8SA 2NRWA 3F2CA 1SL1A 2XGPA 4MEYA 4DL7A 1ZQEA 1ZQPA 8ICXA 3QYPA 1WWVA 1UA1A 1QSLA 3PR5B 1ZQUA 2JXJA 4QZFA 4RQ4A 3GV5B 4OJ6A 1NK0A 2RP5A 9ICTA 1P7DA 1UPHA 4RUAA 3MR6A 2NO5A 1BGXT 1S77D 2DQNB 5J0SA 2HVIA 4C8OA 2YN4A 1F0MA 1PUZA 4IQWA 2M0NA 4Y2VA 4ECSA 3UQ2A 5AK6A 1QQ5A 1H38A 1HEKA 1L7NA 4C8MA 2WF8A 7ICOA 8ICNA 4I2FA 4U6PA 5BPCA 2I6XA 4O0IA 1ZD2P 4FFDA 4DQSA 4F5OA 3RTVA 4DS4A 2HOQA 3RR8A 3PSIA 2HBJA 3F2BA 5J2HA 5ALYA 1O08A 2ISOA 3PW2A 3J81j 2W9BA 5KFHA 1ZQCA 4M9JA 1V85A 3ETLA 3EZ5A 1KFSA 4F72A 2ZUDA 3A0BU 3SV3A 5AM1A 4C4RA 4FZNA 1WCNA 3L3FX 2KN7A 1COOA 4PL2A 5KG5A 5IILA 1S0VA 3BJYA 2VA8A 2PMZF 4P2HA 4DSIA 1PK1B 3RRGA 1N63A 4DQPA 4IRCA 5J2GA 8ICVA 1FFUA 3WU2U 9ICMA 1UA0A 4J9OA 5ALFA 1SZPA 4ED6A 2RDJA 7ICNA 4MFCA 4P0PA 2IOHA 2YB1A 1DGJA 4I27A 4YFKA 4UBBA 3Q8KA 4XRHA 3KHRA 5KT3A 5HHIA 2R8JA 4DQRA 1TFRA 2LHTA 2WF6A 5EWFA 4C7YA 2AXTU 1S0NA 1J2MA 2A3VA 2C28A 3KOOA 2E3TA 2H5XA 3UXOA 5J0XA 4GLXA 4YD2A 1RQNA 3MDCA 2DKZA 3HX0A 2V4QA 2BKEA 3HW8A 5DB9A 5ALGA 1ZQVA 2LYAA 4TQSA 1U49A 1JRPA 3MDAA 2ZTDA 3VCBA 1SV4A 4B9VA 3C2KA 5KFBA 2AGOA 4OJPA 4C8LA 2W55A 5DLFA 5KT7A 5KFDA 4DOAA 2CPRA 3D6JA 5DB8A 2F8LA 1UT8A 2MSNA 3H0RB 4J9PA 8ICMA 2MUTA 4LJXA 2KZMA 3QUQA 4RNMA 4TURA 5DDYA 1ZQQA 3EPGA 4J03A 5FP0A 4P4OA 2FI1A 4RT2A 3ZI4A 2NRTA 2XCPA 2ZXIA 3SR6A 5ALNA 4YR2A 2K8AA 5KFPA 4A8EA 3ETRA 2AQ0A 5KL1B 2W43A 4JK1A 2WAQC 5DBAA 4RPYA 2YB4A 2W9AA 3RB6A 4O3SA 2KZZA 5J8YC 1S10A 4DF4A 1F44A 2ZIUB 5DG8A 1ZQSA 1DRGA 3JPNA 2EZXA 3SQIA 1X66A 4YD1A 3PMLA 3PMNA 5ALPA 3RJIA 2BCVA 2YX8A 1X9MA 2H3ZA 1RXVA 5ALKA 4KLSA 3F2DA 2BDPA 3OPXA 2JV3A 5J2EA 3BQ7A 2EANA 2WB1F 5ALJA 5DBCA 4IR1A 1S0OA 2H3IA 3IHQB 3C23A 3ZDBA 2JRZA 3E58A 1PVRA 3B0YA 4M9LA 1WWUA 3G6XA 1PK3A 1Q3UA 1NKCA 2KVSA 2Y1JA 4YXJA 4I28A 2FMSA 4FZMA 1S97A 4RQ6A 3UXPA 4YQWA 4DSEA 2WTFA 2QB1A 1M6YA 3LVWA 2AU0A 3NRZA 1KTQA 4NLGA 4PHPA 4YR3A 5C0YA 4ECZA 5AKZA 1WG8A 4EEKA 5CEHA 4Z6FA 2GLEA 4RQMA 3SAHA 9ICAA 5EWEA 1TVAA 3TKAA 9ICPA 2LM1A 5KFAA 4J9RA 4NM1A 2NRZA 5CB1A 1B4FA 1MSWD 4IR9A 4F4KA 2IOFA 5DKWA 4PHEA 1Q3VA 1KDHA 2B6GA 4KLIA 4R8UA 3I1YA 3V7KA 4XUSA 1NK8A 2BHNA 2OXOA 1DK3A 4IRKA 4UB4A 3EYZA 5DLGA 5KFLA 3GU3A 2W7OA 3UMBA 3K1RB 3JPTA 1BNPA 2W8KA 9ICUA 1DOQA 1CI4A 5GTHU 8ICTA 5BOMA 5KTQA 4RQ3A 5L1MA 1TE2A 3NS1A 4OO1J 4PHAA 1BPXA 5CJ7A 5CR0A 3BS5A 4P4MA 5AIAA 2MUTB 4PZOA 1ZQRA 3WKDA 8ICPA 4BDPA 4KTQA 2XY5A 2L5YA 1RYRA 5IIOA 2GOLA 2KE7A 1ZQKA 4JUZA 5KFCA 5KFRA 5ALMA 4QZDA 4F4XA 2KD1A 3C21A 4KLOA 1O03A 1NNLA 4KN4A 4Y2TA 1ZYQA 5CRXA 2C2EA 4F93B 3JPPA 1TV9A 2DPJA 1UQVA 3BZCA 4M6WA 2H3QA 2QKQA 2VJ5A 3FC4A 2ZIUA 4ECUA 4B9NA 2K4IA 5JTIA 2BPCA 4AYBF 3QU5A 3TAPA 3AN1A 1UHUA 3PX0A 1MA7A 3RJEA 4F92B 1ZQTA 4QWEA 4QZGA 1XO0A 4RQ1A 5T14A 4F4WA 1TK8A 5ALRA 5D49A 4UW9A 4O9MA 3PSTA 1U9LA 2ASLA 1URJA 4ELTA 5D46A 4RPXA 3QUCA 3WK8A 4CE6A 4B9LA 8ICHA 2IA6A 4NLZA 5L1LA 4UQGA 2KSOB 4QZBA 2KFZA 1KFDA 4UB5A 4GC7A 3ZD8A 4DFPA 2F1JA 3N7PD 1TK5A 2UVWA 3WK9A 2E1FA 3H8MA 3WKBA 4B9MA 1ZJNA 4Z6EA 5CA7A 5ALIA 2ZTEA 3ISBA 2WHEA 1X6JA 5G5GA 4KITB 3IN5A 9ICJA 2I5HA 3KHHA 2KKPA 1Z00A 4DFDA 3V7JA 5KFUA 4DO9A 5HNKA 1S0MA 1PVQA 8ICZA 4QZ9A 3NUQA 3FAHA 3TADA 3KHLA 3ONNA 3BQTA 4F4YA 2BZFA 4Q45A 1ZD5A 3S6JA 5L1KA 1SKRA 4JV1A 2MU2A 4HYKA 2FJ6A 5DG9A 3AU6A 2YMMA 3HKZF 2G5HB 4RQ7A 3RB3A 3EUB2 4QIWC 2XY7A 1T4GA 2BPGA 3IV6A 4EX7A 1EXNA 4GXJA 1X2IA 4UASA 3M6ZA 2HBMA 5F9LA 3DEEA 3C5GA 2ZIWB 4Y2QA 4JB3A 4C7ZA 1L7OA 1T3QA 2GO7A 4DL3A 4ED8A 9ICIA 3NVZA 4IQVA 1JXLA 4F50A 4C4SA 3CW2C 5L9XA 4C0ZA 1XSNA 1RZTA 2F77X 3KBBA 1A77A 2AJQA 4YR0A 4I2CA 4LZGA 2QLTA 3MR2A 4QIWF 3T5KA 2DKXA 5J0WA 1XC9A 1SWWA 1LV5A 3QU2A 5D4BA 3Q8QB 1TKDA 4B9UA 3C2LA 3DV9A 3C1ZA 4KLFA 8ICQA 2JEGA 3T5HA 3TQ1A 2KKVA 4DLGA 4ECRA 4NJ8A 2JZBA 4BXOA 5KFTA 5ALSA 4NLNA 2HBLA 5J2KA 3SI8A 1LKYB 5AKEA 1Y88A 1BVSA 1V97A 4IL6U 4QJFB 3T5JA 2OEHA 1ZRMA 4GC6A 1NK9A 4MF2A 1CRXA 3M1YA 3ZD9A 4QZHA 1OXJA 2P6RA 3RFAA 3RJGA 3NGDA 4IS7A 3Q8RB 3GV8B 2F44A 2KG5A 1NJZA 3IRUA 4PL1A 3MR3A 2JR5A 3PW0A 1OW5A 5KFQA 5KFKA 2F76X 4Y2UA 4O3NA 1ZQXA 3PSFA 4BJQA 1L7MA 1T7PA 3AEVA 4I2BA
chains in the Genus database with same CATH topology
3SAHA 2CPRA 2LBOA 2JH7A 4CDGA 2F8LA 5C0YA 2HOIA 2Z7JA 5T14A 3H0RB 2K89A 3KZXA 2W03A 2D6FC 2K4EA 1ECWA 4NWIA 3SAGA 3H0MB 2OYYA 4JMUA 3KFUF 4FE3A 2KEYA 1GO3F 1WUDA 3F53A 2G07A 2W7PA 3C29A 2RRDA 3CP8A 2HMXA 2OM6A 3K1ZA 3PSTA 4C0ZA 4ICAA 2ZXIA 4FZNA 4NLCA 3SAFA 3O0FA 2F77X 2NV3A 3IP4B 3L3FX 2K4HA 1URJA 4PL2A 4QNLA 1Q3VA 1ED1A 3N7RC 3CRXA 4FZLA 2Y0SC 3IG8A 2OH2A 4CGZA 2K8AA 2ZIXB 3M6KA 4NLBA 4KMOB 4QIWF 1XNSA 3AL0B 1IIPA 2G06A 2F2AB 2PMZF 4OJLA 4A8EA 1A0PA 5KL1B 2BDUA 2OXOA 2WAQC 2KJ5A 3D2NA 1Z19A 2HOFA 5HR6A 3T79A 5HR7A 3N7SC 2YB4A 4IC9A 3GU3A 4ACOA 2W7OA 1NZBA 1SZHA 2R18A 3F2CA 3SMVA 3N7PD 1F44A 2ZIUB 2MRLA 1TAMA 3LYSA 2ZIVB 1DRGA 2RHFA 2KKVA 3SQIA 2E1FA 2KOBA 4P0PA 4BX9C 2GH1A 1ZQ1C 2JMGA 2KNJA 2YB1A 2N1RA 1KBUA 2YX8A 4P0QB 2W04A 2G5IB 4OO1J 4WJ3B 4OJ6A 2H3ZA 1HIWA 2K8CB 2ZXHA 2RP5A 3F2DA 3LVVA 5KL8B 3IN5A 2VKQA 3OPXA 4U7CA 3IG5A 2VIXA 1P7DA 2Y0SF 1UPHA 2E1EA 2KJ8A 2KKPA 1A6SA 2HBLA 2JGAA 2WB1F 2LKYA 4KX3A 3D2SA 2XICA 2LHTA 1YT3A 3F5EA 2DQNB 2E5SA 2XVTA 1L6NA 2PMZC 4QJFB 3PSPA 2DGZA 4OJ5A 3D2QA 3VC8A 2A3VA 2LYBA 2WAQF 2H3IA 2JHDA 2KIWA 2KV2A 1PVQA 3CYMA 4CRXA 2GOLA 2CN1A 2ZIWA 3NUQA 1CRXA 2DF4B 2XI9A 2ZIVA 5A0LA 3ONNA 1T94A 2G08A 2M0NA 3AQEA 2G0AA 4P0PB 1PVRA 4BUGA 2JH1A 2KD1A 2XIDA 1Q3UA 2CRXA 3MGVA 2Q4TA 3F5AA 3H0LB 4P0QA 3NRWA 3GZFA 2H3FA 2VJ4A 3RFAA 3HKZF 2MA1A 2G5HB 1OUQA 5CRXA 2KHVA 1HEKA 3ICXA 2HBKA 3HKZC 4FZMA 2KHQA 2H3QA 2LYAA 2VJ5A 4NV0A 4PL1A 4OJOA 2K8BB 2ZIUA 4U6PA 4AYBC 4QIWC 3E0FA 2K4IA 3LVWA 3RF9A 2KICA 3M7DA 1D8BA 2KVCA 4AYBF 3VCBA 3PZPA 1PVPA 2HOQA 2WB1C 3PSIA 2F76X 2HBJA 3AQFA 1MA7A 2ZIXA 4BJQA 3PSFA 3C28A 2ZG6A 3M6ZA 2HBMA 3F2BA 3DEEA 4OJPA 1Z1BA 4O3MA 2ZIWB 4KX5A 2H3VA 3ALRA 4GFJA 1XO0A 2G09A 2KJ9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1HIW A;  2H3F A;  1A6S A;  1UPH A;  1HEK A;  2K4E A;  1ECW A;  4IC9 A;  4JMU A;  2H3Q A;  2LYA A;  1L6N A;  2K4I A;  1TAM A;  2HMX A;  2LYB A;  2H3I A;  4ICA A;  2GOL A;  2NV3 A;  2K4H A;  2JMG A;  1ED1 A;  2N1R A;  2H3V A;  2H3Z A; 
#chains in the Genus database with same CATH topology
 3CNH A;  1L3U A;  3OJS A;  2R8H A;  4ED7 A;  2D6F C;  3PO4 A;  1ECW A;  4F5Q A;  3L4P A;  3K4G A;  2G07 A;  4ELU A;  3C29 A;  2M9N A;  2RRD A;  2AHO B;  4O5C A;  3I28 A;  3M9O B;  3HP6 A;  4DCC A;  2Y0S C;  4KMO B;  3WK6 A;  5J8Y A;  4RQN A;  4J9N A;  2BDU A;  4QZ8 A;  2HI0 A;  2P6U A;  3D2N A;  4MEX A;  4UAW A;  2PFP A;  3T79 A;  1FO4 A;  4DEZ A;  1V9P A;  1SIJ A;  4YP3 A;  5ALO A;  3LYS A;  2FMQ A;  2ZIV B;  1X40 A;  5KFN A;  3RH4 A;  4M0A A;  4OCZ A;  4UBC A;  2N1R A;  2HHX A;  4P0Q B;  1XWL A;  5KL8 B;  2VKQ A;  4C80 A;  2E1E A;  2EDU A;  3UMG A;  5AI5 A;  2LKY A;  2EZZ A;  4F8R A;  4Z6D A;  2LYB A;  4QZI A;  2EAM A;  5J2J A;  3OSP A;  2G08 A;  1JIH A;  2XO7 A;  4P0P B;  5IIN A;  4TQR A;  4DL5 A;  4R65 A;  2Q4T A;  3H0L B;  4PGY A;  1N5X A;  1X6I A;  4ECW A;  3ICX A;  1TK0 A;  3HKZ C;  1KKX A;  1UCV A;  1JXE A;  3BZK A;  4F5N A;  4IQT A;  3RF9 A;  1S9F A;  1SXD A;  3NVW A;  1U47 A;  4BXO B;  4O3M A;  3ALR A;  2O6K A;  5JU5 A;  1X9X A;  2CXY A;  3GDX A;  4FO6 A;  3M8S A;  3RAQ A;  1NI3 A;  5AI0 A;  2LPE A;  4NWI A;  5TZV A;  3ISC A;  2KEY A;  2EAO A;  1WUD A;  3C5F A;  1KW4 A;  1K1Q A;  2W7P A;  2YY6 A;  3CP8 A;  1D9D A;  5ALL A;  4ICA A;  8ICG A;  2FLN A;  3QX7 A;  2LMR A;  4DSF A;  4UB8 U;  2OH2 A;  5DB6 A;  4CGZ A;  5DGB A;  2DWQ A;  1KLN A;  4Q44 A;  2KJ5 A;  1QTM A;  5C5J A;  1QLN A;  1SZH A;  2A19 A;  2W3S A;  3UMC A;  4QWC A;  2VAN A;  1B0X A;  3MBY A;  3TI0 A;  1TAU A;  2LI6 A;  2E8M A;  1ZQY A;  3PO5 A;  5KFX A;  4UAR A;  4UAY A;  2ZJA A;  4ECQ A;  2XCA A;  1ZOL A;  2JEI A;  4EZ9 A;  3HJE A;  9ICH A;  4RU9 A;  2AQ4 A;  7ICT A;  3F5E A;  3TAN A;  1L6N A;  1ZQW A;  3D2Q A;  1KSP A;  2XI9 A;  5E79 U;  3PX6 A;  1JN3 A;  4P4P A;  1XS9 D;  3RJJ A;  2XID A;  2CRX A;  5EE3 A;  4C4T A;  4B9S A;  4M9G A;  9ICC A;  2YMP A;  2QB0 A;  4MFA A;  5EE1 A;  2LM4 A;  1VLB A;  5J2B A;  5AK3 A;  3LWM A;  3M7D A;  2K4P A;  2FE9 A;  2KMD A;  3QZ8 A;  5HMM A;  1Z1B A;  1XSP A;  1N60 A;  8ICW A;  3AU2 A;  5KFV A;  2HOI A;  2Z7J A;  5DB7 A;  5DQI A;  4F5P A;  2K89 A;  5J2A A;  4JWN A;  5KG4 A;  1LVH A;  3ZDC A;  4I2I A;  4GIB A;  3TAC B;  2HHQ A;  1N5W A;  2OWO A;  1BPB A;  4Q43 A;  4YCX A;  2NV3 A;  2YTU A;  1DGS A;  2FMP A;  3QXG A;  1A0P A;  3EPI A;  2YMQ A;  4JV0 A;  1QSY A;  4FS1 A;  2HOF A;  5AKY A;  4B9T A;  4CNQ A;  1ZQG A;  4BGD A;  2BCR A;  4F2R A;  4EBD A;  2RHF A;  3ISD A;  1U45 A;  3QUB A;  2Y1I A;  3RRH A;  4CCH A;  4WJ3 B;  8ICI A;  1PZN A;  2WFA A;  1ZQO A;  1HUO A;  2VIX A;  1V38 A;  4ECV A;  2Y0S F;  4TUP A;  3H40 A;  4TUQ A;  2JGA A;  3BS7 A;  4DF8 A;  3GII A;  5KFG A;  3MFI A;  5JRT A;  3VC8 A;  1XSL A;  2CN1 A;  2Y9U A;  2G0A A;  1JMS A;  2NRV A;  3WK7 A;  3T5L A;  1FFV A;  5ALZ A;  2H3F A;  2MA1 A;  5EE0 A;  5AM2 A;  2IHN A;  3BS5 B;  1QH9 A;  3H7I A;  2WB1 C;  3SYZ A;  4NXZ A;  1NJW A;  4O3P A;  9ICB A;  2BCQ A;  2H3V A;  3H8J A;  2B0C A;  2RLT A;  2ZUB A;  4DOB A;  1A76 A;  1K5O A;  3QU4 A;  2ODG A;  4F91 B;  2A1J B;  1J97 A;  5HP4 A;  5J2F A;  1T8E A;  4EYI B;  2OYY A;  4I2E A;  2XGQ A;  4KLG A;  1L7P A;  4ED3 A;  1J2N A;  2V4R A;  3TFS A;  2WF5 A;  4DLE A;  7ICQ A;  3OTQ A;  2AGQ A;  7ICH A;  3SAF A;  1NK6 A;  5J0Y A;  3N7R C;  1IV8 A;  1BPY A;  4R66 A;  4RQ0 A;  2ZIX B;  5K4L A;  4NLB A;  5AI4 A;  1ZQD A;  1KN5 A;  3MR5 A;  4EYH B;  1B22 A;  9ICV A;  5J29 A;  2PKE A;  4RNN A;  5ALW A;  5IIK A;  5KG0 A;  2BQ3 A;  1D9F A;  4DSJ A;  4Q8E A;  7ICF A;  2K60 A;  2UVU A;  3NVY A;  2MRL A;  3KD3 A;  3QNM A;  2HHS A;  5AKI A;  3N28 A;  7ICK A;  4KLU A;  1KQQ A;  3JPO A;  1RG6 A;  2WF7 A;  4C8N A;  1SV0 C;  1HIW A;  4B6J A;  2ZXH A;  3H4B A;  2QAR B;  1C7Y A;  2I9G A;  2KSO A;  1ZQN A;  5AM4 A;  3EWA A;  3FM9 A;  5J0U A;  1SKW A;  8ICY A;  1YT3 A;  2PMZ C;  2DGZ A;  3QE9 Y;  2ZIW A;  2DF4 B;  4USA A;  5A0L A;  3V6H A;  3HPO A;  2ALZ A;  5CHG A;  4DOC A;  1QCK A;  1RYS A;  4NLK A;  5KNI A;  3H4D A;  3THV A;  4DWI A;  2KHQ A;  4NV0 A;  1X9W A;  4OJO A;  2YQE A;  4K4I A;  1RM6 C;  1SXE A;  3Q8M A;  1N48 A;  2ZG6 A;  3ZDD A;  2IMW P;  4YG2 A;  4XQ8 A;  1U4B A;  7ICL A;  1MN8 A;  4RQ2 A;  2C2D A;  5ALQ A;  4Y2J A;  4KN7 A;  4RPZ A;  3HIL A;  1BPE A;  1ZQM A;  2OHF A;  9ICF A;  3FYH A;  1NKE A;  1IM4 A;  4QZC A;  1NJX A;  4RQ8 A;  4EBE A;  2VA3 A;  1GO3 F;  1ZD3 A;  4ED0 A;  4EEN A;  8ICB A;  5J0Q A;  2FDR A;  1ZET A;  4DFM A;  1L3S A;  3O0F A;  2HDO A;  2NYV A;  3IP4 B;  4QZE A;  4X5V A;  2W54 A;  4BWM A;  5III A;  3MGH A;  8ICR A;  2OCE A;  4CF3 A;  4BWJ A;  3C2M A;  1LKY A;  3PW4 A;  1Z19 A;  5GTI U;  5G5H A;  2R8G A;  2E8O A;  2R18 A;  2NO4 A;  1WCL A;  3C1Y A;  8ICE A;  3B0X A;  1TAQ A;  2D3D A;  4PH5 A;  3I76 A;  2ESE A;  1ZRN A;  4EX6 A;  5EE9 A;  5CWR A;  3UQ0 A;  1L8O A;  4U7C A;  2IOF K;  2KJ8 A;  3KKA C;  1MQ3 A;  4DQI A;  3ZDE A;  4EEL A;  2Q0Z X;  3ORY A;  1NK7 A;  4CRX A;  1YZ6 A;  2KIW A;  4ELV A;  4OD0 A;  5J0R A;  2W9M A;  3AQE A;  4UAU A;  1IG6 A;  2JZB B;  2P66 A;  1DXS A;  5AK4 A;  7ICM A;  4RQ5 A;  3RJK A;  4F4Z A;  4I2H A;  4RUC A;  4NL9 C;  1RDF A;  8ICS A;  1NKB A;  4ECT A;  3WK4 A;  3BQ0 A;  1VDV A;  2HHT A;  5AKK A;  2ATL A;  2LYH A;  2DBY A;  2W9C A;  4KLH A;  3PW5 A;  4I2J A;  2YML A;  2KJ9 A;  3SEN A;  3RJF A;  1KL9 A;  5ALH A;  4JV2 A;  4HAI A;  2HCF A;  3B9J A;  2W8L A;  4FBU A;  4M9N A;  1D8L A;  5AKX A;  4NLC A;  4Y2Y A;  1DK2 A;  4G9B A;  3AM9 A;  5DBB A;  4F3O A;  9ICO A;  2EQY A;  5EWG A;  3JPR A;  3R9K A;  1JI7 A;  7ICU A;  2BCS A;  5KG7 A;  4J9Q A;  8ICF A;  4IC9 A;  4ACO A;  1NZB A;  3QEB Z;  4YVZ A;  3GIK A;  1SL0 A;  1X9S A;  3V6K A;  2IHM A;  1JRO A;  5IIJ A;  5HHH A;  1FEZ A;  1X42 A;  3TAD C;  2G5I B;  3V7L A;  5KT6 A;  1MQ2 A;  4LVS A;  3UXN A;  4UAV A;  5AKH A;  3IM1 A;  2I1Q A;  4O5E A;  1U48 A;  2V9W A;  3LDA A;  1B43 A;  5AHX A;  1COK A;  2ZIV A;  3MFH A;  5KAI U;  1SWV A;  5KFM A;  2F1I A;  2PFO A;  8ICO A;  1N56 A;  8ICJ A;  4P0Q A;  5KFF A;  4F71 A;  4PPX A;  4US8 A;  5H2F U;  2XY6 A;  1RXW A;  2KHV A;  2HBK A;  2KP7 A;  1BPD A;  2IBK A;  1MC8 A;  1JAL A;  2FLL A;  5JUM A;  3PZP A;  4CF4 A;  5ALE A;  1ZJM A;  4YMM A;  1NJY A;  7ICG A;  2LBO A;  2JH7 A;  4QZA A;  3G6Y A;  1N61 A;  4KMU A;  7ICP A;  1Z3E B;  1ZXI A;  5AKJ A;  5AKG A;  3PW7 A;  4IRD A;  2K4E A;  4R63 A;  3M9N B;  1HJP A;  3RJH A;  3RH6 A;  3PV8 A;  1RYU A;  2DL0 A;  5L1J A;  3PX4 A;  4DL6 A;  5HML A;  4Q8F A;  4QW8 A;  1ED1 A;  4FZL A;  4C8K A;  2HHV A;  5DQG A;  3AL0 B;  4OJL A;  4MF8 A;  2R8K A;  3N4M B;  3M8R A;  5ALD A;  2B21 A;  1FIQ A;  5HR7 A;  3N7S C;  3SEI A;  2BQU A;  2ZJ5 A;  1XU4 A;  1KEJ A;  3MAB A;  5KG1 A;  1ZQ1 C;  1F5S A;  3QU7 A;  2K8C B;  1JX4 A;  2QB0 B;  5AIB A;  3IDW A;  3KTQ A;  3IG5 A;  4IQU A;  4KX3 A;  2D8C A;  4QWB A;  2AH5 A;  5BOL A;  5KG2 A;  3PSP A;  4ED2 A;  5AM3 A;  4UB1 A;  5KFO A;  4EEY A;  5J0P A;  2NRX A;  2Y9T A;  4QWA A;  9ICQ A;  3Q8S B;  4AP9 A;  3QU9 A;  2WF9 A;  2ES6 A;  4ZOH C;  4M2Y A;  4RT3 A;  1XO1 A;  2VJ4 A;  4FS2 A;  3WKA A;  5AM0 A;  4ZH4 A;  3PVX A;  1ZD4 A;  4UB3 A;  2KVC A;  2ZTC A;  4E0D A;  1C20 A;  4YN4 A;  4I2G A;  3AQF A;  2J6S A;  1UT5 A;  3RR7 A;  3C28 A;  4QWD A;  4KX5 A;  5KT2 A;  3RBD A;  1ZQI A;  4ECY A;  5J0O A;  2ASD A;  4O3R A;  9ICX A;  1Q8K A;  2F3N A;  5IIM A;  3QEA Z;  2W03 A;  4DSL A;  3SAG A;  4YXM A;  3KFU F;  3MC1 A;  2RQ5 A;  1D8Y A;  3KHG A;  4K4H A;  5KFJ A;  2OM6 A;  3K1Z A;  4UAT A;  4QNL A;  1ZQA A;  3H8W A;  2UVV A;  3WKC A;  3Q8P B;  2JEF A;  4Y2S A;  1WYG A;  4TUS A;  2F8K A;  4PGX A;  2RDI A;  5J2C A;  1XNS A;  4I29 A;  4DS5 A;  1NOM A;  4DFK A;  3RB4 A;  4EZ6 A;  2MAX A;  3JPQ A;  4CF5 A;  1NK4 A;  5F9N A;  2KIV A;  4PHD A;  3E2E A;  1BPZ A;  2HW3 A;  3NVV A;  4KLM A;  4BX9 C;  5B66 U;  2W04 A;  4DL4 A;  5EOZ A;  5AK5 A;  5ALV A;  2BGW A;  3GIL A;  2HVH A;  1L5U A;  4FBT A;  2A1J A;  1S8O A;  2XIC A;  1ZQJ A;  2EZY A;  2E5S A;  4OJ5 A;  2JHD A;  3WK5 A;  5KG6 A;  4O3O A;  5KFS A;  3QZ7 A;  7ICS A;  4R64 A;  3OJU A;  4BUG A;  3KKA A;  3UM9 A;  1JUD A;  3MGV A;  4NY8 A;  3F5A A;  1SL2 A;  1L3V A;  4DSK A;  3UPQ A;  1QSS A;  1AQ6 A;  2HSZ A;  4AYB C;  2C22 A;  3E0F A;  7ICJ A;  9ICL A;  2R8I A;  4J9K A;  9ICW A;  1S76 D;  2KZ3 A;  2ZIX A;  1PVP A;  4K4G A;  3SZ2 A;  3GFK B;  5AM5 A;  3ZDA A;  2VA2 A;  2G09 A;  4CDG A;  2JEJ A;  2AGP A;  1CEZ A;  1ZQZ A;  4J9L A;  3AUO A;  1RPL A;  2ZUC A;  9ICE A;  4JMU A;  2FPM A;  3HWT A;  1Q46 A;  5KFI A;  3GIJ A;  2HMX A;  2XC9 A;  3A0H U;  4ED1 A;  4RZR A;  3PR4 A;  8ICU A;  2KFN A;  3CRX A;  5ALT A;  9ICN A;  5AI8 A;  1RQL A;  9ICS A;  8ICK A;  3HT3 A;  2E8P A;  3N97 B;  1IIP A;  2G06 A;  3TFR A;  4I2A A;  1BNO A;  4NL9 A;  4Z6C A;  9ICG A;  3PNC A;  4PZN A;  1ARO P;  1ZQF A;  3PY8 A;  5HR6 A;  1HUZ A;  3SMV A;  1QQ7 A;  2HHU A;  3SD7 A;  2DFL A;  2J6T A;  5KG3 A;  5AIC A;  2GH1 A;  1N2X A;  2PI5 A;  2ZJ8 A;  1KBU A;  1S5L U;  3OGU A;  3BQ2 A;  5KFY A;  4I2D A;  2FPL A;  2KK0 A;  3LVV A;  4UAZ A;  3K75 D;  1A6S A;  9ICR A;  1KFT A;  2XVT A;  4G3I A;  4UB2 A;  3M9M B;  3GIM A;  2ASJ A;  2FPK A;  2WAQ F;  3CYM A;  4R8U B;  3KZI U;  4DL2 A;  1SB3 C;  3OHB A;  2E8N A;  8ICC A;  5F3X B;  3EW9 A;  5DGA A;  1SV0 A;  3AMZ A;  2W11 A;  3GZF A;  3WKE A;  1K1S A;  4XA5 A;  2QAR A;  1NZP A;  1ZQL A;  1NK5 A;  5DQH A;  7ICV A;  3GV7 B;  2KIC A;  2ISP A;  2FLP A;  4PGQ A;  4Y2X A;  4KLD A;  4US9 A;  2W3R A;  3ED5 A;  2PI4 A;  3GQC A;  4KLE A;  3NRW A;  1ZQB A;  3Q8L A;  4KLJ A;  2BR0 A;  3QUT A;  4M04 A;  3T3F A;  1Z4N A;  2DPI A;  4DQQ A;  2EH9 A;  3F53 A;  3RAX A;  3RB0 A;  4JWM A;  3TAR A;  2K4H A;  1N62 A;  1YZ7 A;  3V6J A;  3V72 A;  4GXK A;  5TIS U;  4YMN A;  3M6K A;  3LWL A;  2F2A B;  5DG7 A;  2PFQ A;  8ICA A;  4LZD A;  4ECX A;  4F5R A;  5ALX A;  4M6W B;  2GWS A;  3NAS A;  2UVR A;  2BCU A;  3LK9 A;  8ICL A;  4M9H A;  3TAQ A;  1TAM A;  2BQR A;  4Y2P A;  2KOB A;  5CP2 A;  2JMG A;  2KNJ A;  2W9C B;  1LB2 B;  4RNO A;  3NTU A;  5J2I A;  7ICE A;  3JPS A;  1IXR A;  2W9B B;  3OSN A;  4F2S A;  2PXI A;  1L3T A;  3G6V A;  4EBC A;  5KFW A;  3D2S A;  2C2R A;  2P35 A;  4KLT A;  3FDS A;  3L5K A;  2KV2 A;  2EAP A;  3RH5 A;  1T94 A;  1QQ6 A;  2HHW A;  2JH1 A;  5KT5 A;  2DUY A;  1PK1 A;  1OUQ A;  1SKS A;  4J9S A;  4NM2 A;  3BQ1 A;  1SGG A;  1Z4O A;  2J6U A;  4KLL A;  3BDP A;  1T3N A;  2K8B B;  1Z00 B;  4MHV A;  2A1A A;  5DDM A;  5L1I A;  1D8B A;  2F1H A;  4O5K A;  3HRD D;  2PFN A;  1L8L A;  4QW9 A;  5AI9 A;  3OHA A;  5ALU A;  4KLQ A;  5KAF U;  4GFJ A;  4PJ0 U;  5J0T A;  1Z1V A;  4YMO A;  3KZX A;  3H0M B;  3SV4 A;  5J2D A;  4FE3 A;  5KT4 A;  1ZQH A;  9ICK A;  4DFJ A;  5AI6 A;  5KFE A;  4UB6 U;  2KTQ A;  2BPF A;  3RBE A;  4MFF A;  4O3Q A;  3DDH A;  3IG8 A;  4GXI A;  4Y2R A;  7ICI A;  3MGI A;  5KFZ A;  5B5E U;  3U26 A;  5AKL A;  1CUK A;  1VJ5 A;  4M47 A;  1KRP A;  7ICR A;  4J9M A;  3H8S A;  2NRW A;  3F2C A;  1SL1 A;  2XGP A;  4MEY A;  4DL7 A;  1ZQE A;  1ZQP A;  8ICX A;  3QYP A;  1WWV A;  1UA1 A;  1QSL A;  3PR5 B;  1ZQU A;  2JXJ A;  4QZF A;  4RQ4 A;  3GV5 B;  4OJ6 A;  1NK0 A;  2RP5 A;  9ICT A;  1P7D A;  1UPH A;  4RUA A;  3MR6 A;  2NO5 A;  1BGX T;  1S77 D;  2DQN B;  5J0S A;  2HVI A;  4C8O A;  2YN4 A;  1F0M A;  1PUZ A;  4IQW A;  2M0N A;  4Y2V A;  4ECS A;  3UQ2 A;  5AK6 A;  1QQ5 A;  1H38 A;  1HEK A;  1L7N A;  4C8M A;  2WF8 A;  7ICO A;  8ICN A;  4I2F A;  4U6P A;  5BPC A;  2I6X A;  4O0I A;  1ZD2 P;  4FFD A;  4DQS A;  4F5O A;  3RTV A;  4DS4 A;  2HOQ A;  3RR8 A;  3PSI A;  2HBJ A;  3F2B A;  5J2H A;  5ALY A;  1O08 A;  2ISO A;  3PW2 A;  3J81 j;  2W9B A;  5KFH A;  1ZQC A;  4M9J A;  1V85 A;  3ETL A;  3EZ5 A;  1KFS A;  4F72 A;  2ZUD A;  3A0B U;  3SV3 A;  5AM1 A;  4C4R A;  4FZN A;  1WCN A;  3L3F X;  2KN7 A;  1COO A;  4PL2 A;  5KG5 A;  5IIL A;  1S0V A;  3BJY A;  2VA8 A;  2PMZ F;  4P2H A;  4DSI A;  1PK1 B;  3RRG A;  1N63 A;  4DQP A;  4IRC A;  5J2G A;  8ICV A;  1FFU A;  3WU2 U;  9ICM A;  1UA0 A;  4J9O A;  5ALF A;  1SZP A;  4ED6 A;  2RDJ A;  7ICN A;  4MFC A;  4P0P A;  2IOH A;  2YB1 A;  1DGJ A;  4I27 A;  4YFK A;  4UBB A;  3Q8K A;  4XRH A;  3KHR A;  5KT3 A;  5HHI A;  2R8J A;  4DQR A;  1TFR A;  2LHT A;  2WF6 A;  5EWF A;  4C7Y A;  2AXT U;  1S0N A;  1J2M A;  2A3V A;  2C28 A;  3KOO A;  2E3T A;  2H5X A;  3UXO A;  5J0X A;  4GLX A;  4YD2 A;  1RQN A;  3MDC A;  2DKZ A;  3HX0 A;  2V4Q A;  2BKE A;  3HW8 A;  5DB9 A;  5ALG A;  1ZQV A;  2LYA A;  4TQS A;  1U49 A;  1JRP A;  3MDA A;  2ZTD A;  3VCB A;  1SV4 A;  4B9V A;  3C2K A;  5KFB A;  2AGO A;  4OJP A;  4C8L A;  2W55 A;  5DLF A;  5KT7 A;  5KFD A;  4DOA A;  2CPR A;  3D6J A;  5DB8 A;  2F8L A;  1UT8 A;  2MSN A;  3H0R B;  4J9P A;  8ICM A;  2MUT A;  4LJX A;  2KZM A;  3QUQ A;  4RNM A;  4TUR A;  5DDY A;  1ZQQ A;  3EPG A;  4J03 A;  5FP0 A;  4P4O A;  2FI1 A;  4RT2 A;  3ZI4 A;  2NRT A;  2XCP A;  2ZXI A;  3SR6 A;  5ALN A;  4YR2 A;  2K8A A;  5KFP A;  4A8E A;  3ETR A;  2AQ0 A;  5KL1 B;  2W43 A;  4JK1 A;  2WAQ C;  5DBA A;  4RPY A;  2YB4 A;  2W9A A;  3RB6 A;  4O3S A;  2KZZ A;  5J8Y C;  1S10 A;  4DF4 A;  1F44 A;  2ZIU B;  5DG8 A;  1ZQS A;  1DRG A;  3JPN A;  2EZX A;  3SQI A;  1X66 A;  4YD1 A;  3PML A;  3PMN A;  5ALP A;  3RJI A;  2BCV A;  2YX8 A;  1X9M A;  2H3Z A;  1RXV A;  5ALK A;  4KLS A;  3F2D A;  2BDP A;  3OPX A;  2JV3 A;  5J2E A;  3BQ7 A;  2EAN A;  2WB1 F;  5ALJ A;  5DBC A;  4IR1 A;  1S0O A;  2H3I A;  3IHQ B;  3C23 A;  3ZDB A;  2JRZ A;  3E58 A;  1PVR A;  3B0Y A;  4M9L A;  1WWU A;  3G6X A;  1PK3 A;  1Q3U A;  1NKC A;  2KVS A;  2Y1J A;  4YXJ A;  4I28 A;  2FMS A;  4FZM A;  1S97 A;  4RQ6 A;  3UXP A;  4YQW A;  4DSE A;  2WTF A;  2QB1 A;  1M6Y A;  3LVW A;  2AU0 A;  3NRZ A;  1KTQ A;  4NLG A;  4PHP A;  4YR3 A;  5C0Y A;  4ECZ A;  5AKZ A;  1WG8 A;  4EEK A;  5CEH A;  4Z6F A;  2GLE A;  4RQM A;  3SAH A;  9ICA A;  5EWE A;  1TVA A;  3TKA A;  9ICP A;  2LM1 A;  5KFA A;  4J9R A;  4NM1 A;  2NRZ A;  5CB1 A;  1B4F A;  1MSW D;  4IR9 A;  4F4K A;  2IOF A;  5DKW A;  4PHE A;  1Q3V A;  1KDH A;  2B6G A;  4KLI A;  4R8U A;  3I1Y A;  3V7K A;  4XUS A;  1NK8 A;  2BHN A;  2OXO A;  1DK3 A;  4IRK A;  4UB4 A;  3EYZ A;  5DLG A;  5KFL A;  3GU3 A;  2W7O A;  3UMB A;  3K1R B;  3JPT A;  1BNP A;  2W8K A;  9ICU A;  1DOQ A;  1CI4 A;  5GTH U;  8ICT A;  5BOM A;  5KTQ A;  4RQ3 A;  5L1M A;  1TE2 A;  3NS1 A;  4OO1 J;  4PHA A;  1BPX A;  5CJ7 A;  5CR0 A;  3BS5 A;  4P4M A;  5AIA A;  2MUT B;  4PZO A;  1ZQR A;  3WKD A;  8ICP A;  4BDP A;  4KTQ A;  2XY5 A;  2L5Y A;  1RYR A;  5IIO A;  2GOL A;  2KE7 A;  1ZQK A;  4JUZ A;  5KFC A;  5KFR A;  5ALM A;  4QZD A;  4F4X A;  2KD1 A;  3C21 A;  4KLO A;  1O03 A;  1NNL A;  4KN4 A;  4Y2T A;  1ZYQ A;  5CRX A;  2C2E A;  4F93 B;  3JPP A;  1TV9 A;  2DPJ A;  1UQV A;  3BZC A;  4M6W A;  2H3Q A;  2QKQ A;  2VJ5 A;  3FC4 A;  2ZIU A;  4ECU A;  4B9N A;  2K4I A;  5JTI A;  2BPC A;  4AYB F;  3QU5 A;  3TAP A;  3AN1 A;  1UHU A;  3PX0 A;  1MA7 A;  3RJE A;  4F92 B;  1ZQT A;  4QWE A;  4QZG A;  1XO0 A;  4RQ1 A;  5T14 A;  4F4W A;  1TK8 A;  5ALR A;  5D49 A;  4UW9 A;  4O9M A;  3PST A;  1U9L A;  2ASL A;  1URJ A;  4ELT A;  5D46 A;  4RPX A;  3QUC A;  3WK8 A;  4CE6 A;  4B9L A;  8ICH A;  2IA6 A;  4NLZ A;  5L1L A;  4UQG A;  2KSO B;  4QZB A;  2KFZ A;  1KFD A;  4UB5 A;  4GC7 A;  3ZD8 A;  4DFP A;  2F1J A;  3N7P D;  1TK5 A;  2UVW A;  3WK9 A;  2E1F A;  3H8M A;  3WKB A;  4B9M A;  1ZJN A;  4Z6E A;  5CA7 A;  5ALI A;  2ZTE A;  3ISB A;  2WHE A;  1X6J A;  5G5G A;  4KIT B;  3IN5 A;  9ICJ A;  2I5H A;  3KHH A;  2KKP A;  1Z00 A;  4DFD A;  3V7J A;  5KFU A;  4DO9 A;  5HNK A;  1S0M A;  1PVQ A;  8ICZ A;  4QZ9 A;  3NUQ A;  3FAH A;  3TAD A;  3KHL A;  3ONN A;  3BQT A;  4F4Y A;  2BZF A;  4Q45 A;  1ZD5 A;  3S6J A;  5L1K A;  1SKR A;  4JV1 A;  2MU2 A;  4HYK A;  2FJ6 A;  5DG9 A;  3AU6 A;  2YMM A;  3HKZ F;  2G5H B;  4RQ7 A;  3RB3 A;  3EUB 2;  4QIW C;  2XY7 A;  1T4G A;  2BPG A;  3IV6 A;  4EX7 A;  1EXN A;  4GXJ A;  1X2I A;  4UAS A;  3M6Z A;  2HBM A;  5F9L A;  3DEE A;  3C5G A;  2ZIW B;  4Y2Q A;  4JB3 A;  4C7Z A;  1L7O A;  1T3Q A;  2GO7 A;  4DL3 A;  4ED8 A;  9ICI A;  3NVZ A;  4IQV A;  1JXL A;  4F50 A;  4C4S A;  3CW2 C;  5L9X A;  4C0Z A;  1XSN A;  1RZT A;  2F77 X;  3KBB A;  1A77 A;  2AJQ A;  4YR0 A;  4I2C A;  4LZG A;  2QLT A;  3MR2 A;  4QIW F;  3T5K A;  2DKX A;  5J0W A;  1XC9 A;  1SWW A;  1LV5 A;  3QU2 A;  5D4B A;  3Q8Q B;  1TKD A;  4B9U A;  3C2L A;  3DV9 A;  3C1Z A;  4KLF A;  8ICQ A;  2JEG A;  3T5H A;  3TQ1 A;  2KKV A;  4DLG A;  4ECR A;  4NJ8 A;  2JZB A;  4BXO A;  5KFT A;  5ALS A;  4NLN A;  2HBL A;  5J2K A;  3SI8 A;  1LKY B;  5AKE A;  1Y88 A;  1BVS A;  1V97 A;  4IL6 U;  4QJF B;  3T5J A;  2OEH A;  1ZRM A;  4GC6 A;  1NK9 A;  4MF2 A;  1CRX A;  3M1Y A;  3ZD9 A;  4QZH A;  1OXJ A;  2P6R A;  3RFA A;  3RJG A;  3NGD A;  4IS7 A;  3Q8R B;  3GV8 B;  2F44 A;  2KG5 A;  1NJZ A;  3IRU A;  4PL1 A;  3MR3 A;  2JR5 A;  3PW0 A;  1OW5 A;  5KFQ A;  5KFK A;  2F76 X;  4Y2U A;  4O3N A;  1ZQX A;  3PSF A;  4BJQ A;  1L7M A;  1T7P A;  3AEV A;  4I2B A; 
#chains in the Genus database with same CATH homology
 3SAH A;  2CPR A;  2LBO A;  2JH7 A;  4CDG A;  2F8L A;  5C0Y A;  2HOI A;  2Z7J A;  5T14 A;  3H0R B;  2K89 A;  3KZX A;  2W03 A;  2D6F C;  2K4E A;  1ECW A;  4NWI A;  3SAG A;  3H0M B;  2OYY A;  4JMU A;  3KFU F;  4FE3 A;  2KEY A;  1GO3 F;  1WUD A;  3F53 A;  2G07 A;  2W7P A;  3C29 A;  2RRD A;  3CP8 A;  2HMX A;  2OM6 A;  3K1Z A;  3PST A;  4C0Z A;  4ICA A;  2ZXI A;  4FZN A;  4NLC A;  3SAF A;  3O0F A;  2F77 X;  2NV3 A;  3IP4 B;  3L3F X;  2K4H A;  1URJ A;  4PL2 A;  4QNL A;  1Q3V A;  1ED1 A;  3N7R C;  3CRX A;  4FZL A;  2Y0S C;  3IG8 A;  2OH2 A;  4CGZ A;  2K8A A;  2ZIX B;  3M6K A;  4NLB A;  4KMO B;  4QIW F;  1XNS A;  3AL0 B;  1IIP A;  2G06 A;  2F2A B;  2PMZ F;  4OJL A;  4A8E A;  1A0P A;  5KL1 B;  2BDU A;  2OXO A;  2WAQ C;  2KJ5 A;  3D2N A;  1Z19 A;  2HOF A;  5HR6 A;  3T79 A;  5HR7 A;  3N7S C;  2YB4 A;  4IC9 A;  3GU3 A;  4ACO A;  2W7O A;  1NZB A;  1SZH A;  2R18 A;  3F2C A;  3SMV A;  3N7P D;  1F44 A;  2ZIU B;  2MRL A;  1TAM A;  3LYS A;  2ZIV B;  1DRG A;  2RHF A;  2KKV A;  3SQI A;  2E1F A;  2KOB A;  4P0P A;  4BX9 C;  2GH1 A;  1ZQ1 C;  2JMG A;  2KNJ A;  2YB1 A;  2N1R A;  1KBU A;  2YX8 A;  4P0Q B;  2W04 A;  2G5I B;  4OO1 J;  4WJ3 B;  4OJ6 A;  2H3Z A;  1HIW A;  2K8C B;  2ZXH A;  2RP5 A;  3F2D A;  3LVV A;  5KL8 B;  3IN5 A;  2VKQ A;  3OPX A;  4U7C A;  3IG5 A;  2VIX A;  1P7D A;  2Y0S F;  1UPH A;  2E1E A;  2KJ8 A;  2KKP A;  1A6S A;  2HBL A;  2JGA A;  2WB1 F;  2LKY A;  4KX3 A;  3D2S A;  2XIC A;  2LHT A;  1YT3 A;  3F5E A;  2DQN B;  2E5S A;  2XVT A;  1L6N A;  2PMZ C;  4QJF B;  3PSP A;  2DGZ A;  4OJ5 A;  3D2Q A;  3VC8 A;  2A3V A;  2LYB A;  2WAQ F;  2H3I A;  2JHD A;  2KIW A;  2KV2 A;  1PVQ A;  3CYM A;  4CRX A;  2GOL A;  2CN1 A;  2ZIW A;  3NUQ A;  1CRX A;  2DF4 B;  2XI9 A;  2ZIV A;  5A0L A;  3ONN A;  1T94 A;  2G08 A;  2M0N A;  3AQE A;  2G0A A;  4P0P B;  1PVR A;  4BUG A;  2JH1 A;  2KD1 A;  2XID A;  1Q3U A;  2CRX A;  3MGV A;  2Q4T A;  3F5A A;  3H0L B;  4P0Q A;  3NRW A;  3GZF A;  2H3F A;  2VJ4 A;  3RFA A;  3HKZ F;  2MA1 A;  2G5H B;  1OUQ A;  5CRX A;  2KHV A;  1HEK A;  3ICX A;  2HBK A;  3HKZ C;  4FZM A;  2KHQ A;  2H3Q A;  2LYA A;  2VJ5 A;  4NV0 A;  4PL1 A;  4OJO A;  2K8B B;  2ZIU A;  4U6P A;  4AYB C;  4QIW C;  3E0F A;  2K4I A;  3LVW A;  3RF9 A;  2KIC A;  3M7D A;  1D8B A;  2KVC A;  4AYB F;  3VCB A;  3PZP A;  1PVP A;  2HOQ A;  2WB1 C;  3PSI A;  2F76 X;  2HBJ A;  3AQF A;  1MA7 A;  2ZIX A;  4BJQ A;  3PSF A;  3C28 A;  2ZG6 A;  3M6Z A;  2HBM A;  3F2B A;  3DEE A;  4OJP A;  1Z1B A;  4O3M A;  2ZIW B;  4KX5 A;  2H3V A;  3ALR A;  4GFJ A;  1XO0 A;  2G09 A;  2KJ9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...