2H3VA

Structure of the hiv-1 matrix protein bound to di-c8-phosphatidylinositol-(4,5)-bisphosphate
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
131
structure length
131
Chain Sequence
b'GARASVLSGGELDKWEKIRLRPGGKKQYKLKHIVWASRELERFAVNPGLLETSEGCRQILGQLQPSLQTGSEELRSLYNTIAVLYCVHQRIDVKDTKEALDKIEEEQNKSKKKAQQAAADTGNNSQVSQNY'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Gag polyprotein
publication title Structural basis for targeting HIV-1 Gag proteins to the plasma membrane for virus assembly.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Viral protein
total genus 33
structure length 131
sequence length 131
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2006-05-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00540 Gag_p17 gag gene protein p17 (matrix protein)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.90 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase; domain 1 2h3vA01
2K4HA 2H3FA 2JMGA 1HIWA 1L6NA 2LYAA 2K4EA 1TAMA 4IC9A 2HMXA 4ICAA 2H3IA 2K4IA 2NV3A 1ECWA 2H3QA 2H3ZA 1A6SA 2H3VA 1HEKA 4JMUA 2LYBA 1ED1A 2N1RA 2GOLA 1UPHA
chains in the Genus database with same CATH superfamily
4DS4A 3QYPA 3E0FA 4O9MA 4TQRA 4NLCA 4XUSA 4LJXA 1KLNA 4QZ9A 5DQGA 3NVVA 4QWCA 5AM0A 2LBOA 4LVSA 4DF8A 2J6UA 2WB1F 4K4GA 4ED6A 4AYBF 7ICMA 2FI1A 2EH9A 1FEZA 5ALJA 2JMGA 4DFMA 9ICVA 2D8CA 1TAMA 3QX7A 1URJA 4ECVA 3BS7A 1NK4A 4B9SA 4P0QB 8ICPA 2NRTA 1Q3UA 2JEFA 2Y0SC 4Z6EA 3DDHA 1NJXA 1M6YA 9ICLA 3Q8RB 5EE9A 4F4ZA 1NK5A 3UQ0A 1Z4NA 1NKEA 1QTMA 4M9LA 9ICPA 1SKWA 3H4BA 4O3NA 4PH5A 3TACB 2A3VA 4Y2RA 1ZXIA 3TADC 8ICOA 4F4YA 4KLOA 4GXJA 4KLJA 8ICXA 2YMLA 1U45A 1NK9A 4DQIA 3B9JA 3RAXA 1ED1A 3ORYA 4B9VA 2BDPA 4QZ8A 1LVHA 2KD1A 3PSPA 1Q46A 1X6JA 2EAPA 1C7YA 3MFIA 4CNQA 2HOQA 5AKKA 1ZQCA 2NV3A 2GH1A 2F77X 2BPGA 4GXKA 5JU5A 1MQ3A 4KLMA 1S77D 2VANA 3B0XA 2D6FC 4JWNA 2FPLA 3BZCA 1NKCA 5HR7A 4C8NA 1V97A 1OXJA 2W03A 2BCQA 2IOFK 5L1KA 2W55A 3WKEA 4PHDA 4F71A 1X9WA 5ALSA 3PSIA 1COKA 3GIMA 5TZVA 3C1ZA 5KFGA 5KG3A 4NV0A 4Q8FA 4DFDA 1N5XA 2GWSA 4IQVA 3KZXA 1V38A 4Y2JA 1SXEA 1ZQQA 5DQIA 3SYZA 3N97B 4ECXA 3AUOA 3TQ1A 5KFDA 5AM5A 3NVWA 5J0SA 4IR9A 1DK3A 1QQ6A 5IIOA 8ICBA 2BCSA 4YMMA 1T3NA 3MDCA 3N28A 2Y9TA 5KL8B 4ECSA 1D8LA 3ZDBA 1DGSA 4KLLA 4M6WA 3NVYA 2AHOB 2XVTA 2ZG6A 4MHVA 4P4PA 3PX0A 5KG7A 1UT5A 5KFXA 4F92B 4QZHA 4ECUA 3H8JA 1FFVA 3V7JA 8ICVA 5HMMA 2MAXA 1JIHA 2LKYA 4KN7A 5DQHA 2ZTCA 1TK0A 4RQNA 1S97A 4DF4A 3HKZC 2G07A 4M47A 4R8UA 3L3FX 3RJGA 5KT2A 5B5EU 7ICRA 2QLTA 1ZQOA 5ALWA 3BQ1A 7ICFA 3FAHA 2AQ0A 3H4DA 1QSLA 4Y2XA 8ICSA 2P6RA 5ALYA 5ALOA 9ICTA 4UBCA 5J29A 5DB9A 3K1ZA 4DL4A 1NJWA 2XCAA 3QU4A 3PR4A 1QCKA 2KHVA 5AM2A 5AKYA 4FBUA 3O0FA 1TE2A 2W9BA 2MA1A 1S5LU 2A1AA 1H38A 1D9FA 3OPXA 1VDVA 4P0PB 1KBUA 3DV9A 1T4GA 4DQPA 2JZBA 2QB1A 4QJFB 4C4RA 1SZPA 3Q8QB 3Q8SB 4FFDA 3SV3A 1J2MA 2F2AB 5CRXA 4ELUA 2JEIA 4QIWC 4PJ0U 1QQ7A 1T8EA 7ICIA 3UM9A 8ICYA 9ICRA 1S9FA 2MUTA 3ALRA 4NLNA 4KLQA 4KTQA 1F44A 4K4IA 2HVHA 7ICTA 2BHNA 4YR2A 4F72A 2UVWA 4MEYA 4FS2A 5HHIA 2Y1JA 2LYHA 5ALZA 3C21A 3D2NA 3M7DA 1SKRA 1HIWA 2A1JA 1X2IA 8ICIA 4PGYA 3ETRA 3TFSA 3OGUA 4R66A 3HW8A 8ICZA 5J2AA 1SV0C 4YR0A 5AI9A 1JXEA 3RR7A 2YX8A 5EWFA 4KLIA 2W9CA 1HEKA 2WF6A 1N61A 5KFOA 3SQIA 5F9LA 1D8BA 2YY6A 5AK5A 2F1IA 1ZQZA 2KFZA 2I5HA 2W9AA 1KFSA 3C28A 3JPOA 3PW4A 4ED0A 5DBAA 4ELVA 4P2HA 2CPRA 1BPYA 1ZYQA 2KIVA 1L3TA 3VC8A 1TK5A 3QEBZ 3PSTA 1U4BA 1Z1VA 1VJ5A 4YP3A 1JUDA 1L8LA 4RQMA 2F8KA 3QU7A 3SAFA 1N60A 2WTFA 4QWBA 7ICOA 4DSLA 4IRCA 1GO3F 3V7LA 3G6XA 2XGQA 1ZQLA 2QARA 1OW5A 2I6XA 4PHPA 3C5FA 4FBTA 1T7PA 1NK8A 1LKYA 1DRGA 4CDGA 1ZQGA 3QZ7A 4ELTA 3ZD8A 1AQ6A 1FO4A 1IIPA 4NLGA 3N7RC 2R18A 2H3FA 1KSPA 2UVUA 4ED2A 5KT6A 1ZQ1C 3HJEA 4DSFA 3RJIA 2QKQA 1N62A 3NRZA 3KKAC 2BDUA 2KEYA 2F3NA 5KFYA 4USAA 2DBYA 5DB6A 4TURA 3IN5A 1OUQA 3M8SA 5J0YA 2DUYA 2AGQA 1SV0A 3TI0A 2P35A 9ICCA 1DOQA 1L3UA 1NK7A 3NASA 2KZMA 5KFWA 3CNHA 3U26A 2ZXHA 4O3PA 3IP4B 3HWTA 1PK1B 1UQVA 2W7PA 2LM4A 4J9PA 3K4GA 2K4PA 4QZGA 2BR0A 9ICKA 2HBLA 1DXSA 2EQYA 4O0IA 2W43A 3JPNA 1N48A 4U6PA 5AKGA 3C2LA 2JR5A 4P4OA 2J6TA 3ETLA 1HUZA 4ED7A 2DKZA 1BPBA 2MSNA 5AHXA 3LWLA 4YMNA 4DL7A 1ZRMA 4Q45A 4BWMA 4BX9C 2E8OA 2FLPA 4XRHA 4B9UA 1PK3A 4ICAA 4YXMA 2QB0B 3RJFA 1ZQKA 3E2EA 2WAQC 5KFPA 5EE0A 3TANA 4P0QA 3RBDA 5DGBA 3HILA 4MF2A 4OO1J 4Y2UA 4M2YA 5KFHA 5KG2A 3UMBA 4J9RA 5CEHA 3GV5B 1UCVA 5CJ7A 1TV9A 2ESEA 5ALLA 9ICUA 4O3RA 2WFAA 2HOIA 3ZD9A 2A19A 2NRZA 4PZOA 3QEAZ 4UASA 1RYUA 2XICA 2Y1IA 1ZJNA 4C80A 4ECYA 5B66U 2IOHA 3IHQB 7ICEA 1PUZA 4PL1A 4DLEA 4JMUA 3F5EA 5C5JA 4C0ZA 4DSIA 2EAOA 2PMZC 1X42A 2OH2A 4I2BA 3WKCA 3J81j 2FLLA 1O03A 2NRVA 3I76A 5BOLA 2VA3A 8ICMA 4BJQA 2BPCA 3PMNA 5AKLA 1Q3VA 1TFRA 2IHNA 3WKBA 2HBMA 3EWAA 4KMUA 3L4PA 4ECTA 1JXLA 1ZQIA 3OJUA 2RLTA 2VA2A 1JRPA 3FDSA 1L6NA 5KFTA 4I27A 2BCVA 4KN4A 3TARA 4QNLA 3CYMA 2JHDA 2WB1C 1JI7A 2Z7JA 3I1YA 4AYBC 3RR8A 4F93B 2G08A 2OWOA 3RRGA 8ICJA 2ZXIA 2AQ4A 5H2FU 1ZRNA 5KFKA 2K8BB 1V9PA 2KKVA 2KJ5A 1ZD5A 5AM1A 5JUMA 9ICHA 1KL9A 5KFVA 3Q8LA 1X66A 4IRKA 1NK0A 2BGWA 7ICJA 1RDFA 2ISOA 4F8RA 5J0XA 3N7SC 1AROP 2B21A 1L8OA 2KVCA 2KP7A 4DSJA 1L7OA 2EAMA 8ICKA 3TKAA 5DB8A 4RUCA 8ICTA 4XA5A 4ED8A 2IOFA 4IRDA 1X9XA 2ZUCA 3PX4A 4DSEA 3F2CA 1ZQXA 2W8LA 1SL1A 1X9MA 3OSNA 3G6VA 9ICSA 3KOOA 1ZD4A 1ZQNA 2MU2A 2IA6A 4MFCA 1B43A 1RXWA 3T79A 4YG2A 4UB1A 1XSNA 4TUPA 3RH5A 4OCZA 2RDIA 2KJ9A 2J6SA 2YMPA 3HRDD 2EZXA 1Z1BA 3NTUA 5J0TA 2ISPA 8ICWA 9ICNA 4PHEA 5IIMA 3WK7A 2FE9A 4QWEA 4EELA 2V4QA 3N7PD 2LYBA 3SD7A 3EZ5A 3EW9A 5KFMA 3PW2A 5ALIA 3MC1A 5ALDA 4RQ5A 2CN1A 2FPMA 5J2HA 4O5EA 4GXIA 4P0PA 4R65A 1NJYA 9ICQA 3C5GA 4CF5A 1B0XA 5HMLA 4M9NA 4RQ7A 5ALKA 2G0AA 3GV8B 3CRXA 5KFFA 1S76D 1K5OA 1JX4A 5D46A 2P6UA 3B0YA 4QZAA 4DSKA 1X40A 2BCUA 4MEXA 4RNOA 5AK6A 3M9OB 3ZDAA 2OXOA 5KFUA 5KG5A 3JPTA 7ICKA 4DQSA 1SGGA 1U9LA 3CP8A 5KFAA 2ZJ8A 4Q44A 4R63A 4RQ6A 2BCRA 4M04A 4JV1A 3QUCA 3M9NB 5ALQA 3MR5A 2AH5A 3T5LA 3Q8MA 2HW3A 3H8SA 1KFTA 3LDAA 2ZIWB 4Y2VA 3PY8A 2ZIUB 4J9OA 3TADA 3EUB2 2JRZA 4C7YA 1WWUA 4PGXA 3GIJA 2IBKA 4RPYA 3ZI4A 2Y9UA 2W7OA 4KX5A 1RQLA 5KFQA 2FLNA 4FS1A 2GOLA 4O3MA 2CXYA 4ZH4A 1Z19A 5EOZA 2K4EA 8ICLA 2BZFA 1ZQHA 2PI5A 2G5IB 4RZRA 4UARA 3H0LB 3RAQA 5DGAA 2E8PA 5IIKA 4US9A 2GO7A 5A0LA 1Z3EB 5G5HA 5J2DA 3LK9A 5CA7A 3V6KA 1JMSA 5KFCA 4DFKA 4C4TA 2HCFA 2FMQA 2KFNA 2HHWA 1NJZA 7ICUA 1NI3A 3S6JA 4DQQA 2FMSA 8ICRA 5DBBA 3AMZA 1UT8A 3KHLA 2ZIVA 1RXVA 3AM9A 2P66A 1B22A 2XCPA 2FDRA 2K89A 4DS5A 4GLXA 1XU4A 1A77A 3MDAA 1WUDA 2G06A 3LVWA 2DFLA 5DB7A 1CI4A 4PHAA 5ALEA 5F3XB 4RNMA 3T5JA 2BPFA 1JN3A 5L1MA 9ICWA 2KK0A 1L7NA 4NM1A 1CRXA 5JTIA 1KN5A 4UAZA 4UAWA 2XY6A 7ICSA 5KFLA 2LI6A 1T94A 3UXOA 4FZNA 1NK6A 2KMDA 3WKDA 1UA0A 2LYAA 2ASDA 3MBYA 2K8CB 1D9DA 4DL2A 3BQ0A 1KRPA 2HSZA 9ICXA 1T3QA 4TUSA 4I28A 4CCHA 3OJSA 3JPRA 4RT2A 5L1IA 3I28A 3GV7B 3T5HA 4RQ4A 1NNLA 1KEJA 2PKEA 1BPEA 2W11A 4Y2SA 1IM4A 4IL6U 3GDXA 1P7DA 3H0MB 2O6KA 4M6WB 3VCBA 4I2CA 1TAUA 2F1JA 1EXNA 3RJHA 1UA1A 4I29A 2XGPA 4CF4A 1TAQA 5E79U 3UQ2A 2R8KA 4RQ3A 4ECRA 3D2QA 3EPGA 1JALA 2KJ8A 4IQTA 4G9BA 3Q8PB 1RYSA 2RQ5A 3BDPA 2CRXA 3A0BU 3ZDDA 5HP4A 5AKZA 2HBKA 4C8MA 2LMRA 5TISU 3RH6A 5BPCA 1XSLA 5CB1A 2PFOA 1PVPA 2NYVA 4E0DA 4KLHA 1NOMA 2LPEA 3AQFA 5J0WA 1LB2B 3EPIA 2H3IA 3IM1A 2JEGA 2HHVA 4LZGA 4UBBA 4DOBA 4UB8U 4QZBA 2EZZA 1U49A 1SV4A 5ALGA 2DQNB 4OJ5A 5AI6A 2OCEA 2AJQA 4UB4A 5D4BA 3KD3A 3NUQA 2ZJ5A 1MQ2A 3SAHA 4C8KA 5AK3A 1XO1A 2ODGA 4PZNA 4QZCA 2JV3A 4C8OA 2YQEA 1X6IA 1ZQRA 4ECWA 3QUTA 4UAYA 3AEVA 2B0CA 7ICGA 1F0MA 2HHXA 2N1RA 3SZ2A 4UQGA 1HJPA 4EENA 5DLFA 5D49A 1RYRA 4YN4A 4UW9A 5KFIA 9ICOA 3M9MB 2W9MA 4B9LA 1A76A 2HMXA 3BQ7A 3WK9A 4YFKA 4JK1A 3D2SA 3UMCA 4YD1A 1U48A 3BZKA 2C2EA 2PFPA 3KBBA 4RQ1A 1WYGA 3PVXA 1ZD2P 1J97A 3WK4A 4OJ6A 3GIKA 4Y2QA 1BVSA 2KE7A 5KTQA 4FZMA 1BPDA 5K4LA 2KNJA 3MR6A 1PVRA 3KHGA 1K1QA 2F76X 3AU2A 4NL9C 3RTVA 5AM3A 2MRLA 5KNIA 3TAPA 3KZIU 2JEJA 1TVAA 5KFRA 4BUGA 1ZJMA 5IINA 2HHSA 1Q8KA 2GLEA 2XIDA 3QU9A 2PI4A 2DPJA 1S10A 1ECWA 4YMOA 4YD2A 2JH1A 5AKIA 2EANA 4UAVA 4IR1A 5AKHA 3GFKB 3ICXA 2DWQA 8ICGA 3FM9A 3PNCA 2I9GA 1QLNA 4NWIA 8ICEA 2PXIA 1N5WA 4NLZA 4ACOA 4F5NA 2K60A 4TUQA 5J0UA 3LWMA 4EEYA 9ICMA 3N4MB 2C2DA 2F1HA 2FJ6A 1D8YA 1JROA 4HAIA 2ZUDA 3KKAA 2OM6A 1BNPA 4Z6FA 3AU6A 4EX6A 4DFJA 2AU0A 4Q43A 5L1LA 4OJOA 3NS1A 3OTQA 1RQNA 3Q8KA 4DFPA 2BQ3A 3C1YA 3ONNA 4KX3A 5J0QA 2KSOB 2DF4B 3C29A 5AI4A 3D6JA 1VLBA 2WF9A 3PZPA 3SAGA 7ICNA 2DL0A 3WU2U 1N56A 8ICHA 4QW8A 4F5PA 1MC8A 2H3VA 3KTQA 7ICHA 4Y2YA 4IQWA 3BS5B 1ZOLA 3ISDA 1WWVA 4YCXA 3K75D 3F5AA 5AKJA 1V85A 3PW5A 9ICBA 2PFQA 2ZIXB 3T3FA 2KZZA 5KG1A 8ICCA 2FPKA 1BNOA 5AI0A 3QZ8A 3F2DA 1L3VA 4DOCA 1ZQWA 3DEEA 1IG6A 3H7IA 5AK4A 5ALVA 2M9NA 2JH7A 5EE1A 8ICUA 5J0PA 5CWRA 7ICLA 2ALZA 3M6ZA 4EBDA 2B6GA 5KT7A 5J2FA 3MGHA 2UVRA 3RRHA 3ZDEA 4I2GA 5KAIU 1BPXA 5IILA 5KFZA 4QWAA 3CW2C 1LV5A 3C2KA 1ZQDA 2XC9A 3SV4A 5J2JA 4J9LA 2Q4TA 5AM4A 5L9XA 4KLEA 2F8LA 2BQRA 9ICEA 1XC9A 1Z00B 4J9KA 2ZIWA 4CGZA 3RB4A 2ZIUA 3F53A 4DL3A 4NJ8A 1B4FA 3PW0A 2KHQA 2YMQA 2V4RA 1WCLA 9ICGA 1WCNA 1RG6A 2XO7A 2DGZA 4EYIB 4NLKA 2W54A 3LVVA 4O5CA 1J2NA 2VJ4A 5BOMA 4F4XA 1ZQEA 4UB6U 4ECZA 2ASLA 5HR6A 4O5KA 4OJLA 2DPIA 1ZQPA 3MFHA 3GZFA 2OYYA 2PFNA 2KICA 3PR5B 4RPZA 4M0AA 2Y0SF 3GIIA 2V9WA 5J0RA 2Q0ZX 1ZQJA 9ICJA 2G09A 3ZDCA 3JPQA 3AN1A 5CR0A 5ALTA 2H5XA 5KG0A 3SI8A 2I1QA 4IC9A 3G6YA 5IIJA 4J9QA 3WKAA 4C4SA 1ZQTA 2ZJAA 3V6JA 3LYSA 3KHHA 4YXJA 3FYHA 4G3IA 4EEKA 3THVA 4GIBA 4BXOB 4JV2A 3RBEA 4JV0A 5AI5A 1KW4A 1MN8A 4EYHB 3KHRA 4IS7A 4F4KA 2KN7A 4NXZA 4RNNA 5AIBA 1ZQAA 4KLTA 1ZETA 1FFUA 4DCCA 2K4HA 1S0MA 2ATLA 5L1JA 2D3DA 1S0NA 5F9NA 2W3SA 2ZTDA 3V72A 3SR6A 1F5SA 5ALPA 3C23A 4F5RA 3IG8A 1U47A 3RFAA 3M8RA 2ASJA 2KVSA 2L5YA 4YVZA 1SXDA 1MA7A 1XWLA 2E1EA 4EBCA 5J2BA 2HHTA 5KFNA 4BGDA 5ALFA 4EBEA 1KKXA 4DO9A 2C28A 5EWEA 1CUKA 1ZQYA 4GFJA 4JUZA 2NRXA 3QNMA 4ED3A 3E58A 4RUAA 1NKBA 5AIAA 1DK2A 3RB0A 2WF5A 1XO0A 4DEZA 3FC4A 1C20A 3H0RB 4MFFA 4UAUA 5KT5A 4EX7A 3HP6A 4RU9A 4I2HA 5DDMA 4UB2A 3K1RB 4MFAA 4ED1A 4FZLA 5DKWA 1KTQA 1KDHA 3H8WA 1X9SA 1L7MA 3RJJA 1L3SA 4M9GA 3MABA 4F5QA 3RF9A 7ICPA 2OHFA 3C2MA 3HKZF 3PSFA 3NVZA 5IIIA 8ICNA 2RHFA 3UXPA 4J03A 1IV8A 3ISCA 1HUOA 1CEZA 3PW7A 2EDUA 1WG8A 2E3TA 4FE3A 2RDJA 8ICFA 3PX6A 3QUBA 3SENA 4DL6A 3QE9Y 5CHGA 3PO5A 2W8KA 3L5KA 4F2RA 3JPSA 3OHAA 5JRTA 1L5UA 1S8OA 3GILA 5KL1B 4C8LA 5T14A 4LZDA 2G5HB 3IDWA 4QZDA 2JXJA 4JB3A 4J9MA 4KLFA 5KT4A 5J2IA 4B9TA 2JGAA 3JPPA 2E8NA 4F4WA 2KOBA 5J0OA 2OEHA 5GTIU 5DG9A 3BQ2A 2M0NA 8ICQA 1BPZA 4ZOHC 1SIJA 4X5VA 1MSWD 3ED5A 2W04A 4P4MA 1PK1A 5DLGA 4U7CA 3RH4A 5KG4A 2VIXA 5AICA 4YQWA 4QIWF 5J2KA 2K4IA 4J9NA 5KAFU 2R8IA 4DWIA 4UATA 9ICIA 3V7KA 3HX0A 3M6KA 4QW9A 4CE6A 5GTHU 1N2XA 4CF3A 3TFRA 2XY7A 4F2SA 1KFDA 2K8AA 4OD0A 4BDPA 1ZQVA 8ICAA 1ZQSA 7ICVA 4NLBA 4IQUA 3IG5A 2NO5A 1FIQA 4BWJA 1UHUA 1ZQBA 4DLGA 4R8UB 2YB4A 3UXNA 1A6SA 1NZBA 2QB0A 3QU5A 3WK6A 4OJPA 4Y2TA 4KLDA 4NM2A 5CP2A 3ISBA 4I2AA 2YTUA 4KLUA 4I2DA 2AGPA 4F3OA 2UVVA 4Z6DA 2E8MA 5J8YC 1PZNA 3QUQA 2HOFA 3SMVA 5ALHA 2WF8A 1SL2A 4I2FA 1YZ7A 5KFEA 1K1SA 4K4HA 5KFJA 4KMOB 1L7PA 5AKEA 5ALMA 4Q8EA 2HDOA 3WK8A 1UPHA 9ICAA 4QZFA 4XQ8A 4PPXA 5EE3A 2HBJA 2FMPA 2RRDA 2XY5A 2KG5A 2KSOA 3GQCA 1DGJA 3MGIA 4I2EA 1RM6C 3H8MA 2KKPA 2ZIVB 5EWGA 5ALXA 2W9BB 3OSPA 5C0YA 1RZTA 4RQ2A 2IHMA 1YZ6A 9ICFA 2JZBB 4A8EA 5HNKA 3RB3A 1ZD3A 3KFUF 3BS5A 2YMMA 2KZ3A 3RJKA 2ZUBA 5KT3A 2VJ5A 4KLSA 1KQQA 1A0PA 4KLGA 3M1YA 5DBCA 1TKDA 3IV6A 2ZIXA 3EYZA 3NRWA 2AXTU 4QWDA 1QH9A 4M9HA 2MUTB 1Y88A 3IRUA 3QXGA 4WJ3B 2KV2A 4DQRA 2BKEA 1SKSA 5AI8A 4YR3A 3NGDA 1PVQA 3AL0B 5DG8A 4I2IA 2H3ZA 5ALRA 3PO4A 1XS9D 3RJEA 1TK8A 5KFSA 4GC7A 2A1JB 4PL2A 4RPXA 1QSYA 3GU3A 2W3RA 4US8A 4NY8A 5J8YA 3MR3A 4DL5A 3HPOA 1XSPA 4M9JA 4F5OA 1S0VA 3UPQA 2KTQA 2R8GA 2W9CB 4CRXA 1Z00A 5ALNA 1QSSA 1SWWA 4B9NA 4AP9A 4Z6CA 4HYKA 4C7ZA 1O08A 3SEIA 5DG7A 4JWMA 1SZHA 2VKQA 2XI9A 2YN4A 2ES6A 7ICQA 4Y2PA 1BGXT 2RP5A 5DDYA 4RQ8A 5ALUA 2IMWP 1YT3A 4RQ0A 4O3SA 2DKXA 4F91B 3UMGA 2HHUA 4RT3A 1N63A 2WAQF 4QZEA 2LM1A 4UB3A 2KIWA 3T5KA 3F2BA 4F50A 2C22A 2QARB 5J2EA 4DOAA 3MR2A 5AKXA 4GC6A 5FP0A 1LKYB 2R8JA 4O3OA 3MGVA 2HI0A 2H3QA 2E1FA 1SB3C 4KITB 4TQSA 5KFBA 4QZIA 4R64A 2NO4A 2EZYA 3WK5A 3V6HA 3BJYA 2E5SA 2BQUA 4PGQA 2HHQA 1NZPA 4MF8A 4UB5A 4B6JA 3RB6A 4NL9A 4BXOA 5HHHA 3TAQA 4O3QA 3R9KA 4FO6A 3PMLA 4B9MA 4EZ6A 1RPLA 1ZQUA 2WF7A 1Z4OA 2WHEA 1S0OA 2VA8A 2YB1A 3A0HU 2AGOA 2HVIA 3QU2A 3H40A 1ZQFA 5J2GA 1SWVA 2PMZF 1XNSA 1SL0A 1ZQMA 3BQTA 2NRWA 5KG6A 3AQEA 3PV8A 2LHTA 1IXRA 5G5GA 2R8HA 4J9SA 1QQ5A 4I2JA 4EZ9A 2F44A 2ZTEA 2C2RA 4ECQA 5J2CA 3OHBA 3HT3A 1COOA
chains in the Genus database with same CATH topology
1SZHA 2PMZC 2VJ4A 3E0FA 3C28A 2VKQA 2OH2A 2DF4B 2KJ9A 2XI9A 3C29A 1Z19A 2HBLA 2CPRA 1Z1BA 2HBJA 2K4EA 3PSIA 4NLCA 2RRDA 3K1ZA 3PZPA 2RP5A 5HR6A 2HMXA 2JGAA 4OJLA 4NV0A 3VC8A 2G5IB 3SAGA 1YT3A 4U6PA 2KOBA 2KKPA 2ZIVB 3GZFA 2OYYA 2LBOA 5C0YA 2KHVA 1P7DA 3D2SA 3PSTA 4BJQA 2WB1F 3KZXA 3H0LB 3H0MB 4GFJA 2KICA 1Q3VA 4AYBF 3O0FA 3VCBA 2H3VA 2M0NA 2HBMA 2Y0SF 3N7PD 2WAQF 2MA1A 2LYBA 3SAFA 2KIWA 5A0LA 4OJ6A 2G09A 3F2BA 1XO0A 2W04A 4A8EA 3OPXA 2JMGA 4P0PB 3F5AA 3D2QA 1KBUA 3H0RB 4BX9C 3KFUF 4U7CA 4FZMA 1L6NA 1GO3F 2VIXA 2CN1A 2KNJA 2JHDA 2KJ8A 3CYMA 4QNLA 4QIWF 1PVRA 1TAMA 2WB1C 4IC9A 2Z7JA 1MA7A 2F76X 1URJA 4ICAA 4P0PA 3MGVA 2ZIXB 2VJ5A 2K4IA 4AYBC 4QJFB 4P0QB 1Q3UA 1A0PA 2Y0SC 2H3QA 2CRXA 2E1FA 2WAQC 2G08A 4FZLA 1DRGA 2ZXIA 4CDGA 5KL8B 2ZIXA 3F2DA 2MRLA 2HBKA 3M6KA 4P0QA 3NRWA 2K8BB 2ZIVA 3DEEA 2KKVA 2G0AA 2KJ5A 3CRXA 3LYSA 2K89A 2F2AB 5CRXA 2K8AA 2JH7A 1IIPA 3RF9A 4QIWC 1PVPA 3N7RC 4OO1J 2R18A 2H3FA 2XVTA 1WUDA 2E5SA 2G06A 3LVWA 4BUGA 2ZG6A 3AQFA 3HKZF 3PSFA 4WJ3B 1ZQ1C 2KV2A 3ALRA 4NLBA 3M6ZA 2OXOA 3IG5A 4C0ZA 2A3VA 2XIDA 1F44A 2H3IA 2RHFA 3AL0B 1PVQA 3CP8A 1ECWA 2BDUA 2KEYA 2JH1A 2H3ZA 3N7SC 2HOIA 1CRXA 2YB4A 1A6SA 2LKYA 2DQNB 2KVCA 3ICXA 1NZBA 4OJ5A 4NWIA 3IN5A 3HKZC 2G07A 4OJPA 1ED1A 4PL2A 1OUQA 4ACOA 3GU3A 4KX3A 2Q4TA 3NUQA 1T94A 2ZIWB 2F8LA 2K4HA 3D2NA 3M7DA 4FE3A 4FZNA 2YB1A 2KD1A 2ZIUB 3PSPA 2XICA 3F2CA 1HIWA 3L3FX 3SAHA 2LYAA 2ZIWA 4CGZA 2K8CB 2HOQA 2OM6A 2PMZF 2ZIUA 1XNSA 4CRXA 2NV3A 3F53A 2GH1A 2F77X 3AQEA 2HOFA 3SMVA 2LHTA 2ZXHA 4OJOA 2KHQA 3IG8A 5KL1B 3IP4B 2YX8A 2D6FC 5T14A 3RFAA 3T79A 1HEKA 4PL1A 2W7OA 4KX5A 4KMOB 3SQIA 4JMUA 5HR7A 2W7PA 2DGZA 2G5HB 3F5EA 1D8BA 2W03A 3ONNA 2N1RA 2GOLA 4O3MA 1UPHA 2E1EA 3LVVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2K4H A;  2H3F A;  2JMG A;  1HIW A;  1L6N A;  2LYA A;  2K4E A;  1TAM A;  4IC9 A;  2HMX A;  4ICA A;  2H3I A;  2K4I A;  2NV3 A;  1ECW A;  2H3Q A;  2H3Z A;  1A6S A;  2H3V A;  1HEK A;  4JMU A;  2LYB A;  1ED1 A;  2N1R A;  2GOL A;  1UPH A; 
#chains in the Genus database with same CATH topology
 4DS4 A;  3QYP A;  3E0F A;  4O9M A;  4TQR A;  4NLC A;  4XUS A;  4LJX A;  1KLN A;  4QZ9 A;  5DQG A;  3NVV A;  4QWC A;  5AM0 A;  2LBO A;  4LVS A;  4DF8 A;  2J6U A;  2WB1 F;  4K4G A;  4ED6 A;  4AYB F;  7ICM A;  2FI1 A;  2EH9 A;  1FEZ A;  5ALJ A;  2JMG A;  4DFM A;  9ICV A;  2D8C A;  1TAM A;  3QX7 A;  1URJ A;  4ECV A;  3BS7 A;  1NK4 A;  4B9S A;  4P0Q B;  8ICP A;  2NRT A;  1Q3U A;  2JEF A;  2Y0S C;  4Z6E A;  3DDH A;  1NJX A;  1M6Y A;  9ICL A;  3Q8R B;  5EE9 A;  4F4Z A;  1NK5 A;  3UQ0 A;  1Z4N A;  1NKE A;  1QTM A;  4M9L A;  9ICP A;  1SKW A;  3H4B A;  4O3N A;  4PH5 A;  3TAC B;  2A3V A;  4Y2R A;  1ZXI A;  3TAD C;  8ICO A;  4F4Y A;  4KLO A;  4GXJ A;  4KLJ A;  8ICX A;  2YML A;  1U45 A;  1NK9 A;  4DQI A;  3B9J A;  3RAX A;  1ED1 A;  3ORY A;  4B9V A;  2BDP A;  4QZ8 A;  1LVH A;  2KD1 A;  3PSP A;  1Q46 A;  1X6J A;  2EAP A;  1C7Y A;  3MFI A;  4CNQ A;  2HOQ A;  5AKK A;  1ZQC A;  2NV3 A;  2GH1 A;  2F77 X;  2BPG A;  4GXK A;  5JU5 A;  1MQ3 A;  4KLM A;  1S77 D;  2VAN A;  3B0X A;  2D6F C;  4JWN A;  2FPL A;  3BZC A;  1NKC A;  5HR7 A;  4C8N A;  1V97 A;  1OXJ A;  2W03 A;  2BCQ A;  2IOF K;  5L1K A;  2W55 A;  3WKE A;  4PHD A;  4F71 A;  1X9W A;  5ALS A;  3PSI A;  1COK A;  3GIM A;  5TZV A;  3C1Z A;  5KFG A;  5KG3 A;  4NV0 A;  4Q8F A;  4DFD A;  1N5X A;  2GWS A;  4IQV A;  3KZX A;  1V38 A;  4Y2J A;  1SXE A;  1ZQQ A;  5DQI A;  3SYZ A;  3N97 B;  4ECX A;  3AUO A;  3TQ1 A;  5KFD A;  5AM5 A;  3NVW A;  5J0S A;  4IR9 A;  1DK3 A;  1QQ6 A;  5IIO A;  8ICB A;  2BCS A;  4YMM A;  1T3N A;  3MDC A;  3N28 A;  2Y9T A;  5KL8 B;  4ECS A;  1D8L A;  3ZDB A;  1DGS A;  4KLL A;  4M6W A;  3NVY A;  2AHO B;  2XVT A;  2ZG6 A;  4MHV A;  4P4P A;  3PX0 A;  5KG7 A;  1UT5 A;  5KFX A;  4F92 B;  4QZH A;  4ECU A;  3H8J A;  1FFV A;  3V7J A;  8ICV A;  5HMM A;  2MAX A;  1JIH A;  2LKY A;  4KN7 A;  5DQH A;  2ZTC A;  1TK0 A;  4RQN A;  1S97 A;  4DF4 A;  3HKZ C;  2G07 A;  4M47 A;  4R8U A;  3L3F X;  3RJG A;  5KT2 A;  5B5E U;  7ICR A;  2QLT A;  1ZQO A;  5ALW A;  3BQ1 A;  7ICF A;  3FAH A;  2AQ0 A;  3H4D A;  1QSL A;  4Y2X A;  8ICS A;  2P6R A;  5ALY A;  5ALO A;  9ICT A;  4UBC A;  5J29 A;  5DB9 A;  3K1Z A;  4DL4 A;  1NJW A;  2XCA A;  3QU4 A;  3PR4 A;  1QCK A;  2KHV A;  5AM2 A;  5AKY A;  4FBU A;  3O0F A;  1TE2 A;  2W9B A;  2MA1 A;  1S5L U;  2A1A A;  1H38 A;  1D9F A;  3OPX A;  1VDV A;  4P0P B;  1KBU A;  3DV9 A;  1T4G A;  4DQP A;  2JZB A;  2QB1 A;  4QJF B;  4C4R A;  1SZP A;  3Q8Q B;  3Q8S B;  4FFD A;  3SV3 A;  1J2M A;  2F2A B;  5CRX A;  4ELU A;  2JEI A;  4QIW C;  4PJ0 U;  1QQ7 A;  1T8E A;  7ICI A;  3UM9 A;  8ICY A;  9ICR A;  1S9F A;  2MUT A;  3ALR A;  4NLN A;  4KLQ A;  4KTQ A;  1F44 A;  4K4I A;  2HVH A;  7ICT A;  2BHN A;  4YR2 A;  4F72 A;  2UVW A;  4MEY A;  4FS2 A;  5HHI A;  2Y1J A;  2LYH A;  5ALZ A;  3C21 A;  3D2N A;  3M7D A;  1SKR A;  1HIW A;  2A1J A;  1X2I A;  8ICI A;  4PGY A;  3ETR A;  3TFS A;  3OGU A;  4R66 A;  3HW8 A;  8ICZ A;  5J2A A;  1SV0 C;  4YR0 A;  5AI9 A;  1JXE A;  3RR7 A;  2YX8 A;  5EWF A;  4KLI A;  2W9C A;  1HEK A;  2WF6 A;  1N61 A;  5KFO A;  3SQI A;  5F9L A;  1D8B A;  2YY6 A;  5AK5 A;  2F1I A;  1ZQZ A;  2KFZ A;  2I5H A;  2W9A A;  1KFS A;  3C28 A;  3JPO A;  3PW4 A;  4ED0 A;  5DBA A;  4ELV A;  4P2H A;  2CPR A;  1BPY A;  1ZYQ A;  2KIV A;  1L3T A;  3VC8 A;  1TK5 A;  3QEB Z;  3PST A;  1U4B A;  1Z1V A;  1VJ5 A;  4YP3 A;  1JUD A;  1L8L A;  4RQM A;  2F8K A;  3QU7 A;  3SAF A;  1N60 A;  2WTF A;  4QWB A;  7ICO A;  4DSL A;  4IRC A;  1GO3 F;  3V7L A;  3G6X A;  2XGQ A;  1ZQL A;  2QAR A;  1OW5 A;  2I6X A;  4PHP A;  3C5F A;  4FBT A;  1T7P A;  1NK8 A;  1LKY A;  1DRG A;  4CDG A;  1ZQG A;  3QZ7 A;  4ELT A;  3ZD8 A;  1AQ6 A;  1FO4 A;  1IIP A;  4NLG A;  3N7R C;  2R18 A;  2H3F A;  1KSP A;  2UVU A;  4ED2 A;  5KT6 A;  1ZQ1 C;  3HJE A;  4DSF A;  3RJI A;  2QKQ A;  1N62 A;  3NRZ A;  3KKA C;  2BDU A;  2KEY A;  2F3N A;  5KFY A;  4USA A;  2DBY A;  5DB6 A;  4TUR A;  3IN5 A;  1OUQ A;  3M8S A;  5J0Y A;  2DUY A;  2AGQ A;  1SV0 A;  3TI0 A;  2P35 A;  9ICC A;  1DOQ A;  1L3U A;  1NK7 A;  3NAS A;  2KZM A;  5KFW A;  3CNH A;  3U26 A;  2ZXH A;  4O3P A;  3IP4 B;  3HWT A;  1PK1 B;  1UQV A;  2W7P A;  2LM4 A;  4J9P A;  3K4G A;  2K4P A;  4QZG A;  2BR0 A;  9ICK A;  2HBL A;  1DXS A;  2EQY A;  4O0I A;  2W43 A;  3JPN A;  1N48 A;  4U6P A;  5AKG A;  3C2L A;  2JR5 A;  4P4O A;  2J6T A;  3ETL A;  1HUZ A;  4ED7 A;  2DKZ A;  1BPB A;  2MSN A;  5AHX A;  3LWL A;  4YMN A;  4DL7 A;  1ZRM A;  4Q45 A;  4BWM A;  4BX9 C;  2E8O A;  2FLP A;  4XRH A;  4B9U A;  1PK3 A;  4ICA A;  4YXM A;  2QB0 B;  3RJF A;  1ZQK A;  3E2E A;  2WAQ C;  5KFP A;  5EE0 A;  3TAN A;  4P0Q A;  3RBD A;  5DGB A;  3HIL A;  4MF2 A;  4OO1 J;  4Y2U A;  4M2Y A;  5KFH A;  5KG2 A;  3UMB A;  4J9R A;  5CEH A;  3GV5 B;  1UCV A;  5CJ7 A;  1TV9 A;  2ESE A;  5ALL A;  9ICU A;  4O3R A;  2WFA A;  2HOI A;  3ZD9 A;  2A19 A;  2NRZ A;  4PZO A;  3QEA Z;  4UAS A;  1RYU A;  2XIC A;  2Y1I A;  1ZJN A;  4C80 A;  4ECY A;  5B66 U;  2IOH A;  3IHQ B;  7ICE A;  1PUZ A;  4PL1 A;  4DLE A;  4JMU A;  3F5E A;  5C5J A;  4C0Z A;  4DSI A;  2EAO A;  2PMZ C;  1X42 A;  2OH2 A;  4I2B A;  3WKC A;  3J81 j;  2FLL A;  1O03 A;  2NRV A;  3I76 A;  5BOL A;  2VA3 A;  8ICM A;  4BJQ A;  2BPC A;  3PMN A;  5AKL A;  1Q3V A;  1TFR A;  2IHN A;  3WKB A;  2HBM A;  3EWA A;  4KMU A;  3L4P A;  4ECT A;  1JXL A;  1ZQI A;  3OJU A;  2RLT A;  2VA2 A;  1JRP A;  3FDS A;  1L6N A;  5KFT A;  4I27 A;  2BCV A;  4KN4 A;  3TAR A;  4QNL A;  3CYM A;  2JHD A;  2WB1 C;  1JI7 A;  2Z7J A;  3I1Y A;  4AYB C;  3RR8 A;  4F93 B;  2G08 A;  2OWO A;  3RRG A;  8ICJ A;  2ZXI A;  2AQ4 A;  5H2F U;  1ZRN A;  5KFK A;  2K8B B;  1V9P A;  2KKV A;  2KJ5 A;  1ZD5 A;  5AM1 A;  5JUM A;  9ICH A;  1KL9 A;  5KFV A;  3Q8L A;  1X66 A;  4IRK A;  1NK0 A;  2BGW A;  7ICJ A;  1RDF A;  2ISO A;  4F8R A;  5J0X A;  3N7S C;  1ARO P;  2B21 A;  1L8O A;  2KVC A;  2KP7 A;  4DSJ A;  1L7O A;  2EAM A;  8ICK A;  3TKA A;  5DB8 A;  4RUC A;  8ICT A;  4XA5 A;  4ED8 A;  2IOF A;  4IRD A;  1X9X A;  2ZUC A;  3PX4 A;  4DSE A;  3F2C A;  1ZQX A;  2W8L A;  1SL1 A;  1X9M A;  3OSN A;  3G6V A;  9ICS A;  3KOO A;  1ZD4 A;  1ZQN A;  2MU2 A;  2IA6 A;  4MFC A;  1B43 A;  1RXW A;  3T79 A;  4YG2 A;  4UB1 A;  1XSN A;  4TUP A;  3RH5 A;  4OCZ A;  2RDI A;  2KJ9 A;  2J6S A;  2YMP A;  3HRD D;  2EZX A;  1Z1B A;  3NTU A;  5J0T A;  2ISP A;  8ICW A;  9ICN A;  4PHE A;  5IIM A;  3WK7 A;  2FE9 A;  4QWE A;  4EEL A;  2V4Q A;  3N7P D;  2LYB A;  3SD7 A;  3EZ5 A;  3EW9 A;  5KFM A;  3PW2 A;  5ALI A;  3MC1 A;  5ALD A;  4RQ5 A;  2CN1 A;  2FPM A;  5J2H A;  4O5E A;  4GXI A;  4P0P A;  4R65 A;  1NJY A;  9ICQ A;  3C5G A;  4CF5 A;  1B0X A;  5HML A;  4M9N A;  4RQ7 A;  5ALK A;  2G0A A;  3GV8 B;  3CRX A;  5KFF A;  1S76 D;  1K5O A;  1JX4 A;  5D46 A;  2P6U A;  3B0Y A;  4QZA A;  4DSK A;  1X40 A;  2BCU A;  4MEX A;  4RNO A;  5AK6 A;  3M9O B;  3ZDA A;  2OXO A;  5KFU A;  5KG5 A;  3JPT A;  7ICK A;  4DQS A;  1SGG A;  1U9L A;  3CP8 A;  5KFA A;  2ZJ8 A;  4Q44 A;  4R63 A;  4RQ6 A;  2BCR A;  4M04 A;  4JV1 A;  3QUC A;  3M9N B;  5ALQ A;  3MR5 A;  2AH5 A;  3T5L A;  3Q8M A;  2HW3 A;  3H8S A;  1KFT A;  3LDA A;  2ZIW B;  4Y2V A;  3PY8 A;  2ZIU B;  4J9O A;  3TAD A;  3EUB 2;  2JRZ A;  4C7Y A;  1WWU A;  4PGX A;  3GIJ A;  2IBK A;  4RPY A;  3ZI4 A;  2Y9U A;  2W7O A;  4KX5 A;  1RQL A;  5KFQ A;  2FLN A;  4FS1 A;  2GOL A;  4O3M A;  2CXY A;  4ZH4 A;  1Z19 A;  5EOZ A;  2K4E A;  8ICL A;  2BZF A;  1ZQH A;  2PI5 A;  2G5I B;  4RZR A;  4UAR A;  3H0L B;  3RAQ A;  5DGA A;  2E8P A;  5IIK A;  4US9 A;  2GO7 A;  5A0L A;  1Z3E B;  5G5H A;  5J2D A;  3LK9 A;  5CA7 A;  3V6K A;  1JMS A;  5KFC A;  4DFK A;  4C4T A;  2HCF A;  2FMQ A;  2KFN A;  2HHW A;  1NJZ A;  7ICU A;  1NI3 A;  3S6J A;  4DQQ A;  2FMS A;  8ICR A;  5DBB A;  3AMZ A;  1UT8 A;  3KHL A;  2ZIV A;  1RXV A;  3AM9 A;  2P66 A;  1B22 A;  2XCP A;  2FDR A;  2K89 A;  4DS5 A;  4GLX A;  1XU4 A;  1A77 A;  3MDA A;  1WUD A;  2G06 A;  3LVW A;  2DFL A;  5DB7 A;  1CI4 A;  4PHA A;  5ALE A;  5F3X B;  4RNM A;  3T5J A;  2BPF A;  1JN3 A;  5L1M A;  9ICW A;  2KK0 A;  1L7N A;  4NM1 A;  1CRX A;  5JTI A;  1KN5 A;  4UAZ A;  4UAW A;  2XY6 A;  7ICS A;  5KFL A;  2LI6 A;  1T94 A;  3UXO A;  4FZN A;  1NK6 A;  2KMD A;  3WKD A;  1UA0 A;  2LYA A;  2ASD A;  3MBY A;  2K8C B;  1D9D A;  4DL2 A;  3BQ0 A;  1KRP A;  2HSZ A;  9ICX A;  1T3Q A;  4TUS A;  4I28 A;  4CCH A;  3OJS A;  3JPR A;  4RT2 A;  5L1I A;  3I28 A;  3GV7 B;  3T5H A;  4RQ4 A;  1NNL A;  1KEJ A;  2PKE A;  1BPE A;  2W11 A;  4Y2S A;  1IM4 A;  4IL6 U;  3GDX A;  1P7D A;  3H0M B;  2O6K A;  4M6W B;  3VCB A;  4I2C A;  1TAU A;  2F1J A;  1EXN A;  3RJH A;  1UA1 A;  4I29 A;  2XGP A;  4CF4 A;  1TAQ A;  5E79 U;  3UQ2 A;  2R8K A;  4RQ3 A;  4ECR A;  3D2Q A;  3EPG A;  1JAL A;  2KJ8 A;  4IQT A;  4G9B A;  3Q8P B;  1RYS A;  2RQ5 A;  3BDP A;  2CRX A;  3A0B U;  3ZDD A;  5HP4 A;  5AKZ A;  2HBK A;  4C8M A;  2LMR A;  5TIS U;  3RH6 A;  5BPC A;  1XSL A;  5CB1 A;  2PFO A;  1PVP A;  2NYV A;  4E0D A;  4KLH A;  1NOM A;  2LPE A;  3AQF A;  5J0W A;  1LB2 B;  3EPI A;  2H3I A;  3IM1 A;  2JEG A;  2HHV A;  4LZG A;  4UBB A;  4DOB A;  4UB8 U;  4QZB A;  2EZZ A;  1U49 A;  1SV4 A;  5ALG A;  2DQN B;  4OJ5 A;  5AI6 A;  2OCE A;  2AJQ A;  4UB4 A;  5D4B A;  3KD3 A;  3NUQ A;  2ZJ5 A;  1MQ2 A;  3SAH A;  4C8K A;  5AK3 A;  1XO1 A;  2ODG A;  4PZN A;  4QZC A;  2JV3 A;  4C8O A;  2YQE A;  1X6I A;  1ZQR A;  4ECW A;  3QUT A;  4UAY A;  3AEV A;  2B0C A;  7ICG A;  1F0M A;  2HHX A;  2N1R A;  3SZ2 A;  4UQG A;  1HJP A;  4EEN A;  5DLF A;  5D49 A;  1RYR A;  4YN4 A;  4UW9 A;  5KFI A;  9ICO A;  3M9M B;  2W9M A;  4B9L A;  1A76 A;  2HMX A;  3BQ7 A;  3WK9 A;  4YFK A;  4JK1 A;  3D2S A;  3UMC A;  4YD1 A;  1U48 A;  3BZK A;  2C2E A;  2PFP A;  3KBB A;  4RQ1 A;  1WYG A;  3PVX A;  1ZD2 P;  1J97 A;  3WK4 A;  4OJ6 A;  3GIK A;  4Y2Q A;  1BVS A;  2KE7 A;  5KTQ A;  4FZM A;  1BPD A;  5K4L A;  2KNJ A;  3MR6 A;  1PVR A;  3KHG A;  1K1Q A;  2F76 X;  3AU2 A;  4NL9 C;  3RTV A;  5AM3 A;  2MRL A;  5KNI A;  3TAP A;  3KZI U;  2JEJ A;  1TVA A;  5KFR A;  4BUG A;  1ZJM A;  5IIN A;  2HHS A;  1Q8K A;  2GLE A;  2XID A;  3QU9 A;  2PI4 A;  2DPJ A;  1S10 A;  1ECW A;  4YMO A;  4YD2 A;  2JH1 A;  5AKI A;  2EAN A;  4UAV A;  4IR1 A;  5AKH A;  3GFK B;  3ICX A;  2DWQ A;  8ICG A;  3FM9 A;  3PNC A;  2I9G A;  1QLN A;  4NWI A;  8ICE A;  2PXI A;  1N5W A;  4NLZ A;  4ACO A;  4F5N A;  2K60 A;  4TUQ A;  5J0U A;  3LWM A;  4EEY A;  9ICM A;  3N4M B;  2C2D A;  2F1H A;  2FJ6 A;  1D8Y A;  1JRO A;  4HAI A;  2ZUD A;  3KKA A;  2OM6 A;  1BNP A;  4Z6F A;  3AU6 A;  4EX6 A;  4DFJ A;  2AU0 A;  4Q43 A;  5L1L A;  4OJO A;  3NS1 A;  3OTQ A;  1RQN A;  3Q8K A;  4DFP A;  2BQ3 A;  3C1Y A;  3ONN A;  4KX3 A;  5J0Q A;  2KSO B;  2DF4 B;  3C29 A;  5AI4 A;  3D6J A;  1VLB A;  2WF9 A;  3PZP A;  3SAG A;  7ICN A;  2DL0 A;  3WU2 U;  1N56 A;  8ICH A;  4QW8 A;  4F5P A;  1MC8 A;  2H3V A;  3KTQ A;  7ICH A;  4Y2Y A;  4IQW A;  3BS5 B;  1ZOL A;  3ISD A;  1WWV A;  4YCX A;  3K75 D;  3F5A A;  5AKJ A;  1V85 A;  3PW5 A;  9ICB A;  2PFQ A;  2ZIX B;  3T3F A;  2KZZ A;  5KG1 A;  8ICC A;  2FPK A;  1BNO A;  5AI0 A;  3QZ8 A;  3F2D A;  1L3V A;  4DOC A;  1ZQW A;  3DEE A;  1IG6 A;  3H7I A;  5AK4 A;  5ALV A;  2M9N A;  2JH7 A;  5EE1 A;  8ICU A;  5J0P A;  5CWR A;  7ICL A;  2ALZ A;  3M6Z A;  4EBD A;  2B6G A;  5KT7 A;  5J2F A;  3MGH A;  2UVR A;  3RRH A;  3ZDE A;  4I2G A;  5KAI U;  1BPX A;  5IIL A;  5KFZ A;  4QWA A;  3CW2 C;  1LV5 A;  3C2K A;  1ZQD A;  2XC9 A;  3SV4 A;  5J2J A;  4J9L A;  2Q4T A;  5AM4 A;  5L9X A;  4KLE A;  2F8L A;  2BQR A;  9ICE A;  1XC9 A;  1Z00 B;  4J9K A;  2ZIW A;  4CGZ A;  3RB4 A;  2ZIU A;  3F53 A;  4DL3 A;  4NJ8 A;  1B4F A;  3PW0 A;  2KHQ A;  2YMQ A;  2V4R A;  1WCL A;  9ICG A;  1WCN A;  1RG6 A;  2XO7 A;  2DGZ A;  4EYI B;  4NLK A;  2W54 A;  3LVV A;  4O5C A;  1J2N A;  2VJ4 A;  5BOM A;  4F4X A;  1ZQE A;  4UB6 U;  4ECZ A;  2ASL A;  5HR6 A;  4O5K A;  4OJL A;  2DPI A;  1ZQP A;  3MFH A;  3GZF A;  2OYY A;  2PFN A;  2KIC A;  3PR5 B;  4RPZ A;  4M0A A;  2Y0S F;  3GII A;  2V9W A;  5J0R A;  2Q0Z X;  1ZQJ A;  9ICJ A;  2G09 A;  3ZDC A;  3JPQ A;  3AN1 A;  5CR0 A;  5ALT A;  2H5X A;  5KG0 A;  3SI8 A;  2I1Q A;  4IC9 A;  3G6Y A;  5IIJ A;  4J9Q A;  3WKA A;  4C4S A;  1ZQT A;  2ZJA A;  3V6J A;  3LYS A;  3KHH A;  4YXJ A;  3FYH A;  4G3I A;  4EEK A;  3THV A;  4GIB A;  4BXO B;  4JV2 A;  3RBE A;  4JV0 A;  5AI5 A;  1KW4 A;  1MN8 A;  4EYH B;  3KHR A;  4IS7 A;  4F4K A;  2KN7 A;  4NXZ A;  4RNN A;  5AIB A;  1ZQA A;  4KLT A;  1ZET A;  1FFU A;  4DCC A;  2K4H A;  1S0M A;  2ATL A;  5L1J A;  2D3D A;  1S0N A;  5F9N A;  2W3S A;  2ZTD A;  3V72 A;  3SR6 A;  1F5S A;  5ALP A;  3C23 A;  4F5R A;  3IG8 A;  1U47 A;  3RFA A;  3M8R A;  2ASJ A;  2KVS A;  2L5Y A;  4YVZ A;  1SXD A;  1MA7 A;  1XWL A;  2E1E A;  4EBC A;  5J2B A;  2HHT A;  5KFN A;  4BGD A;  5ALF A;  4EBE A;  1KKX A;  4DO9 A;  2C28 A;  5EWE A;  1CUK A;  1ZQY A;  4GFJ A;  4JUZ A;  2NRX A;  3QNM A;  4ED3 A;  3E58 A;  4RUA A;  1NKB A;  5AIA A;  1DK2 A;  3RB0 A;  2WF5 A;  1XO0 A;  4DEZ A;  3FC4 A;  1C20 A;  3H0R B;  4MFF A;  4UAU A;  5KT5 A;  4EX7 A;  3HP6 A;  4RU9 A;  4I2H A;  5DDM A;  4UB2 A;  3K1R B;  4MFA A;  4ED1 A;  4FZL A;  5DKW A;  1KTQ A;  1KDH A;  3H8W A;  1X9S A;  1L7M A;  3RJJ A;  1L3S A;  4M9G A;  3MAB A;  4F5Q A;  3RF9 A;  7ICP A;  2OHF A;  3C2M A;  3HKZ F;  3PSF A;  3NVZ A;  5III A;  8ICN A;  2RHF A;  3UXP A;  4J03 A;  1IV8 A;  3ISC A;  1HUO A;  1CEZ A;  3PW7 A;  2EDU A;  1WG8 A;  2E3T A;  4FE3 A;  2RDJ A;  8ICF A;  3PX6 A;  3QUB A;  3SEN A;  4DL6 A;  3QE9 Y;  5CHG A;  3PO5 A;  2W8K A;  3L5K A;  4F2R A;  3JPS A;  3OHA A;  5JRT A;  1L5U A;  1S8O A;  3GIL A;  5KL1 B;  4C8L A;  5T14 A;  4LZD A;  2G5H B;  3IDW A;  4QZD A;  2JXJ A;  4JB3 A;  4J9M A;  4KLF A;  5KT4 A;  5J2I A;  4B9T A;  2JGA A;  3JPP A;  2E8N A;  4F4W A;  2KOB A;  5J0O A;  2OEH A;  5GTI U;  5DG9 A;  3BQ2 A;  2M0N A;  8ICQ A;  1BPZ A;  4ZOH C;  1SIJ A;  4X5V A;  1MSW D;  3ED5 A;  2W04 A;  4P4M A;  1PK1 A;  5DLG A;  4U7C A;  3RH4 A;  5KG4 A;  2VIX A;  5AIC A;  4YQW A;  4QIW F;  5J2K A;  2K4I A;  4J9N A;  5KAF U;  2R8I A;  4DWI A;  4UAT A;  9ICI A;  3V7K A;  3HX0 A;  3M6K A;  4QW9 A;  4CE6 A;  5GTH U;  1N2X A;  4CF3 A;  3TFR A;  2XY7 A;  4F2S A;  1KFD A;  2K8A A;  4OD0 A;  4BDP A;  1ZQV A;  8ICA A;  1ZQS A;  7ICV A;  4NLB A;  4IQU A;  3IG5 A;  2NO5 A;  1FIQ A;  4BWJ A;  1UHU A;  1ZQB A;  4DLG A;  4R8U B;  2YB4 A;  3UXN A;  1A6S A;  1NZB A;  2QB0 A;  3QU5 A;  3WK6 A;  4OJP A;  4Y2T A;  4KLD A;  4NM2 A;  5CP2 A;  3ISB A;  4I2A A;  2YTU A;  4KLU A;  4I2D A;  2AGP A;  4F3O A;  2UVV A;  4Z6D A;  2E8M A;  5J8Y C;  1PZN A;  3QUQ A;  2HOF A;  3SMV A;  5ALH A;  2WF8 A;  1SL2 A;  4I2F A;  1YZ7 A;  5KFE A;  1K1S A;  4K4H A;  5KFJ A;  4KMO B;  1L7P A;  5AKE A;  5ALM A;  4Q8E A;  2HDO A;  3WK8 A;  1UPH A;  9ICA A;  4QZF A;  4XQ8 A;  4PPX A;  5EE3 A;  2HBJ A;  2FMP A;  2RRD A;  2XY5 A;  2KG5 A;  2KSO A;  3GQC A;  1DGJ A;  3MGI A;  4I2E A;  1RM6 C;  3H8M A;  2KKP A;  2ZIV B;  5EWG A;  5ALX A;  2W9B B;  3OSP A;  5C0Y A;  1RZT A;  4RQ2 A;  2IHM A;  1YZ6 A;  9ICF A;  2JZB B;  4A8E A;  5HNK A;  3RB3 A;  1ZD3 A;  3KFU F;  3BS5 A;  2YMM A;  2KZ3 A;  3RJK A;  2ZUB A;  5KT3 A;  2VJ5 A;  4KLS A;  1KQQ A;  1A0P A;  4KLG A;  3M1Y A;  5DBC A;  1TKD A;  3IV6 A;  2ZIX A;  3EYZ A;  3NRW A;  2AXT U;  4QWD A;  1QH9 A;  4M9H A;  2MUT B;  1Y88 A;  3IRU A;  3QXG A;  4WJ3 B;  2KV2 A;  4DQR A;  2BKE A;  1SKS A;  5AI8 A;  4YR3 A;  3NGD A;  1PVQ A;  3AL0 B;  5DG8 A;  4I2I A;  2H3Z A;  5ALR A;  3PO4 A;  1XS9 D;  3RJE A;  1TK8 A;  5KFS A;  4GC7 A;  2A1J B;  4PL2 A;  4RPX A;  1QSY A;  3GU3 A;  2W3R A;  4US8 A;  4NY8 A;  5J8Y A;  3MR3 A;  4DL5 A;  3HPO A;  1XSP A;  4M9J A;  4F5O A;  1S0V A;  3UPQ A;  2KTQ A;  2R8G A;  2W9C B;  4CRX A;  1Z00 A;  5ALN A;  1QSS A;  1SWW A;  4B9N A;  4AP9 A;  4Z6C A;  4HYK A;  4C7Z A;  1O08 A;  3SEI A;  5DG7 A;  4JWM A;  1SZH A;  2VKQ A;  2XI9 A;  2YN4 A;  2ES6 A;  7ICQ A;  4Y2P A;  1BGX T;  2RP5 A;  5DDY A;  4RQ8 A;  5ALU A;  2IMW P;  1YT3 A;  4RQ0 A;  4O3S A;  2DKX A;  4F91 B;  3UMG A;  2HHU A;  4RT3 A;  1N63 A;  2WAQ F;  4QZE A;  2LM1 A;  4UB3 A;  2KIW A;  3T5K A;  3F2B A;  4F50 A;  2C22 A;  2QAR B;  5J2E A;  4DOA A;  3MR2 A;  5AKX A;  4GC6 A;  5FP0 A;  1LKY B;  2R8J A;  4O3O A;  3MGV A;  2HI0 A;  2H3Q A;  2E1F A;  1SB3 C;  4KIT B;  4TQS A;  5KFB A;  4QZI A;  4R64 A;  2NO4 A;  2EZY A;  3WK5 A;  3V6H A;  3BJY A;  2E5S A;  2BQU A;  4PGQ A;  2HHQ A;  1NZP A;  4MF8 A;  4UB5 A;  4B6J A;  3RB6 A;  4NL9 A;  4BXO A;  5HHH A;  3TAQ A;  4O3Q A;  3R9K A;  4FO6 A;  3PML A;  4B9M A;  4EZ6 A;  1RPL A;  1ZQU A;  2WF7 A;  1Z4O A;  2WHE A;  1S0O A;  2VA8 A;  2YB1 A;  3A0H U;  2AGO A;  2HVI A;  3QU2 A;  3H40 A;  1ZQF A;  5J2G A;  1SWV A;  2PMZ F;  1XNS A;  1SL0 A;  1ZQM A;  3BQT A;  2NRW A;  5KG6 A;  3AQE A;  3PV8 A;  2LHT A;  1IXR A;  5G5G A;  2R8H A;  4J9S A;  1QQ5 A;  4I2J A;  4EZ9 A;  2F44 A;  2ZTE A;  2C2R A;  4ECQ A;  5J2C A;  3OHB A;  3HT3 A;  1COO A; 
#chains in the Genus database with same CATH homology
 1SZH A;  2PMZ C;  2VJ4 A;  3E0F A;  3C28 A;  2VKQ A;  2OH2 A;  2DF4 B;  2KJ9 A;  2XI9 A;  3C29 A;  1Z19 A;  2HBL A;  2CPR A;  1Z1B A;  2HBJ A;  2K4E A;  3PSI A;  4NLC A;  2RRD A;  3K1Z A;  3PZP A;  2RP5 A;  5HR6 A;  2HMX A;  2JGA A;  4OJL A;  4NV0 A;  3VC8 A;  2G5I B;  3SAG A;  1YT3 A;  4U6P A;  2KOB A;  2KKP A;  2ZIV B;  3GZF A;  2OYY A;  2LBO A;  5C0Y A;  2KHV A;  1P7D A;  3D2S A;  3PST A;  4BJQ A;  2WB1 F;  3KZX A;  3H0L B;  3H0M B;  4GFJ A;  2KIC A;  1Q3V A;  4AYB F;  3O0F A;  3VCB A;  2H3V A;  2M0N A;  2HBM A;  2Y0S F;  3N7P D;  2WAQ F;  2MA1 A;  2LYB A;  3SAF A;  2KIW A;  5A0L A;  4OJ6 A;  2G09 A;  3F2B A;  1XO0 A;  2W04 A;  4A8E A;  3OPX A;  2JMG A;  4P0P B;  3F5A A;  3D2Q A;  1KBU A;  3H0R B;  4BX9 C;  3KFU F;  4U7C A;  4FZM A;  1L6N A;  1GO3 F;  2VIX A;  2CN1 A;  2KNJ A;  2JHD A;  2KJ8 A;  3CYM A;  4QNL A;  4QIW F;  1PVR A;  1TAM A;  2WB1 C;  4IC9 A;  2Z7J A;  1MA7 A;  2F76 X;  1URJ A;  4ICA A;  4P0P A;  3MGV A;  2ZIX B;  2VJ5 A;  2K4I A;  4AYB C;  4QJF B;  4P0Q B;  1Q3U A;  1A0P A;  2Y0S C;  2H3Q A;  2CRX A;  2E1F A;  2WAQ C;  2G08 A;  4FZL A;  1DRG A;  2ZXI A;  4CDG A;  5KL8 B;  2ZIX A;  3F2D A;  2MRL A;  2HBK A;  3M6K A;  4P0Q A;  3NRW A;  2K8B B;  2ZIV A;  3DEE A;  2KKV A;  2G0A A;  2KJ5 A;  3CRX A;  3LYS A;  2K89 A;  2F2A B;  5CRX A;  2K8A A;  2JH7 A;  1IIP A;  3RF9 A;  4QIW C;  1PVP A;  3N7R C;  4OO1 J;  2R18 A;  2H3F A;  2XVT A;  1WUD A;  2E5S A;  2G06 A;  3LVW A;  4BUG A;  2ZG6 A;  3AQF A;  3HKZ F;  3PSF A;  4WJ3 B;  1ZQ1 C;  2KV2 A;  3ALR A;  4NLB A;  3M6Z A;  2OXO A;  3IG5 A;  4C0Z A;  2A3V A;  2XID A;  1F44 A;  2H3I A;  2RHF A;  3AL0 B;  1PVQ A;  3CP8 A;  1ECW A;  2BDU A;  2KEY A;  2JH1 A;  2H3Z A;  3N7S C;  2HOI A;  1CRX A;  2YB4 A;  1A6S A;  2LKY A;  2DQN B;  2KVC A;  3ICX A;  1NZB A;  4OJ5 A;  4NWI A;  3IN5 A;  3HKZ C;  2G07 A;  4OJP A;  1ED1 A;  4PL2 A;  1OUQ A;  4ACO A;  3GU3 A;  4KX3 A;  2Q4T A;  3NUQ A;  1T94 A;  2ZIW B;  2F8L A;  2K4H A;  3D2N A;  3M7D A;  4FE3 A;  4FZN A;  2YB1 A;  2KD1 A;  2ZIU B;  3PSP A;  2XIC A;  3F2C A;  1HIW A;  3L3F X;  3SAH A;  2LYA A;  2ZIW A;  4CGZ A;  2K8C B;  2HOQ A;  2OM6 A;  2PMZ F;  2ZIU A;  1XNS A;  4CRX A;  2NV3 A;  3F53 A;  2GH1 A;  2F77 X;  3AQE A;  2HOF A;  3SMV A;  2LHT A;  2ZXH A;  4OJO A;  2KHQ A;  3IG8 A;  5KL1 B;  3IP4 B;  2YX8 A;  2D6F C;  5T14 A;  3RFA A;  3T79 A;  1HEK A;  4PL1 A;  2W7O A;  4KX5 A;  4KMO B;  3SQI A;  4JMU A;  5HR7 A;  2W7P A;  2DGZ A;  2G5H B;  3F5E A;  1D8B A;  2W03 A;  3ONN A;  2N1R A;  2GOL A;  4O3M A;  1UPH A;  2E1E A;  3LVV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...