2H3VA

Structure of the hiv-1 matrix protein bound to di-c8-phosphatidylinositol-(4,5)-bisphosphate
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
131
structure length
131
Chain Sequence
GARASVLSGGELDKWEKIRLRPGGKKQYKLKHIVWASRELERFAVNPGLLETSEGCRQILGQLQPSLQTGSEELRSLYNTIAVLYCVHQRIDVKDTKEALDKIEEEQNKSKKKAQQAAADTGNNSQVSQNY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for targeting HIV-1 Gag proteins to the plasma membrane for virus assembly.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Viral protein
molecule keywords Gag polyprotein
total genus 33
structure length 131
sequence length 131
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2006-05-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00540 Gag_p17 gag gene protein p17 (matrix protein)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.90 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase; domain 1 2h3vA01
2GOLA 1UPHA 2JMGA 2H3QA 2K4HA 2H3VA 4ICAA 2H3FA 1A6SA 4IC9A 2N1RA 1TAMA 2LYAA 4JMUA 1ED1A 1ECWA 2LYBA 1L6NA 2NV3A 2H3IA 1HEKA 2K4IA 2K4EA 2HMXA 1HIWA 2H3ZA
chains in the Genus database with same CATH superfamily
3N97B 9ICAA 5DGAA 4RUAA 4XA5A 4DFJA 5AK6A 5F3XB 2VA3A 1SL1A 2YY6A 4KLSA 3IP4B 2FMPA 4LJXA 2YN4A 4NLBA 2JH1A 2GLEA 1DOQA 1RQLA 1C20A 1LB2B 4KX5A 4F5NA 2VA2A 2MU2A 1U9LA 4RQ1A 9ICBA 1T7PA 5CP2A 1SV0C 2KVCA 1FEZA 1ZQNA 7ICLA 4O9MA 8ICSA 3LVVA 5DLGA 1XO0A 2I9GA 2E8OA 3V6HA 2OWOA 2KK0A 4NLCA 1EXNA 4UAZA 2NRVA 3ETLA 2F1HA 2XICA 5CB1A 1NZBA 4F5OA 2IOFK 1VJ5A 3NTUA 3SV3A 3OJUA 4RQ4A 4NLZA 3OSNA 2BQRA 1S97A 4UB1A 2KFZA 3G6VA 8ICAA 3HKZC 2Z7JA 4UATA 4RQ5A 3WK6A 2HHXA 3H4DA 1MQ2A 3RJHA 4EELA 5KT7A 4NV0A 1AROP 2JEJA 4P2HA 1ZD2P 4J03A 1PVRA 3V72A 4ECZA 3GV7B 2DPIA 3L4PA 2BCSA 1ZQQA 4Y2YA 1XNSA 4P0PB 1KBUA 3U26A 9ICLA 9ICMA 2YB4A 3T5LA 5KG5A 4RZRA 7ICTA 4O5CA 4I2CA 2DKZA 1QSYA 3IG8A 2P35A 4ICAA 1FFVA 1L3VA 4ECRA 5H2FU 4XUSA 5AM5A 1UCVA 2M9NA 4JB3A 5EE1A 2OCEA 4M9GA 4M9LA 3QEBZ 3PX0A 5AM1A 3ICXA 1N5WA 3NS1A 4YMMA 3T5HA 3KHLA 5KG2A 3PO5A 8ICCA 4UW9A 2WF6A 2G5IB 2MAXA 4IR9A 5J0OA 1KFDA 4KLTA 4LZDA 3C1YA 2W8LA 3BQ0A 4PJ0U 4NLNA 4DL6A 2XY6A 5IILA 2KOBA 8ICJA 4F2RA 2G0AA 4PZOA 2YMQA 2I5HA 5KFPA 4ZH4A 5KFEA 4KLFA 1NZPA 1BPXA 2YMPA 3RB0A 2RHFA 3ZDEA 5AKHA 4QW9A 4Y2VA 3RH5A 5KFMA 2ZJ8A 2ASLA 1D8LA 4GFJA 4I2DA 1V85A 1X40A 1QSLA 4QWAA 5AM0A 3M6ZA 1ZQXA 4YR2A 4UAUA 4IQTA 2C22A 4M6WA 4FBUA 1YZ6A 9ICJA 5KT3A 4FE3A 2PKEA 2WF7A 5DB6A 2XGQA 8ICMA 3AU2A 2ALZA 5JUMA 2DL0A 4IC9A 4DL4A 1KW4A 5J2DA 4YP3A 1N48A 1Z1BA 1IV8A 4NL9C 3ZI4A 5DKWA 5T14A 3TKAA 5AK5A 3WK7A 1NI3A 3KHHA 3PMLA 4IL6U 4GLXA 4MFCA 2AXTU 9ICRA 4O5EA 3KKAC 1Z00B 5DG8A 1S10A 2BZFA 4BXOB 1OUQA 4O5KA 5ALZA 4ED1A 4NLKA 2XCPA 1HEKA 5KFKA 3OHAA 4R8UA 4KLEA 3PNCA 1MA7A 3NRZA 3AL0B 3BQTA 3CNHA 1ZXIA 4XRHA 4EBDA 1URJA 5KT2A 3RJFA 1SKSA 3AMZA 2FJ6A 5AKEA 4QNLA 1Z4NA 4KN7A 8ICZA 4F71A 4P4PA 4GXIA 4CF3A 5BPCA 1NJXA 1NKEA 5AK4A 2KN7A 3BJYA 5ALWA 2VKQA 2GO7A 4DSIA 4F91B 3MFIA 1QQ7A 1DGJA 4ELUA 2DFLA 1X9SA 2ZXIA 2ZIVB 3ZDAA 2V4RA 4RQ0A 5ALTA 3UXPA 2A3VA 3NVVA 2XY7A 5IIKA 3TQ1A 3PW5A 1N56A 2ZTDA 4IRKA 2KE7A 5J2BA 3MFHA 5L1IA 5D49A 2HBJA 4B9UA 3J81j 1QTMA 4B9VA 1COOA 4ECWA 4B9NA 5KFVA 2BDPA 4I2HA 3QE9Y 5KFIA 4DLEA 3TAQA 5FP0A 3PW4A 1XS9D 2C28A 2KJ8A 4CRXA 1S9FA 4RQ3A 4Z6DA 4TQRA 3NVZA 1ZQUA 3AN1A 3MR2A 2IHMA 1NK8A 5KAIU 1RPLA 2VA8A 2AHOB 3DV9A 3M9NB 2UVVA 1KN5A 9ICUA 5AKYA 4I2BA 4M9NA 3BZKA 8ICBA 3HWTA 5ALGA 5J8YC 4YR3A 4P0QB 1PVQA 3N7SC 4U6PA 3RBEA 2BKEA 4DO9A 1KTQA 1ZQTA 2BQUA 2RDIA 4US8A 2B21A 2E8PA 3RJEA 4I28A 5AHXA 5J0TA 2LBOA 1L7OA 5CRXA 4RNNA 2G08A 4ECVA 2C2EA 1BNOA 3QU9A 4PH5A 1RXWA 1B4FA 2NRWA 4DWIA 3TFSA 3NVWA 2BPCA 4Y2PA 1ZQWA 2C2RA 3PX4A 2I1QA 2K4EA 1KQQA 1QH9A 2NRXA 4Y2UA 2DBYA 2KKPA 3ORYA 5J0YA 2R8IA 4JWMA 2KSOB 3NGDA 4ECSA 5ALYA 3SAGA 3Q8PB 2PMZF 1SL0A 2UVRA 4YCXA 2FLNA 2E3TA 4EYHB 2NRTA 3JPRA 3OJSA 3GQCA 4Y2RA 2XI9A 5KFOA 2W7OA 7ICPA 8ICVA 5J2IA 7ICRA 2W9MA 5HNKA 5DBAA 4DS4A 9ICXA 1XSLA 2YB1A 1BPDA 3GIKA 3NASA 1X2IA 4PZNA 4B9TA 5ALHA 1ZQMA 2ZIUA 3WK5A 2V4QA 4MFFA 5KFLA 4DQPA 5IINA 3SENA 2HHWA 1TAQA 4PL1A 8ICNA 3R9KA 1Z19A 1SXDA 4QZIA 3WK4A 5KG0A 4QWDA 2ZJAA 3KHRA 3BS5A 4FBTA 3QUCA 4Q44A 3L3FX 4EBEA 3RR7A 4C4TA 4RU9A 5J2AA 4C8LA 1B43A 3K1ZA 3QUTA 5KL1B 1QCKA 2QB0A 2ZUDA 3WKBA 3TADA 4FZMA 3LDAA 1NKBA 2H5XA 3I1YA 2H3VA 1ZRNA 2XO7A 4ECXA 3C5FA 2JEFA 4Q45A 3RB3A 1SWVA 5C0YA 2LYBA 4IQVA 3C28A 2E1FA 4Z6FA 1DRGA 3QEAZ 4RQ7A 1UT8A 3SEIA 2ODGA 3KHGA 1N63A 1PK1B 2ZTCA 2J6TA 4KLQA 2XGPA 2ISPA 2FPKA 3RF9A 1L7PA 3IV6A 3V6KA 2UVUA 4BGDA 4ED0A 2AQ4A 2HBLA 2KEYA 9ICPA 2KVSA 4EENA 4UB4A 8ICTA 8ICFA 1QLNA 1ZD5A 2WF8A 1U4BA 1CUKA 4IR1A 2H3QA 5HHIA 2PFPA 4OJ5A 4Y2QA 2A19A 3KD3A 1RM6C 9ICOA 2JZBA 5EWGA 2HOIA 5DB8A 2W03A 3D6JA 5KFZA 3JPOA 2JXJA 1S8OA 4QW8A 4BX9C 4BWMA 3KFUF 4BUGA 5GTHU 2F1JA 4CGZA 1ZRMA 2F8KA 4JV2A 1PUZA 4KLIA 4QZHA 3PSTA 5L1MA 3RRGA 4J9LA 4F72A 4NWIA 2FE9A 2KFNA 5AKJA 1Z00A 1ZQEA 3MDAA 1Q8KA 2EH9A 5J0QA 4RPXA 2QARB 2D3DA 3V7KA 2W9BB 3EZ5A 3NVYA 5KL8B 3F53A 5C5JA 3TANA 1WG8A 5GTIU 4UB2A 2NYVA 4F8RA 4FO6A 3RR8A 2KJ5A 4DEZA 3PW2A 5J2HA 3UMCA 1LKYB 2G06A 4AYBC 4DFPA 2KKVA 4US9A 4NM1A 4EX6A 1F44A 2Q0ZX 1DK2A 1UPHA 5AICA 1BPYA 1JMSA 1LV5A 2W9BA 4M6WB 3LK9A 2HVHA 1IM4A 9ICSA 4KLMA 2KICA 4DL7A 3PO4A 3HJEA 1NJWA 4O3OA 2K4IA 4QWEA 4QZCA 3H8MA 4QZEA 3EWAA 1X66A 1Q3UA 4TQSA 3PVXA 5DQHA 3C2MA 3M8SA 4UAVA 3V7JA 4DFMA 3RJIA 4DF4A 2DWQA 2CXYA 1TAMA 2WB1C 4PGQA 5L9XA 3WK9A 2AGOA 2A1AA 2KHQA 2Y0SC 2WAQC 2DGZA 2G5HB 4Y2TA 3THVA 4UASA 5DDMA 4RNOA 2NO5A 3O0FA 2PFNA 5J2JA 2Y9TA 4YD2A 2NV3A 1L8LA 4YG2A 1SKRA 3RAXA 1TE2A 2OH2A 3MR6A 3FC4A 1UT5A 1J97A 2W54A 4G3IA 4DOCA 4YXMA 4J9NA 2KJ9A 4AP9A 1PK1A 1MN8A 2ZIUB 3V7LA 8ICYA 3WKEA 8ICKA 5EE3A 4R66A 3RJGA 3N28A 3CRXA 1TVAA 2RP5A 1UA0A 1N5XA 2HI0A 1ZQVA 4JK1A 1NJZA 2JGAA 3PY8A 5AI5A 4ED3A 1XC9A 4RUCA 1L3TA 1VDVA 1BPEA 4F50A 2LHTA 2LM1A 3ISDA 2W3RA 1DXSA 4GXJA 3MGIA 3QZ8A 1QSSA 5DQIA 1KEJA 5KFBA 3A0BU 1NK5A 2A1JB 2K8BB 4PHPA 4UAYA 5JU5A 1L7MA 5ALDA 1H38A 1SWWA 2EZXA 2P6UA 4GC7A 2KHVA 2BCRA 2K8AA 4DLGA 4PHAA 1ZJNA 3D2QA 1NK6A 3FM9A 2E8MA 1QQ6A 1ZQJA 1ED1A 2YQEA 3E2EA 1JRPA 3A0HU 2HVIA 5AM2A 1B0XA 8ICIA 3Q8RB 1HUZA 2Y9UA 5KG4A 2B6GA 1S0NA 2ZXHA 2PI4A 1XWLA 4PGYA 3IRUA 5ALJA 4QZGA 2F77X 5HR7A 2IHNA 4J9OA 1Y88A 4UBBA 3ZDDA 2HHUA 1KLNA 1SV0A 2IMWP 1UA1A 8ICHA 3E0FA 2YTUA 4P0QA 3MGVA 1OXJA 5B66U 3V6JA 5HR6A 3Q8SB 2PMZC 5KAFU 2P66A 1N60A 1PK3A 4TUQA 1V9PA 3VCBA 2Q4TA 5KT6A 3H8WA 3BDPA 4O3QA 5JTIA 3RTVA 3LWMA 5A0LA 3WU2U 2BCQA 3RRHA 4OJPA 3HRDD 4I2JA 4F2SA 2LYAA 4PHDA 4FS2A 3PV8A 4DSLA 3ZDCA 1TKDA 3VC8A 4RNMA 8ICXA 4NY8A 3MABA 4O3NA 1RYSA 5D4BA 1S77D 3ONNA 3SI8A 4B9MA 7ICUA 1DGSA 1JN3A 2JH7A 4JV0A 2PXIA 2W9CA 3F5AA 8ICRA 4GXKA 2L5YA 4C8MA 1NK7A 3OTQA 3QU2A 2N1RA 2B0CA 2CPRA 3H4BA 2R8JA 5HP4A 1NOMA 2QLTA 4EBCA 3TAPA 5CR0A 1IG6A 3AM9A 1X6JA 3K75D 4OJ6A 1FIQA 4Q8EA 1L5UA 3HKZF 5KFRA 2D8CA 3QU5A 3FYHA 3TARA 3F2BA 2Y1IA 2HOQA 3IG5A 2JRZA 3QNMA 4IQWA 8ICLA 9ICTA 1L7NA 5HMMA 3QU7A 5AI4A 1T8EA 5BOLA 3PMNA 5KFYA 5AKXA 4QWBA 3C23A 7ICIA 4J9QA 2W9CB 1WCNA 4I2IA 1D8BA 4I2EA 4P4MA 4ED2A 4I2GA 3UQ0A 2LKYA 4AYBF 3LVWA 5D46A 3D2SA 5J2CA 4KLLA 9ICWA 5F9NA 1SV4A 3SQIA 2C2DA 1IXRA 2JHDA 2HDOA 5KG6A 1O08A 4R8UB 1ZQFA 1PVPA 1UHUA 2RLTA 4EEKA 5IIJA 3RH6A 2K8CB 2W55A 2OXOA 2BDUA 4UB8U 2EZZA 1A0PA 5AK3A 7ICSA 2ZTEA 2FMSA 5ALXA 5CJ7A 1SIJA 1CEZA 5AI9A 5JRTA 2ZIWA 1SB3C 4QWCA 5L1KA 1SGGA 2LMRA 1WUDA 2R8HA 3Q8LA 2E8NA 4BDPA 4UB5A 5ALNA 2VANA 3GDXA 4F3OA 3M1YA 8ICGA 4J9RA 2G07A 4NL9A 2ZIVA 5L1JA 1NK9A 2K4PA 5J0UA 2RDJA 8ICOA 2KZZA 4Q43A 3PR4A 4CF5A 3FAHA 5ALVA 4USAA 2GOLA 2KIVA 4YFKA 2HHVA 4OJOA 3BQ7A 4QZFA 1N61A 3RBDA 4I2FA 3JPQA 1DK3A 3KKAA 3PSFA 5CEHA 4C4RA 4F5PA 5CWRA 5EE9A 1WWUA 3HX0A 5IIIA 5ALMA 2A1JA 2G09A 1KKXA 3I76A 1ZQBA 1OW5A 3H7IA 5KFFA 3CP8A 2HCFA 4YVZA 2D6FC 4K4HA 2EZYA 1ZETA 3M7DA 1SL2A 1RZTA 2EAMA 1MSWD 3RJJA 2PFQA 4JWNA 1ZQZA 1K1QA 5CHGA 4M2YA 4RQ2A 2W3SA 3PZPA 5DG9A 3ZDBA 7ICEA 3B0XA 4ECYA 4RQ8A 2AGQA 2KZMA 1MC8A 4RPYA 2BCVA 5AKZA 1SZHA 3MR5A 3G6XA 1ZQKA 3UXNA 4X5VA 4DOBA 1S0MA 2EAPA 4C8KA 5J0RA 2DPJA 3SV4A 3GFKB 3HP6A 3UMBA 3PR5B 3BQ2A 3CYMA 4C8NA 4DQSA 4PL2A 4DSJA 5KG1A 1Q46A 5KG7A 1LKYA 1TK5A 4A8EA 5DQGA 5L1LA 3QYPA 3RB6A 4KX3A 7ICKA 2MRLA 3SR6A 3KTQA 7ICHA 2ASDA 2QKQA 4P0PA 4R63A 4J9MA 3QX7A 4C80A 4NJ8A 5KFAA 2AQ0A 3S6JA 5AI8A 3PX6A 4KLUA 5ALSA 2JEGA 2KD1A 5J2EA 2ATLA 5DGBA 4I27A 9ICKA 2JEIA 1CI4A 3OSPA 5AIAA 5J8YA 3EYZA 1X9XA 4O3MA 3OHBA 3D2NA 1CRXA 3H0MB 4B9SA 1ZJMA 3IDWA 5K4LA 2LPEA 4ED8A 3AUOA 9ICNA 3Q8MA 1XO1A 2RQ5A 4YXJA 4ED7A 4IQUA 2MA1A 4ELVA 4DQQA 4K4IA 2F1IA 5AKIA 3GIIA 3ZD9A 4RT3A 1MQ3A 3CW2C 1JALA 1XU4A 1ZYQA 2ES6A 3WK8A 2WTFA 2W7PA 4F4XA 4MEXA 2FPLA 4DF8A 2EQYA 2QB1A 4B6JA 1ZOLA 2MUTA 1ZQGA 4OJLA 1ZQCA 2HBKA 3FDSA 1UQVA 4RQ6A 3L5KA 4F4KA 4JV1A 3Q8QB 1ZQAA 3C2LA 3T3FA 1S76D 3ALRA 3JPNA 4QIWF 1ZQSA 5G5GA 3PSPA 1ZQDA 1BVSA 3QZ7A 4TUSA 4OO1J 5DB7A 2P6RA 1F5SA 5KT5A 1NK4A 4F4WA 5KFSA 5J2GA 7ICFA 2IOHA 4IRDA 4HYKA 5IIMA 2YMLA 2AH5A 5HHHA 2ZJ5A 1HUOA 1A77A 2F3NA 3KZXA 3N7RC 4UBCA 4C0ZA 5J0WA 4JUZA 3M6KA 4M04A 2DUYA 3IM1A 2E1EA 3QXGA 1S0VA 7ICJA 2F8LA 3IHQB 4DSEA 1M6YA 2OEHA 2MUTB 4YD1A 1JX4A 3RJKA 2I6XA 4I2AA 4JMUA 5TISU 5CA7A 2V9WA 4EX7A 4UARA 2XCAA 4U7CA 4KITB 2ESEA 4UAWA 2W43A 3GZFA 3MR3A 3TADC 4FZLA 2ASJA 2JMGA 4F4ZA 5DLFA 9ICGA 3UQ2A 5KFCA 5KFHA 2YMMA 1RYRA 1ZD3A 1RDFA 2BQ3A 4Q8FA 2J6SA 2WAQF 4F5RA 2KG5A 3UMGA 4QIWC 2ZIXA 3F2CA 1JI7A 4Y2XA 4CCHA 4EZ6A 4KLOA 2BR0A 2W9AA 5AI0A 2WB1F 2VJ5A 2HHQA 1X42A 3ZD8A 5AKKA 1L3UA 9ICEA 3EPGA 3SAFA 3SD7A 1RYUA 3BQ1A 2Y0SF 2FMQA 3NUQA 9ICFA 3QUQA 1HIWA 1BNPA 3SYZA 9ICCA 1FFUA 3RAQA 4QZ8A 5J2KA 4MFAA 1SZPA 3BS7A 3JPTA 4J9KA 5G5HA 4KMUA 1X6IA 2FDRA 4R65A 4C4SA 5AM3A 4TURA 8ICEA 4FS1A 4ELTA 5J0SA 1BPZA 4FFDA 1V97A 2HMXA 3B0YA 4YN4A 4QZBA 3GV8B 1KRPA 2J6UA 3C2KA 1D8YA 4DL5A 4MF2A 5KFQA 1RQNA 4GIBA 3H8JA 4M9HA 5ALEA 1K1SA 4Y2SA 1ZQYA 1L6NA 4MEYA 5KG3A 3SAHA 3DDHA 2ZG6A 1SXEA 3TACB 2HOFA 1A76A 1KL9A 4DFDA 1SKWA 1X9WA 4KLJA 4ACOA 3OGUA 1Z3EB 2WHEA 5ALIA 2ZUBA 4DQRA 4G9BA 4BWJA 4ECTA 3TFRA 3E58A 5KNIA 3PSIA 4M0AA 1JROA 5EWEA 5KTQA 4QZDA 1JXEA 1KFSA 3QUBA 2AU0A 1AQ6A 1WWVA 3BZCA 3OPXA 1A6SA 2W04A 5DBCA 1IIPA 3UXOA 4KN4A 1D9FA 2KNJA 2GH1A 2BPGA 3KZIU 1N2XA 3N4MB 5DBBA 1O03A 4FZNA 1ZQIA 1V38A 1XSPA 5J29A 9ICHA 2O6KA 2WF5A 4KLHA 3C29A 1ZQHA 2PFOA 5BOMA 1TK8A 5KFTA 5ALPA 5EOZA 2FI1A 2CN1A 5KFJA 3GIMA 3EPIA 4J9SA 3K1RB 3G6YA 2K89A 1WYGA 2R8KA 3HT3A 3IN5A 4F4YA 7ICGA 1K5OA 1T4GA 2NO4A 4DL3A 3GILA 4YQWA 3KOOA 4HAIA 2DKXA 5AM4A 5ALFA 3BS5B 2EAOA 4RQMA 3UPQA 2F2AB 3WKDA 1ZQ1C 7ICNA 1YZ7A 2LYHA 4PGXA 1P7DA 2KP7A 1BGXT 1JXLA 2HHTA 4F92B 4NLGA 2HBMA 1KSPA 5AKLA 1XSNA 2ZIXB 5ALUA 4O0IA 4IS7A 4CNQA 2MSNA 4QZAA 2OYYA 5J0XA 5AIBA 1VLBA 4DQIA 3I28A 3T5JA 8ICUA 3HILA 3RFAA 1TAUA 5KFXA 2BCUA 3GV5B 2M0NA 3C1ZA 2RRDA 3Q8KA 5KFUA 4DSFA 4NXZA 1S0OA 2IBKA 2XC9A 3LWLA 2K4HA 4XQ8A 5ALLA 1ZQOA 5E79U 3MBYA 2UVWA 4KLGA 2GWSA 1ECWA 4NM2A 2HHSA 5KT4A 1YT3A 2VIXA 2KSOA 3JPPA 3F5EA 2KIWA 2FPMA 4O3PA 2KMDA 3WKAA 3TI0A 1T3NA 2NRZA 5DG7A 5KFGA 4ECUA 5ALOA 4YMNA 1U45A 3ETRA 4K4GA 2JV3A 1WCLA 3T79A 5TZVA 2WFAA 4C7ZA 3H8SA 3N7PD 3T5KA 2KTQA 2W8KA 5HMLA 1BPBA 1ZQPA 2XY5A 1J2MA 1Q3VA 5B5EU 1NKCA 4OCZA 5DB9A 7ICOA 4YR0A 2W11A 2F44A 4PHEA 4R64A 4M9JA 4P4OA 1RXVA 4DFKA 4LZGA 2PI5A 4O3SA 1T3QA 1S5LU 4MF8A 4PPXA 3EW9A 1KFTA 5EE0A 7ICQA 4EZ9A 2FLLA 2FLPA 2CRXA 2KZ3A 1HJPA 4ZOHC 4KTQA 2VJ4A 2WF9A 4E0DA 5J0PA 2DF4B 2BHNA 4KLDA 4LVSA 4EYIB 1F0MA 3M9OB 4F93B 2E5SA 5KFNA 5AI6A 5EWFA 4GC6A 8ICWA 4DSKA 4MHVA 3AQFA 4DCCA 3C5GA 1NK0A 5AKGA 4BJQA 2EDUA 5KFDA 3PW7A 4WJ3B 1U49A 4EEYA 9ICVA 4RT2A 4TUPA 1N62A 4F5QA 2XIDA 3MDCA 3MGHA 2XVTA 2ZIWB 1X9MA 2R18A 4B9LA 4UB6U 3H0LB 5IIOA 2HSZA 2H3IA 4Y2JA 4UQGA 4CF4A 1T94A 4UB3A 1COKA 4OD0A 4DL2A 1Z1VA 2OM6A 4BXOA 2QARA 1NJYA 2JZBB 3F2DA 4ED6A 4RPZA 1GO3F 3K4GA 4CDGA 1Z4OA 5F9LA 4IRCA 3QU4A 2QB0B 1U48A 7ICVA 2H3FA 2JR5A 2BGWA 1C7YA 2AGPA 5ALQA 2DQNB 3HW8A 4I29A 3EUB2 9ICIA 4QZ9A 2BPFA 3JPSA 1JIHA 3H40A 8ICPA 1U47A 3UM9A 3M9MB 8ICQA 2HW3A 4KMOB 1D9DA 2ZUCA 1QQ5A 4YMOA 1FO4A 3SZ2A 1L3SA 2R8GA 1J2NA 4DS5A 2IOFA 3RB4A 3M8RA 3DEEA 2KV2A 1L8OA 2AJQA 1ZQRA 3LYSA 3ISBA 1RG6A 2EANA 3AU6A 4RQNA 2ISOA 3H0RB 3NRWA 9ICQA 2H3ZA 3HPOA 3C21A 1NNLA 3GU3A 5DDYA 3AEVA 5ALRA 1B22A 3RH4A 4J9PA 2F76X 5KFWA 1KDHA 3KBBA 3PW0A 1JUDA 2LM4A 4Z6EA 5J2FA 4Z6CA 4C8OA 2YX8A 2LI6A 4DOAA 1TV9A 4M47A 4C7YA 3SMVA 1TK0A 3MC1A 2K60A 2IA6A 1PZNA 2OHFA 3AQEA 1ZQLA 3WKCA 3B9JA 3ED5A 4QJFB 4O3RA 1LVHA 1TFRA 3GIJA 4ECQA 2Y1JA 1ZD4A 4CE6A 3ISCA 5ALKA 7ICMA
chains in the Genus database with same CATH topology
2OM6A 4P0PA 2GOLA 2KJ8A 3HKZF 4CRXA 3F2DA 2YB4A 1Q3UA 1GO3F 2H3QA 4FZNA 4OJOA 4OJ5A 2KHVA 4CDGA 2YB1A 2K8AA 3IP4B 3D2QA 3PSFA 3IG8A 3F2BA 3T79A 4ICAA 3N7PD 2H3FA 3C29A 2HOQA 2ZIUA 2HOIA 3IG5A 2WB1C 1TAMA 1OUQA 2W03A 1ED1A 2DQNB 4NLBA 2JH1A 1Q3VA 1HEKA 2KD1A 3KZXA 2CN1A 4BX9C 2G09A 2HMXA 4BUGA 3N7RC 3KFUF 4PL1A 4KX5A 1MA7A 2ZXHA 2K89A 2KHQA 4C0ZA 4CGZA 4O3MA 4KMOB 3M6KA 3IN5A 2Y0SC 1Z19A 2F77X 2WAQC 2DGZA 3CP8A 3D2NA 4P0QB 3AL0B 5HR7A 2E1EA 2G5HB 1URJA 3H0MB 3ICXA 3N7SC 1PVQA 4U6PA 1CRXA 2F8LA 3PSTA 2D6FC 3M7DA 1D8BA 2KVCA 4NWIA 2G5IB 3L3FX 2LKYA 3O0FA 3LVWA 4AYBF 3D2SA 2F2AB 4QNLA 1ZQ1C 4JMUA 3DEEA 3E0FA 1L6NA 2MA1A 2KV2A 3LVVA 2NV3A 4P0QA 3MGVA 1XO0A 1P7DA 2KOBA 2G0AA 3SQIA 4U7CA 2LBOA 2CRXA 2HBMA 2JHDA 3LYSA 3SAHA 2OH2A 4P0PB 2ZG6A 3K1ZA 5CRXA 2VJ4A 5KL1B 3PZPA 2ZIXB 3H0RB 3NRWA 5HR6A 2HOFA 3GZFA 2H3ZA 4NLCA 2PMZC 2G08A 1PVPA 2RHFA 3GU3A 2JMGA 2KJ9A 4FZMA 2VKQA 4FZLA 3VCBA 2W7PA 2Q4TA 2DF4B 5KL8B 3F53A 4ACOA 2XICA 2OYYA 2H3VA 2K8CB 1NZBA 2ZIUB 5A0LA 2F76X 2E5SA 4GFJA 4OJPA 4OJLA 2OXOA 2WAQF 2HBKA 2BDUA 1SZHA 2LYAA 3RFAA 5C0YA 2LYBA 2ZXIA 2ZIVB 3M6ZA 3C28A 1A0PA 2KJ5A 3AQFA 3CRXA 2RP5A 3HKZC 2E1FA 2Z7JA 1DRGA 4QIWC 2G06A 2ZIXA 3F2CA 2M0NA 2YX8A 3PSIA 4AYBC 2K4EA 2ZIWA 2RRDA 4BJQA 2A3VA 3SMVA 3VC8A 2KKVA 2JGAA 4WJ3B 1F44A 3ONNA 4FE3A 1UPHA 2KKPA 2XIDA 4NV0A 2WB1F 2JH7A 3AQEA 2VJ5A 1WUDA 3CYMA 2XVTA 2ZIWB 4PL2A 3SAGA 2HBJA 2K4HA 3ALRA 3F5AA 2R18A 2PMZF 2LHTA 4QIWF 4A8EA 3RF9A 3OPXA 1PVRA 1A6SA 4IC9A 2N1RA 2W04A 4KX3A 1IIPA 2CPRA 3PSPA 3H0LB 2MRLA 1ECWA 2KICA 1Z1BA 2HBLA 2KEYA 1YT3A 2VIXA 2H3IA 3SAFA 2G07A 4QJFB 2Y0SF 2KNJA 2K4IA 2ZIVA 2KIWA 2XI9A 3F5EA 4OO1J 2W7OA 1T94A 2GH1A 2K8BB 3NUQA 1XNSA 1HIWA 4OJ6A 5T14A 1KBUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2GOL A;  1UPH A;  2JMG A;  2H3Q A;  2K4H A;  2H3V A;  4ICA A;  2H3F A;  1A6S A;  4IC9 A;  2N1R A;  1TAM A;  2LYA A;  4JMU A;  1ED1 A;  1ECW A;  2LYB A;  1L6N A;  2NV3 A;  2H3I A;  1HEK A;  2K4I A;  2K4E A;  2HMX A;  1HIW A;  2H3Z A; 
#chains in the Genus database with same CATH topology
 3N97 B;  9ICA A;  5DGA A;  4RUA A;  4XA5 A;  4DFJ A;  5AK6 A;  5F3X B;  2VA3 A;  1SL1 A;  2YY6 A;  4KLS A;  3IP4 B;  2FMP A;  4LJX A;  2YN4 A;  4NLB A;  2JH1 A;  2GLE A;  1DOQ A;  1RQL A;  1C20 A;  1LB2 B;  4KX5 A;  4F5N A;  2VA2 A;  2MU2 A;  1U9L A;  4RQ1 A;  9ICB A;  1T7P A;  5CP2 A;  1SV0 C;  2KVC A;  1FEZ A;  1ZQN A;  7ICL A;  4O9M A;  8ICS A;  3LVV A;  5DLG A;  1XO0 A;  2I9G A;  2E8O A;  3V6H A;  2OWO A;  2KK0 A;  4NLC A;  1EXN A;  4UAZ A;  2NRV A;  3ETL A;  2F1H A;  2XIC A;  5CB1 A;  1NZB A;  4F5O A;  2IOF K;  1VJ5 A;  3NTU A;  3SV3 A;  3OJU A;  4RQ4 A;  4NLZ A;  3OSN A;  2BQR A;  1S97 A;  4UB1 A;  2KFZ A;  3G6V A;  8ICA A;  3HKZ C;  2Z7J A;  4UAT A;  4RQ5 A;  3WK6 A;  2HHX A;  3H4D A;  1MQ2 A;  3RJH A;  4EEL A;  5KT7 A;  4NV0 A;  1ARO P;  2JEJ A;  4P2H A;  1ZD2 P;  4J03 A;  1PVR A;  3V72 A;  4ECZ A;  3GV7 B;  2DPI A;  3L4P A;  2BCS A;  1ZQQ A;  4Y2Y A;  1XNS A;  4P0P B;  1KBU A;  3U26 A;  9ICL A;  9ICM A;  2YB4 A;  3T5L A;  5KG5 A;  4RZR A;  7ICT A;  4O5C A;  4I2C A;  2DKZ A;  1QSY A;  3IG8 A;  2P35 A;  4ICA A;  1FFV A;  1L3V A;  4ECR A;  5H2F U;  4XUS A;  5AM5 A;  1UCV A;  2M9N A;  4JB3 A;  5EE1 A;  2OCE A;  4M9G A;  4M9L A;  3QEB Z;  3PX0 A;  5AM1 A;  3ICX A;  1N5W A;  3NS1 A;  4YMM A;  3T5H A;  3KHL A;  5KG2 A;  3PO5 A;  8ICC A;  4UW9 A;  2WF6 A;  2G5I B;  2MAX A;  4IR9 A;  5J0O A;  1KFD A;  4KLT A;  4LZD A;  3C1Y A;  2W8L A;  3BQ0 A;  4PJ0 U;  4NLN A;  4DL6 A;  2XY6 A;  5IIL A;  2KOB A;  8ICJ A;  4F2R A;  2G0A A;  4PZO A;  2YMQ A;  2I5H A;  5KFP A;  4ZH4 A;  5KFE A;  4KLF A;  1NZP A;  1BPX A;  2YMP A;  3RB0 A;  2RHF A;  3ZDE A;  5AKH A;  4QW9 A;  4Y2V A;  3RH5 A;  5KFM A;  2ZJ8 A;  2ASL A;  1D8L A;  4GFJ A;  4I2D A;  1V85 A;  1X40 A;  1QSL A;  4QWA A;  5AM0 A;  3M6Z A;  1ZQX A;  4YR2 A;  4UAU A;  4IQT A;  2C22 A;  4M6W A;  4FBU A;  1YZ6 A;  9ICJ A;  5KT3 A;  4FE3 A;  2PKE A;  2WF7 A;  5DB6 A;  2XGQ A;  8ICM A;  3AU2 A;  2ALZ A;  5JUM A;  2DL0 A;  4IC9 A;  4DL4 A;  1KW4 A;  5J2D A;  4YP3 A;  1N48 A;  1Z1B A;  1IV8 A;  4NL9 C;  3ZI4 A;  5DKW A;  5T14 A;  3TKA A;  5AK5 A;  3WK7 A;  1NI3 A;  3KHH A;  3PML A;  4IL6 U;  4GLX A;  4MFC A;  2AXT U;  9ICR A;  4O5E A;  3KKA C;  1Z00 B;  5DG8 A;  1S10 A;  2BZF A;  4BXO B;  1OUQ A;  4O5K A;  5ALZ A;  4ED1 A;  4NLK A;  2XCP A;  1HEK A;  5KFK A;  3OHA A;  4R8U A;  4KLE A;  3PNC A;  1MA7 A;  3NRZ A;  3AL0 B;  3BQT A;  3CNH A;  1ZXI A;  4XRH A;  4EBD A;  1URJ A;  5KT2 A;  3RJF A;  1SKS A;  3AMZ A;  2FJ6 A;  5AKE A;  4QNL A;  1Z4N A;  4KN7 A;  8ICZ A;  4F71 A;  4P4P A;  4GXI A;  4CF3 A;  5BPC A;  1NJX A;  1NKE A;  5AK4 A;  2KN7 A;  3BJY A;  5ALW A;  2VKQ A;  2GO7 A;  4DSI A;  4F91 B;  3MFI A;  1QQ7 A;  1DGJ A;  4ELU A;  2DFL A;  1X9S A;  2ZXI A;  2ZIV B;  3ZDA A;  2V4R A;  4RQ0 A;  5ALT A;  3UXP A;  2A3V A;  3NVV A;  2XY7 A;  5IIK A;  3TQ1 A;  3PW5 A;  1N56 A;  2ZTD A;  4IRK A;  2KE7 A;  5J2B A;  3MFH A;  5L1I A;  5D49 A;  2HBJ A;  4B9U A;  3J81 j;  1QTM A;  4B9V A;  1COO A;  4ECW A;  4B9N A;  5KFV A;  2BDP A;  4I2H A;  3QE9 Y;  5KFI A;  4DLE A;  3TAQ A;  5FP0 A;  3PW4 A;  1XS9 D;  2C28 A;  2KJ8 A;  4CRX A;  1S9F A;  4RQ3 A;  4Z6D A;  4TQR A;  3NVZ A;  1ZQU A;  3AN1 A;  3MR2 A;  2IHM A;  1NK8 A;  5KAI U;  1RPL A;  2VA8 A;  2AHO B;  3DV9 A;  3M9N B;  2UVV A;  1KN5 A;  9ICU A;  5AKY A;  4I2B A;  4M9N A;  3BZK A;  8ICB A;  3HWT A;  5ALG A;  5J8Y C;  4YR3 A;  4P0Q B;  1PVQ A;  3N7S C;  4U6P A;  3RBE A;  2BKE A;  4DO9 A;  1KTQ A;  1ZQT A;  2BQU A;  2RDI A;  4US8 A;  2B21 A;  2E8P A;  3RJE A;  4I28 A;  5AHX A;  5J0T A;  2LBO A;  1L7O A;  5CRX A;  4RNN A;  2G08 A;  4ECV A;  2C2E A;  1BNO A;  3QU9 A;  4PH5 A;  1RXW A;  1B4F A;  2NRW A;  4DWI A;  3TFS A;  3NVW A;  2BPC A;  4Y2P A;  1ZQW A;  2C2R A;  3PX4 A;  2I1Q A;  2K4E A;  1KQQ A;  1QH9 A;  2NRX A;  4Y2U A;  2DBY A;  2KKP A;  3ORY A;  5J0Y A;  2R8I A;  4JWM A;  2KSO B;  3NGD A;  4ECS A;  5ALY A;  3SAG A;  3Q8P B;  2PMZ F;  1SL0 A;  2UVR A;  4YCX A;  2FLN A;  2E3T A;  4EYH B;  2NRT A;  3JPR A;  3OJS A;  3GQC A;  4Y2R A;  2XI9 A;  5KFO A;  2W7O A;  7ICP A;  8ICV A;  5J2I A;  7ICR A;  2W9M A;  5HNK A;  5DBA A;  4DS4 A;  9ICX A;  1XSL A;  2YB1 A;  1BPD A;  3GIK A;  3NAS A;  1X2I A;  4PZN A;  4B9T A;  5ALH A;  1ZQM A;  2ZIU A;  3WK5 A;  2V4Q A;  4MFF A;  5KFL A;  4DQP A;  5IIN A;  3SEN A;  2HHW A;  1TAQ A;  4PL1 A;  8ICN A;  3R9K A;  1Z19 A;  1SXD A;  4QZI A;  3WK4 A;  5KG0 A;  4QWD A;  2ZJA A;  3KHR A;  3BS5 A;  4FBT A;  3QUC A;  4Q44 A;  3L3F X;  4EBE A;  3RR7 A;  4C4T A;  4RU9 A;  5J2A A;  4C8L A;  1B43 A;  3K1Z A;  3QUT A;  5KL1 B;  1QCK A;  2QB0 A;  2ZUD A;  3WKB A;  3TAD A;  4FZM A;  3LDA A;  1NKB A;  2H5X A;  3I1Y A;  2H3V A;  1ZRN A;  2XO7 A;  4ECX A;  3C5F A;  2JEF A;  4Q45 A;  3RB3 A;  1SWV A;  5C0Y A;  2LYB A;  4IQV A;  3C28 A;  2E1F A;  4Z6F A;  1DRG A;  3QEA Z;  4RQ7 A;  1UT8 A;  3SEI A;  2ODG A;  3KHG A;  1N63 A;  1PK1 B;  2ZTC A;  2J6T A;  4KLQ A;  2XGP A;  2ISP A;  2FPK A;  3RF9 A;  1L7P A;  3IV6 A;  3V6K A;  2UVU A;  4BGD A;  4ED0 A;  2AQ4 A;  2HBL A;  2KEY A;  9ICP A;  2KVS A;  4EEN A;  4UB4 A;  8ICT A;  8ICF A;  1QLN A;  1ZD5 A;  2WF8 A;  1U4B A;  1CUK A;  4IR1 A;  2H3Q A;  5HHI A;  2PFP A;  4OJ5 A;  4Y2Q A;  2A19 A;  3KD3 A;  1RM6 C;  9ICO A;  2JZB A;  5EWG A;  2HOI A;  5DB8 A;  2W03 A;  3D6J A;  5KFZ A;  3JPO A;  2JXJ A;  1S8O A;  4QW8 A;  4BX9 C;  4BWM A;  3KFU F;  4BUG A;  5GTH U;  2F1J A;  4CGZ A;  1ZRM A;  2F8K A;  4JV2 A;  1PUZ A;  4KLI A;  4QZH A;  3PST A;  5L1M A;  3RRG A;  4J9L A;  4F72 A;  4NWI A;  2FE9 A;  2KFN A;  5AKJ A;  1Z00 A;  1ZQE A;  3MDA A;  1Q8K A;  2EH9 A;  5J0Q A;  4RPX A;  2QAR B;  2D3D A;  3V7K A;  2W9B B;  3EZ5 A;  3NVY A;  5KL8 B;  3F53 A;  5C5J A;  3TAN A;  1WG8 A;  5GTI U;  4UB2 A;  2NYV A;  4F8R A;  4FO6 A;  3RR8 A;  2KJ5 A;  4DEZ A;  3PW2 A;  5J2H A;  3UMC A;  1LKY B;  2G06 A;  4AYB C;  4DFP A;  2KKV A;  4US9 A;  4NM1 A;  4EX6 A;  1F44 A;  2Q0Z X;  1DK2 A;  1UPH A;  5AIC A;  1BPY A;  1JMS A;  1LV5 A;  2W9B A;  4M6W B;  3LK9 A;  2HVH A;  1IM4 A;  9ICS A;  4KLM A;  2KIC A;  4DL7 A;  3PO4 A;  3HJE A;  1NJW A;  4O3O A;  2K4I A;  4QWE A;  4QZC A;  3H8M A;  4QZE A;  3EWA A;  1X66 A;  1Q3U A;  4TQS A;  3PVX A;  5DQH A;  3C2M A;  3M8S A;  4UAV A;  3V7J A;  4DFM A;  3RJI A;  4DF4 A;  2DWQ A;  2CXY A;  1TAM A;  2WB1 C;  4PGQ A;  5L9X A;  3WK9 A;  2AGO A;  2A1A A;  2KHQ A;  2Y0S C;  2WAQ C;  2DGZ A;  2G5H B;  4Y2T A;  3THV A;  4UAS A;  5DDM A;  4RNO A;  2NO5 A;  3O0F A;  2PFN A;  5J2J A;  2Y9T A;  4YD2 A;  2NV3 A;  1L8L A;  4YG2 A;  1SKR A;  3RAX A;  1TE2 A;  2OH2 A;  3MR6 A;  3FC4 A;  1UT5 A;  1J97 A;  2W54 A;  4G3I A;  4DOC A;  4YXM A;  4J9N A;  2KJ9 A;  4AP9 A;  1PK1 A;  1MN8 A;  2ZIU B;  3V7L A;  8ICY A;  3WKE A;  8ICK A;  5EE3 A;  4R66 A;  3RJG A;  3N28 A;  3CRX A;  1TVA A;  2RP5 A;  1UA0 A;  1N5X A;  2HI0 A;  1ZQV A;  4JK1 A;  1NJZ A;  2JGA A;  3PY8 A;  5AI5 A;  4ED3 A;  1XC9 A;  4RUC A;  1L3T A;  1VDV A;  1BPE A;  4F50 A;  2LHT A;  2LM1 A;  3ISD A;  2W3R A;  1DXS A;  4GXJ A;  3MGI A;  3QZ8 A;  1QSS A;  5DQI A;  1KEJ A;  5KFB A;  3A0B U;  1NK5 A;  2A1J B;  2K8B B;  4PHP A;  4UAY A;  5JU5 A;  1L7M A;  5ALD A;  1H38 A;  1SWW A;  2EZX A;  2P6U A;  4GC7 A;  2KHV A;  2BCR A;  2K8A A;  4DLG A;  4PHA A;  1ZJN A;  3D2Q A;  1NK6 A;  3FM9 A;  2E8M A;  1QQ6 A;  1ZQJ A;  1ED1 A;  2YQE A;  3E2E A;  1JRP A;  3A0H U;  2HVI A;  5AM2 A;  1B0X A;  8ICI A;  3Q8R B;  1HUZ A;  2Y9U A;  5KG4 A;  2B6G A;  1S0N A;  2ZXH A;  2PI4 A;  1XWL A;  4PGY A;  3IRU A;  5ALJ A;  4QZG A;  2F77 X;  5HR7 A;  2IHN A;  4J9O A;  1Y88 A;  4UBB A;  3ZDD A;  2HHU A;  1KLN A;  1SV0 A;  2IMW P;  1UA1 A;  8ICH A;  3E0F A;  2YTU A;  4P0Q A;  3MGV A;  1OXJ A;  5B66 U;  3V6J A;  5HR6 A;  3Q8S B;  2PMZ C;  5KAF U;  2P66 A;  1N60 A;  1PK3 A;  4TUQ A;  1V9P A;  3VCB A;  2Q4T A;  5KT6 A;  3H8W A;  3BDP A;  4O3Q A;  5JTI A;  3RTV A;  3LWM A;  5A0L A;  3WU2 U;  2BCQ A;  3RRH A;  4OJP A;  3HRD D;  4I2J A;  4F2S A;  2LYA A;  4PHD A;  4FS2 A;  3PV8 A;  4DSL A;  3ZDC A;  1TKD A;  3VC8 A;  4RNM A;  8ICX A;  4NY8 A;  3MAB A;  4O3N A;  1RYS A;  5D4B A;  1S77 D;  3ONN A;  3SI8 A;  4B9M A;  7ICU A;  1DGS A;  1JN3 A;  2JH7 A;  4JV0 A;  2PXI A;  2W9C A;  3F5A A;  8ICR A;  4GXK A;  2L5Y A;  4C8M A;  1NK7 A;  3OTQ A;  3QU2 A;  2N1R A;  2B0C A;  2CPR A;  3H4B A;  2R8J A;  5HP4 A;  1NOM A;  2QLT A;  4EBC A;  3TAP A;  5CR0 A;  1IG6 A;  3AM9 A;  1X6J A;  3K75 D;  4OJ6 A;  1FIQ A;  4Q8E A;  1L5U A;  3HKZ F;  5KFR A;  2D8C A;  3QU5 A;  3FYH A;  3TAR A;  3F2B A;  2Y1I A;  2HOQ A;  3IG5 A;  2JRZ A;  3QNM A;  4IQW A;  8ICL A;  9ICT A;  1L7N A;  5HMM A;  3QU7 A;  5AI4 A;  1T8E A;  5BOL A;  3PMN A;  5KFY A;  5AKX A;  4QWB A;  3C23 A;  7ICI A;  4J9Q A;  2W9C B;  1WCN A;  4I2I A;  1D8B A;  4I2E A;  4P4M A;  4ED2 A;  4I2G A;  3UQ0 A;  2LKY A;  4AYB F;  3LVW A;  5D46 A;  3D2S A;  5J2C A;  4KLL A;  9ICW A;  5F9N A;  1SV4 A;  3SQI A;  2C2D A;  1IXR A;  2JHD A;  2HDO A;  5KG6 A;  1O08 A;  4R8U B;  1ZQF A;  1PVP A;  1UHU A;  2RLT A;  4EEK A;  5IIJ A;  3RH6 A;  2K8C B;  2W55 A;  2OXO A;  2BDU A;  4UB8 U;  2EZZ A;  1A0P A;  5AK3 A;  7ICS A;  2ZTE A;  2FMS A;  5ALX A;  5CJ7 A;  1SIJ A;  1CEZ A;  5AI9 A;  5JRT A;  2ZIW A;  1SB3 C;  4QWC A;  5L1K A;  1SGG A;  2LMR A;  1WUD A;  2R8H A;  3Q8L A;  2E8N A;  4BDP A;  4UB5 A;  5ALN A;  2VAN A;  3GDX A;  4F3O A;  3M1Y A;  8ICG A;  4J9R A;  2G07 A;  4NL9 A;  2ZIV A;  5L1J A;  1NK9 A;  2K4P A;  5J0U A;  2RDJ A;  8ICO A;  2KZZ A;  4Q43 A;  3PR4 A;  4CF5 A;  3FAH A;  5ALV A;  4USA A;  2GOL A;  2KIV A;  4YFK A;  2HHV A;  4OJO A;  3BQ7 A;  4QZF A;  1N61 A;  3RBD A;  4I2F A;  3JPQ A;  1DK3 A;  3KKA A;  3PSF A;  5CEH A;  4C4R A;  4F5P A;  5CWR A;  5EE9 A;  1WWU A;  3HX0 A;  5III A;  5ALM A;  2A1J A;  2G09 A;  1KKX A;  3I76 A;  1ZQB A;  1OW5 A;  3H7I A;  5KFF A;  3CP8 A;  2HCF A;  4YVZ A;  2D6F C;  4K4H A;  2EZY A;  1ZET A;  3M7D A;  1SL2 A;  1RZT A;  2EAM A;  1MSW D;  3RJJ A;  2PFQ A;  4JWN A;  1ZQZ A;  1K1Q A;  5CHG A;  4M2Y A;  4RQ2 A;  2W3S A;  3PZP A;  5DG9 A;  3ZDB A;  7ICE A;  3B0X A;  4ECY A;  4RQ8 A;  2AGQ A;  2KZM A;  1MC8 A;  4RPY A;  2BCV A;  5AKZ A;  1SZH A;  3MR5 A;  3G6X A;  1ZQK A;  3UXN A;  4X5V A;  4DOB A;  1S0M A;  2EAP A;  4C8K A;  5J0R A;  2DPJ A;  3SV4 A;  3GFK B;  3HP6 A;  3UMB A;  3PR5 B;  3BQ2 A;  3CYM A;  4C8N A;  4DQS A;  4PL2 A;  4DSJ A;  5KG1 A;  1Q46 A;  5KG7 A;  1LKY A;  1TK5 A;  4A8E A;  5DQG A;  5L1L A;  3QYP A;  3RB6 A;  4KX3 A;  7ICK A;  2MRL A;  3SR6 A;  3KTQ A;  7ICH A;  2ASD A;  2QKQ A;  4P0P A;  4R63 A;  4J9M A;  3QX7 A;  4C80 A;  4NJ8 A;  5KFA A;  2AQ0 A;  3S6J A;  5AI8 A;  3PX6 A;  4KLU A;  5ALS A;  2JEG A;  2KD1 A;  5J2E A;  2ATL A;  5DGB A;  4I27 A;  9ICK A;  2JEI A;  1CI4 A;  3OSP A;  5AIA A;  5J8Y A;  3EYZ A;  1X9X A;  4O3M A;  3OHB A;  3D2N A;  1CRX A;  3H0M B;  4B9S A;  1ZJM A;  3IDW A;  5K4L A;  2LPE A;  4ED8 A;  3AUO A;  9ICN A;  3Q8M A;  1XO1 A;  2RQ5 A;  4YXJ A;  4ED7 A;  4IQU A;  2MA1 A;  4ELV A;  4DQQ A;  4K4I A;  2F1I A;  5AKI A;  3GII A;  3ZD9 A;  4RT3 A;  1MQ3 A;  3CW2 C;  1JAL A;  1XU4 A;  1ZYQ A;  2ES6 A;  3WK8 A;  2WTF A;  2W7P A;  4F4X A;  4MEX A;  2FPL A;  4DF8 A;  2EQY A;  2QB1 A;  4B6J A;  1ZOL A;  2MUT A;  1ZQG A;  4OJL A;  1ZQC A;  2HBK A;  3FDS A;  1UQV A;  4RQ6 A;  3L5K A;  4F4K A;  4JV1 A;  3Q8Q B;  1ZQA A;  3C2L A;  3T3F A;  1S76 D;  3ALR A;  3JPN A;  4QIW F;  1ZQS A;  5G5G A;  3PSP A;  1ZQD A;  1BVS A;  3QZ7 A;  4TUS A;  4OO1 J;  5DB7 A;  2P6R A;  1F5S A;  5KT5 A;  1NK4 A;  4F4W A;  5KFS A;  5J2G A;  7ICF A;  2IOH A;  4IRD A;  4HYK A;  5IIM A;  2YML A;  2AH5 A;  5HHH A;  2ZJ5 A;  1HUO A;  1A77 A;  2F3N A;  3KZX A;  3N7R C;  4UBC A;  4C0Z A;  5J0W A;  4JUZ A;  3M6K A;  4M04 A;  2DUY A;  3IM1 A;  2E1E A;  3QXG A;  1S0V A;  7ICJ A;  2F8L A;  3IHQ B;  4DSE A;  1M6Y A;  2OEH A;  2MUT B;  4YD1 A;  1JX4 A;  3RJK A;  2I6X A;  4I2A A;  4JMU A;  5TIS U;  5CA7 A;  2V9W A;  4EX7 A;  4UAR A;  2XCA A;  4U7C A;  4KIT B;  2ESE A;  4UAW A;  2W43 A;  3GZF A;  3MR3 A;  3TAD C;  4FZL A;  2ASJ A;  2JMG A;  4F4Z A;  5DLF A;  9ICG A;  3UQ2 A;  5KFC A;  5KFH A;  2YMM A;  1RYR A;  1ZD3 A;  1RDF A;  2BQ3 A;  4Q8F A;  2J6S A;  2WAQ F;  4F5R A;  2KG5 A;  3UMG A;  4QIW C;  2ZIX A;  3F2C A;  1JI7 A;  4Y2X A;  4CCH A;  4EZ6 A;  4KLO A;  2BR0 A;  2W9A A;  5AI0 A;  2WB1 F;  2VJ5 A;  2HHQ A;  1X42 A;  3ZD8 A;  5AKK A;  1L3U A;  9ICE A;  3EPG A;  3SAF A;  3SD7 A;  1RYU A;  3BQ1 A;  2Y0S F;  2FMQ A;  3NUQ A;  9ICF A;  3QUQ A;  1HIW A;  1BNP A;  3SYZ A;  9ICC A;  1FFU A;  3RAQ A;  4QZ8 A;  5J2K A;  4MFA A;  1SZP A;  3BS7 A;  3JPT A;  4J9K A;  5G5H A;  4KMU A;  1X6I A;  2FDR A;  4R65 A;  4C4S A;  5AM3 A;  4TUR A;  8ICE A;  4FS1 A;  4ELT A;  5J0S A;  1BPZ A;  4FFD A;  1V97 A;  2HMX A;  3B0Y A;  4YN4 A;  4QZB A;  3GV8 B;  1KRP A;  2J6U A;  3C2K A;  1D8Y A;  4DL5 A;  4MF2 A;  5KFQ A;  1RQN A;  4GIB A;  3H8J A;  4M9H A;  5ALE A;  1K1S A;  4Y2S A;  1ZQY A;  1L6N A;  4MEY A;  5KG3 A;  3SAH A;  3DDH A;  2ZG6 A;  1SXE A;  3TAC B;  2HOF A;  1A76 A;  1KL9 A;  4DFD A;  1SKW A;  1X9W A;  4KLJ A;  4ACO A;  3OGU A;  1Z3E B;  2WHE A;  5ALI A;  2ZUB A;  4DQR A;  4G9B A;  4BWJ A;  4ECT A;  3TFR A;  3E58 A;  5KNI A;  3PSI A;  4M0A A;  1JRO A;  5EWE A;  5KTQ A;  4QZD A;  1JXE A;  1KFS A;  3QUB A;  2AU0 A;  1AQ6 A;  1WWV A;  3BZC A;  3OPX A;  1A6S A;  2W04 A;  5DBC A;  1IIP A;  3UXO A;  4KN4 A;  1D9F A;  2KNJ A;  2GH1 A;  2BPG A;  3KZI U;  1N2X A;  3N4M B;  5DBB A;  1O03 A;  4FZN A;  1ZQI A;  1V38 A;  1XSP A;  5J29 A;  9ICH A;  2O6K A;  2WF5 A;  4KLH A;  3C29 A;  1ZQH A;  2PFO A;  5BOM A;  1TK8 A;  5KFT A;  5ALP A;  5EOZ A;  2FI1 A;  2CN1 A;  5KFJ A;  3GIM A;  3EPI A;  4J9S A;  3K1R B;  3G6Y A;  2K89 A;  1WYG A;  2R8K A;  3HT3 A;  3IN5 A;  4F4Y A;  7ICG A;  1K5O A;  1T4G A;  2NO4 A;  4DL3 A;  3GIL A;  4YQW A;  3KOO A;  4HAI A;  2DKX A;  5AM4 A;  5ALF A;  3BS5 B;  2EAO A;  4RQM A;  3UPQ A;  2F2A B;  3WKD A;  1ZQ1 C;  7ICN A;  1YZ7 A;  2LYH A;  4PGX A;  1P7D A;  2KP7 A;  1BGX T;  1JXL A;  2HHT A;  4F92 B;  4NLG A;  2HBM A;  1KSP A;  5AKL A;  1XSN A;  2ZIX B;  5ALU A;  4O0I A;  4IS7 A;  4CNQ A;  2MSN A;  4QZA A;  2OYY A;  5J0X A;  5AIB A;  1VLB A;  4DQI A;  3I28 A;  3T5J A;  8ICU A;  3HIL A;  3RFA A;  1TAU A;  5KFX A;  2BCU A;  3GV5 B;  2M0N A;  3C1Z A;  2RRD A;  3Q8K A;  5KFU A;  4DSF A;  4NXZ A;  1S0O A;  2IBK A;  2XC9 A;  3LWL A;  2K4H A;  4XQ8 A;  5ALL A;  1ZQO A;  5E79 U;  3MBY A;  2UVW A;  4KLG A;  2GWS A;  1ECW A;  4NM2 A;  2HHS A;  5KT4 A;  1YT3 A;  2VIX A;  2KSO A;  3JPP A;  3F5E A;  2KIW A;  2FPM A;  4O3P A;  2KMD A;  3WKA A;  3TI0 A;  1T3N A;  2NRZ A;  5DG7 A;  5KFG A;  4ECU A;  5ALO A;  4YMN A;  1U45 A;  3ETR A;  4K4G A;  2JV3 A;  1WCL A;  3T79 A;  5TZV A;  2WFA A;  4C7Z A;  3H8S A;  3N7P D;  3T5K A;  2KTQ A;  2W8K A;  5HML A;  1BPB A;  1ZQP A;  2XY5 A;  1J2M A;  1Q3V A;  5B5E U;  1NKC A;  4OCZ A;  5DB9 A;  7ICO A;  4YR0 A;  2W11 A;  2F44 A;  4PHE A;  4R64 A;  4M9J A;  4P4O A;  1RXV A;  4DFK A;  4LZG A;  2PI5 A;  4O3S A;  1T3Q A;  1S5L U;  4MF8 A;  4PPX A;  3EW9 A;  1KFT A;  5EE0 A;  7ICQ A;  4EZ9 A;  2FLL A;  2FLP A;  2CRX A;  2KZ3 A;  1HJP A;  4ZOH C;  4KTQ A;  2VJ4 A;  2WF9 A;  4E0D A;  5J0P A;  2DF4 B;  2BHN A;  4KLD A;  4LVS A;  4EYI B;  1F0M A;  3M9O B;  4F93 B;  2E5S A;  5KFN A;  5AI6 A;  5EWF A;  4GC6 A;  8ICW A;  4DSK A;  4MHV A;  3AQF A;  4DCC A;  3C5G A;  1NK0 A;  5AKG A;  4BJQ A;  2EDU A;  5KFD A;  3PW7 A;  4WJ3 B;  1U49 A;  4EEY A;  9ICV A;  4RT2 A;  4TUP A;  1N62 A;  4F5Q A;  2XID A;  3MDC A;  3MGH A;  2XVT A;  2ZIW B;  1X9M A;  2R18 A;  4B9L A;  4UB6 U;  3H0L B;  5IIO A;  2HSZ A;  2H3I A;  4Y2J A;  4UQG A;  4CF4 A;  1T94 A;  4UB3 A;  1COK A;  4OD0 A;  4DL2 A;  1Z1V A;  2OM6 A;  4BXO A;  2QAR A;  1NJY A;  2JZB B;  3F2D A;  4ED6 A;  4RPZ A;  1GO3 F;  3K4G A;  4CDG A;  1Z4O A;  5F9L A;  4IRC A;  3QU4 A;  2QB0 B;  1U48 A;  7ICV A;  2H3F A;  2JR5 A;  2BGW A;  1C7Y A;  2AGP A;  5ALQ A;  2DQN B;  3HW8 A;  4I29 A;  3EUB 2;  9ICI A;  4QZ9 A;  2BPF A;  3JPS A;  1JIH A;  3H40 A;  8ICP A;  1U47 A;  3UM9 A;  3M9M B;  8ICQ A;  2HW3 A;  4KMO B;  1D9D A;  2ZUC A;  1QQ5 A;  4YMO A;  1FO4 A;  3SZ2 A;  1L3S A;  2R8G A;  1J2N A;  4DS5 A;  2IOF A;  3RB4 A;  3M8R A;  3DEE A;  2KV2 A;  1L8O A;  2AJQ A;  1ZQR A;  3LYS A;  3ISB A;  1RG6 A;  2EAN A;  3AU6 A;  4RQN A;  2ISO A;  3H0R B;  3NRW A;  9ICQ A;  2H3Z A;  3HPO A;  3C21 A;  1NNL A;  3GU3 A;  5DDY A;  3AEV A;  5ALR A;  1B22 A;  3RH4 A;  4J9P A;  2F76 X;  5KFW A;  1KDH A;  3KBB A;  3PW0 A;  1JUD A;  2LM4 A;  4Z6E A;  5J2F A;  4Z6C A;  4C8O A;  2YX8 A;  2LI6 A;  4DOA A;  1TV9 A;  4M47 A;  4C7Y A;  3SMV A;  1TK0 A;  3MC1 A;  2K60 A;  2IA6 A;  1PZN A;  2OHF A;  3AQE A;  1ZQL A;  3WKC A;  3B9J A;  3ED5 A;  4QJF B;  4O3R A;  1LVH A;  1TFR A;  3GIJ A;  4ECQ A;  2Y1J A;  1ZD4 A;  4CE6 A;  3ISC A;  5ALK A;  7ICM A; 
#chains in the Genus database with same CATH homology
 2OM6 A;  4P0P A;  2GOL A;  2KJ8 A;  3HKZ F;  4CRX A;  3F2D A;  2YB4 A;  1Q3U A;  1GO3 F;  2H3Q A;  4FZN A;  4OJO A;  4OJ5 A;  2KHV A;  4CDG A;  2YB1 A;  2K8A A;  3IP4 B;  3D2Q A;  3PSF A;  3IG8 A;  3F2B A;  3T79 A;  4ICA A;  3N7P D;  2H3F A;  3C29 A;  2HOQ A;  2ZIU A;  2HOI A;  3IG5 A;  2WB1 C;  1TAM A;  1OUQ A;  2W03 A;  1ED1 A;  2DQN B;  4NLB A;  2JH1 A;  1Q3V A;  1HEK A;  2KD1 A;  3KZX A;  2CN1 A;  4BX9 C;  2G09 A;  2HMX A;  4BUG A;  3N7R C;  3KFU F;  4PL1 A;  4KX5 A;  1MA7 A;  2ZXH A;  2K89 A;  2KHQ A;  4C0Z A;  4CGZ A;  4O3M A;  4KMO B;  3M6K A;  3IN5 A;  2Y0S C;  1Z19 A;  2F77 X;  2WAQ C;  2DGZ A;  3CP8 A;  3D2N A;  4P0Q B;  3AL0 B;  5HR7 A;  2E1E A;  2G5H B;  1URJ A;  3H0M B;  3ICX A;  3N7S C;  1PVQ A;  4U6P A;  1CRX A;  2F8L A;  3PST A;  2D6F C;  3M7D A;  1D8B A;  2KVC A;  4NWI A;  2G5I B;  3L3F X;  2LKY A;  3O0F A;  3LVW A;  4AYB F;  3D2S A;  2F2A B;  4QNL A;  1ZQ1 C;  4JMU A;  3DEE A;  3E0F A;  1L6N A;  2MA1 A;  2KV2 A;  3LVV A;  2NV3 A;  4P0Q A;  3MGV A;  1XO0 A;  1P7D A;  2KOB A;  2G0A A;  3SQI A;  4U7C A;  2LBO A;  2CRX A;  2HBM A;  2JHD A;  3LYS A;  3SAH A;  2OH2 A;  4P0P B;  2ZG6 A;  3K1Z A;  5CRX A;  2VJ4 A;  5KL1 B;  3PZP A;  2ZIX B;  3H0R B;  3NRW A;  5HR6 A;  2HOF A;  3GZF A;  2H3Z A;  4NLC A;  2PMZ C;  2G08 A;  1PVP A;  2RHF A;  3GU3 A;  2JMG A;  2KJ9 A;  4FZM A;  2VKQ A;  4FZL A;  3VCB A;  2W7P A;  2Q4T A;  2DF4 B;  5KL8 B;  3F53 A;  4ACO A;  2XIC A;  2OYY A;  2H3V A;  2K8C B;  1NZB A;  2ZIU B;  5A0L A;  2F76 X;  2E5S A;  4GFJ A;  4OJP A;  4OJL A;  2OXO A;  2WAQ F;  2HBK A;  2BDU A;  1SZH A;  2LYA A;  3RFA A;  5C0Y A;  2LYB A;  2ZXI A;  2ZIV B;  3M6Z A;  3C28 A;  1A0P A;  2KJ5 A;  3AQF A;  3CRX A;  2RP5 A;  3HKZ C;  2E1F A;  2Z7J A;  1DRG A;  4QIW C;  2G06 A;  2ZIX A;  3F2C A;  2M0N A;  2YX8 A;  3PSI A;  4AYB C;  2K4E A;  2ZIW A;  2RRD A;  4BJQ A;  2A3V A;  3SMV A;  3VC8 A;  2KKV A;  2JGA A;  4WJ3 B;  1F44 A;  3ONN A;  4FE3 A;  1UPH A;  2KKP A;  2XID A;  4NV0 A;  2WB1 F;  2JH7 A;  3AQE A;  2VJ5 A;  1WUD A;  3CYM A;  2XVT A;  2ZIW B;  4PL2 A;  3SAG A;  2HBJ A;  2K4H A;  3ALR A;  3F5A A;  2R18 A;  2PMZ F;  2LHT A;  4QIW F;  4A8E A;  3RF9 A;  3OPX A;  1PVR A;  1A6S A;  4IC9 A;  2N1R A;  2W04 A;  4KX3 A;  1IIP A;  2CPR A;  3PSP A;  3H0L B;  2MRL A;  1ECW A;  2KIC A;  1Z1B A;  2HBL A;  2KEY A;  1YT3 A;  2VIX A;  2H3I A;  3SAF A;  2G07 A;  4QJF B;  2Y0S F;  2KNJ A;  2K4I A;  2ZIV A;  2KIW A;  2XI9 A;  3F5E A;  4OO1 J;  2W7O A;  1T94 A;  2GH1 A;  2K8B B;  3NUQ A;  1XNS A;  1HIW A;  4OJ6 A;  5T14 A;  1KBU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...