2H3VA

Structure of the hiv-1 matrix protein bound to di-c8-phosphatidylinositol-(4,5)-bisphosphate
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
131
structure length
131
Chain Sequence
GARASVLSGGELDKWEKIRLRPGGKKQYKLKHIVWASRELERFAVNPGLLETSEGCRQILGQLQPSLQTGSEELRSLYNTIAVLYCVHQRIDVKDTKEALDKIEEEQNKSKKKAQQAAADTGNNSQVSQNY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Gag polyprotein
publication title Structural basis for targeting HIV-1 Gag proteins to the plasma membrane for virus assembly.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Viral protein
total genus 33
structure length 131
sequence length 131
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2006-05-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00540 Gag_p17 gag gene protein p17 (matrix protein)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.90 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase; domain 1 2h3vA01
2H3QA 4ICAA 1TAMA 2JMGA 2H3VA 2GOLA 2H3ZA 1ECWA 1A6SA 1HIWA 1L6NA 2N1RA 2K4IA 2K4HA 4JMUA 1UPHA 2H3FA 2K4EA 2NV3A 2HMXA 1ED1A 2H3IA 2LYAA 2LYBA 4IC9A 1HEKA
chains in the Genus database with same CATH superfamily
4CF4A 3E2EA 1CI4A 2EH9A 5HP4A 3SI8A 3AN1A 3DV9A 3TACB 2H3ZA 3WK4A 4M9HA 1Q3UA 4NLNA 2KD1A 4DQQA 5KFTA 2EQYA 2BCVA 4IL6U 2HHTA 2QB0A 5ALMA 2WAQF 5KG5A 2FLNA 4YQWA 3F2CA 5J2IA 3V7JA 3ONNA 4ECRA 3KKAA 3OJSA 4FBUA 3CP8A 2VA2A 4RQMA 3AQFA 1LV5A 2HHSA 4LVSA 2ZIXB 1TAUA 1X6IA 2ZIUA 5CR0A 2LMRA 2FPMA 5AKIA 1ZQJA 2Z7JA 2EAOA 1UQVA 3RJKA 3C2MA 4UARA 1SV0A 3GZFA 4Z6FA 2C2DA 1WCNA 2KVSA 3HILA 3PY8A 2GLEA 1NOMA 4PPXA 3MFIA 4QIWC 2IOFA 4B6JA 5J0PA 5HR6A 1ZQLA 4Q8EA 1ZQDA 5EE1A 5KFNA 4QZIA 2BQUA 1ZD4A 2BZFA 2XY7A 5BPCA 2KSOA 5L1KA 2ZXHA 2LM1A 5AI8A 1FEZA 1GO3F 2XO7A 2RHFA 2YB4A 2HHQA 2ZJ8A 3WKBA 4US9A 1XSNA 7ICJA 4M2YA 5EOZA 1BPEA 4C4RA 2WF9A 2W54A 2W9CA 4EYIB 3SV4A 4ECYA 1Q8KA 1KN5A 3BJYA 3Q8RB 4DSJA 5KFSA 3SAGA 7ICKA 2F44A 4QNLA 5B5EU 4UB8U 5ALZA 2BDUA 5ALSA 3PNCA 1KFDA 3C5FA 4GXKA 4UAZA 3H40A 3CRXA 4OJ6A 2ZXIA 5KG4A 3FYHA 2GO7A 5HNKA 2FMPA 4IC9A 1VJ5A 3QXGA 3QUTA 4PJ0U 1KRPA 4LJXA 4YP3A 5J0UA 2F2AB 5ALGA 5DBBA 1Z00B 5DQGA 1S0VA 1Z3EB 1PVQA 3MC1A 3ZDAA 2EANA 4YR0A 2N1RA 3BDPA 1U4BA 3ZDCA 1PK3A 5J2HA 4PHAA 4BJQA 2B21A 4JWNA 5KFPA 3LVWA 5J0XA 2FI1A 3NS1A 4IS7A 3OHBA 4YD2A 4K4GA 3PO5A 2M9NA 1JXLA 4F3OA 2GOLA 4FS1A 3HKZC 4J03A 3M8SA 4E0DA 2D3DA 3AUOA 4DQSA 1SXDA 4DL5A 2ZUBA 3JPOA 3ICXA 2OWOA 3U26A 2A3VA 2HCFA 1SKRA 1JALA 2HVHA 2ALZA 7ICMA 3IG5A 3V72A 2I6XA 2W43A 3SR6A 4KLDA 5J8YA 5ALDA 2G07A 4DOAA 3PX6A 3PR5B 4F5NA 1T7PA 1ZD2P 2ODGA 4RZRA 1TK8A 3GDXA 4KLHA 2CRXA 3D2NA 4OO1J 3KZXA 1HJPA 5CA7A 2A1JB 3RJIA 3WK9A 4DFDA 3IN5A 3RTVA 2ZIXA 2F1JA 5DB8A 1NK0A 5KFKA 3J81j 2V4RA 2ZG6A 4Z6DA 4YMNA 8ICUA 1ZQBA 3QUQA 4KLOA 3WU2U 2LYBA 3OSNA 4UASA 1ZQVA 3G6YA 2JXJA 5EWFA 4MEXA 4C8OA 1DXSA 4USAA 4TUSA 4QZAA 1KDHA 4FO6A 3VC8A 3KHLA 2LI6A 2NRWA 4QZHA 1X40A 5DG8A 2AGQA 4NLKA 4P4PA 4DS5A 4RPZA 3AU2A 1ZQNA 1C20A 3HT3A 3H8WA 3QUBA 1TK5A 5KAIU 1VDVA 3TADC 4UB2A 2VJ4A 4IR9A 5KFHA 5J0TA 5KFVA 3B0YA 3PW5A 3RB3A 4MFAA 3QE9Y 1T4GA 8ICFA 3SEIA 1NJZA 5J2KA 9ICMA 1X2IA 1NI3A 1Y88A 4FE3A 1UPHA 3NGDA 2DWQA 1VLBA 2MRLA 2NO5A 2F3NA 3L4PA 2KZ3A 2Y0SC 3SENA 2XGQA 2KJ8A 4WJ3B 4EBEA 3AMZA 4U6PA 4UB4A 5AICA 3D2QA 4UAVA 3UPQA 7ICVA 1DK2A 2V4QA 2KE7A 3JPQA 1KLNA 4KLFA 2HBJA 4JWMA 1WCLA 5IINA 3PW4A 3A0BU 7ICQA 4NY8A 1L3TA 2C2RA 2FPKA 5IIJA 5KTQA 1ZQMA 2FLLA 4DO9A 1Z00A 2JMGA 1J2MA 3OTQA 3C2KA 1ZQYA 2KIVA 3N4MB 5AI0A 3JPPA 1KW4A 3RRGA 4DQIA 2HHWA 5C0YA 7ICHA 4RUCA 3GILA 5KAFU 3PMLA 3M6ZA 2AQ0A 3UMCA 3PO4A 4J9PA 4YD1A 2VANA 3EZ5A 2KICA 5DGBA 2PFPA 4YMMA 4TUPA 4P0QA 5DQHA 4ELTA 1YT3A 3RH6A 5L1MA 3M9OB 4JB3A 2PFNA 2QKQA 3MDAA 4PZNA 1TE2A 2BR0A 4M04A 1LVHA 4PGYA 3PVXA 1KBUA 3ZDEA 1A6SA 4GLXA 4I2GA 4UBCA 4R64A 1BPDA 5EWGA 3TAPA 2KKPA 2CXYA 2XY6A 2JEGA 1ZJMA 2BCRA 7ICGA 3M9MB 1V97A 1F5SA 3GU3A 3IV6A 5CWRA 3JPNA 1K1QA 1BPYA 5E79U 2KFZA 1QSLA 7ICTA 2LM4A 2W3SA 2AHOB 4FZLA 5AKEA 5KFYA 1ZQZA 1U9LA 2W9BB 1QLNA 4KLUA 2H3VA 2PMZC 2JH1A 3MDCA 5J2FA 3C1YA 7ICEA 1SL0A 4CNQA 1CRXA 5D46A 1XU4A 2XCAA 4UAYA 1ZRMA 5KT2A 3K4GA 2YQEA 4DL4A 4EX6A 4DL3A 1TAMA 3CW2C 1WG8A 1ZQSA 1AQ6A 9ICBA 4A8EA 2HBMA 2VKQA 4PL1A 1KFSA 1L7MA 1RM6C 3L5KA 4IR1A 4QZCA 2FE9A 5EE3A 2I9GA 5KFQA 2KFNA 4KLMA 1A0PA 1LKYB 1H38A 3N28A 1JXEA 3EWAA 3OPXA 4O3RA 5K4LA 4RT2A 3UMGA 2DL0A 3M8RA 3BQ2A 3B9JA 3KHHA 3UXPA 4Y2JA 5AM0A 2DGZA 4IQUA 1FIQA 2E3TA 2YMQA 4YVZA 4ECXA 3SAFA 2YY6A 3GFKB 5KL8B 5AHXA 4AYBC 4HAIA 4PZOA 9ICTA 4ICAA 4KLLA 9ICHA 9ICNA 5AKKA 4EEKA 2LYHA 3RAQA 1ZQPA 3ED5A 1S8OA 2XY5A 2A19A 4O3QA 2K4IA 1ZQRA 4OJPA 1V9PA 3NASA 1ED1A 2W55A 3BS7A 2XICA 3ISCA 2KG5A 4F50A 2Y0SF 1SWWA 2Y9UA 5ALLA 1SWVA 2VJ5A 5F9NA 4RPXA 5T14A 5KFRA 4YMOA 5ALHA 4YXJA 5CHGA 4NLGA 2HSZA 4O0IA 3JPTA 2D8CA 3RRHA 3ZD9A 2EAPA 1RXWA 2IBKA 2BCUA 4Y2SA 3OHAA 2G06A 5KT3A 4F4YA 1Q3VA 5AKZA 4NWIA 4O3SA 3HX0A 1ZQIA 4QJFB 2C22A 4UBBA 1RZTA 2R8IA 4EENA 1S76D 3QZ8A 3ALRA 4OD0A 1ZQUA 1U48A 8ICSA 9ICJA 3N7SC 3LWLA 9ICSA 2AJQA 4J9SA 5ALJA 2ZUCA 3MBYA 3RB6A 4ED2A 3F53A 1F44A 2PI4A 1J2NA 1EXNA 2UVRA 2UVUA 1ZQTA 2OHFA 2DPJA 3H8SA 3V6KA 5CEHA 4B9UA 5J2CA 2ZTDA 3QEAZ 9ICWA 3AL0B 1L7NA 5DB9A 5A0LA 4CDGA 3QNMA 1S5LU 1KKXA 1PK1B 4KLIA 4NM1A 5JUMA 3RB4A 7ICFA 1JI7A 1ZQEA 1N2XA 3VCBA 2WB1C 1DGJA 3RJHA 1D9DA 4PHPA 3SZ2A 2NV3A 1U49A 4MHVA 2KEYA 2PKEA 4FS2A 8ICNA 3O0FA 4RQ8A 5IILA 4B9VA 1RG6A 3AM9A 3HPOA 4DEZA 1S9FA 2LKYA 4RQ5A 1HIWA 9ICRA 1JN3A 2CPRA 5AK5A 1L5UA 1D9FA 3SAHA 2A1AA 1FO4A 4X5VA 4I2DA 1PZNA 4CF3A 2MUTB 4F2SA 5AK4A 3Q8KA 4RQ0A 2ESEA 2Q0ZX 2KZZA 2YX8A 8ICQA 5DDMA 1ZQXA 2BPCA 3LVVA 4EYHB 2ASDA 3S6JA 4Y2VA 2AH5A 4O3NA 4QZFA 2F1IA 3QU7A 3PX4A 1UCVA 4M9NA 2KV2A 3QU5A 3N7RC 1COOA 2E8OA 1IV8A 2R8JA 4DCCA 3BQ0A 2WHEA 5TZVA 1NK5A 2KJ9A 1U45A 1B43A 4IQVA 2ZJAA 2AGOA 1XS9D 4FZMA 4QW9A 5AM5A 4DL2A 4RU9A 4CRXA 4Z6EA 4B9TA 1RDFA 4GIBA 3PV8A 4R66A 4ACOA 2KP7A 2DBYA 4XA5A 1TAQA 5KL1B 5ALIA 4EBCA 5J0WA 4C4SA 1QQ6A 1M6YA 2JHDA 4F4WA 4K4HA 5DQIA 1S97A 4AYBF 4BGDA 5TISU 2RP5A 2W7OA 3RF9A 1Z4OA 4EZ9A 1Z1BA 4F93B 5F9LA 9ICGA 4QZBA 3Q8MA 3UXOA 3PR4A 4YXMA 2ZIVB 8ICXA 1P7DA 3TAQA 4KMUA 2EZXA 3RR7A 3HRDD 4K4IA 1KFTA 2XI9A 4TURA 3KKAC 4EBDA 2Y1JA 2R18A 3C28A 3T5JA 5L1IA 5DG7A 5ALYA 1ZXIA 1ZQHA 2HDOA 4PH5A 3HJEA 5ALXA 4Y2UA 2P6UA 4U7CA 3C21A 4OJLA 4F5RA 1S0OA 1ZQGA 1BNPA 1TK0A 4YFKA 2R8GA 1SV0C 1SKWA 4DF4A 3B0XA 7ICUA 9ICFA 3RJEA 3HWTA 3T5HA 5KFDA 5ALTA 1S10A 1PK1A 3UXNA 1A77A 2G0AA 3ZI4A 5KG1A 3WK5A 1JROA 4R65A 2K8AA 4RNNA 4DF8A 2HOFA 1ECWA 3RB0A 3Q8SB 4GC7A 3H7IA 1N62A 2UVWA 4F5PA 5G5GA 3OSPA 3WK7A 1QSYA 3H0RB 3RAXA 1ZD5A 1QTMA 4F4ZA 4ZOHC 2R8HA 5DG9A 1S77D 2RDJA 2NO4A 4C8LA 3V6HA 4M9GA 7ICOA 2W9MA 4JK1A 9ICEA 5ALUA 1PUZA 4RPYA 2OXOA 2VA8A 5ALPA 2MUTA 4I29A 3RJFA 3G6VA 3WKDA 1K1SA 5KFFA 1KL9A 4Y2QA 4KLEA 2FMSA 1IXRA 4QIWF 3BZKA 3L3FX 4C8KA 8ICKA 2OYYA 3EUB2 4MF2A 5JTIA 5ALOA 2DF4B 4RNOA 2EAMA 3BQ1A 4J9MA 1PVPA 4F2RA 1IG6A 3KTQA 1L7PA 2HVIA 4I28A 1IIPA 4NLZA 3RFAA 3RH4A 3QEBZ 3EPGA 2O6KA 1NK4A 4F4XA 3Q8QB 3UMBA 4IRKA 5KFZA 2ISPA 5KT4A 3NVZA 5J2EA 1NKEA 4FBTA 9ICAA 2VA3A 5CB1A 1Z1VA 2OEHA 1RYSA 2ATLA 5KG6A 1NZBA 2DKXA 4QZ9A 4EELA 3MABA 3D6JA 4ED3A 3PZPA 9ICLA 2B0CA 3IM1A 4DS4A 1XO0A 4AP9A 3I1YA 4XRHA 2JR5A 4QWAA 2I1QA 5AM1A 4BXOB 2MSNA 1C7YA 9ICUA 5KT6A 3C1ZA 5G5HA 8ICZA 4GC6A 2WAQC 1MN8A 5KFEA 3EPIA 2DKZA 4O9MA 2MAXA 3KHGA 4J9KA 4Q44A 4RQ4A 5J8YC 2HHVA 3NVVA 4DFPA 1UT8A 2ZIVA 3FDSA 3MGIA 2C2EA 4O5CA 3SMVA 4ECQA 3MR2A 3QUCA 3SYZA 4PHDA 3PSTA 9ICKA 4DL7A 3KBBA 1TFRA 5DBCA 3JPSA 2A1JA 1V38A 3DDHA 2XIDA 3HKZF 9ICXA 3WKAA 1KSPA 4PGQA 4PHEA 5AK6A 1N63A 3M7DA 4P4MA 4R63A 4ED8A 3PSIA 2HBLA 5KFBA 4TQRA 7ICPA 2JEJA 5J2GA 3M9NB 5AKJA 2KTQA 1T3QA 4ED6A 2XC9A 1UHUA 4KLGA 2YN4A 3NVWA 4F4KA 5HMLA 3I28A 3QU4A 4BWMA 5HHIA 4B9LA 2RLTA 1N5XA 4J9OA 2WTFA 1MQ2A 4J9RA 1JIHA 3AU6A 2JGAA 4ECTA 4XQ8A 2ZTCA 4BWJA 4RUAA 2W7PA 1SL1A 3ISDA 1WYGA 4DSLA 1HUZA 4PL2A 3H4DA 5AKHA 4R8UB 2JV3A 9ICIA 1ZQQA 3SD7A 8ICBA 3N7PD 2E8MA 4UB5A 4DFMA 4LZDA 4DSEA 2GH1A 4NM2A 4M0AA 2Y9TA 2QLTA 3FC4A 4G3IA 5ALRA 2H3FA 2P66A 2KHQA 4EEYA 4DL6A 4UW9A 2ASLA 1N60A 3PMNA 2K89A 4TUQA 1NK8A 2HW3A 4DQPA 2KVCA 4Z6CA 1ZQOA 5C5JA 5EE0A 1WWVA 2IOFK 8ICHA 5KFXA 2E5SA 1TKDA 1DRGA 1TVAA 3GIIA 2NRVA 4F72A 1NK6A 4F5OA 2ZIWB 4C7YA 3T5LA 2BGWA 2K4PA 1B4FA 4TQSA 4B9NA 5FP0A 5EWEA 4FFDA 2WF5A 2KZMA 4DSKA 4C80A 1YZ6A 2KNJA 5KT5A 5L9XA 8ICIA 3RBEA 1NNLA 4KN4A 2YB1A 4IRCA 1MSWD 3R9KA 5HR7A 3T3FA 1O08A 2K8BB 1N48A 4UAUA 1MA7A 1B22A 4BXOA 2Q4TA 1NJYA 4RQ2A 2WF8A 1X42A 1D8LA 3V7KA 4UATA 2HMXA 5KFGA 1NJXA 2H3IA 3PW0A 4IQTA 5KG3A 2JZBB 5IIMA 7ICNA 4P0PB 4ED7A 2J6TA 3EW9A 3SQIA 3F5AA 4ECSA 1A76A 1T8EA 3UM9A 5CRXA 8ICGA 1XSPA 3NUQA 2B6GA 2BQRA 2KJ5A 1UA1A 4ELUA 4HYKA 2K4HA 5KFWA 1BNOA 3C23A 4QZ8A 1S0MA 4F91B 1JUDA 5AKYA 4I2CA 3IP4B 4NV0A 1ZETA 8ICTA 3GIKA 2FLPA 4MF8A 5KFLA 8ICMA 2NRZA 1WWUA 1X9SA 2CN1A 3THVA 4I2IA 1X9XA 2PFOA 4G9BA 5KNIA 1K5OA 2GWSA 1XO1A 2AXTU 5KFOA 2F1HA 8ICAA 4QZGA 2JEFA 2W9BA 4ED0A 1NZPA 1D8YA 1F0MA 3KFUF 3AEVA 5DKWA 1UT5A 2MU2A 2AU0A 3LYSA 4GFJA 4NJ8A 4NXZA 4RQ3A 2ISOA 4F5QA 5AKXA 2ES6A 5J0YA 4JV2A 2DPIA 1ZRNA 4R8UA 4QWDA 4O5KA 2K8CB 3NRWA 2VIXA 1N5WA 5J0SA 4ECWA 1WUDA 4GXIA 3IRUA 2KHVA 3PW7A 2DFLA 5DGAA 2XVTA 1BPZA 2NRTA 3E58A 3TFSA 3MGHA 2E1FA 5AI4A 4YR2A 4OCZA 1BPXA 2YMMA 1KEJA 1KQQA 1LKYA 1SIJA 5GTIU 1DGSA 5IIOA 1COKA 3TADA 2G5HB 3KD3A 2KMDA 2G08A 1ZQ1C 2K60A 2PMZF 4JV0A 4BX9C 3K75D 2ZUDA 3TQ1A 1FFVA 1JMSA 3WKEA 3OJUA 8ICOA 5AKLA 3MGVA 4RT3A 3GQCA 2ZIWA 3QX7A 5KG0A 2IMWP 5J0QA 3QYPA 2YTUA 2PXIA 4YN4A 4J9LA 3KZIU 4JV1A 4UB3A 1L3SA 4Y2YA 3GIJA 5L1JA 4CCHA 3T5KA 1J97A 4JMUA 2W8LA 4MFCA 2ASJA 3PSPA 3Q8LA 1T94A 5L1LA 4F71A 4BDPA 5DB7A 5BOMA 1XNSA 2HHUA 5AI6A 4EX7A 3ZDDA 4DWIA 2NRXA 4ZH4A 5J2JA 5KFJA 1X9MA 4RQ6A 3WKCA 3F2BA 3SV3A 4OJOA 1CEZA 2R8KA 3NRZA 2JZBA 1ZQCA 2KK0A 2WFAA 4P0PA 5AM4A 4UQGA 3LWMA 2IHMA 2MA1A 4RQNA 4P0QB 5JU5A 8ICWA 1RQLA 3BQ7A 3BZCA 5CP2A 3TI0A 4DSFA 4KLTA 2AGPA 5J0OA 4CF5A 2BPFA 4PGXA 4M47A 5J2BA 4J9NA 3PW2A 1N61A 4Y2TA 2HI0A 1SZHA 4ED1A 4QW8A 2W03A 4F8RA 2G09A 5AIAA 3M6KA 2PFQA 1HUOA 5ALQA 7ICRA 2WF6A 1IM4A 1QQ5A 2W3RA 5AM3A 4NL9A 4DFJA 2LYAA 3RH5A 2H3QA 1X66A 9ICQA 3MR6A 2BPGA 2EDUA 1S0NA 1TV9A 5AKGA 9ICCA 1URJA 5AIBA 4ECZA 4C8NA 5J2DA 2OCEA 4O3PA 4IQWA 4KMOB 3GV8B 3GIMA 3I76A 4KLSA 4KX3A 3MR3A 4DQRA 4QZEA 4I27A 3TKAA 5EE9A 4O5EA 1QCKA 2IA6A 4I2AA 5HMMA 3H0MB 1CUKA 4BUGA 3WK8A 2ZTEA 1X6JA 3A0HU 1RXVA 1L6NA 3TFRA 4JUZA 4DLGA 1L3UA 4XUSA 4NLBA 2JH7A 1AROP 4CGZA 2FJ6A 3FM9A 4UB6U 1LB2B 4M9JA 1X9WA 5KFUA 1O03A 3ORYA 2F8KA 7ICIA 1Q46A 5ALNA 2UVVA 1SGGA 5DLFA 2F8LA 4ECUA 1MQ3A 3OGUA 4IRDA 1ZQWA 2WB1F 1ZD3A 3IDWA 4DLEA 1DK3A 1FFUA 1YZ7A 5J2AA 3LK9A 1UA0A 5J29A 1OXJA 2E8PA 1RYRA 1RQNA 5KG7A 4NLCA 3BS5B 4I2JA 5KFMA 5GTHU 4J9QA 5F3XB 2V9WA 3G6XA 4KLQA 7ICSA 1BGXT 2EZZA 4KITB 1KTQA 5BOLA 2QB1A 2HOQA 2W11A 4P2HA 8ICRA 3TARA 1ZOLA 4F92B 5DDYA 3E0FA 4B9SA 4ELVA 2JEIA 3PSFA 2K4EA 5B66U 3FAHA 3T79A 3QZ7A 8ICCA 4DOCA 2J6UA 3ISBA 1NJWA 2KIWA 1NK9A 5D4BA 2AQ4A 4CE6A 2E8NA 2KN7A 2G5IB 3K1RB 5KG2A 3ZDBA 3KOOA 2L5YA 3K1ZA 9ICPA 4M6WB 5KFIA 2DUYA 4I2FA 2YMLA 2C28A 2HBKA 4KX5A 1SB3C 4C0ZA 3V6JA 3CNHA 2XGPA 1OW5A 4KLJA 4O3OA 3HP6A 8ICYA 3C5GA 2F77X 1RPLA 2W9AA 5H2FU 2QARB 4MEYA 4C4TA 2J6SA 4KTQA 8ICPA 1PVRA 4YR3A 4RQ7A 2BCQA 3BQTA 2OH2A 2IOHA 5AI5A 2OM6A 1XSLA 4UAWA 2P6RA 4Q45A 1QQ7A 4I2BA 1SL2A 3H0LB 2BKEA 1JX4A 2PI5A 2RRDA 3NTUA 4NL9C 4DSIA 4RQ1A 3IG8A 2IHNA 1SZPA 3LDAA 5J0RA 4Q8FA 5DBAA 3RBDA 1ZYQA 1V85A 3CYMA 4EZ6A 1SV4A 2QB0B 2FDRA 4YCXA 5AK3A 3PX0A 2M0NA 5ALVA 1L8LA 3F5EA 2I5HA 4Q43A 4QWEA 1NKBA 4O3MA 1DOQA 1NKCA 4Y2RA 3C29A 2EZYA 4YG2A 4FZNA 4QZDA 2HHXA 3JPRA 4GXJA 3EYZA 2ZIUB 5DLGA 3TANA 3UQ2A 1D8BA 2KOBA 1BPBA 2E1EA 4B9MA 1XC9A 2BDPA 2BQ3A 1HEKA 2FMQA 5ALKA 1U47A 3MR5A 1BVSA 2P35A 1QH9A 4UB1A 3AQEA 4DFKA 3NVYA 4RNMA 5HHHA 3ZD8A 3V7LA 1JRPA 2BCSA 5ALFA 1ZQAA 3D2SA 4C8MA 4DOBA 2KSOB 4QWCA 3MFHA 5KT7A 3RJGA 4P4OA 8ICEA 2DQNB 1OUQA 2F76X 1Z19A 3RR8A 4MFFA 5CJ7A 2W8KA 4I2EA 3GV7B 4Y2PA 2W9CB 1MC8A 1ZQKA 2RQ5A 3IHQB 4M9LA 2W04A 5JRTA 4KN7A 1L8OA 5KFAA 2D6FC 1L3VA 2H5XA 9ICOA 3GV5B 3BS5A 3WK6A 3ETLA 3ETRA 1SKSA 2LBOA 4LZGA 1ZQFA 1RYUA 2WF7A 8ICJA 2ZJ5A 2XCPA 5KFCA 5DB6A 7ICLA 2FPLA 8ICLA 1XWLA 4Y2XA 3DEEA 1QSSA 4US8A 3RJJA 5AI9A 3M1YA 1B0XA 1T3NA 2KKVA 2RDIA 5ALWA 1Z4NA 3C2LA 2YMPA 2HOIA 1N56A 4ECVA 2BHNA 3Q8PB 5IIKA 1L7OA 1ZJNA 9ICVA 2LHTA 4M6WA 4I2HA 1SXEA 4QWBA 3F2DA 3KHRA 5AM2A 5IIIA 3H8MA 5ALEA 2JRZA 4OJ5A 4C7ZA 2QARA 3QU2A 1NK7A 3UQ0A 3N97B 3HW8A 2NYVA 3H4BA 2LPEA 3H8JA 3QU9A 8ICVA 2Y1IA 5D49A
chains in the Genus database with same CATH topology
2ZIWB 2VJ5A 1Z1BA 4QNLA 5T14A 3H0MB 2JMGA 2H3VA 2XIDA 4BUGA 3IN5A 2PMZC 3KFUF 2JH1A 2ZIXA 2H3ZA 3HKZF 2DQNB 1XNSA 2BDUA 1OUQA 2ZIVB 2F77X 2F76X 2LKYA 1Z19A 4QIWF 1Q3UA 1P7DA 2KD1A 3L3FX 2ZG6A 3LYSA 1HIWA 1L6NA 2OYYA 4GFJA 4OJ6A 1CRXA 2KNJA 2ZXIA 3CRXA 5C0YA 2CPRA 2JH7A 4NLBA 2XI9A 2DF4B 1PVRA 3F2BA 3SAHA 2W04A 3M7DA 1PVPA 3M6ZA 4CGZA 2G06A 2WAQF 2LYBA 2R18A 3PSIA 4OJOA 3C28A 1Q3VA 2HBLA 4IC9A 2YB1A 4NWIA 2D6FC 3F2CA 2OH2A 1IIPA 2OM6A 3ONNA 2K8CB 4P0PA 1TAMA 3NRWA 4QJFB 4U7CA 2F2AB 2VIXA 4OJLA 3RFAA 5HR7A 3CP8A 2KICA 2YX8A 3H0LB 2LBOA 3VC8A 3AQFA 2K8BB 2MA1A 2F8LA 4A8EA 4KX3A 2ZIXB 3LVVA 1WUDA 4P0QA 1MA7A 2HBMA 2VKQA 2RRDA 2ZIUA 3ALRA 1PVQA 4PL1A 4P0QB 2Q4TA 3IG8A 2KHVA 1YT3A 2WB1F 2N1RA 2XVTA 3N7SC 2Z7JA 2JGAA 2E1FA 4BJQA 3DEEA 2W7PA 2HMXA 3CYMA 1NZBA 2H3IA 2VJ4A 2KV2A 3LVWA 3N7RC 3GZFA 4PL2A 1A0PA 3SAGA 3PZPA 2KKVA 3OPXA 2M0NA 3F53A 1F44A 4NLCA 4P0PB 2G5HB 3F5EA 2G0AA 1SZHA 3SQIA 3N7PD 2HOIA 4O3MA 2G08A 2KJ9A 1ZQ1C 2PMZF 2GOLA 3F5AA 4BX9C 3HKZC 1XO0A 2DGZA 3C29A 2W03A 4FZNA 2K8AA 5CRXA 2G09A 2GH1A 2HOFA 3M6KA 4QIWC 1KBUA 3O0FA 1ECWA 2HOQA 2LHTA 2ZIUB 1A6SA 4FZMA 3F2DA 3NUQA 3SAFA 5HR6A 2KJ5A 1D8BA 3E0FA 4CRXA 5KL8B 2KOBA 4FE3A 2E1EA 2K4HA 1UPHA 3PSFA 3H0RB 2H3FA 2K4EA 3MGVA 4AYBC 2MRLA 3T79A 3AL0B 2WAQC 2KKPA 2LYAA 5A0LA 2KHQA 1HEKA 2ZIWA 4CDGA 2H3QA 2ZXHA 3IP4B 2Y0SC 2KIWA 3ICXA 4ICAA 4NV0A 4ACOA 2KJ8A 4WJ3B 1GO3F 3GU3A 2A3VA 2K89A 5KL1B 4OJ5A 2RHFA 4U6PA 3IG5A 2YB4A 2KVCA 2G5IB 2ZIVA 1URJA 3AQEA 3D2QA 3K1ZA 3VCBA 2JHDA 3SMVA 2G07A 2WB1C 2CRXA 2CN1A 2E5SA 2K4IA 4JMUA 4OJPA 4AYBF 1DRGA 2OXOA 3PSTA 2HBJA 2NV3A 2HBKA 4KMOB 2KEYA 4KX5A 2RP5A 3PSPA 1ED1A 4FZLA 3D2SA 1T94A 4C0ZA 2XICA 3RF9A 2W7OA 3D2NA 2Y0SF 4OO1J 3KZXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2H3Q A;  4ICA A;  1TAM A;  2JMG A;  2H3V A;  2GOL A;  2H3Z A;  1ECW A;  1A6S A;  1HIW A;  1L6N A;  2N1R A;  2K4I A;  2K4H A;  4JMU A;  1UPH A;  2H3F A;  2K4E A;  2NV3 A;  2HMX A;  1ED1 A;  2H3I A;  2LYA A;  2LYB A;  4IC9 A;  1HEK A; 
#chains in the Genus database with same CATH topology
 4CF4 A;  3E2E A;  1CI4 A;  2EH9 A;  5HP4 A;  3SI8 A;  3AN1 A;  3DV9 A;  3TAC B;  2H3Z A;  3WK4 A;  4M9H A;  1Q3U A;  4NLN A;  2KD1 A;  4DQQ A;  5KFT A;  2EQY A;  2BCV A;  4IL6 U;  2HHT A;  2QB0 A;  5ALM A;  2WAQ F;  5KG5 A;  2FLN A;  4YQW A;  3F2C A;  5J2I A;  3V7J A;  3ONN A;  4ECR A;  3KKA A;  3OJS A;  4FBU A;  3CP8 A;  2VA2 A;  4RQM A;  3AQF A;  1LV5 A;  2HHS A;  4LVS A;  2ZIX B;  1TAU A;  1X6I A;  2ZIU A;  5CR0 A;  2LMR A;  2FPM A;  5AKI A;  1ZQJ A;  2Z7J A;  2EAO A;  1UQV A;  3RJK A;  3C2M A;  4UAR A;  1SV0 A;  3GZF A;  4Z6F A;  2C2D A;  1WCN A;  2KVS A;  3HIL A;  3PY8 A;  2GLE A;  1NOM A;  4PPX A;  3MFI A;  4QIW C;  2IOF A;  4B6J A;  5J0P A;  5HR6 A;  1ZQL A;  4Q8E A;  1ZQD A;  5EE1 A;  5KFN A;  4QZI A;  2BQU A;  1ZD4 A;  2BZF A;  2XY7 A;  5BPC A;  2KSO A;  5L1K A;  2ZXH A;  2LM1 A;  5AI8 A;  1FEZ A;  1GO3 F;  2XO7 A;  2RHF A;  2YB4 A;  2HHQ A;  2ZJ8 A;  3WKB A;  4US9 A;  1XSN A;  7ICJ A;  4M2Y A;  5EOZ A;  1BPE A;  4C4R A;  2WF9 A;  2W54 A;  2W9C A;  4EYI B;  3SV4 A;  4ECY A;  1Q8K A;  1KN5 A;  3BJY A;  3Q8R B;  4DSJ A;  5KFS A;  3SAG A;  7ICK A;  2F44 A;  4QNL A;  5B5E U;  4UB8 U;  5ALZ A;  2BDU A;  5ALS A;  3PNC A;  1KFD A;  3C5F A;  4GXK A;  4UAZ A;  3H40 A;  3CRX A;  4OJ6 A;  2ZXI A;  5KG4 A;  3FYH A;  2GO7 A;  5HNK A;  2FMP A;  4IC9 A;  1VJ5 A;  3QXG A;  3QUT A;  4PJ0 U;  1KRP A;  4LJX A;  4YP3 A;  5J0U A;  2F2A B;  5ALG A;  5DBB A;  1Z00 B;  5DQG A;  1S0V A;  1Z3E B;  1PVQ A;  3MC1 A;  3ZDA A;  2EAN A;  4YR0 A;  2N1R A;  3BDP A;  1U4B A;  3ZDC A;  1PK3 A;  5J2H A;  4PHA A;  4BJQ A;  2B21 A;  4JWN A;  5KFP A;  3LVW A;  5J0X A;  2FI1 A;  3NS1 A;  4IS7 A;  3OHB A;  4YD2 A;  4K4G A;  3PO5 A;  2M9N A;  1JXL A;  4F3O A;  2GOL A;  4FS1 A;  3HKZ C;  4J03 A;  3M8S A;  4E0D A;  2D3D A;  3AUO A;  4DQS A;  1SXD A;  4DL5 A;  2ZUB A;  3JPO A;  3ICX A;  2OWO A;  3U26 A;  2A3V A;  2HCF A;  1SKR A;  1JAL A;  2HVH A;  2ALZ A;  7ICM A;  3IG5 A;  3V72 A;  2I6X A;  2W43 A;  3SR6 A;  4KLD A;  5J8Y A;  5ALD A;  2G07 A;  4DOA A;  3PX6 A;  3PR5 B;  4F5N A;  1T7P A;  1ZD2 P;  2ODG A;  4RZR A;  1TK8 A;  3GDX A;  4KLH A;  2CRX A;  3D2N A;  4OO1 J;  3KZX A;  1HJP A;  5CA7 A;  2A1J B;  3RJI A;  3WK9 A;  4DFD A;  3IN5 A;  3RTV A;  2ZIX A;  2F1J A;  5DB8 A;  1NK0 A;  5KFK A;  3J81 j;  2V4R A;  2ZG6 A;  4Z6D A;  4YMN A;  8ICU A;  1ZQB A;  3QUQ A;  4KLO A;  3WU2 U;  2LYB A;  3OSN A;  4UAS A;  1ZQV A;  3G6Y A;  2JXJ A;  5EWF A;  4MEX A;  4C8O A;  1DXS A;  4USA A;  4TUS A;  4QZA A;  1KDH A;  4FO6 A;  3VC8 A;  3KHL A;  2LI6 A;  2NRW A;  4QZH A;  1X40 A;  5DG8 A;  2AGQ A;  4NLK A;  4P4P A;  4DS5 A;  4RPZ A;  3AU2 A;  1ZQN A;  1C20 A;  3HT3 A;  3H8W A;  3QUB A;  1TK5 A;  5KAI U;  1VDV A;  3TAD C;  4UB2 A;  2VJ4 A;  4IR9 A;  5KFH A;  5J0T A;  5KFV A;  3B0Y A;  3PW5 A;  3RB3 A;  4MFA A;  3QE9 Y;  1T4G A;  8ICF A;  3SEI A;  1NJZ A;  5J2K A;  9ICM A;  1X2I A;  1NI3 A;  1Y88 A;  4FE3 A;  1UPH A;  3NGD A;  2DWQ A;  1VLB A;  2MRL A;  2NO5 A;  2F3N A;  3L4P A;  2KZ3 A;  2Y0S C;  3SEN A;  2XGQ A;  2KJ8 A;  4WJ3 B;  4EBE A;  3AMZ A;  4U6P A;  4UB4 A;  5AIC A;  3D2Q A;  4UAV A;  3UPQ A;  7ICV A;  1DK2 A;  2V4Q A;  2KE7 A;  3JPQ A;  1KLN A;  4KLF A;  2HBJ A;  4JWM A;  1WCL A;  5IIN A;  3PW4 A;  3A0B U;  7ICQ A;  4NY8 A;  1L3T A;  2C2R A;  2FPK A;  5IIJ A;  5KTQ A;  1ZQM A;  2FLL A;  4DO9 A;  1Z00 A;  2JMG A;  1J2M A;  3OTQ A;  3C2K A;  1ZQY A;  2KIV A;  3N4M B;  5AI0 A;  3JPP A;  1KW4 A;  3RRG A;  4DQI A;  2HHW A;  5C0Y A;  7ICH A;  4RUC A;  3GIL A;  5KAF U;  3PML A;  3M6Z A;  2AQ0 A;  3UMC A;  3PO4 A;  4J9P A;  4YD1 A;  2VAN A;  3EZ5 A;  2KIC A;  5DGB A;  2PFP A;  4YMM A;  4TUP A;  4P0Q A;  5DQH A;  4ELT A;  1YT3 A;  3RH6 A;  5L1M A;  3M9O B;  4JB3 A;  2PFN A;  2QKQ A;  3MDA A;  4PZN A;  1TE2 A;  2BR0 A;  4M04 A;  1LVH A;  4PGY A;  3PVX A;  1KBU A;  3ZDE A;  1A6S A;  4GLX A;  4I2G A;  4UBC A;  4R64 A;  1BPD A;  5EWG A;  3TAP A;  2KKP A;  2CXY A;  2XY6 A;  2JEG A;  1ZJM A;  2BCR A;  7ICG A;  3M9M B;  1V97 A;  1F5S A;  3GU3 A;  3IV6 A;  5CWR A;  3JPN A;  1K1Q A;  1BPY A;  5E79 U;  2KFZ A;  1QSL A;  7ICT A;  2LM4 A;  2W3S A;  2AHO B;  4FZL A;  5AKE A;  5KFY A;  1ZQZ A;  1U9L A;  2W9B B;  1QLN A;  4KLU A;  2H3V A;  2PMZ C;  2JH1 A;  3MDC A;  5J2F A;  3C1Y A;  7ICE A;  1SL0 A;  4CNQ A;  1CRX A;  5D46 A;  1XU4 A;  2XCA A;  4UAY A;  1ZRM A;  5KT2 A;  3K4G A;  2YQE A;  4DL4 A;  4EX6 A;  4DL3 A;  1TAM A;  3CW2 C;  1WG8 A;  1ZQS A;  1AQ6 A;  9ICB A;  4A8E A;  2HBM A;  2VKQ A;  4PL1 A;  1KFS A;  1L7M A;  1RM6 C;  3L5K A;  4IR1 A;  4QZC A;  2FE9 A;  5EE3 A;  2I9G A;  5KFQ A;  2KFN A;  4KLM A;  1A0P A;  1LKY B;  1H38 A;  3N28 A;  1JXE A;  3EWA A;  3OPX A;  4O3R A;  5K4L A;  4RT2 A;  3UMG A;  2DL0 A;  3M8R A;  3BQ2 A;  3B9J A;  3KHH A;  3UXP A;  4Y2J A;  5AM0 A;  2DGZ A;  4IQU A;  1FIQ A;  2E3T A;  2YMQ A;  4YVZ A;  4ECX A;  3SAF A;  2YY6 A;  3GFK B;  5KL8 B;  5AHX A;  4AYB C;  4HAI A;  4PZO A;  9ICT A;  4ICA A;  4KLL A;  9ICH A;  9ICN A;  5AKK A;  4EEK A;  2LYH A;  3RAQ A;  1ZQP A;  3ED5 A;  1S8O A;  2XY5 A;  2A19 A;  4O3Q A;  2K4I A;  1ZQR A;  4OJP A;  1V9P A;  3NAS A;  1ED1 A;  2W55 A;  3BS7 A;  2XIC A;  3ISC A;  2KG5 A;  4F50 A;  2Y0S F;  1SWW A;  2Y9U A;  5ALL A;  1SWV A;  2VJ5 A;  5F9N A;  4RPX A;  5T14 A;  5KFR A;  4YMO A;  5ALH A;  4YXJ A;  5CHG A;  4NLG A;  2HSZ A;  4O0I A;  3JPT A;  2D8C A;  3RRH A;  3ZD9 A;  2EAP A;  1RXW A;  2IBK A;  2BCU A;  4Y2S A;  3OHA A;  2G06 A;  5KT3 A;  4F4Y A;  1Q3V A;  5AKZ A;  4NWI A;  4O3S A;  3HX0 A;  1ZQI A;  4QJF B;  2C22 A;  4UBB A;  1RZT A;  2R8I A;  4EEN A;  1S76 D;  3QZ8 A;  3ALR A;  4OD0 A;  1ZQU A;  1U48 A;  8ICS A;  9ICJ A;  3N7S C;  3LWL A;  9ICS A;  2AJQ A;  4J9S A;  5ALJ A;  2ZUC A;  3MBY A;  3RB6 A;  4ED2 A;  3F53 A;  1F44 A;  2PI4 A;  1J2N A;  1EXN A;  2UVR A;  2UVU A;  1ZQT A;  2OHF A;  2DPJ A;  3H8S A;  3V6K A;  5CEH A;  4B9U A;  5J2C A;  2ZTD A;  3QEA Z;  9ICW A;  3AL0 B;  1L7N A;  5DB9 A;  5A0L A;  4CDG A;  3QNM A;  1S5L U;  1KKX A;  1PK1 B;  4KLI A;  4NM1 A;  5JUM A;  3RB4 A;  7ICF A;  1JI7 A;  1ZQE A;  1N2X A;  3VCB A;  2WB1 C;  1DGJ A;  3RJH A;  1D9D A;  4PHP A;  3SZ2 A;  2NV3 A;  1U49 A;  4MHV A;  2KEY A;  2PKE A;  4FS2 A;  8ICN A;  3O0F A;  4RQ8 A;  5IIL A;  4B9V A;  1RG6 A;  3AM9 A;  3HPO A;  4DEZ A;  1S9F A;  2LKY A;  4RQ5 A;  1HIW A;  9ICR A;  1JN3 A;  2CPR A;  5AK5 A;  1L5U A;  1D9F A;  3SAH A;  2A1A A;  1FO4 A;  4X5V A;  4I2D A;  1PZN A;  4CF3 A;  2MUT B;  4F2S A;  5AK4 A;  3Q8K A;  4RQ0 A;  2ESE A;  2Q0Z X;  2KZZ A;  2YX8 A;  8ICQ A;  5DDM A;  1ZQX A;  2BPC A;  3LVV A;  4EYH B;  2ASD A;  3S6J A;  4Y2V A;  2AH5 A;  4O3N A;  4QZF A;  2F1I A;  3QU7 A;  3PX4 A;  1UCV A;  4M9N A;  2KV2 A;  3QU5 A;  3N7R C;  1COO A;  2E8O A;  1IV8 A;  2R8J A;  4DCC A;  3BQ0 A;  2WHE A;  5TZV A;  1NK5 A;  2KJ9 A;  1U45 A;  1B43 A;  4IQV A;  2ZJA A;  2AGO A;  1XS9 D;  4FZM A;  4QW9 A;  5AM5 A;  4DL2 A;  4RU9 A;  4CRX A;  4Z6E A;  4B9T A;  1RDF A;  4GIB A;  3PV8 A;  4R66 A;  4ACO A;  2KP7 A;  2DBY A;  4XA5 A;  1TAQ A;  5KL1 B;  5ALI A;  4EBC A;  5J0W A;  4C4S A;  1QQ6 A;  1M6Y A;  2JHD A;  4F4W A;  4K4H A;  5DQI A;  1S97 A;  4AYB F;  4BGD A;  5TIS U;  2RP5 A;  2W7O A;  3RF9 A;  1Z4O A;  4EZ9 A;  1Z1B A;  4F93 B;  5F9L A;  9ICG A;  4QZB A;  3Q8M A;  3UXO A;  3PR4 A;  4YXM A;  2ZIV B;  8ICX A;  1P7D A;  3TAQ A;  4KMU A;  2EZX A;  3RR7 A;  3HRD D;  4K4I A;  1KFT A;  2XI9 A;  4TUR A;  3KKA C;  4EBD A;  2Y1J A;  2R18 A;  3C28 A;  3T5J A;  5L1I A;  5DG7 A;  5ALY A;  1ZXI A;  1ZQH A;  2HDO A;  4PH5 A;  3HJE A;  5ALX A;  4Y2U A;  2P6U A;  4U7C A;  3C21 A;  4OJL A;  4F5R A;  1S0O A;  1ZQG A;  1BNP A;  1TK0 A;  4YFK A;  2R8G A;  1SV0 C;  1SKW A;  4DF4 A;  3B0X A;  7ICU A;  9ICF A;  3RJE A;  3HWT A;  3T5H A;  5KFD A;  5ALT A;  1S10 A;  1PK1 A;  3UXN A;  1A77 A;  2G0A A;  3ZI4 A;  5KG1 A;  3WK5 A;  1JRO A;  4R65 A;  2K8A A;  4RNN A;  4DF8 A;  2HOF A;  1ECW A;  3RB0 A;  3Q8S B;  4GC7 A;  3H7I A;  1N62 A;  2UVW A;  4F5P A;  5G5G A;  3OSP A;  3WK7 A;  1QSY A;  3H0R B;  3RAX A;  1ZD5 A;  1QTM A;  4F4Z A;  4ZOH C;  2R8H A;  5DG9 A;  1S77 D;  2RDJ A;  2NO4 A;  4C8L A;  3V6H A;  4M9G A;  7ICO A;  2W9M A;  4JK1 A;  9ICE A;  5ALU A;  1PUZ A;  4RPY A;  2OXO A;  2VA8 A;  5ALP A;  2MUT A;  4I29 A;  3RJF A;  3G6V A;  3WKD A;  1K1S A;  5KFF A;  1KL9 A;  4Y2Q A;  4KLE A;  2FMS A;  1IXR A;  4QIW F;  3BZK A;  3L3F X;  4C8K A;  8ICK A;  2OYY A;  3EUB 2;  4MF2 A;  5JTI A;  5ALO A;  2DF4 B;  4RNO A;  2EAM A;  3BQ1 A;  4J9M A;  1PVP A;  4F2R A;  1IG6 A;  3KTQ A;  1L7P A;  2HVI A;  4I28 A;  1IIP A;  4NLZ A;  3RFA A;  3RH4 A;  3QEB Z;  3EPG A;  2O6K A;  1NK4 A;  4F4X A;  3Q8Q B;  3UMB A;  4IRK A;  5KFZ A;  2ISP A;  5KT4 A;  3NVZ A;  5J2E A;  1NKE A;  4FBT A;  9ICA A;  2VA3 A;  5CB1 A;  1Z1V A;  2OEH A;  1RYS A;  2ATL A;  5KG6 A;  1NZB A;  2DKX A;  4QZ9 A;  4EEL A;  3MAB A;  3D6J A;  4ED3 A;  3PZP A;  9ICL A;  2B0C A;  3IM1 A;  4DS4 A;  1XO0 A;  4AP9 A;  3I1Y A;  4XRH A;  2JR5 A;  4QWA A;  2I1Q A;  5AM1 A;  4BXO B;  2MSN A;  1C7Y A;  9ICU A;  5KT6 A;  3C1Z A;  5G5H A;  8ICZ A;  4GC6 A;  2WAQ C;  1MN8 A;  5KFE A;  3EPI A;  2DKZ A;  4O9M A;  2MAX A;  3KHG A;  4J9K A;  4Q44 A;  4RQ4 A;  5J8Y C;  2HHV A;  3NVV A;  4DFP A;  1UT8 A;  2ZIV A;  3FDS A;  3MGI A;  2C2E A;  4O5C A;  3SMV A;  4ECQ A;  3MR2 A;  3QUC A;  3SYZ A;  4PHD A;  3PST A;  9ICK A;  4DL7 A;  3KBB A;  1TFR A;  5DBC A;  3JPS A;  2A1J A;  1V38 A;  3DDH A;  2XID A;  3HKZ F;  9ICX A;  3WKA A;  1KSP A;  4PGQ A;  4PHE A;  5AK6 A;  1N63 A;  3M7D A;  4P4M A;  4R63 A;  4ED8 A;  3PSI A;  2HBL A;  5KFB A;  4TQR A;  7ICP A;  2JEJ A;  5J2G A;  3M9N B;  5AKJ A;  2KTQ A;  1T3Q A;  4ED6 A;  2XC9 A;  1UHU A;  4KLG A;  2YN4 A;  3NVW A;  4F4K A;  5HML A;  3I28 A;  3QU4 A;  4BWM A;  5HHI A;  4B9L A;  2RLT A;  1N5X A;  4J9O A;  2WTF A;  1MQ2 A;  4J9R A;  1JIH A;  3AU6 A;  2JGA A;  4ECT A;  4XQ8 A;  2ZTC A;  4BWJ A;  4RUA A;  2W7P A;  1SL1 A;  3ISD A;  1WYG A;  4DSL A;  1HUZ A;  4PL2 A;  3H4D A;  5AKH A;  4R8U B;  2JV3 A;  9ICI A;  1ZQQ A;  3SD7 A;  8ICB A;  3N7P D;  2E8M A;  4UB5 A;  4DFM A;  4LZD A;  4DSE A;  2GH1 A;  4NM2 A;  4M0A A;  2Y9T A;  2QLT A;  3FC4 A;  4G3I A;  5ALR A;  2H3F A;  2P66 A;  2KHQ A;  4EEY A;  4DL6 A;  4UW9 A;  2ASL A;  1N60 A;  3PMN A;  2K89 A;  4TUQ A;  1NK8 A;  2HW3 A;  4DQP A;  2KVC A;  4Z6C A;  1ZQO A;  5C5J A;  5EE0 A;  1WWV A;  2IOF K;  8ICH A;  5KFX A;  2E5S A;  1TKD A;  1DRG A;  1TVA A;  3GII A;  2NRV A;  4F72 A;  1NK6 A;  4F5O A;  2ZIW B;  4C7Y A;  3T5L A;  2BGW A;  2K4P A;  1B4F A;  4TQS A;  4B9N A;  5FP0 A;  5EWE A;  4FFD A;  2WF5 A;  2KZM A;  4DSK A;  4C80 A;  1YZ6 A;  2KNJ A;  5KT5 A;  5L9X A;  8ICI A;  3RBE A;  1NNL A;  4KN4 A;  2YB1 A;  4IRC A;  1MSW D;  3R9K A;  5HR7 A;  3T3F A;  1O08 A;  2K8B B;  1N48 A;  4UAU A;  1MA7 A;  1B22 A;  4BXO A;  2Q4T A;  1NJY A;  4RQ2 A;  2WF8 A;  1X42 A;  1D8L A;  3V7K A;  4UAT A;  2HMX A;  5KFG A;  1NJX A;  2H3I A;  3PW0 A;  4IQT A;  5KG3 A;  2JZB B;  5IIM A;  7ICN A;  4P0P B;  4ED7 A;  2J6T A;  3EW9 A;  3SQI A;  3F5A A;  4ECS A;  1A76 A;  1T8E A;  3UM9 A;  5CRX A;  8ICG A;  1XSP A;  3NUQ A;  2B6G A;  2BQR A;  2KJ5 A;  1UA1 A;  4ELU A;  4HYK A;  2K4H A;  5KFW A;  1BNO A;  3C23 A;  4QZ8 A;  1S0M A;  4F91 B;  1JUD A;  5AKY A;  4I2C A;  3IP4 B;  4NV0 A;  1ZET A;  8ICT A;  3GIK A;  2FLP A;  4MF8 A;  5KFL A;  8ICM A;  2NRZ A;  1WWU A;  1X9S A;  2CN1 A;  3THV A;  4I2I A;  1X9X A;  2PFO A;  4G9B A;  5KNI A;  1K5O A;  2GWS A;  1XO1 A;  2AXT U;  5KFO A;  2F1H A;  8ICA A;  4QZG A;  2JEF A;  2W9B A;  4ED0 A;  1NZP A;  1D8Y A;  1F0M A;  3KFU F;  3AEV A;  5DKW A;  1UT5 A;  2MU2 A;  2AU0 A;  3LYS A;  4GFJ A;  4NJ8 A;  4NXZ A;  4RQ3 A;  2ISO A;  4F5Q A;  5AKX A;  2ES6 A;  5J0Y A;  4JV2 A;  2DPI A;  1ZRN A;  4R8U A;  4QWD A;  4O5K A;  2K8C B;  3NRW A;  2VIX A;  1N5W A;  5J0S A;  4ECW A;  1WUD A;  4GXI A;  3IRU A;  2KHV A;  3PW7 A;  2DFL A;  5DGA A;  2XVT A;  1BPZ A;  2NRT A;  3E58 A;  3TFS A;  3MGH A;  2E1F A;  5AI4 A;  4YR2 A;  4OCZ A;  1BPX A;  2YMM A;  1KEJ A;  1KQQ A;  1LKY A;  1SIJ A;  5GTI U;  1DGS A;  5IIO A;  1COK A;  3TAD A;  2G5H B;  3KD3 A;  2KMD A;  2G08 A;  1ZQ1 C;  2K60 A;  2PMZ F;  4JV0 A;  4BX9 C;  3K75 D;  2ZUD A;  3TQ1 A;  1FFV A;  1JMS A;  3WKE A;  3OJU A;  8ICO A;  5AKL A;  3MGV A;  4RT3 A;  3GQC A;  2ZIW A;  3QX7 A;  5KG0 A;  2IMW P;  5J0Q A;  3QYP A;  2YTU A;  2PXI A;  4YN4 A;  4J9L A;  3KZI U;  4JV1 A;  4UB3 A;  1L3S A;  4Y2Y A;  3GIJ A;  5L1J A;  4CCH A;  3T5K A;  1J97 A;  4JMU A;  2W8L A;  4MFC A;  2ASJ A;  3PSP A;  3Q8L A;  1T94 A;  5L1L A;  4F71 A;  4BDP A;  5DB7 A;  5BOM A;  1XNS A;  2HHU A;  5AI6 A;  4EX7 A;  3ZDD A;  4DWI A;  2NRX A;  4ZH4 A;  5J2J A;  5KFJ A;  1X9M A;  4RQ6 A;  3WKC A;  3F2B A;  3SV3 A;  4OJO A;  1CEZ A;  2R8K A;  3NRZ A;  2JZB A;  1ZQC A;  2KK0 A;  2WFA A;  4P0P A;  5AM4 A;  4UQG A;  3LWM A;  2IHM A;  2MA1 A;  4RQN A;  4P0Q B;  5JU5 A;  8ICW A;  1RQL A;  3BQ7 A;  3BZC A;  5CP2 A;  3TI0 A;  4DSF A;  4KLT A;  2AGP A;  5J0O A;  4CF5 A;  2BPF A;  4PGX A;  4M47 A;  5J2B A;  4J9N A;  3PW2 A;  1N61 A;  4Y2T A;  2HI0 A;  1SZH A;  4ED1 A;  4QW8 A;  2W03 A;  4F8R A;  2G09 A;  5AIA A;  3M6K A;  2PFQ A;  1HUO A;  5ALQ A;  7ICR A;  2WF6 A;  1IM4 A;  1QQ5 A;  2W3R A;  5AM3 A;  4NL9 A;  4DFJ A;  2LYA A;  3RH5 A;  2H3Q A;  1X66 A;  9ICQ A;  3MR6 A;  2BPG A;  2EDU A;  1S0N A;  1TV9 A;  5AKG A;  9ICC A;  1URJ A;  5AIB A;  4ECZ A;  4C8N A;  5J2D A;  2OCE A;  4O3P A;  4IQW A;  4KMO B;  3GV8 B;  3GIM A;  3I76 A;  4KLS A;  4KX3 A;  3MR3 A;  4DQR A;  4QZE A;  4I27 A;  3TKA A;  5EE9 A;  4O5E A;  1QCK A;  2IA6 A;  4I2A A;  5HMM A;  3H0M B;  1CUK A;  4BUG A;  3WK8 A;  2ZTE A;  1X6J A;  3A0H U;  1RXV A;  1L6N A;  3TFR A;  4JUZ A;  4DLG A;  1L3U A;  4XUS A;  4NLB A;  2JH7 A;  1ARO P;  4CGZ A;  2FJ6 A;  3FM9 A;  4UB6 U;  1LB2 B;  4M9J A;  1X9W A;  5KFU A;  1O03 A;  3ORY A;  2F8K A;  7ICI A;  1Q46 A;  5ALN A;  2UVV A;  1SGG A;  5DLF A;  2F8L A;  4ECU A;  1MQ3 A;  3OGU A;  4IRD A;  1ZQW A;  2WB1 F;  1ZD3 A;  3IDW A;  4DLE A;  1DK3 A;  1FFU A;  1YZ7 A;  5J2A A;  3LK9 A;  1UA0 A;  5J29 A;  1OXJ A;  2E8P A;  1RYR A;  1RQN A;  5KG7 A;  4NLC A;  3BS5 B;  4I2J A;  5KFM A;  5GTH U;  4J9Q A;  5F3X B;  2V9W A;  3G6X A;  4KLQ A;  7ICS A;  1BGX T;  2EZZ A;  4KIT B;  1KTQ A;  5BOL A;  2QB1 A;  2HOQ A;  2W11 A;  4P2H A;  8ICR A;  3TAR A;  1ZOL A;  4F92 B;  5DDY A;  3E0F A;  4B9S A;  4ELV A;  2JEI A;  3PSF A;  2K4E A;  5B66 U;  3FAH A;  3T79 A;  3QZ7 A;  8ICC A;  4DOC A;  2J6U A;  3ISB A;  1NJW A;  2KIW A;  1NK9 A;  5D4B A;  2AQ4 A;  4CE6 A;  2E8N A;  2KN7 A;  2G5I B;  3K1R B;  5KG2 A;  3ZDB A;  3KOO A;  2L5Y A;  3K1Z A;  9ICP A;  4M6W B;  5KFI A;  2DUY A;  4I2F A;  2YML A;  2C28 A;  2HBK A;  4KX5 A;  1SB3 C;  4C0Z A;  3V6J A;  3CNH A;  2XGP A;  1OW5 A;  4KLJ A;  4O3O A;  3HP6 A;  8ICY A;  3C5G A;  2F77 X;  1RPL A;  2W9A A;  5H2F U;  2QAR B;  4MEY A;  4C4T A;  2J6S A;  4KTQ A;  8ICP A;  1PVR A;  4YR3 A;  4RQ7 A;  2BCQ A;  3BQT A;  2OH2 A;  2IOH A;  5AI5 A;  2OM6 A;  1XSL A;  4UAW A;  2P6R A;  4Q45 A;  1QQ7 A;  4I2B A;  1SL2 A;  3H0L B;  2BKE A;  1JX4 A;  2PI5 A;  2RRD A;  3NTU A;  4NL9 C;  4DSI A;  4RQ1 A;  3IG8 A;  2IHN A;  1SZP A;  3LDA A;  5J0R A;  4Q8F A;  5DBA A;  3RBD A;  1ZYQ A;  1V85 A;  3CYM A;  4EZ6 A;  1SV4 A;  2QB0 B;  2FDR A;  4YCX A;  5AK3 A;  3PX0 A;  2M0N A;  5ALV A;  1L8L A;  3F5E A;  2I5H A;  4Q43 A;  4QWE A;  1NKB A;  4O3M A;  1DOQ A;  1NKC A;  4Y2R A;  3C29 A;  2EZY A;  4YG2 A;  4FZN A;  4QZD A;  2HHX A;  3JPR A;  4GXJ A;  3EYZ A;  2ZIU B;  5DLG A;  3TAN A;  3UQ2 A;  1D8B A;  2KOB A;  1BPB A;  2E1E A;  4B9M A;  1XC9 A;  2BDP A;  2BQ3 A;  1HEK A;  2FMQ A;  5ALK A;  1U47 A;  3MR5 A;  1BVS A;  2P35 A;  1QH9 A;  4UB1 A;  3AQE A;  4DFK A;  3NVY A;  4RNM A;  5HHH A;  3ZD8 A;  3V7L A;  1JRP A;  2BCS A;  5ALF A;  1ZQA A;  3D2S A;  4C8M A;  4DOB A;  2KSO B;  4QWC A;  3MFH A;  5KT7 A;  3RJG A;  4P4O A;  8ICE A;  2DQN B;  1OUQ A;  2F76 X;  1Z19 A;  3RR8 A;  4MFF A;  5CJ7 A;  2W8K A;  4I2E A;  3GV7 B;  4Y2P A;  2W9C B;  1MC8 A;  1ZQK A;  2RQ5 A;  3IHQ B;  4M9L A;  2W04 A;  5JRT A;  4KN7 A;  1L8O A;  5KFA A;  2D6F C;  1L3V A;  2H5X A;  9ICO A;  3GV5 B;  3BS5 A;  3WK6 A;  3ETL A;  3ETR A;  1SKS A;  2LBO A;  4LZG A;  1ZQF A;  1RYU A;  2WF7 A;  8ICJ A;  2ZJ5 A;  2XCP A;  5KFC A;  5DB6 A;  7ICL A;  2FPL A;  8ICL A;  1XWL A;  4Y2X A;  3DEE A;  1QSS A;  4US8 A;  3RJJ A;  5AI9 A;  3M1Y A;  1B0X A;  1T3N A;  2KKV A;  2RDI A;  5ALW A;  1Z4N A;  3C2L A;  2YMP A;  2HOI A;  1N56 A;  4ECV A;  2BHN A;  3Q8P B;  5IIK A;  1L7O A;  1ZJN A;  9ICV A;  2LHT A;  4M6W A;  4I2H A;  1SXE A;  4QWB A;  3F2D A;  3KHR A;  5AM2 A;  5III A;  3H8M A;  5ALE A;  2JRZ A;  4OJ5 A;  4C7Z A;  2QAR A;  3QU2 A;  1NK7 A;  3UQ0 A;  3N97 B;  3HW8 A;  2NYV A;  3H4B A;  2LPE A;  3H8J A;  3QU9 A;  8ICV A;  2Y1I A;  5D49 A; 
#chains in the Genus database with same CATH homology
 2ZIW B;  2VJ5 A;  1Z1B A;  4QNL A;  5T14 A;  3H0M B;  2JMG A;  2H3V A;  2XID A;  4BUG A;  3IN5 A;  2PMZ C;  3KFU F;  2JH1 A;  2ZIX A;  2H3Z A;  3HKZ F;  2DQN B;  1XNS A;  2BDU A;  1OUQ A;  2ZIV B;  2F77 X;  2F76 X;  2LKY A;  1Z19 A;  4QIW F;  1Q3U A;  1P7D A;  2KD1 A;  3L3F X;  2ZG6 A;  3LYS A;  1HIW A;  1L6N A;  2OYY A;  4GFJ A;  4OJ6 A;  1CRX A;  2KNJ A;  2ZXI A;  3CRX A;  5C0Y A;  2CPR A;  2JH7 A;  4NLB A;  2XI9 A;  2DF4 B;  1PVR A;  3F2B A;  3SAH A;  2W04 A;  3M7D A;  1PVP A;  3M6Z A;  4CGZ A;  2G06 A;  2WAQ F;  2LYB A;  2R18 A;  3PSI A;  4OJO A;  3C28 A;  1Q3V A;  2HBL A;  4IC9 A;  2YB1 A;  4NWI A;  2D6F C;  3F2C A;  2OH2 A;  1IIP A;  2OM6 A;  3ONN A;  2K8C B;  4P0P A;  1TAM A;  3NRW A;  4QJF B;  4U7C A;  2F2A B;  2VIX A;  4OJL A;  3RFA A;  5HR7 A;  3CP8 A;  2KIC A;  2YX8 A;  3H0L B;  2LBO A;  3VC8 A;  3AQF A;  2K8B B;  2MA1 A;  2F8L A;  4A8E A;  4KX3 A;  2ZIX B;  3LVV A;  1WUD A;  4P0Q A;  1MA7 A;  2HBM A;  2VKQ A;  2RRD A;  2ZIU A;  3ALR A;  1PVQ A;  4PL1 A;  4P0Q B;  2Q4T A;  3IG8 A;  2KHV A;  1YT3 A;  2WB1 F;  2N1R A;  2XVT A;  3N7S C;  2Z7J A;  2JGA A;  2E1F A;  4BJQ A;  3DEE A;  2W7P A;  2HMX A;  3CYM A;  1NZB A;  2H3I A;  2VJ4 A;  2KV2 A;  3LVW A;  3N7R C;  3GZF A;  4PL2 A;  1A0P A;  3SAG A;  3PZP A;  2KKV A;  3OPX A;  2M0N A;  3F53 A;  1F44 A;  4NLC A;  4P0P B;  2G5H B;  3F5E A;  2G0A A;  1SZH A;  3SQI A;  3N7P D;  2HOI A;  4O3M A;  2G08 A;  2KJ9 A;  1ZQ1 C;  2PMZ F;  2GOL A;  3F5A A;  4BX9 C;  3HKZ C;  1XO0 A;  2DGZ A;  3C29 A;  2W03 A;  4FZN A;  2K8A A;  5CRX A;  2G09 A;  2GH1 A;  2HOF A;  3M6K A;  4QIW C;  1KBU A;  3O0F A;  1ECW A;  2HOQ A;  2LHT A;  2ZIU B;  1A6S A;  4FZM A;  3F2D A;  3NUQ A;  3SAF A;  5HR6 A;  2KJ5 A;  1D8B A;  3E0F A;  4CRX A;  5KL8 B;  2KOB A;  4FE3 A;  2E1E A;  2K4H A;  1UPH A;  3PSF A;  3H0R B;  2H3F A;  2K4E A;  3MGV A;  4AYB C;  2MRL A;  3T79 A;  3AL0 B;  2WAQ C;  2KKP A;  2LYA A;  5A0L A;  2KHQ A;  1HEK A;  2ZIW A;  4CDG A;  2H3Q A;  2ZXH A;  3IP4 B;  2Y0S C;  2KIW A;  3ICX A;  4ICA A;  4NV0 A;  4ACO A;  2KJ8 A;  4WJ3 B;  1GO3 F;  3GU3 A;  2A3V A;  2K89 A;  5KL1 B;  4OJ5 A;  2RHF A;  4U6P A;  3IG5 A;  2YB4 A;  2KVC A;  2G5I B;  2ZIV A;  1URJ A;  3AQE A;  3D2Q A;  3K1Z A;  3VCB A;  2JHD A;  3SMV A;  2G07 A;  2WB1 C;  2CRX A;  2CN1 A;  2E5S A;  2K4I A;  4JMU A;  4OJP A;  4AYB F;  1DRG A;  2OXO A;  3PST A;  2HBJ A;  2NV3 A;  2HBK A;  4KMO B;  2KEY A;  4KX5 A;  2RP5 A;  3PSP A;  1ED1 A;  4FZL A;  3D2S A;  1T94 A;  4C0Z A;  2XIC A;  3RF9 A;  2W7O A;  3D2N A;  2Y0S F;  4OO1 J;  3KZX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...