2H3VA

Structure of the hiv-1 matrix protein bound to di-c8-phosphatidylinositol-(4,5)-bisphosphate
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
131
structure length
131
Chain Sequence
GARASVLSGGELDKWEKIRLRPGGKKQYKLKHIVWASRELERFAVNPGLLETSEGCRQILGQLQPSLQTGSEELRSLYNTIAVLYCVHQRIDVKDTKEALDKIEEEQNKSKKKAQQAAADTGNNSQVSQNY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for targeting HIV-1 Gag proteins to the plasma membrane for virus assembly.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Viral protein
molecule keywords Gag polyprotein
total genus 33
structure length 131
sequence length 131
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2006-05-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00540 Gag_p17 gag gene protein p17 (matrix protein)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.90 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase; domain 1 2h3vA01
1HEKA 4ICAA 2H3VA 1ED1A 2HMXA 2K4EA 4IC9A 2K4HA 1L6NA 2H3ZA 2H3QA 1TAMA 2NV3A 1ECWA 2JMGA 1UPHA 2H3IA 4JMUA 1HIWA 2N1RA 2K4IA 2GOLA 1A6SA 2LYAA 2H3FA 2LYBA
chains in the Genus database with same CATH superfamily
4QZIA 4O3NA 3TFRA 4UQGA 3QE9Y 4O5EA 4M9NA 8ICBA 1V38A 2ZIWA 4DOAA 5KG1A 2H3QA 4XQ8A 2VJ5A 1NJXA 1NK9A 5KFXA 4EEKA 1T3QA 4DWIA 3PSPA 4QJFB 4ACOA 3BDPA 4B9MA 3Q8QB 1N2XA 2WAQF 5ALGA 3QEAZ 9ICKA 2LYAA 5HHIA 4MF8A 2MA1A 2JV3A 4NM2A 1WCLA 2K8AA 1Z4NA 5AI4A 3N7SC 3FYHA 4QZ8A 1L8LA 2XCAA 1ZQCA 3MFIA 2GWSA 1XSNA 4P4PA 5J8YA 1JI7A 5J0PA 5EOZA 3BS5A 5KFBA 1DK3A 2JXJA 5AKZA 4M04A 5G5GA 1BPZA 5HR6A 4GC6A 4CF5A 4LVSA 3PW7A 4GLXA 2ZIVB 2AH5A 2UVWA 5L9XA 5B66U 2KHVA 2AQ4A 4CCHA 2YQEA 1L3SA 2F3NA 5GTHU 4DCCA 3PVXA 3Q8LA 4Y2QA 2QARB 4KLMA 4A8EA 4NLKA 4QZBA 3KZXA 1YZ7A 5AKYA 5AIAA 4K4HA 2P6RA 4YMOA 5EWGA 1PUZA 5J2DA 1NJZA 3SQIA 1XS9D 4KTQA 4UAVA 4JB3A 4M9HA 3KTQA 3HILA 4R64A 5EWFA 1ZQFA 5AI9A 4J9LA 1UA1A 1XO1A 2ZIVA 4DOCA 4JV1A 3QU4A 1ZQ1C 3NVWA 4FBUA 2W55A 2MUTA 3BZKA 2W8LA 2LYHA 2KJ8A 1X9WA 9ICTA 1NJWA 1RYSA 4NY8A 3RAQA 2KHQA 4KLEA 2PFNA 4BXOB 4JWNA 2B21A 1K1SA 5HHHA 3HKZF 4DL3A 5J2IA 5DDMA 4DLEA 1COKA 3CRXA 1BNOA 3IG8A 5J2EA 5KFRA 3G6XA 1D8BA 1ZD3A 2LPEA 1PK3A 1V85A 2EH9A 8ICNA 1CI4A 4OJ5A 3IV6A 4PGYA 2W3SA 2ZIXA 4B6JA 2CXYA 4U6PA 2PMZF 2AQ0A 3N28A 3TANA 1ZYQA 2I6XA 4HYKA 2V4RA 3M7DA 3N4MB 1ZQZA 3PW0A 4PHPA 2Q0ZX 4DFJA 2HBJA 2OYYA 3WK4A 2Q4TA 2ZJ5A 3PX6A 2I9GA 4C4SA 5J2FA 2IHNA 4O5CA 2FPMA 4YD1A 3HX0A 1ZQEA 3HT3A 2BDPA 2HBKA 8ICZA 3FM9A 2ZUCA 5AM3A 5B5EU 1U4BA 5AM5A 2KN7A 4EYIB 2EZZA 4C7ZA 2RP5A 1ECWA 2IOFA 2HW3A 5GTIU 3ISCA 1S0MA 1NNLA 2PFPA 1ZQTA 2F44A 5KT6A 4EBDA 4B9NA 1ZRMA 9ICFA 1V97A 4TUPA 3BQ0A 2R8HA 5K4LA 4DL2A 8ICOA 1MSWD 1S97A 4NV0A 3GV8B 4KLTA 2EAOA 1X9SA 2FJ6A 5AM0A 4NL9A 1QQ6A 3SR6A 4Y2PA 3T5HA 3AU2A 2M0NA 4I2IA 5L1KA 1IIPA 2QB0B 3OGUA 3J81j 3SZ2A 1ZETA 2D3DA 3V6KA 2C28A 1K5OA 2C2DA 2KZMA 2XC9A 3I76A 1B4FA 1L7PA 1L8OA 3KHGA 4UBCA 4B9SA 2DWQA 4P0PB 3BZCA 4F4XA 5J0XA 5C0YA 4WJ3B 1U47A 1WCNA 3GV5B 4R65A 5J0RA 3QNMA 5AKJA 2D6FC 3SAHA 2ZUBA 4DQPA 2KK0A 2NRZA 4GXJA 8ICFA 2ZIXB 2JH7A 5AK6A 2DBYA 2ZJ8A 3C1ZA 1KN5A 3GIMA 3ETLA 3KHLA 3SMVA 1ZD5A 2QKQA 9ICLA 2A1JB 3M8SA 2DFLA 1NOMA 2H3IA 5CHGA 5KFQA 3TKAA 5DGAA 1N5XA 2IA6A 2R8KA 4Y2UA 5ALNA 5AI5A 4ED8A 2UVVA 8ICYA 2K4EA 2JEGA 5ALIA 3C2MA 3B0XA 5HR7A 2ZTCA 1JRPA 4P0PA 9ICMA 3GDXA 1TK5A 3H7IA 2JZBB 5KFEA 2L5YA 4I28A 4UATA 4DQSA 1ZQMA 5KT7A 4C8LA 2K4IA 8ICIA 1KBUA 4R63A 1S76D 4F5RA 3B0YA 3KD3A 4DFMA 5AK4A 2E1FA 3BJYA 3UXOA 4MEXA 2H3ZA 7ICPA 2VA2A 5AK5A 3TADC 4Z6FA 4I2AA 4GC7A 3Q8SB 3TQ1A 3RJKA 5DG7A 4RPYA 3C21A 2F1IA 3MR6A 5KG2A 4DOBA 4Z6DA 4EX7A 1UA0A 4MHVA 2IMWP 2PXIA 3M6ZA 4YR3A 3H4DA 4PL2A 3QU7A 4C0ZA 4DSJA 1F44A 4BDPA 2ASJA 4YR2A 2OHFA 2D8CA 2ZG6A 3RBDA 3AM9A 3PMLA 4UB8U 2OEHA 1XO0A 3H8JA 2WF5A 2BPFA 3QX7A 2W7PA 5KFSA 4F71A 1KRPA 4O5KA 3PX4A 4QWCA 8ICQA 3ED5A 1D8LA 1CUKA 3WKEA 3RB3A 4FZLA 2F76X 5FP0A 1L7OA 4NLBA 1ZQDA 4IRDA 4GIBA 4ZOHC 1TAUA 3C28A 2FLLA 1C7YA 3LWLA 4J9SA 4AYBF 1TVAA 2W9BA 4RNMA 3NVZA 2BQUA 2E8NA 1DGJA 2AHOB 4C4RA 4TURA 3IHQB 3TI0A 5L1MA 5DB6A 4Q44A 3SAGA 1AQ6A 3EW9A 1Q3VA 4DSEA 3MDAA 1BGXT 1NK4A 2JEFA 4Z6EA 1SKRA 4K4IA 3WK6A 1D9FA 4F5OA 2G07A 2P6UA 2BKEA 2KIWA 3JPOA 4CDGA 4PGXA 2HI0A 2XY7A 5AM2A 3GIJA 1SZHA 4R66A 1KFDA 2PMZC 2EAMA 2F1HA 1PK1B 4QZGA 1HIWA 3AMZA 3IM1A 5IIOA 3PSIA 2HHWA 4FS2A 2BCSA 4UARA 1XSPA 1S0OA 4C8KA 4RUCA 4IL6U 2HMXA 1SL1A 5KFJA 2KD1A 4DFDA 2LI6A 4TUSA 2ODGA 2V9WA 5IINA 2HHVA 4RPXA 2HBLA 2DPIA 3SV4A 5J0YA 4BXOA 2E8OA 5AKIA 3FC4A 2ZXIA 2HOFA 4I2GA 3GIKA 3BQ7A 5AKEA 4DS5A 8ICGA 1NZPA 4DF8A 3KKAA 4ED6A 4KLJA 3T5LA 3M9NB 2E5SA 2RDIA 3KFUF 3E2EA 2WFAA 4Y2SA 2DF4B 5DG9A 1PK1A 3V72A 4I2HA 3IN5A 3C2KA 2B6GA 5ALYA 4ECZA 2VA8A 3Q8KA 2BCRA 5L1IA 4ECUA 2XGPA 3RR7A 4YXMA 1Z00B 5F9LA 3CYMA 2KG5A 5EE1A 3MGHA 4QZ9A 5BOLA 4US9A 1JUDA 1O03A 3TADA 2GH1A 3U26A 2G09A 3FAHA 4M2YA 2FLNA 3THVA 1RDFA 3RJIA 2BZFA 4ECYA 2WB1F 1TE2A 3C1YA 2Y0SF 4RQ8A 2KEYA 1ZQVA 3NASA 1CRXA 5KFNA 4O3RA 2EDUA 3NRZA 5DG8A 2R18A 4I27A 1S5LU 3IG5A 1S10A 3SYZA 4QNLA 4BUGA 4KITB 5KFOA 5ALFA 4F5QA 2E8MA 3A0BU 1KDHA 3ZDCA 2BCUA 4EBEA 4I2JA 5CA7A 3C2LA 3JPSA 1ZJNA 5HMLA 3EZ5A 3GILA 4QZAA 5L1JA 4UB3A 1T7PA 4F93B 5BOMA 4MFCA 5DB9A 3AU6A 2JMGA 5AM4A 1D8YA 4JV0A 1OXJA 4PHDA 2ALZA 1T3NA 3RH6A 7ICFA 1ZQAA 1ZQIA 1A6SA 3RR8A 2QB1A 3RB0A 1VDVA 2ZTDA 4UB1A 3LK9A 1NK5A 1ZQWA 1WUDA 4USAA 1NI3A 1X6IA 2M9NA 2RLTA 4YD2A 3MFHA 4YMNA 3QYPA 1D9DA 3RH4A 2YTUA 2KTQA 2Y1IA 1RYUA 1N60A 2LYBA 4J9NA 8ICUA 1H38A 5J2HA 5DBAA 9ICHA 1BNPA 2XICA 3L3FX 2K4HA 2HCFA 3BQ2A 2W3RA 4TUQA 3OJSA 3PO5A 2KP7A 1XWLA 3K4GA 1XC9A 5ALEA 2KE7A 4PZOA 2I5HA 5J2KA 1Z1VA 2O6KA 5KG7A 4RNNA 3C29A 3HJEA 4I2DA 2BDUA 3Q8RB 2JRZA 2JZBA 1RXVA 5J8YC 5KG3A 2J6SA 4P0QB 5TISU 4IR1A 1KL9A 2FMSA 1X66A 5AI6A 2H5XA 4KLIA 3L5KA 2IOFK 3QUTA 1T94A 2XIDA 1TFRA 4ED3A 3MDCA 1LKYA 4K4GA 5KAIU 4MEYA 5KFTA 4J03A 4TQRA 1WWVA 4O3MA 5EWEA 1WYGA 4C80A 1KSPA 1ZQHA 3KBBA 1UPHA 3OJUA 1QLNA 1FO4A 4C7YA 4B9LA 2NYVA 3HPOA 4IRKA 1N61A 2IHMA 9ICNA 1KTQA 4P4OA 3HKZC 4PHAA 3KKAC 2KJ9A 2Y0SC 9ICWA 3UXPA 2BCQA 2MU2A 3MR5A 2HOQA 2DUYA 5JTIA 3T5KA 5CR0A 2Y9UA 4RQMA 3PW2A 5CEHA 4KLGA 2EAPA 4NM1A 2EZYA 5KFFA 1XNSA 2ISPA 3RRGA 3PR5B 3E0FA 5DLGA 1DRGA 2RHFA 5KL1B 1NZBA 1TAMA 3NUQA 3ZDBA 5AM1A 3JPRA 4LJXA 4QWDA 1KW4A 4EX6A 3ICXA 3M9MB 4FFDA 2LM4A 4YVZA 3PW5A 1OW5A 3LVVA 2NO4A 4NLGA 4RT2A 2Z7JA 5KT3A 5J29A 3H4BA 5KFDA 1NK6A 3EPGA 2ISOA 3ALRA 4RT3A 5CP2A 4M9LA 2F8LA 3NRWA 2P35A 3F2DA 5DDYA 1ZQNA 1NKCA 1L5UA 4RQ5A 1PZNA 1BPXA 3H0LB 2NV3A 4Q43A 3QZ7A 1ZQBA 3ZD9A 5ALDA 1Q8KA 1ZQSA 1UHUA 4UB2A 3AL0B 4RQ1A 1N56A 1ZRNA 3PZPA 2YB1A 5KFCA 3QUBA 3WK5A 2G06A 2HHUA 3LVWA 5AICA 2KNJA 4RQNA 4UAYA 1RPLA 2I1QA 2JR5A 4I29A 4Y2VA 5D4BA 7ICIA 3ONNA 2VKQA 2MSNA 3H40A 5J2CA 1RM6C 3KHHA 3C5GA 4F72A 4QZFA 2W9CA 4QW9A 4BGDA 2A1AA 4ECQA 2KFNA 8ICWA 4Y2TA 3VC8A 7ICKA 7ICMA 4LZGA 4Y2YA 3T79A 3VCBA 1QCKA 4B9TA 1F0MA 3JPQA 2NRWA 4RNOA 2W04A 4F5PA 9ICEA 3SI8A 1GO3F 2CPRA 3JPNA 2WF8A 1TK8A 2J6TA 3WKCA 1T8EA 2XCPA 3JPTA 1ZQYA 2BQ3A 2ESEA 4KX3A 4UASA 2W8KA 3GIIA 4YP3A 4F92B 7ICNA 5KFHA 4J9MA 2KFZA 5J2GA 1ZJMA 3L4PA 2VANA 4G3IA 2ZXHA 4PL1A 4FS1A 4QZHA 4I2EA 5AKKA 4IQUA 3ZD8A 2JH1A 1KFSA 3M8RA 1F5SA 4KN7A 8ICPA 2AJQA 4PGQA 4ELUA 1Y88A 1ZQUA 4YR0A 2KZZA 4NLZA 3OSPA 2KMDA 5KFIA 4HAIA 2XI9A 4I2FA 9ICCA 2K60A 4DSFA 3QEBZ 3CNHA 4NL9C 4OD0A 5ALOA 3EPIA 4EZ6A 2ZUDA 4GFJA 2K4PA 4XUSA 4US8A 8ICXA 2OWOA 3PV8A 4RUAA 4P0QA 4RQ6A 4FE3A 3TAPA 4FZNA 3QZ8A 5ALLA 4IS7A 5KFWA 8ICSA 1COOA 5AKXA 2YMPA 1ZQOA 2YMQA 2LM1A 1BPDA 3K1ZA 5ALRA 4QWAA 3PMNA 2MUTB 2F2AB 4RU9A 3NVYA 5J2BA 4F2SA 4LZDA 3RB4A 1OUQA 1KEJA 4IRCA 4YXJA 5DQHA 5KT5A 3HWTA 5JRTA 1NKEA 5IIJA 8ICLA 4KLDA 1JX4A 2H3VA 4KMUA 3PR4A 8ICEA 4CE6A 4EZ9A 3TACB 2KV2A 1SV4A 8ICJA 8ICKA 1KQQA 3DEEA 5CWRA 2XY5A 4J9PA 1KFTA 1KLNA 2FPLA 1N48A 4J9RA 2QLTA 9ICGA 3GU3A 1VJ5A 3MGVA 1NKBA 3WK7A 4R8UB 5HP4A 3F5AA 4OJ6A 5ALXA 2W43A 4IC9A 3V7JA 3S6JA 3V6HA 1X6JA 5DKWA 3M9OB 4AP9A 4OO1J 1SWVA 1ZQLA 1N62A 4RQ2A 4DL4A 2K8BB 1U45A 4GXKA 1A76A 1JXEA 3RH5A 2HHTA 1SKWA 2KVSA 3KOOA 3WKDA 5KG4A 3OHAA 3UQ2A 1S9FA 4JWMA 5AI8A 1PVQA 4ZH4A 4M9JA 4X5VA 2V4QA 3WKAA 5ALKA 2EZXA 3ZI4A 3T5JA 5CRXA 2FLPA 1ED1A 5CB1A 2FMQA 3RBEA 1RYRA 5KFYA 2LHTA 3UXNA 5AKHA 3IDWA 2DPJA 2YY6A 1IG6A 4J9QA 2K89A 1JROA 3GFKB 9ICXA 3C23A 1ZXIA 3RB6A 1P7DA 4OJLA 4IQWA 8ICVA 3GV7B 4PZNA 4Y2RA 2EANA 9ICSA 2BGWA 2YMMA 5ALSA 1JXLA 2DGZA 2R8GA 1QH9A 8ICRA 4KLLA 3MR3A 3ETRA 4FBTA 3NS1A 5AKGA 4RQ0A 2F8KA 3DV9A 1SXDA 2YN4A 3D2SA 2H3FA 2HSZA 2PKEA 2OH2A 9ICQA 5IIKA 4YFKA 4U7CA 3MBYA 4XRHA 1LKYB 4O3QA 1VLBA 1X2IA 7ICJA 8ICHA 4IQVA 4BWMA 1ZQKA 4QZEA 2B0CA 3SEIA 3MABA 4QWBA 3PX0A 4ECTA 3F2BA 4F4ZA 1X40A 2LKYA 2KJ5A 5KFMA 1JIHA 2E8PA 3MC1A 4NLNA 2NRVA 3NGDA 7ICQA 2NRXA 5DBBA 1L3VA 1Z1BA 3QXGA 3BQTA 3E58A 1ZQGA 1FIQA 2HOIA 3MR2A 1HEKA 1PVPA 5IILA 2G0AA 2WAQC 5A0LA 4PHEA 1S77D 3UMGA 3ISDA 4QWEA 2JGAA 4ED2A 4I2CA 2E1EA 3N97B 5KFPA 1HUOA 2PFOA 2AGQA 3N7PD 1XSLA 4DLGA 4ECRA 2C2EA 2YX8A 1X9MA 2IBKA 3R9KA 1BVSA 5KL8B 4KLOA 1SV0A 7ICEA 2GLEA 2R8IA 2ATLA 2XY6A 4UW9A 5J0UA 5IIMA 1UT8A 2K8CB 3H8MA 7ICGA 3V7LA 1RQNA 3SENA 4DQRA 3RAXA 9ICOA 4ELVA 2HHSA 3QUCA 2NRTA 2AGOA 3ZDAA 1PVRA 3F5EA 3M6KA 5DGBA 5AK3A 4EELA 3D2QA 1SGGA 3TAQA 5DB7A 4DEZA 4Q45A 2XVTA 3SD7A 9ICJA 3KZIU 3QU2A 4C8MA 2ASDA 1O08A 4F50A 5J0WA 2BPCA 4KMOB 4UAZA 4C8OA 3QU5A 1WG8A 4NJ8A 3PY8A 4CRXA 3LDAA 5IIIA 4M6WA 3KHRA 4ECVA 3V7KA 3QU9A 4RQ7A 1J2NA 2A19A 2CN1A 2N1RA 3RTVA 4KN4A 4F91B 5KG5A 5J2AA 5E79U 3MGIA 3A0HU 3RRHA 2W9CB 2JEJA 4R8UA 4BWJA 5BPCA 3HP6A 4B9VA 5J2JA 1NK0A 1EXNA 4JUZA 1T4GA 4KLQA 1QSYA 9ICPA 2DKXA 1ZD4A 4JK1A 3Q8PB 3PW4A 9ICAA 2ZIUA 2PI4A 4DL6A 3EWAA 1QQ7A 5EE3A 2EQYA 3UM9A 5F3XB 7ICVA 2W9BB 1IXRA 2A3VA 1QQ5A 2OXOA 1HUZA 3EYZA 1Q46A 3RJEA 4QIWF 4ECXA 4P4MA 2LMRA 4FO6A 4JV2A 5DB8A 2KVCA 5ALVA 2RQ5A 5D49A 4UBBA 2LBOA 4EYHB 2KSOB 3M1YA 2BPGA 4NLCA 4JMUA 2F77X 1LB2B 5KG0A 3ISBA 2A1JA 1ZQPA 2WHEA 2KOBA 4IQTA 2WF7A 1S0VA 3AN1A 3ZDDA 3UQ0A 2Y9TA 2KKPA 1X42A 1DOQA 2NO5A 1URJA 1SL0A 2PI5A 3PSFA 4DFKA 3LYSA 5KFAA 2IOHA 1NJYA 3AEVA 4ED7A 4Y2JA 4UB5A 2FDRA 4TQSA 1L3UA 4MF2A 3NVVA 4DQQA 4P2HA 3HRDD 4MFFA 3RJJA 3I1YA 3WK8A 1Z4OA 4OJOA 4Z6CA 5KAFU 4MFAA 3AQEA 5J0OA 3T3FA 1JMSA 3SV3A 2P66A 5J0SA 4IR9A 1FFUA 1UT5A 3OTQA 2ASLA 5ALUA 1BPBA 4NXZA 1DGSA 1NK7A 2J6UA 2RDJA 4O3SA 1UQVA 1JALA 4M9GA 9ICUA 7ICSA 2FE9A 4ECWA 1ZQXA 3SAFA 1SV0C 2HDOA 4EBCA 3H8WA 3HW8A 4RQ4A 4UB6U 4PH5A 3OPXA 5JU5A 2VIXA 3WKBA 1A0PA 2WF6A 3RFAA 3EUB2 4RZRA 3PNCA 2VJ4A 3TFSA 4ED0A 2KIVA 4RQ3A 1YZ6A 4KLUA 4DO9A 2W03A 2KKVA 5G5HA 4EENA 4F8RA 1N5WA 4YMMA 1UCVA 3AUOA 4DSIA 4B9UA 1ZQQA 3ORYA 4DF4A 1U9LA 2KZ3A 5KFGA 5KT4A 4DQIA 1U48A 4Q8FA 3TARA 4F2RA 1SB3C 3V6JA 1SXEA 2AGPA 4DSLA 4YN4A 9ICBA 7ICRA 1A77A 4F5NA 2JEIA 2HBMA 5KTQA 5ALZA 3K1RB 1L6NA 1S0NA 1B0XA 5ALQA 5F9NA 1KKXA 2W7OA 5J0TA 5AHXA 1ZQRA 5T14A 4J9KA 5DQIA 3WU2U 1SKSA 2W9MA 1FEZA 7ICTA 4C8NA 1C20A 2WF9A 4ICAA 5KFKA 1IV8A 2HVHA 4Q8EA 5KT2A 7ICLA 1L3TA 2MAXA 4O3OA 4CNQA 7ICOA 4QIWC 2AU0A 5CJ7A 2Y1JA 1ZD2P 4QZDA 8ICAA 3RJGA 5ALWA 4PJ0U 5KFLA 3H0MB 5AKLA 2C2RA 2BR0A 2DQNB 4DL7A 5ALMA 5ALHA 1MN8A 2VA3A 1QSSA 2XO7A 1L7NA 2W54A 1RZTA 1JN3A 5AIBA 4O9MA 2AXTU 2HHQA 4RPZA 2YMLA 1V9PA 3G6YA 1WWUA 5ALPA 2R8JA 2GOLA 4GXIA 5DBCA 3H0RB 3BQ1A 5HNKA 9ICVA 4ED1A 3RJFA 1X9XA 3F53A 1QSLA 3JPPA 4UAWA 4QW8A 3IP4B 1SWWA 2ZTEA 1IM4A 5H2FU 4O0IA 4AYBC 1N63A 3D2NA 1LV5A 4DL5A 4CF3A 4NWIA 4KLHA 4G9BA 4M47A 3N7RC 1TK0A 2CRXA 2HVIA 2YB4A 1ZOLA 2G08A 1K1QA 1Z00A 4CF4A 5EE9A 1BPEA 7ICHA 2OM6A 2FMPA 1RG6A 2UVUA 1CEZA 1MA7A 9ICRA 5AI0A 3H8SA 1NK8A 1J97A 2WB1C 3FDSA 5DLFA 4J9OA 5KNIA 1MC8A 3GZFA 3ZDEA 2G5HB 1HJPA 2F1JA 1J2MA 4KX5A 5EE0A 3BS7A 3CW2C 4CGZA 5DQGA 4O3PA 5KFUA 5ALTA 5TZVA 2JHDA 1ZQJA 4OJPA 4YQWA 1LVHA 2DKZA 2RRDA 5KFZA 5KG6A 1XU4A 2ZIWB 3UMBA 3B9JA 5ALJA 2BCVA 1SZPA 1Z3EB 2QB0A 3NTUA 3CP8A 3UMCA 5J0QA 3F2CA 3LWMA 3C5FA 1DK2A 2BHNA 1B22A 1MQ3A 3D6JA 3PO4A 2UVRA 4QZCA 3I28A 5D46A 2DL0A 4E0DA 4F4WA 3IRUA 4Y2XA 2ZIUB 1TV9A 4ECSA 1SIJA 4BJQA 2FPKA 1Z19A 2ZJAA 2GO7A 3OSNA 1AROP 1FFVA 3RJHA 2WTFA 3OHBA 1SL2A 1S8OA 4PPXA 3PSTA 3G6VA 2XGQA 4DFPA 3AQFA 5C5JA 4DS4A 9ICIA 2HHXA 4C4TA 4UB4A 3BS5B 1QTMA 1Q3UA 4UAUA 8ICTA 1L7MA 1B43A 2PFQA 4EEYA 3QUQA 1M6YA 2KICA 4F3OA 2KSOA 5HMMA 5L1LA 3K75D 4BX9C 4XA5A 1MQ2A 4M0AA 7ICUA 8ICMA 4DSKA 2OCEA 4ELTA 1RQLA 1U49A 2QARA 4M6WB 3UPQA 2BQRA 4KLFA 1DXSA 3GQCA 1RXWA 4KLSA 4F4KA 2W9AA 2MRLA 4YG2A 4F4YA 5JUMA 2FI1A 3DDHA 4YCXA 2E3TA 5KFVA 2G5IB 4OCZA 3WK9A 8ICCA 3O0FA 1BPYA 1TAQA 1YT3A 3RF9A 4FZMA 2C22A 4I2BA 2ES6A 1TKDA 2W11A 3Q8MA
chains in the Genus database with same CATH topology
2H3VA 1CRXA 3LVVA 2BDUA 3OPXA 4NV0A 2R18A 2VIXA 2G07A 1A0PA 3CP8A 3F2CA 2E1FA 2ZIWA 4KX3A 3RFAA 2Z7JA 2ZIVA 3IG5A 2DGZA 2KIWA 4P0QB 4QNLA 1ZQ1C 4CDGA 2H3QA 2H3ZA 3ALRA 4BUGA 2KV2A 1SZHA 2VJ5A 2M0NA 2A3VA 2PMZC 2F8LA 2VJ4A 2OXOA 2K8CB 3NRWA 3DEEA 3PSPA 4QJFB 4ACOA 1HIWA 3F2DA 1IIPA 2ZIUB 2KJ8A 2GOLA 3PSIA 3H0RB 4QIWF 2ZXHA 2KHQA 4PL1A 2WAQF 1T94A 2W03A 2XIDA 3F53A 3D2SA 2H3FA 3GU3A 2KKVA 2LYAA 3MGVA 4BJQA 2OH2A 3IP4B 2MA1A 3F5AA 4OJ6A 1PVRA 1Z19A 2HMXA 2KVCA 3HKZF 3M6ZA 2JH1A 3F5EA 3M6KA 4U7CA 4IC9A 2K8AA 4AYBC 3D2NA 4PL2A 3CRXA 2KD1A 4O3MA 3IG8A 3N7SC 4C0ZA 3D2QA 1F44A 3PSTA 3H0LB 1D8BA 2LBOA 2NV3A 2XVTA 2JMGA 4NWIA 3AQFA 4P0PB 4OO1J 1UPHA 2K8BB 4NLCA 4JMUA 2F77X 2HBLA 3N7RC 5C0YA 2ZG6A 4WJ3B 2XI9A 4OJ5A 1Q3UA 3AL0B 2CRXA 2KOBA 1A6SA 2ZIXA 2YB4A 4U6PA 2ZXIA 1XO0A 2HOFA 2PMZF 3F2BA 2D6FC 2G08A 3SAHA 2LKYA 2KJ5A 2KKPA 4GFJA 2ZIXB 2YB1A 3PZPA 2JH7A 2OM6A 2HBMA 3M7DA 1URJA 2G06A 2KICA 3LVWA 2W7PA 4KMOB 2E5SA 1L6NA 3HKZC 3KFUF 5HR6A 3PSFA 1WUDA 2DF4B 2KNJA 2KJ9A 3LYSA 3SMVA 1MA7A 3IN5A 4CRXA 2Y0SC 2ZIVB 1Z1BA 2HBJA 4BX9C 2OYYA 2W7OA 5T14A 1PVQA 2H3IA 2KHVA 4P0QA 2HOQA 2Q4TA 2WB1C 4FE3A 4FZLA 2F76X 2CN1A 2N1RA 4FZNA 3ONNA 2VKQA 4NLBA 4OJOA 3GZFA 3C28A 3AQEA 3CYMA 5CRXA 2HOIA 2K4EA 2LYBA 1ED1A 2G5HB 4AYBF 1HEKA 2HBKA 4ICAA 1PVPA 4A8EA 2G0AA 5HR7A 2WAQC 5A0LA 2GH1A 3K1ZA 5KL8B 2MRLA 2G09A 3VC8A 2XICA 4KX5A 1XNSA 3L3FX 2K4HA 4P0PA 2LHTA 3KZXA 3VCBA 3T79A 3E0FA 2G5IB 1DRGA 2RHFA 5KL1B 2F2AB 2JGAA 2RP5A 4QIWC 1TAMA 1NZBA 4CGZA 3NUQA 1ECWA 2E1EA 3SAGA 2K89A 1Q3VA 2W04A 3O0FA 1OUQA 1YT3A 2WB1F 3SAFA 3N7PD 3RF9A 2K4IA 3ICXA 4FZMA 3SQIA 2JHDA 2YX8A 4OJPA 1P7DA 3H0MB 4OJLA 1GO3F 2Y0SF 1KBUA 2KEYA 2CPRA 2RRDA 2DQNB 3C29A 2ZIWB 2ZIUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1HEK A;  4ICA A;  2H3V A;  1ED1 A;  2HMX A;  2K4E A;  4IC9 A;  2K4H A;  1L6N A;  2H3Z A;  2H3Q A;  1TAM A;  2NV3 A;  1ECW A;  2JMG A;  1UPH A;  2H3I A;  4JMU A;  1HIW A;  2N1R A;  2K4I A;  2GOL A;  1A6S A;  2LYA A;  2H3F A;  2LYB A; 
#chains in the Genus database with same CATH topology
 4QZI A;  4O3N A;  3TFR A;  4UQG A;  3QE9 Y;  4O5E A;  4M9N A;  8ICB A;  1V38 A;  2ZIW A;  4DOA A;  5KG1 A;  2H3Q A;  4XQ8 A;  2VJ5 A;  1NJX A;  1NK9 A;  5KFX A;  4EEK A;  1T3Q A;  4DWI A;  3PSP A;  4QJF B;  4ACO A;  3BDP A;  4B9M A;  3Q8Q B;  1N2X A;  2WAQ F;  5ALG A;  3QEA Z;  9ICK A;  2LYA A;  5HHI A;  4MF8 A;  2MA1 A;  2JV3 A;  4NM2 A;  1WCL A;  2K8A A;  1Z4N A;  5AI4 A;  3N7S C;  3FYH A;  4QZ8 A;  1L8L A;  2XCA A;  1ZQC A;  3MFI A;  2GWS A;  1XSN A;  4P4P A;  5J8Y A;  1JI7 A;  5J0P A;  5EOZ A;  3BS5 A;  5KFB A;  1DK3 A;  2JXJ A;  5AKZ A;  4M04 A;  5G5G A;  1BPZ A;  5HR6 A;  4GC6 A;  4CF5 A;  4LVS A;  3PW7 A;  4GLX A;  2ZIV B;  2AH5 A;  2UVW A;  5L9X A;  5B66 U;  2KHV A;  2AQ4 A;  4CCH A;  2YQE A;  1L3S A;  2F3N A;  5GTH U;  4DCC A;  3PVX A;  3Q8L A;  4Y2Q A;  2QAR B;  4KLM A;  4A8E A;  4NLK A;  4QZB A;  3KZX A;  1YZ7 A;  5AKY A;  5AIA A;  4K4H A;  2P6R A;  4YMO A;  5EWG A;  1PUZ A;  5J2D A;  1NJZ A;  3SQI A;  1XS9 D;  4KTQ A;  4UAV A;  4JB3 A;  4M9H A;  3KTQ A;  3HIL A;  4R64 A;  5EWF A;  1ZQF A;  5AI9 A;  4J9L A;  1UA1 A;  1XO1 A;  2ZIV A;  4DOC A;  4JV1 A;  3QU4 A;  1ZQ1 C;  3NVW A;  4FBU A;  2W55 A;  2MUT A;  3BZK A;  2W8L A;  2LYH A;  2KJ8 A;  1X9W A;  9ICT A;  1NJW A;  1RYS A;  4NY8 A;  3RAQ A;  2KHQ A;  4KLE A;  2PFN A;  4BXO B;  4JWN A;  2B21 A;  1K1S A;  5HHH A;  3HKZ F;  4DL3 A;  5J2I A;  5DDM A;  4DLE A;  1COK A;  3CRX A;  1BNO A;  3IG8 A;  5J2E A;  5KFR A;  3G6X A;  1D8B A;  1ZD3 A;  2LPE A;  1PK3 A;  1V85 A;  2EH9 A;  8ICN A;  1CI4 A;  4OJ5 A;  3IV6 A;  4PGY A;  2W3S A;  2ZIX A;  4B6J A;  2CXY A;  4U6P A;  2PMZ F;  2AQ0 A;  3N28 A;  3TAN A;  1ZYQ A;  2I6X A;  4HYK A;  2V4R A;  3M7D A;  3N4M B;  1ZQZ A;  3PW0 A;  4PHP A;  2Q0Z X;  4DFJ A;  2HBJ A;  2OYY A;  3WK4 A;  2Q4T A;  2ZJ5 A;  3PX6 A;  2I9G A;  4C4S A;  5J2F A;  2IHN A;  4O5C A;  2FPM A;  4YD1 A;  3HX0 A;  1ZQE A;  3HT3 A;  2BDP A;  2HBK A;  8ICZ A;  3FM9 A;  2ZUC A;  5AM3 A;  5B5E U;  1U4B A;  5AM5 A;  2KN7 A;  4EYI B;  2EZZ A;  4C7Z A;  2RP5 A;  1ECW A;  2IOF A;  2HW3 A;  5GTI U;  3ISC A;  1S0M A;  1NNL A;  2PFP A;  1ZQT A;  2F44 A;  5KT6 A;  4EBD A;  4B9N A;  1ZRM A;  9ICF A;  1V97 A;  4TUP A;  3BQ0 A;  2R8H A;  5K4L A;  4DL2 A;  8ICO A;  1MSW D;  1S97 A;  4NV0 A;  3GV8 B;  4KLT A;  2EAO A;  1X9S A;  2FJ6 A;  5AM0 A;  4NL9 A;  1QQ6 A;  3SR6 A;  4Y2P A;  3T5H A;  3AU2 A;  2M0N A;  4I2I A;  5L1K A;  1IIP A;  2QB0 B;  3OGU A;  3J81 j;  3SZ2 A;  1ZET A;  2D3D A;  3V6K A;  2C28 A;  1K5O A;  2C2D A;  2KZM A;  2XC9 A;  3I76 A;  1B4F A;  1L7P A;  1L8O A;  3KHG A;  4UBC A;  4B9S A;  2DWQ A;  4P0P B;  3BZC A;  4F4X A;  5J0X A;  5C0Y A;  4WJ3 B;  1U47 A;  1WCN A;  3GV5 B;  4R65 A;  5J0R A;  3QNM A;  5AKJ A;  2D6F C;  3SAH A;  2ZUB A;  4DQP A;  2KK0 A;  2NRZ A;  4GXJ A;  8ICF A;  2ZIX B;  2JH7 A;  5AK6 A;  2DBY A;  2ZJ8 A;  3C1Z A;  1KN5 A;  3GIM A;  3ETL A;  3KHL A;  3SMV A;  1ZD5 A;  2QKQ A;  9ICL A;  2A1J B;  3M8S A;  2DFL A;  1NOM A;  2H3I A;  5CHG A;  5KFQ A;  3TKA A;  5DGA A;  1N5X A;  2IA6 A;  2R8K A;  4Y2U A;  5ALN A;  5AI5 A;  4ED8 A;  2UVV A;  8ICY A;  2K4E A;  2JEG A;  5ALI A;  3C2M A;  3B0X A;  5HR7 A;  2ZTC A;  1JRP A;  4P0P A;  9ICM A;  3GDX A;  1TK5 A;  3H7I A;  2JZB B;  5KFE A;  2L5Y A;  4I28 A;  4UAT A;  4DQS A;  1ZQM A;  5KT7 A;  4C8L A;  2K4I A;  8ICI A;  1KBU A;  4R63 A;  1S76 D;  4F5R A;  3B0Y A;  3KD3 A;  4DFM A;  5AK4 A;  2E1F A;  3BJY A;  3UXO A;  4MEX A;  2H3Z A;  7ICP A;  2VA2 A;  5AK5 A;  3TAD C;  4Z6F A;  4I2A A;  4GC7 A;  3Q8S B;  3TQ1 A;  3RJK A;  5DG7 A;  4RPY A;  3C21 A;  2F1I A;  3MR6 A;  5KG2 A;  4DOB A;  4Z6D A;  4EX7 A;  1UA0 A;  4MHV A;  2IMW P;  2PXI A;  3M6Z A;  4YR3 A;  3H4D A;  4PL2 A;  3QU7 A;  4C0Z A;  4DSJ A;  1F44 A;  4BDP A;  2ASJ A;  4YR2 A;  2OHF A;  2D8C A;  2ZG6 A;  3RBD A;  3AM9 A;  3PML A;  4UB8 U;  2OEH A;  1XO0 A;  3H8J A;  2WF5 A;  2BPF A;  3QX7 A;  2W7P A;  5KFS A;  4F71 A;  1KRP A;  4O5K A;  3PX4 A;  4QWC A;  8ICQ A;  3ED5 A;  1D8L A;  1CUK A;  3WKE A;  3RB3 A;  4FZL A;  2F76 X;  5FP0 A;  1L7O A;  4NLB A;  1ZQD A;  4IRD A;  4GIB A;  4ZOH C;  1TAU A;  3C28 A;  2FLL A;  1C7Y A;  3LWL A;  4J9S A;  4AYB F;  1TVA A;  2W9B A;  4RNM A;  3NVZ A;  2BQU A;  2E8N A;  1DGJ A;  2AHO B;  4C4R A;  4TUR A;  3IHQ B;  3TI0 A;  5L1M A;  5DB6 A;  4Q44 A;  3SAG A;  1AQ6 A;  3EW9 A;  1Q3V A;  4DSE A;  3MDA A;  1BGX T;  1NK4 A;  2JEF A;  4Z6E A;  1SKR A;  4K4I A;  3WK6 A;  1D9F A;  4F5O A;  2G07 A;  2P6U A;  2BKE A;  2KIW A;  3JPO A;  4CDG A;  4PGX A;  2HI0 A;  2XY7 A;  5AM2 A;  3GIJ A;  1SZH A;  4R66 A;  1KFD A;  2PMZ C;  2EAM A;  2F1H A;  1PK1 B;  4QZG A;  1HIW A;  3AMZ A;  3IM1 A;  5IIO A;  3PSI A;  2HHW A;  4FS2 A;  2BCS A;  4UAR A;  1XSP A;  1S0O A;  4C8K A;  4RUC A;  4IL6 U;  2HMX A;  1SL1 A;  5KFJ A;  2KD1 A;  4DFD A;  2LI6 A;  4TUS A;  2ODG A;  2V9W A;  5IIN A;  2HHV A;  4RPX A;  2HBL A;  2DPI A;  3SV4 A;  5J0Y A;  4BXO A;  2E8O A;  5AKI A;  3FC4 A;  2ZXI A;  2HOF A;  4I2G A;  3GIK A;  3BQ7 A;  5AKE A;  4DS5 A;  8ICG A;  1NZP A;  4DF8 A;  3KKA A;  4ED6 A;  4KLJ A;  3T5L A;  3M9N B;  2E5S A;  2RDI A;  3KFU F;  3E2E A;  2WFA A;  4Y2S A;  2DF4 B;  5DG9 A;  1PK1 A;  3V72 A;  4I2H A;  3IN5 A;  3C2K A;  2B6G A;  5ALY A;  4ECZ A;  2VA8 A;  3Q8K A;  2BCR A;  5L1I A;  4ECU A;  2XGP A;  3RR7 A;  4YXM A;  1Z00 B;  5F9L A;  3CYM A;  2KG5 A;  5EE1 A;  3MGH A;  4QZ9 A;  5BOL A;  4US9 A;  1JUD A;  1O03 A;  3TAD A;  2GH1 A;  3U26 A;  2G09 A;  3FAH A;  4M2Y A;  2FLN A;  3THV A;  1RDF A;  3RJI A;  2BZF A;  4ECY A;  2WB1 F;  1TE2 A;  3C1Y A;  2Y0S F;  4RQ8 A;  2KEY A;  1ZQV A;  3NAS A;  1CRX A;  5KFN A;  4O3R A;  2EDU A;  3NRZ A;  5DG8 A;  2R18 A;  4I27 A;  1S5L U;  3IG5 A;  1S10 A;  3SYZ A;  4QNL A;  4BUG A;  4KIT B;  5KFO A;  5ALF A;  4F5Q A;  2E8M A;  3A0B U;  1KDH A;  3ZDC A;  2BCU A;  4EBE A;  4I2J A;  5CA7 A;  3C2L A;  3JPS A;  1ZJN A;  5HML A;  3EZ5 A;  3GIL A;  4QZA A;  5L1J A;  4UB3 A;  1T7P A;  4F93 B;  5BOM A;  4MFC A;  5DB9 A;  3AU6 A;  2JMG A;  5AM4 A;  1D8Y A;  4JV0 A;  1OXJ A;  4PHD A;  2ALZ A;  1T3N A;  3RH6 A;  7ICF A;  1ZQA A;  1ZQI A;  1A6S A;  3RR8 A;  2QB1 A;  3RB0 A;  1VDV A;  2ZTD A;  4UB1 A;  3LK9 A;  1NK5 A;  1ZQW A;  1WUD A;  4USA A;  1NI3 A;  1X6I A;  2M9N A;  2RLT A;  4YD2 A;  3MFH A;  4YMN A;  3QYP A;  1D9D A;  3RH4 A;  2YTU A;  2KTQ A;  2Y1I A;  1RYU A;  1N60 A;  2LYB A;  4J9N A;  8ICU A;  1H38 A;  5J2H A;  5DBA A;  9ICH A;  1BNP A;  2XIC A;  3L3F X;  2K4H A;  2HCF A;  3BQ2 A;  2W3R A;  4TUQ A;  3OJS A;  3PO5 A;  2KP7 A;  1XWL A;  3K4G A;  1XC9 A;  5ALE A;  2KE7 A;  4PZO A;  2I5H A;  5J2K A;  1Z1V A;  2O6K A;  5KG7 A;  4RNN A;  3C29 A;  3HJE A;  4I2D A;  2BDU A;  3Q8R B;  2JRZ A;  2JZB A;  1RXV A;  5J8Y C;  5KG3 A;  2J6S A;  4P0Q B;  5TIS U;  4IR1 A;  1KL9 A;  2FMS A;  1X66 A;  5AI6 A;  2H5X A;  4KLI A;  3L5K A;  2IOF K;  3QUT A;  1T94 A;  2XID A;  1TFR A;  4ED3 A;  3MDC A;  1LKY A;  4K4G A;  5KAI U;  4MEY A;  5KFT A;  4J03 A;  4TQR A;  1WWV A;  4O3M A;  5EWE A;  1WYG A;  4C80 A;  1KSP A;  1ZQH A;  3KBB A;  1UPH A;  3OJU A;  1QLN A;  1FO4 A;  4C7Y A;  4B9L A;  2NYV A;  3HPO A;  4IRK A;  1N61 A;  2IHM A;  9ICN A;  1KTQ A;  4P4O A;  3HKZ C;  4PHA A;  3KKA C;  2KJ9 A;  2Y0S C;  9ICW A;  3UXP A;  2BCQ A;  2MU2 A;  3MR5 A;  2HOQ A;  2DUY A;  5JTI A;  3T5K A;  5CR0 A;  2Y9U A;  4RQM A;  3PW2 A;  5CEH A;  4KLG A;  2EAP A;  4NM1 A;  2EZY A;  5KFF A;  1XNS A;  2ISP A;  3RRG A;  3PR5 B;  3E0F A;  5DLG A;  1DRG A;  2RHF A;  5KL1 B;  1NZB A;  1TAM A;  3NUQ A;  3ZDB A;  5AM1 A;  3JPR A;  4LJX A;  4QWD A;  1KW4 A;  4EX6 A;  3ICX A;  3M9M B;  4FFD A;  2LM4 A;  4YVZ A;  3PW5 A;  1OW5 A;  3LVV A;  2NO4 A;  4NLG A;  4RT2 A;  2Z7J A;  5KT3 A;  5J29 A;  3H4B A;  5KFD A;  1NK6 A;  3EPG A;  2ISO A;  3ALR A;  4RT3 A;  5CP2 A;  4M9L A;  2F8L A;  3NRW A;  2P35 A;  3F2D A;  5DDY A;  1ZQN A;  1NKC A;  1L5U A;  4RQ5 A;  1PZN A;  1BPX A;  3H0L B;  2NV3 A;  4Q43 A;  3QZ7 A;  1ZQB A;  3ZD9 A;  5ALD A;  1Q8K A;  1ZQS A;  1UHU A;  4UB2 A;  3AL0 B;  4RQ1 A;  1N56 A;  1ZRN A;  3PZP A;  2YB1 A;  5KFC A;  3QUB A;  3WK5 A;  2G06 A;  2HHU A;  3LVW A;  5AIC A;  2KNJ A;  4RQN A;  4UAY A;  1RPL A;  2I1Q A;  2JR5 A;  4I29 A;  4Y2V A;  5D4B A;  7ICI A;  3ONN A;  2VKQ A;  2MSN A;  3H40 A;  5J2C A;  1RM6 C;  3KHH A;  3C5G A;  4F72 A;  4QZF A;  2W9C A;  4QW9 A;  4BGD A;  2A1A A;  4ECQ A;  2KFN A;  8ICW A;  4Y2T A;  3VC8 A;  7ICK A;  7ICM A;  4LZG A;  4Y2Y A;  3T79 A;  3VCB A;  1QCK A;  4B9T A;  1F0M A;  3JPQ A;  2NRW A;  4RNO A;  2W04 A;  4F5P A;  9ICE A;  3SI8 A;  1GO3 F;  2CPR A;  3JPN A;  2WF8 A;  1TK8 A;  2J6T A;  3WKC A;  1T8E A;  2XCP A;  3JPT A;  1ZQY A;  2BQ3 A;  2ESE A;  4KX3 A;  4UAS A;  2W8K A;  3GII A;  4YP3 A;  4F92 B;  7ICN A;  5KFH A;  4J9M A;  2KFZ A;  5J2G A;  1ZJM A;  3L4P A;  2VAN A;  4G3I A;  2ZXH A;  4PL1 A;  4FS1 A;  4QZH A;  4I2E A;  5AKK A;  4IQU A;  3ZD8 A;  2JH1 A;  1KFS A;  3M8R A;  1F5S A;  4KN7 A;  8ICP A;  2AJQ A;  4PGQ A;  4ELU A;  1Y88 A;  1ZQU A;  4YR0 A;  2KZZ A;  4NLZ A;  3OSP A;  2KMD A;  5KFI A;  4HAI A;  2XI9 A;  4I2F A;  9ICC A;  2K60 A;  4DSF A;  3QEB Z;  3CNH A;  4NL9 C;  4OD0 A;  5ALO A;  3EPI A;  4EZ6 A;  2ZUD A;  4GFJ A;  2K4P A;  4XUS A;  4US8 A;  8ICX A;  2OWO A;  3PV8 A;  4RUA A;  4P0Q A;  4RQ6 A;  4FE3 A;  3TAP A;  4FZN A;  3QZ8 A;  5ALL A;  4IS7 A;  5KFW A;  8ICS A;  1COO A;  5AKX A;  2YMP A;  1ZQO A;  2YMQ A;  2LM1 A;  1BPD A;  3K1Z A;  5ALR A;  4QWA A;  3PMN A;  2MUT B;  2F2A B;  4RU9 A;  3NVY A;  5J2B A;  4F2S A;  4LZD A;  3RB4 A;  1OUQ A;  1KEJ A;  4IRC A;  4YXJ A;  5DQH A;  5KT5 A;  3HWT A;  5JRT A;  1NKE A;  5IIJ A;  8ICL A;  4KLD A;  1JX4 A;  2H3V A;  4KMU A;  3PR4 A;  8ICE A;  4CE6 A;  4EZ9 A;  3TAC B;  2KV2 A;  1SV4 A;  8ICJ A;  8ICK A;  1KQQ A;  3DEE A;  5CWR A;  2XY5 A;  4J9P A;  1KFT A;  1KLN A;  2FPL A;  1N48 A;  4J9R A;  2QLT A;  9ICG A;  3GU3 A;  1VJ5 A;  3MGV A;  1NKB A;  3WK7 A;  4R8U B;  5HP4 A;  3F5A A;  4OJ6 A;  5ALX A;  2W43 A;  4IC9 A;  3V7J A;  3S6J A;  3V6H A;  1X6J A;  5DKW A;  3M9O B;  4AP9 A;  4OO1 J;  1SWV A;  1ZQL A;  1N62 A;  4RQ2 A;  4DL4 A;  2K8B B;  1U45 A;  4GXK A;  1A76 A;  1JXE A;  3RH5 A;  2HHT A;  1SKW A;  2KVS A;  3KOO A;  3WKD A;  5KG4 A;  3OHA A;  3UQ2 A;  1S9F A;  4JWM A;  5AI8 A;  1PVQ A;  4ZH4 A;  4M9J A;  4X5V A;  2V4Q A;  3WKA A;  5ALK A;  2EZX A;  3ZI4 A;  3T5J A;  5CRX A;  2FLP A;  1ED1 A;  5CB1 A;  2FMQ A;  3RBE A;  1RYR A;  5KFY A;  2LHT A;  3UXN A;  5AKH A;  3IDW A;  2DPJ A;  2YY6 A;  1IG6 A;  4J9Q A;  2K89 A;  1JRO A;  3GFK B;  9ICX A;  3C23 A;  1ZXI A;  3RB6 A;  1P7D A;  4OJL A;  4IQW A;  8ICV A;  3GV7 B;  4PZN A;  4Y2R A;  2EAN A;  9ICS A;  2BGW A;  2YMM A;  5ALS A;  1JXL A;  2DGZ A;  2R8G A;  1QH9 A;  8ICR A;  4KLL A;  3MR3 A;  3ETR A;  4FBT A;  3NS1 A;  5AKG A;  4RQ0 A;  2F8K A;  3DV9 A;  1SXD A;  2YN4 A;  3D2S A;  2H3F A;  2HSZ A;  2PKE A;  2OH2 A;  9ICQ A;  5IIK A;  4YFK A;  4U7C A;  3MBY A;  4XRH A;  1LKY B;  4O3Q A;  1VLB A;  1X2I A;  7ICJ A;  8ICH A;  4IQV A;  4BWM A;  1ZQK A;  4QZE A;  2B0C A;  3SEI A;  3MAB A;  4QWB A;  3PX0 A;  4ECT A;  3F2B A;  4F4Z A;  1X40 A;  2LKY A;  2KJ5 A;  5KFM A;  1JIH A;  2E8P A;  3MC1 A;  4NLN A;  2NRV A;  3NGD A;  7ICQ A;  2NRX A;  5DBB A;  1L3V A;  1Z1B A;  3QXG A;  3BQT A;  3E58 A;  1ZQG A;  1FIQ A;  2HOI A;  3MR2 A;  1HEK A;  1PVP A;  5IIL A;  2G0A A;  2WAQ C;  5A0L A;  4PHE A;  1S77 D;  3UMG A;  3ISD A;  4QWE A;  2JGA A;  4ED2 A;  4I2C A;  2E1E A;  3N97 B;  5KFP A;  1HUO A;  2PFO A;  2AGQ A;  3N7P D;  1XSL A;  4DLG A;  4ECR A;  2C2E A;  2YX8 A;  1X9M A;  2IBK A;  3R9K A;  1BVS A;  5KL8 B;  4KLO A;  1SV0 A;  7ICE A;  2GLE A;  2R8I A;  2ATL A;  2XY6 A;  4UW9 A;  5J0U A;  5IIM A;  1UT8 A;  2K8C B;  3H8M A;  7ICG A;  3V7L A;  1RQN A;  3SEN A;  4DQR A;  3RAX A;  9ICO A;  4ELV A;  2HHS A;  3QUC A;  2NRT A;  2AGO A;  3ZDA A;  1PVR A;  3F5E A;  3M6K A;  5DGB A;  5AK3 A;  4EEL A;  3D2Q A;  1SGG A;  3TAQ A;  5DB7 A;  4DEZ A;  4Q45 A;  2XVT A;  3SD7 A;  9ICJ A;  3KZI U;  3QU2 A;  4C8M A;  2ASD A;  1O08 A;  4F50 A;  5J0W A;  2BPC A;  4KMO B;  4UAZ A;  4C8O A;  3QU5 A;  1WG8 A;  4NJ8 A;  3PY8 A;  4CRX A;  3LDA A;  5III A;  4M6W A;  3KHR A;  4ECV A;  3V7K A;  3QU9 A;  4RQ7 A;  1J2N A;  2A19 A;  2CN1 A;  2N1R A;  3RTV A;  4KN4 A;  4F91 B;  5KG5 A;  5J2A A;  5E79 U;  3MGI A;  3A0H U;  3RRH A;  2W9C B;  2JEJ A;  4R8U A;  4BWJ A;  5BPC A;  3HP6 A;  4B9V A;  5J2J A;  1NK0 A;  1EXN A;  4JUZ A;  1T4G A;  4KLQ A;  1QSY A;  9ICP A;  2DKX A;  1ZD4 A;  4JK1 A;  3Q8P B;  3PW4 A;  9ICA A;  2ZIU A;  2PI4 A;  4DL6 A;  3EWA A;  1QQ7 A;  5EE3 A;  2EQY A;  3UM9 A;  5F3X B;  7ICV A;  2W9B B;  1IXR A;  2A3V A;  1QQ5 A;  2OXO A;  1HUZ A;  3EYZ A;  1Q46 A;  3RJE A;  4QIW F;  4ECX A;  4P4M A;  2LMR A;  4FO6 A;  4JV2 A;  5DB8 A;  2KVC A;  5ALV A;  2RQ5 A;  5D49 A;  4UBB A;  2LBO A;  4EYH B;  2KSO B;  3M1Y A;  2BPG A;  4NLC A;  4JMU A;  2F77 X;  1LB2 B;  5KG0 A;  3ISB A;  2A1J A;  1ZQP A;  2WHE A;  2KOB A;  4IQT A;  2WF7 A;  1S0V A;  3AN1 A;  3ZDD A;  3UQ0 A;  2Y9T A;  2KKP A;  1X42 A;  1DOQ A;  2NO5 A;  1URJ A;  1SL0 A;  2PI5 A;  3PSF A;  4DFK A;  3LYS A;  5KFA A;  2IOH A;  1NJY A;  3AEV A;  4ED7 A;  4Y2J A;  4UB5 A;  2FDR A;  4TQS A;  1L3U A;  4MF2 A;  3NVV A;  4DQQ A;  4P2H A;  3HRD D;  4MFF A;  3RJJ A;  3I1Y A;  3WK8 A;  1Z4O A;  4OJO A;  4Z6C A;  5KAF U;  4MFA A;  3AQE A;  5J0O A;  3T3F A;  1JMS A;  3SV3 A;  2P66 A;  5J0S A;  4IR9 A;  1FFU A;  1UT5 A;  3OTQ A;  2ASL A;  5ALU A;  1BPB A;  4NXZ A;  1DGS A;  1NK7 A;  2J6U A;  2RDJ A;  4O3S A;  1UQV A;  1JAL A;  4M9G A;  9ICU A;  7ICS A;  2FE9 A;  4ECW A;  1ZQX A;  3SAF A;  1SV0 C;  2HDO A;  4EBC A;  3H8W A;  3HW8 A;  4RQ4 A;  4UB6 U;  4PH5 A;  3OPX A;  5JU5 A;  2VIX A;  3WKB A;  1A0P A;  2WF6 A;  3RFA A;  3EUB 2;  4RZR A;  3PNC A;  2VJ4 A;  3TFS A;  4ED0 A;  2KIV A;  4RQ3 A;  1YZ6 A;  4KLU A;  4DO9 A;  2W03 A;  2KKV A;  5G5H A;  4EEN A;  4F8R A;  1N5W A;  4YMM A;  1UCV A;  3AUO A;  4DSI A;  4B9U A;  1ZQQ A;  3ORY A;  4DF4 A;  1U9L A;  2KZ3 A;  5KFG A;  5KT4 A;  4DQI A;  1U48 A;  4Q8F A;  3TAR A;  4F2R A;  1SB3 C;  3V6J A;  1SXE A;  2AGP A;  4DSL A;  4YN4 A;  9ICB A;  7ICR A;  1A77 A;  4F5N A;  2JEI A;  2HBM A;  5KTQ A;  5ALZ A;  3K1R B;  1L6N A;  1S0N A;  1B0X A;  5ALQ A;  5F9N A;  1KKX A;  2W7O A;  5J0T A;  5AHX A;  1ZQR A;  5T14 A;  4J9K A;  5DQI A;  3WU2 U;  1SKS A;  2W9M A;  1FEZ A;  7ICT A;  4C8N A;  1C20 A;  2WF9 A;  4ICA A;  5KFK A;  1IV8 A;  2HVH A;  4Q8E A;  5KT2 A;  7ICL A;  1L3T A;  2MAX A;  4O3O A;  4CNQ A;  7ICO A;  4QIW C;  2AU0 A;  5CJ7 A;  2Y1J A;  1ZD2 P;  4QZD A;  8ICA A;  3RJG A;  5ALW A;  4PJ0 U;  5KFL A;  3H0M B;  5AKL A;  2C2R A;  2BR0 A;  2DQN B;  4DL7 A;  5ALM A;  5ALH A;  1MN8 A;  2VA3 A;  1QSS A;  2XO7 A;  1L7N A;  2W54 A;  1RZT A;  1JN3 A;  5AIB A;  4O9M A;  2AXT U;  2HHQ A;  4RPZ A;  2YML A;  1V9P A;  3G6Y A;  1WWU A;  5ALP A;  2R8J A;  2GOL A;  4GXI A;  5DBC A;  3H0R B;  3BQ1 A;  5HNK A;  9ICV A;  4ED1 A;  3RJF A;  1X9X A;  3F53 A;  1QSL A;  3JPP A;  4UAW A;  4QW8 A;  3IP4 B;  1SWW A;  2ZTE A;  1IM4 A;  5H2F U;  4O0I A;  4AYB C;  1N63 A;  3D2N A;  1LV5 A;  4DL5 A;  4CF3 A;  4NWI A;  4KLH A;  4G9B A;  4M47 A;  3N7R C;  1TK0 A;  2CRX A;  2HVI A;  2YB4 A;  1ZOL A;  2G08 A;  1K1Q A;  1Z00 A;  4CF4 A;  5EE9 A;  1BPE A;  7ICH A;  2OM6 A;  2FMP A;  1RG6 A;  2UVU A;  1CEZ A;  1MA7 A;  9ICR A;  5AI0 A;  3H8S A;  1NK8 A;  1J97 A;  2WB1 C;  3FDS A;  5DLF A;  4J9O A;  5KNI A;  1MC8 A;  3GZF A;  3ZDE A;  2G5H B;  1HJP A;  2F1J A;  1J2M A;  4KX5 A;  5EE0 A;  3BS7 A;  3CW2 C;  4CGZ A;  5DQG A;  4O3P A;  5KFU A;  5ALT A;  5TZV A;  2JHD A;  1ZQJ A;  4OJP A;  4YQW A;  1LVH A;  2DKZ A;  2RRD A;  5KFZ A;  5KG6 A;  1XU4 A;  2ZIW B;  3UMB A;  3B9J A;  5ALJ A;  2BCV A;  1SZP A;  1Z3E B;  2QB0 A;  3NTU A;  3CP8 A;  3UMC A;  5J0Q A;  3F2C A;  3LWM A;  3C5F A;  1DK2 A;  2BHN A;  1B22 A;  1MQ3 A;  3D6J A;  3PO4 A;  2UVR A;  4QZC A;  3I28 A;  5D46 A;  2DL0 A;  4E0D A;  4F4W A;  3IRU A;  4Y2X A;  2ZIU B;  1TV9 A;  4ECS A;  1SIJ A;  4BJQ A;  2FPK A;  1Z19 A;  2ZJA A;  2GO7 A;  3OSN A;  1ARO P;  1FFV A;  3RJH A;  2WTF A;  3OHB A;  1SL2 A;  1S8O A;  4PPX A;  3PST A;  3G6V A;  2XGQ A;  4DFP A;  3AQF A;  5C5J A;  4DS4 A;  9ICI A;  2HHX A;  4C4T A;  4UB4 A;  3BS5 B;  1QTM A;  1Q3U A;  4UAU A;  8ICT A;  1L7M A;  1B43 A;  2PFQ A;  4EEY A;  3QUQ A;  1M6Y A;  2KIC A;  4F3O A;  2KSO A;  5HMM A;  5L1L A;  3K75 D;  4BX9 C;  4XA5 A;  1MQ2 A;  4M0A A;  7ICU A;  8ICM A;  4DSK A;  2OCE A;  4ELT A;  1RQL A;  1U49 A;  2QAR A;  4M6W B;  3UPQ A;  2BQR A;  4KLF A;  1DXS A;  3GQC A;  1RXW A;  4KLS A;  4F4K A;  2W9A A;  2MRL A;  4YG2 A;  4F4Y A;  5JUM A;  2FI1 A;  3DDH A;  4YCX A;  2E3T A;  5KFV A;  2G5I B;  4OCZ A;  3WK9 A;  8ICC A;  3O0F A;  1BPY A;  1TAQ A;  1YT3 A;  3RF9 A;  4FZM A;  2C22 A;  4I2B A;  2ES6 A;  1TKD A;  2W11 A;  3Q8M A; 
#chains in the Genus database with same CATH homology
 2H3V A;  1CRX A;  3LVV A;  2BDU A;  3OPX A;  4NV0 A;  2R18 A;  2VIX A;  2G07 A;  1A0P A;  3CP8 A;  3F2C A;  2E1F A;  2ZIW A;  4KX3 A;  3RFA A;  2Z7J A;  2ZIV A;  3IG5 A;  2DGZ A;  2KIW A;  4P0Q B;  4QNL A;  1ZQ1 C;  4CDG A;  2H3Q A;  2H3Z A;  3ALR A;  4BUG A;  2KV2 A;  1SZH A;  2VJ5 A;  2M0N A;  2A3V A;  2PMZ C;  2F8L A;  2VJ4 A;  2OXO A;  2K8C B;  3NRW A;  3DEE A;  3PSP A;  4QJF B;  4ACO A;  1HIW A;  3F2D A;  1IIP A;  2ZIU B;  2KJ8 A;  2GOL A;  3PSI A;  3H0R B;  4QIW F;  2ZXH A;  2KHQ A;  4PL1 A;  2WAQ F;  1T94 A;  2W03 A;  2XID A;  3F53 A;  3D2S A;  2H3F A;  3GU3 A;  2KKV A;  2LYA A;  3MGV A;  4BJQ A;  2OH2 A;  3IP4 B;  2MA1 A;  3F5A A;  4OJ6 A;  1PVR A;  1Z19 A;  2HMX A;  2KVC A;  3HKZ F;  3M6Z A;  2JH1 A;  3F5E A;  3M6K A;  4U7C A;  4IC9 A;  2K8A A;  4AYB C;  3D2N A;  4PL2 A;  3CRX A;  2KD1 A;  4O3M A;  3IG8 A;  3N7S C;  4C0Z A;  3D2Q A;  1F44 A;  3PST A;  3H0L B;  1D8B A;  2LBO A;  2NV3 A;  2XVT A;  2JMG A;  4NWI A;  3AQF A;  4P0P B;  4OO1 J;  1UPH A;  2K8B B;  4NLC A;  4JMU A;  2F77 X;  2HBL A;  3N7R C;  5C0Y A;  2ZG6 A;  4WJ3 B;  2XI9 A;  4OJ5 A;  1Q3U A;  3AL0 B;  2CRX A;  2KOB A;  1A6S A;  2ZIX A;  2YB4 A;  4U6P A;  2ZXI A;  1XO0 A;  2HOF A;  2PMZ F;  3F2B A;  2D6F C;  2G08 A;  3SAH A;  2LKY A;  2KJ5 A;  2KKP A;  4GFJ A;  2ZIX B;  2YB1 A;  3PZP A;  2JH7 A;  2OM6 A;  2HBM A;  3M7D A;  1URJ A;  2G06 A;  2KIC A;  3LVW A;  2W7P A;  4KMO B;  2E5S A;  1L6N A;  3HKZ C;  3KFU F;  5HR6 A;  3PSF A;  1WUD A;  2DF4 B;  2KNJ A;  2KJ9 A;  3LYS A;  3SMV A;  1MA7 A;  3IN5 A;  4CRX A;  2Y0S C;  2ZIV B;  1Z1B A;  2HBJ A;  4BX9 C;  2OYY A;  2W7O A;  5T14 A;  1PVQ A;  2H3I A;  2KHV A;  4P0Q A;  2HOQ A;  2Q4T A;  2WB1 C;  4FE3 A;  4FZL A;  2F76 X;  2CN1 A;  2N1R A;  4FZN A;  3ONN A;  2VKQ A;  4NLB A;  4OJO A;  3GZF A;  3C28 A;  3AQE A;  3CYM A;  5CRX A;  2HOI A;  2K4E A;  2LYB A;  1ED1 A;  2G5H B;  4AYB F;  1HEK A;  2HBK A;  4ICA A;  1PVP A;  4A8E A;  2G0A A;  5HR7 A;  2WAQ C;  5A0L A;  2GH1 A;  3K1Z A;  5KL8 B;  2MRL A;  2G09 A;  3VC8 A;  2XIC A;  4KX5 A;  1XNS A;  3L3F X;  2K4H A;  4P0P A;  2LHT A;  3KZX A;  3VCB A;  3T79 A;  3E0F A;  2G5I B;  1DRG A;  2RHF A;  5KL1 B;  2F2A B;  2JGA A;  2RP5 A;  4QIW C;  1TAM A;  1NZB A;  4CGZ A;  3NUQ A;  1ECW A;  2E1E A;  3SAG A;  2K89 A;  1Q3V A;  2W04 A;  3O0F A;  1OUQ A;  1YT3 A;  2WB1 F;  3SAF A;  3N7P D;  3RF9 A;  2K4I A;  3ICX A;  4FZM A;  3SQI A;  2JHD A;  2YX8 A;  4OJP A;  1P7D A;  3H0M B;  4OJL A;  1GO3 F;  2Y0S F;  1KBU A;  2KEY A;  2CPR A;  2RRD A;  2DQN B;  3C29 A;  2ZIW B;  2ZIU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...