2H3VA

Structure of the hiv-1 matrix protein bound to di-c8-phosphatidylinositol-(4,5)-bisphosphate
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
131
structure length
131
Chain Sequence
GARASVLSGGELDKWEKIRLRPGGKKQYKLKHIVWASRELERFAVNPGLLETSEGCRQILGQLQPSLQTGSEELRSLYNTIAVLYCVHQRIDVKDTKEALDKIEEEQNKSKKKAQQAAADTGNNSQVSQNY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for targeting HIV-1 Gag proteins to the plasma membrane for virus assembly.
pubmed doi rcsb
molecule keywords Gag polyprotein
source organism Human immunodeficiency virus 1
molecule tags Viral protein
total genus 33
structure length 131
sequence length 131
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2006-05-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00540 Gag_p17 gag gene protein p17 (matrix protein)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.90 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase; domain 1 2h3vA01
1L6NA 2LYAA 1ECWA 1TAMA 1ED1A 2H3FA 2N1RA 2HMXA 1UPHA 1A6SA 2K4IA 2NV3A 4JMUA 1HEKA 2LYBA 2H3IA 2K4EA 2K4HA 2H3ZA 2GOLA 2H3QA 4ICAA 2H3VA 4IC9A 1HIWA 2JMGA
chains in the Genus database with same CATH superfamily
4M47A 4MF2A 9ICEA 3FAHA 4PGYA 4F3OA 3MFIA 1X40A 1ZQBA 2F8LA 4IRDA 5C5JA 2ZJ8A 8ICAA 1D8BA 1T94A 2PXIA 5AK4A 3SAFA 3QUBA 4X5VA 1NOMA 3N7SC 5IIMA 1L5UA 3DEEA 4LZGA 2VA2A 5ALYA 1YT3A 1N5XA 1X9MA 2KICA 9ICFA 4EZ9A 4IQUA 4F4XA 3KHHA 3ZDEA 2O6KA 4M04A 4KLGA 1Z1BA 5H2FU 1QSSA 5AI5A 4AYBC 2HW3A 4YMNA 3RFAA 2HBMA 1NK8A 3SMVA 2BDUA 1DGJA 1JUDA 4CGZA 1AQ6A 2EAMA 1MQ2A 2Y0SF 2ASJA 2D6FC 5EWEA 4YCXA 1NJYA 3RJJA 2XY6A 2R18A 3M9NB 2NYVA 3UQ0A 4UB2A 2K4PA 9ICOA 2DQNB 4M2YA 2WTFA 1PK1A 2JGAA 4GLXA 5DB8A 4US8A 2R8IA 2VIXA 8ICFA 4TQRA 1ZD5A 3UMCA 1WCNA 3QU4A 1JXLA 5J8YC 2BCSA 1JI7A 5AIBA 2G06A 3WK5A 2XO7A 1COKA 4KLQA 4FFDA 3IDWA 3T5HA 5AI9A 2ZIXA 4PZNA 3FDSA 4EBCA 4C0ZA 1ZD3A 5KFTA 2ZXHA 5AK3A 2NRXA 1BPBA 5HMLA 4DSFA 2F1JA 1U45A 4TUQA 2PFQA 2UVRA 1ZQQA 2R8KA 7ICHA 4M9JA 2Y0SC 4QW8A 1QSLA 4KLLA 3RBDA 2PI5A 3PX4A 1T7PA 2KZZA 4ED6A 3RB3A 3ICXA 3WKDA 3C2MA 2W11A 5IINA 3U26A 5DG7A 3T5LA 4UBCA 4O5KA 4EEYA 4KLJA 8ICYA 3M9OB 2I1QA 2E8OA 1UA1A 1ZQCA 5KFRA 4DQIA 4C8LA 4B9TA 4JWMA 5B66U 1IXRA 3OPXA 9ICHA 4I27A 1P7DA 1X9SA 3I76A 2ZUBA 1UT5A 5L1JA 3KFUF 3LVWA 8ICVA 2HHUA 4PHEA 3V6JA 1O03A 1TE2A 4CNQA 4Y2VA 4F5QA 3N28A 7ICEA 2DBYA 4U6PA 5L9XA 1WYGA 3CP8A 1BNPA 2G08A 1J2MA 1KFTA 3TAQA 1RYSA 4FS2A 3FC4A 5J0QA 4Y2SA 2WF7A 3F2BA 2W9BA 5DLFA 2ESEA 4KLEA 2R8HA 2FMPA 2QARA 4NWIA 3GV8B 2XCPA 5AHXA 4CRXA 9ICRA 2G07A 4PJ0U 2XY5A 2E1EA 5KFJA 1WCLA 5KG6A 1VJ5A 1X6IA 2KJ8A 4B9LA 1BPDA 2A3VA 1L3UA 1ZRNA 1QLNA 4MFAA 7ICQA 4Y2YA 3C28A 3QUTA 4IQWA 4UAUA 1ECWA 3DDHA 3OSPA 3ISDA 3MBYA 5ALZA 5KFAA 4DOBA 5ALPA 2G5IB 3TAPA 1ZQGA 5CWRA 3OGUA 2JRZA 3C2LA 1IV8A 2PMZF 4C7YA 3JPNA 4XA5A 2H3ZA 2H3QA 5JUMA 4UARA 1JROA 5AKXA 3IHQB 2IHNA 5ALKA 4NLBA 3V72A 4ECUA 2XGPA 2P6RA 4P4MA 4GC6A 1ZQIA 2HDOA 5KTQA 4YMMA 4DEZA 1XO0A 1OUQA 1HEKA 4RT2A 1ZQSA 3TANA 2A1JA 3RH4A 4IQVA 8ICQA 2B6GA 5CHGA 4KN7A 7ICFA 4XQ8A 4DSKA 2HHQA 4F5PA 7ICMA 4XUSA 4YVZA 4KLIA 3C21A 2OEHA 1Z00B 5JRTA 3C2KA 4I28A 4F8RA 4F50A 3QEBZ 4MEXA 1SV4A 2OCEA 1ZQFA 2DF4B 3GIIA 4F91B 1FFUA 5KG1A 3F2CA 2HBLA 2PMZC 2GLEA 3LYSA 2WF9A 4P0PA 2KD1A 2W04A 1MA7A 4F2SA 4I2HA 2V4QA 2EH9A 3LWLA 5DB6A 2MUTB 3ETLA 1X42A 5DQGA 4IR1A 1KBUA 1ZJMA 3GQCA 3IP4B 4Y2TA 2KVCA 1U49A 2FPKA 3C1YA 1HUOA 2AH5A 3SEIA 4BX9C 2CXYA 5KAIU 1PUZA 5K4LA 1N61A 4Y2XA 1S76D 4F72A 4FBUA 4DCCA 5ALGA 2QB0B 4DQQA 3C1ZA 3T5JA 3MR6A 3V6KA 4JUZA 2BKEA 3SD7A 1DRGA 1SL1A 4DL4A 2KV2A 4IC9A 2LPEA 2G09A 3HKZF 2KN7A 2ZXIA 3THVA 1ZQWA 8ICBA 2DKXA 3T79A 5KFYA 3QNMA 4UB4A 4Q43A 4F4WA 1SB3C 3QYPA 2A19A 2H3IA 2K8AA 3OHAA 3UPQA 1ZQOA 1O08A 1ZQKA 5CRXA 7ICSA 4ECYA 5BOMA 1L7NA 2LMRA 5AM1A 2BQUA 2C2RA 4UAWA 2ZG6A 4O3OA 2NO4A 2KIWA 5KFNA 3RAXA 3AQEA 4J9SA 3TADA 5KFKA 4Y2UA 1BPXA 1D9DA 3Q8SB 1UCVA 3SYZA 2YN4A 1Q8KA 1HIWA 4DL5A 3NRWA 5KFBA 3LDAA 5BOLA 5DB7A 2KFNA 3HKZC 1VLBA 2ZJAA 1S5LU 4ZOHC 2HOQA 4BWJA 3ZDCA 1BPYA 2VANA 2DUYA 1HUZA 3D2QA 1ZJNA 2RDIA 5J2DA 4Z6FA 2HI0A 3V7JA 4Y2QA 1SL2A 3QUCA 4QJFB 4ECVA 5ALJA 3GILA 1DK2A 4DQPA 1KQQA 4KLMA 4R8UA 4M9GA 4DL2A 3Q8LA 4DFKA 1S0VA 3PX6A 3LVVA 3M6KA 4ED7A 1CRXA 2KKVA 1SXEA 1X9WA 2HHTA 2J6TA 4PHDA 2BPGA 1C7YA 3EPIA 4NLGA 4B9VA 4ELVA 1A6SA 3EW9A 4JMUA 2FPMA 1LKYA 2WF8A 1M6YA 5KFGA 3H0MB 2J6UA 1IIPA 3PX0A 4YP3A 2JZBA 2ZIVA 5G5GA 4QZBA 1PZNA 4YD2A 2ASDA 3V7KA 5J0YA 3CRXA 4FBTA 5HR7A 2DKZA 1CEZA 1BVSA 2YMLA 5J0SA 3MR3A 1Q3VA 5KL8B 4UATA 2AGOA 4F5NA 2VJ5A 2BPCA 4KLTA 5EE9A 4BUGA 5ALOA 2WB1F 4NLKA 4QNLA 3TQ1A 3TARA 4M9NA 2EQYA 4RUCA 2P35A 1SV0C 3ZDAA 1ZETA 1XS9D 9ICXA 3ORYA 2KP7A 4I2JA 4Z6CA 2AGQA 4NV0A 2BQRA 4KTQA 4OJLA 4KITB 1RXWA 2GOLA 2JXJA 4ICAA 2VJ4A 3KBBA 4DL7A 8ICNA 1N56A 1PVQA 4J9KA 3G6VA 4DL6A 5ALXA 1ZYQA 1XO1A 3TFRA 1MQ3A 4I2AA 2NRVA 4BXOB 9ICVA 3T3FA 2F2AB 9ICCA 3QEAZ 2OYYA 4UAYA 5KFIA 1BNOA 4Y2RA 3L3FX 2KE7A 2E8PA 2I6XA 3PW5A 5KFZA 5KFXA 2BQ3A 4MF8A 3HRDD 3RBEA 9ICLA 4C4TA 1FO4A 5KT6A 4B9SA 2JMGA 2F44A 2WB1C 4F93B 4MHVA 1RG6A 5HMMA 4EBEA 4ZH4A 5J2EA 9ICKA 1Q46A 4OCZA 4MEYA 2EAPA 2KZMA 5KT2A 1J97A 3ONNA 3N7PD 4EZ6A 3GIKA 7ICGA 1KL9A 3UQ2A 5CP2A 3DV9A 5HHIA 2KFZA 4RQ5A 2K8CB 5HNKA 4KX5A 4ECQA 1JRPA 2HCFA 2K89A 2HBJA 2FI1A 4F71A 8ICUA 1NKEA 5KFOA 3I1YA 4RQ2A 1ZQJA 1PVPA 1RXVA 5CR0A 4R63A 1S8OA 1D9FA 2OHFA 4E0DA 2MA1A 4GIBA 4F4ZA 1N48A 1C20A 1X9XA 4KLHA 3QUQA 5KT4A 1FFVA 3NUQA 1Y88A 3QU9A 3EZ5A 3M9MB 1B22A 3TI0A 3A0BU 3NTUA 4QWBA 2K60A 5BPCA 5ALEA 1ZD4A 2JHDA 1WUDA 1K5OA 1RQNA 1IM4A 4QZDA 4O5CA 2RHFA 2W9CB 2IOFA 3MR2A 5ALMA 1LB2B 3L4PA 4ED3A 5J0RA 2JEGA 4F92B 2HMXA 3WK4A 4JK1A 2L5YA 3AL0B 2ASLA 4CF5A 5L1KA 4TUPA 4QZGA 1BPZA 2W03A 3QU5A 4PL2A 3GU3A 5DGBA 5KL1B 2HHXA 5ALIA 3KHLA 3PW4A 1KFDA 4FS1A 1ZQHA 1NI3A 1KTQA 5J0WA 2YB1A 3SQIA 1L7OA 5AKJA 3G6XA 4UBBA 1N5WA 2ZTCA 4U7CA 5AI4A 2W7PA 1N2XA 1TVAA 2BCVA 3H0RB 5AM4A 5CEHA 5D46A 4OD0A 5CA7A 4USAA 5DGAA 2RDJA 4WJ3B 1YZ6A 1J2NA 2AQ4A 5AKHA 2RQ5A 3RJIA 1WWVA 5DLGA 2YTUA 1ZQXA 4RQ0A 1TFRA 3N97B 1NJZA 1AROP 3TKAA 3C23A 4ELUA 1TK0A 1U9LA 5EWFA 2WHEA 1SWVA 4RPXA 2NRZA 4YD1A 3PR4A 4KX3A 2DPIA 4LJXA 5ALDA 1WWUA 3SR6A 5EE3A 4C8MA 4K4GA 9ICUA 2F1HA 3PW7A 3ZI4A 4RQMA 1SKWA 2EZYA 1UHUA 1CI4A 3SV3A 2PI4A 5L1LA 4PHAA 2W9AA 5AKLA 4J03A 5DB9A 4G3IA 1LVHA 3V6HA 4OJ6A 3ETRA 4IRKA 2HBKA 8ICPA 5J0XA 3B9JA 4M6WB 4HAIA 1SXDA 4RQ3A 4I2GA 5JU5A 3TACB 3PV8A 1OW5A 4ED0A 8ICIA 2PKEA 4MFCA 4NJ8A 2ZIUA 2M9NA 2XCAA 2LHTA 4QIWF 4ECTA 2J6SA 2BCRA 4Z6EA 2WAQC 2ZIWB 5JTIA 3Q8MA 3PR5B 4P0QA 1ZQ1C 3MDCA 4RQ8A 2FPLA 4PGXA 4DQSA 1ZQRA 5TISU 3RAQA 3BQ7A 5D49A 1KFSA 2XIDA 3PSFA 5ALWA 1URJA 1ZOLA 2ODGA 2F3NA 3M8RA 1QH9A 3Q8QB 1NZPA 2D8CA 2Y9UA 3BS5A 3H4DA 1N63A 3GV5B 2YQEA 5TZVA 3PSPA 4PL1A 4EYIB 3RH6A 8ICJA 3NS1A 3KHRA 2AHOB 4Q45A 2XVTA 1CUKA 3C29A 1T4GA 4DL3A 2IA6A 2Y1IA 3CNHA 4QIWC 1U47A 2BHNA 3BQ2A 2EAOA 4QWAA 2KMDA 1L8LA 4I2EA 4FZLA 3JPTA 3H8SA 2NV3A 4ECXA 1UT8A 2KEYA 1ZQLA 8ICGA 2KNJA 2AU0A 5KFWA 3AMZA 4YFKA 3IRUA 2AXTU 1S97A 1ZQPA 8ICOA 3OJUA 2FDRA 2QB1A 2EZZA 1PK1B 2C28A 4AP9A 2H3FA 1TK8A 4RNOA 1QQ5A 5A0LA 3SV4A 3AU2A 4XRHA 3C5GA 4YXJA 3PMNA 2E5SA 2RLTA 2IOHA 4RPYA 2ZIXB 3RB0A 3NRZA 2B0CA 2JV3A 4O3NA 3GZFA 3D6JA 4YR0A 4NLZA 3PO5A 1JX4A 2Y1JA 2DWQA 3KZIU 1Q3UA 4QZHA 2DGZA 3WKAA 3MR5A 8ICEA 1ZQUA 4GFJA 4DFJA 2R8GA 2XGQA 1U4BA 4O3MA 4GXKA 5GTHU 5CJ7A 4US9A 5DBAA 1MSWD 1TAUA 4KN4A 4QWCA 2OWOA 4B6JA 3NGDA 2RRDA 3MGVA 3BQTA 4I2FA 2N1RA 3E58A 1L7PA 1DXSA 3Q8PB 2BZFA 1NKBA 5KG4A 7ICNA 3HILA 3KKAA 1UQVA 1ZQAA 2YMPA 4QZFA 4C8KA 2HSZA 3MABA 3QU7A 3RJEA 3AN1A 2PFNA 3NVVA 4EX7A 5KG7A 5KFPA 2XC9A 2FMQA 2F8KA 4FZNA 8ICXA 4QWDA 2QLTA 3BDPA 3O0FA 1S77D 1PK3A 3WK8A 3LK9A 2C22A 3PO4A 2BR0A 2YB4A 1Z1VA 3H8JA 2ES6A 5G5HA 4JV1A 1KKXA 1NK9A 3GDXA 4YG2A 2G5HB 1VDVA 1T3QA 3OTQA 4JB3A 5DBBA 1SIJA 3T5KA 5KG2A 2W9BB 1NNLA 2QARB 2AJQA 5DDYA 1S0OA 4J9RA 2FE9A 4GXIA 1SZPA 3BZCA 7ICKA 5D4BA 3WKCA 1F0MA 3WKBA 5ALUA 4O3PA 4JWNA 2ZUDA 5J2JA 2LBOA 1SZHA 2E3TA 2E1FA 2W43A 4M0AA 1UA0A 4BWMA 3UM9A 3MGIA 4M9LA 4TQSA 5DBCA 1KDHA 4PPXA 2H3VA 1TK5A 1DOQA 2GH1A 3GV7B 4ELTA 3F2DA 1L6NA 2DL0A 5AK5A 4J9OA 5KFUA 5HP4A 1RYRA 5KG0A 9ICSA 3K75D 3UXPA 4DSIA 1NK5A 4UASA 5ALVA 3HT3A 4EEKA 2RP5A 3K1ZA 1NK6A 2XY7A 2QKQA 1KLNA 4RNNA 1ZQEA 1X6JA 2E8NA 4ECSA 2W7OA 4J9QA 4UB5A 3D2NA 3UMBA 4QWEA 4K4IA 4OJPA 2HHSA 4M6WA 3PSIA 1A76A 8ICRA 1FIQA 3RRGA 4IR9A 2A1JB 3IM1A 2EDUA 3RTVA 4UW9A 4DWIA 2BCQA 4QZCA 9ICWA 1ZD2P 4OJ5A 3QZ8A 2WF6A 1ZQDA 1V38A 5J29A 2JEFA 4OO1J 2KVSA 3H0LB 1PVRA 2E8MA 2W3RA 4I2CA 5ALLA 3SI8A 2KSOB 2YMMA 5AI0A 3B0XA 4DFDA 3JPQA 4OJOA 4EENA 2OXOA 4RT3A 4RQNA 2FJ6A 1UPHA 5KAFU 5AKEA 4P0PB 8ICKA 2KJ9A 1D8LA 3EUB2 4F4YA 1MN8A 2K4EA 5DKWA 4DLGA 3OJSA 4Q8EA 4UB8U 5ALNA 9ICTA 2C2DA 4KLUA 4C4RA 3EYZA 3SZ2A 1Z00A 1ED1A 4GXJA 5J2KA 2W9MA 5AICA 4NL9A 4O0IA 1S10A 5ALSA 5L1IA 1XSPA 2F77X 4Z6DA 3TFSA 1KN5A 3NVYA 4F5OA 2AQ0A 5KT7A 1RZTA 4BGDA 4JV2A 2FLPA 5EWGA 3M1YA 2LYAA 1XWLA 4QZ8A 3FYHA 3N7RC 4RQ6A 2V9WA 2MUTA 4C8OA 3GIJA 1K1QA 3JPPA 3K1RB 4IRCA 4FZMA 4CF3A 5J0OA 2OH2A 3QX7A 3ISBA 4NLNA 4J9PA 1KSPA 1HJPA 3SAGA 3E2EA 3CYMA 5F9LA 1L7MA 5DQHA 3UXNA 3RR8A 7ICTA 3M7DA 3H4BA 1WG8A 2MAXA 2XI9A 1GO3F 5AKKA 4C4SA 2QB0A 3BS7A 1OXJA 3PZPA 5AIAA 4I2IA 3KKAC 4YQWA 4DSLA 4LVSA 5J2AA 8ICTA 4TURA 4DLEA 5DG9A 3ZD8A 4PH5A 4BJQA 1BPEA 1T3NA 3TADC 4A8EA 7ICPA 4FO6A 2MU2A 5T14A 3MC1A 2Z7JA 4C80A 4J9NA 4CCHA 3AEVA 5HR6A 2H5XA 3KTQA 3E0FA 4O3RA 4HYKA 8ICMA 3PVXA 2HVHA 5AM0A 4B9MA 1Z3EB 4IL6U 2ZUCA 8ICWA 4CF4A 1NK0A 2F76X 5ALQA 4ECRA 1NKCA 2YMQA 1S9FA 5AM3A 3MGHA 5KG5A 1NJWA 3F53A 5C0YA 2JEJA 2FLNA 4F4KA 4ED8A 4ACOA 1SWWA 3IN5A 3PSTA 3BQ0A 9ICMA 1BGXT 1V97A 3NVWA 3UMGA 2LI6A 3QE9Y 4R8UB 4O9MA 2WFAA 1Z4OA 1N62A 2LYBA 3RJKA 3JPSA 2FLLA 2IBKA 2BPFA 2CN1A 3HJEA 5IIKA 1Z4NA 5FP0A 9ICJA 3Q8RB 1S0NA 3F5AA 3MDAA 3C5FA 3PNCA 2KHQA 5DQIA 3HW8A 4UB6U 2WAQF 3M6ZA 3BZKA 1F5SA 1LKYB 3OSNA 1N60A 2G0AA 3HWTA 2ATLA 3KZXA 5L1MA 2JH7A 4YR3A 9ICNA 2GO7A 2YY6A 2KKPA 2JZBB 2ZIVB 3RJHA 5EE0A 2BCUA 5J0TA 1ZQZA 4RQ1A 5AI6A 7ICIA 3RF9A 2KIVA 3FM9A 3ZD9A 1X66A 2W55A 4RZRA 9ICGA 3Q8KA 1JXEA 1V85A 2LKYA 3NVZA 4DFMA 2A1AA 2CRXA 4DSJA 2VA8A 2V4RA 1T8EA 2ZJ5A 5AM5A 4QZAA 4RU9A 2NRWA 4ECZA 1L3VA 3UXOA 4EX6A 9ICQA 5KFLA 3BQ1A 5KFDA 1DGSA 5AM2A 4MFFA 1LV5A 3RJFA 4O5EA 4I2BA 3L5KA 4UB1A 2HHWA 7ICRA 2W8LA 2P66A 5F9NA 2DPJA 3IG8A 1TAQA 2HOIA 2W54A 1NK4A 4YXMA 3MFHA 1B43A 1DK3A 5J2GA 3GFKB 1K1SA 3PW2A 4P4OA 4JV0A 1ZQVA 5AKIA 2LYHA 5KFFA 2ISOA 4Q8FA 5J2IA 2I5HA 1RDFA 2NO5A 9ICAA 5J2CA 4KMOB 2WF5A 4DS5A 2UVVA 1SV0A 2JR5A 2KHVA 2K8BB 3H40A 1S0MA 2D3DA 4DQRA 5IIOA 7ICJA 4R64A 2C2EA 3IV6A 4CE6A 5KT3A 4NM2A 2VA3A 2DFLA 3VC8A 5ALTA 8ICHA 2HOFA 1SGGA 4KMUA 4DF4A 4B9UA 3RH5A 4NL9C 4UB3A 4RQ7A 3B0YA 5KFQA 4ED1A 4QZEA 2K4IA 5EE1A 4F2RA 5KFCA 1NJXA 4BXOA 4QZIA 3QXGA 2BGWA 3S6JA 2M0NA 5F3XB 2KSOA 5AKGA 1D8YA 1ZQTA 4KLOA 2KZ3A 2KTQA 2I9GA 1X2IA 9ICPA 5KFMA 5KNIA 5HHHA 5J0UA 4ECWA 5CB1A 1XSNA 5ALRA 5B5EU 4RNMA 2PFPA 3WU2U 4R66A 4J9MA 2MRLA 2W3SA 2JH1A 3RB4A 1A77A 4PGQA 3RR7A 2OM6A 4UAZA 4QW9A 5J2FA 5ALFA 2YX8A 1B0XA 3RB6A 4P2HA 3K4GA 1JIHA 7ICUA 3AUOA 2HVIA 1RYUA 2KK0A 7ICLA 3OHBA 1TAMA 9ICIA 1RM6C 2CPRA 3ED5A 5DDMA 5KFHA 2XICA 5IIIA 3KOOA 3PMLA 5IILA 3AM9A 3ZDDA 1EXNA 3QU2A 1L3SA 3AQFA 4RUAA 1KW4A 2UVWA 1L3TA 3SAHA 4FE3A 4DF8A 3JPRA 1SKRA 2ZTDA 1H38A 8ICLA 1ZRMA 4PZOA 4QZ9A 2R8JA 4I29A 3M8SA 2BDPA 4DSEA 1XC9A 5KFEA 5J8YA 1QQ6A 2ZTEA 2MSNA 4C7ZA 3ISCA 2W8KA 3ALRA 3R9KA 5J0PA 4PHPA 3A0HU 2VKQA 5DG8A 2W9CA 4NXZA 1JN3A 1JMSA 4NLCA 2HHVA 5EOZA 3G6YA 3H7IA 1TV9A 3LWMA 1JALA 1XU4A 1RQLA 1ZQNA 2Q0ZX 2ALZA 4YMOA 4KLDA 4C8NA 3F5EA 1QCKA 1NK7A 2Y9TA 3KD3A 4EYHB 1XSLA 1COOA 3EWAA 1KEJA 2IMWP 7ICOA 2B21A 5KFSA 1Z19A 1YZ7A 4DS4A 5AKZA 4CDGA 2AGPA 3H8WA 4I2DA 1MC8A 2FMSA 4LZDA 3D2SA 3WK9A 1B4FA 1SL0A 3NASA 4P4PA 4R65A 1ZQYA 2KOBA 5KT5A 3EPGA 4UAVA 5AI8A 3H8MA 5KFVA 1TKDA 1RPLA 2NRTA 2IOFK 3V7LA 1F44A 4TUSA 3HPOA 1QQ7A 4Y2JA 2F1IA 2EZXA 3N4MB 4EELA 3JPOA 1V9PA 4GC7A 4G9BA 8ICCA 1L8OA 2P6UA 4NY8A 2EANA 3VCBA 1NZBA 2ISPA 2PFOA 3PY8A 3RJGA 1A0PA 3AU6A 1FEZA 8ICSA 4DFPA 3KHGA 4BDPA 1SKSA 3WK7A 2KG5A 4NM1A 3J81j 2LM4A 3GIMA 5J2BA 2ZIUB 4IS7A 4O3SA 4DOAA 5AKYA 3HX0A 3WKEA 4ED2A 2GWSA 2LM1A 4DO9A 4DOCA 1U48A 3HP6A 4Y2PA 5GTIU 4EBDA 5ALHA 7ICVA 1KRPA 4YR2A 4O3QA 4P0QB 3SENA 5J2HA 4F5RA 2UVUA 5IIJA 1QSYA 2Q4TA 4UQGA 5KG3A 4K4HA 2IHMA 3QZ7A 4Q44A 5E79U 3ZDBA 3PW0A 2K4HA 1XNSA 3I28A 3CW2C 4YN4A 4RQ4A 9ICBA 3BS5B 4IQTA 1QTMA 4M9HA 4KLSA 1ZQMA 8ICZA 5AK6A 3RRHA 2KJ5A 4AYBF 1ZXIA 3IG5A 4J9LA 2ZIWA 4KLFA 4B9NA 2JEIA 3WK6A 1IG6A 3BJYA 4RPZA
chains in the Genus database with same CATH topology
3IN5A 1L6NA 3PSTA 2RRDA 3MGVA 1TAMA 1ED1A 3LYSA 2HOIA 2N1RA 1F44A 4P0PA 2KD1A 2W04A 1MA7A 2CPRA 2XVTA 2F8LA 2KJ8A 3HKZC 2Y0SC 3C29A 2XICA 2A3VA 4NV0A 1T94A 2F77X 2HOQA 1D8BA 2LYBA 3SAFA 3AQFA 4QIWC 2JHDA 3D2QA 1WUDA 4OJLA 3VCBA 3ICXA 3N7SC 1NZBA 1KBUA 3IP4B 2RHFA 2KVCA 2GOLA 3DEEA 2CN1A 4ICAA 3SAHA 1A0PA 2RP5A 2VJ4A 3K1ZA 4FE3A 3C28A 4QJFB 4KMOB 4BX9C 1PVQA 2LYAA 1ECWA 3F5AA 4FZNA 2KHVA 1YT3A 2K8BB 2HMXA 3N7RC 2KICA 2W7OA 4FZLA 2KHQA 3AL0B 2ZIUB 3O0FA 3D2NA 2WAQF 2G5IB 2NV3A 3M6ZA 4OJPA 4FZMA 2KEYA 2OH2A 4OJ6A 3PSIA 2F2AB 3ALRA 2KNJA 2HBKA 1Z1BA 2OYYA 2PMZF 2YB4A 2W03A 2VKQA 4PL2A 4AYBC 3SAGA 3L3FX 3RFAA 3LVVA 2G0AA 3GU3A 2H3ZA 2HBMA 3M6KA 3SMVA 5KL1B 3VC8A 3CYMA 2BDUA 2H3QA 3KZXA 1DRGA 2HOFA 4CGZA 3OPXA 1CRXA 4NLCA 2JH7A 2KV2A 4IC9A 1P7DA 2KKVA 2G09A 3HKZF 2Y0SF 2ZXIA 4NLBA 4P0QB 2JMGA 3M7DA 2KKPA 2ZIVB 2H3FA 2D6FC 2ZIUA 2YB1A 2WB1C 2XI9A 1GO3F 3T79A 3SQIA 1A6SA 2K4IA 2G5HB 3KFUF 2LHTA 3LVWA 4QIWF 4OJ5A 3PZPA 2Q4TA 5A0LA 3NRWA 4JMUA 2R18A 2M0NA 4U7CA 3F5EA 1XO0A 1OUQA 1HEKA 3RF9A 2W7PA 4OO1J 2H3IA 2K8AA 3H0LB 3H0MB 4BJQA 1PVRA 2DQNB 3H0RB 2WAQC 2K4HA 2ZIWB 1XNSA 1IIPA 3ONNA 3N7PD 4A8EA 2E5SA 1Z19A 2JGAA 2ZIXB 4P0QA 4CDGA 5T14A 4OJOA 2Z7JA 1ZQ1C 2LKYA 5CRXA 2OXOA 4WJ3B 2ZIVA 4U6PA 3GZFA 5HR6A 3CP8A 2VIXA 2K8CB 2G08A 4KX5A 3E0FA 3F2DA 2K89A 2HBJA 2MRLA 3CRXA 1UPHA 2KJ5A 2CRXA 2JH1A 3D2SA 2ZG6A 5HR7A 3F2BA 4AYBF 2G06A 1Q3UA 4P0PB 1PVPA 2LBOA 2DGZA 2OM6A 2KJ9A 3IG5A 1Q3VA 1SZHA 2XIDA 3PSFA 3IG8A 1URJA 2E1FA 2KOBA 2ZIWA 4NWIA 5KL8B 2VJ5A 2YX8A 2K4EA 2KIWA 4CRXA 4GFJA 2ZIXA 4BUGA 3AQEA 4O3MA 2F76X 2MA1A 2DF4B 2WB1F 4C0ZA 4QNLA 2H3VA 2G07A 3F53A 3F2CA 2ZXHA 3NUQA 3PSPA 5C0YA 2GH1A 2HBLA 1HIWA 2PMZC 4PL1A 2E1EA 4KX3A 4ACOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1L6N A;  2LYA A;  1ECW A;  1TAM A;  1ED1 A;  2H3F A;  2N1R A;  2HMX A;  1UPH A;  1A6S A;  2K4I A;  2NV3 A;  4JMU A;  1HEK A;  2LYB A;  2H3I A;  2K4E A;  2K4H A;  2H3Z A;  2GOL A;  2H3Q A;  4ICA A;  2H3V A;  4IC9 A;  1HIW A;  2JMG A; 
#chains in the Genus database with same CATH topology
 4M47 A;  4MF2 A;  9ICE A;  3FAH A;  4PGY A;  4F3O A;  3MFI A;  1X40 A;  1ZQB A;  2F8L A;  4IRD A;  5C5J A;  2ZJ8 A;  8ICA A;  1D8B A;  1T94 A;  2PXI A;  5AK4 A;  3SAF A;  3QUB A;  4X5V A;  1NOM A;  3N7S C;  5IIM A;  1L5U A;  3DEE A;  4LZG A;  2VA2 A;  5ALY A;  1YT3 A;  1N5X A;  1X9M A;  2KIC A;  9ICF A;  4EZ9 A;  4IQU A;  4F4X A;  3KHH A;  3ZDE A;  2O6K A;  4M04 A;  4KLG A;  1Z1B A;  5H2F U;  1QSS A;  5AI5 A;  4AYB C;  2HW3 A;  4YMN A;  3RFA A;  2HBM A;  1NK8 A;  3SMV A;  2BDU A;  1DGJ A;  1JUD A;  4CGZ A;  1AQ6 A;  2EAM A;  1MQ2 A;  2Y0S F;  2ASJ A;  2D6F C;  5EWE A;  4YCX A;  1NJY A;  3RJJ A;  2XY6 A;  2R18 A;  3M9N B;  2NYV A;  3UQ0 A;  4UB2 A;  2K4P A;  9ICO A;  2DQN B;  4M2Y A;  2WTF A;  1PK1 A;  2JGA A;  4GLX A;  5DB8 A;  4US8 A;  2R8I A;  2VIX A;  8ICF A;  4TQR A;  1ZD5 A;  3UMC A;  1WCN A;  3QU4 A;  1JXL A;  5J8Y C;  2BCS A;  1JI7 A;  5AIB A;  2G06 A;  3WK5 A;  2XO7 A;  1COK A;  4KLQ A;  4FFD A;  3IDW A;  3T5H A;  5AI9 A;  2ZIX A;  4PZN A;  3FDS A;  4EBC A;  4C0Z A;  1ZD3 A;  5KFT A;  2ZXH A;  5AK3 A;  2NRX A;  1BPB A;  5HML A;  4DSF A;  2F1J A;  1U45 A;  4TUQ A;  2PFQ A;  2UVR A;  1ZQQ A;  2R8K A;  7ICH A;  4M9J A;  2Y0S C;  4QW8 A;  1QSL A;  4KLL A;  3RBD A;  2PI5 A;  3PX4 A;  1T7P A;  2KZZ A;  4ED6 A;  3RB3 A;  3ICX A;  3WKD A;  3C2M A;  2W11 A;  5IIN A;  3U26 A;  5DG7 A;  3T5L A;  4UBC A;  4O5K A;  4EEY A;  4KLJ A;  8ICY A;  3M9O B;  2I1Q A;  2E8O A;  1UA1 A;  1ZQC A;  5KFR A;  4DQI A;  4C8L A;  4B9T A;  4JWM A;  5B66 U;  1IXR A;  3OPX A;  9ICH A;  4I27 A;  1P7D A;  1X9S A;  3I76 A;  2ZUB A;  1UT5 A;  5L1J A;  3KFU F;  3LVW A;  8ICV A;  2HHU A;  4PHE A;  3V6J A;  1O03 A;  1TE2 A;  4CNQ A;  4Y2V A;  4F5Q A;  3N28 A;  7ICE A;  2DBY A;  4U6P A;  5L9X A;  1WYG A;  3CP8 A;  1BNP A;  2G08 A;  1J2M A;  1KFT A;  3TAQ A;  1RYS A;  4FS2 A;  3FC4 A;  5J0Q A;  4Y2S A;  2WF7 A;  3F2B A;  2W9B A;  5DLF A;  2ESE A;  4KLE A;  2R8H A;  2FMP A;  2QAR A;  4NWI A;  3GV8 B;  2XCP A;  5AHX A;  4CRX A;  9ICR A;  2G07 A;  4PJ0 U;  2XY5 A;  2E1E A;  5KFJ A;  1WCL A;  5KG6 A;  1VJ5 A;  1X6I A;  2KJ8 A;  4B9L A;  1BPD A;  2A3V A;  1L3U A;  1ZRN A;  1QLN A;  4MFA A;  7ICQ A;  4Y2Y A;  3C28 A;  3QUT A;  4IQW A;  4UAU A;  1ECW A;  3DDH A;  3OSP A;  3ISD A;  3MBY A;  5ALZ A;  5KFA A;  4DOB A;  5ALP A;  2G5I B;  3TAP A;  1ZQG A;  5CWR A;  3OGU A;  2JRZ A;  3C2L A;  1IV8 A;  2PMZ F;  4C7Y A;  3JPN A;  4XA5 A;  2H3Z A;  2H3Q A;  5JUM A;  4UAR A;  1JRO A;  5AKX A;  3IHQ B;  2IHN A;  5ALK A;  4NLB A;  3V72 A;  4ECU A;  2XGP A;  2P6R A;  4P4M A;  4GC6 A;  1ZQI A;  2HDO A;  5KTQ A;  4YMM A;  4DEZ A;  1XO0 A;  1OUQ A;  1HEK A;  4RT2 A;  1ZQS A;  3TAN A;  2A1J A;  3RH4 A;  4IQV A;  8ICQ A;  2B6G A;  5CHG A;  4KN7 A;  7ICF A;  4XQ8 A;  4DSK A;  2HHQ A;  4F5P A;  7ICM A;  4XUS A;  4YVZ A;  4KLI A;  3C21 A;  2OEH A;  1Z00 B;  5JRT A;  3C2K A;  4I28 A;  4F8R A;  4F50 A;  3QEB Z;  4MEX A;  1SV4 A;  2OCE A;  1ZQF A;  2DF4 B;  3GII A;  4F91 B;  1FFU A;  5KG1 A;  3F2C A;  2HBL A;  2PMZ C;  2GLE A;  3LYS A;  2WF9 A;  4P0P A;  2KD1 A;  2W04 A;  1MA7 A;  4F2S A;  4I2H A;  2V4Q A;  2EH9 A;  3LWL A;  5DB6 A;  2MUT B;  3ETL A;  1X42 A;  5DQG A;  4IR1 A;  1KBU A;  1ZJM A;  3GQC A;  3IP4 B;  4Y2T A;  2KVC A;  1U49 A;  2FPK A;  3C1Y A;  1HUO A;  2AH5 A;  3SEI A;  4BX9 C;  2CXY A;  5KAI U;  1PUZ A;  5K4L A;  1N61 A;  4Y2X A;  1S76 D;  4F72 A;  4FBU A;  4DCC A;  5ALG A;  2QB0 B;  4DQQ A;  3C1Z A;  3T5J A;  3MR6 A;  3V6K A;  4JUZ A;  2BKE A;  3SD7 A;  1DRG A;  1SL1 A;  4DL4 A;  2KV2 A;  4IC9 A;  2LPE A;  2G09 A;  3HKZ F;  2KN7 A;  2ZXI A;  3THV A;  1ZQW A;  8ICB A;  2DKX A;  3T79 A;  5KFY A;  3QNM A;  4UB4 A;  4Q43 A;  4F4W A;  1SB3 C;  3QYP A;  2A19 A;  2H3I A;  2K8A A;  3OHA A;  3UPQ A;  1ZQO A;  1O08 A;  1ZQK A;  5CRX A;  7ICS A;  4ECY A;  5BOM A;  1L7N A;  2LMR A;  5AM1 A;  2BQU A;  2C2R A;  4UAW A;  2ZG6 A;  4O3O A;  2NO4 A;  2KIW A;  5KFN A;  3RAX A;  3AQE A;  4J9S A;  3TAD A;  5KFK A;  4Y2U A;  1BPX A;  1D9D A;  3Q8S B;  1UCV A;  3SYZ A;  2YN4 A;  1Q8K A;  1HIW A;  4DL5 A;  3NRW A;  5KFB A;  3LDA A;  5BOL A;  5DB7 A;  2KFN A;  3HKZ C;  1VLB A;  2ZJA A;  1S5L U;  4ZOH C;  2HOQ A;  4BWJ A;  3ZDC A;  1BPY A;  2VAN A;  2DUY A;  1HUZ A;  3D2Q A;  1ZJN A;  2RDI A;  5J2D A;  4Z6F A;  2HI0 A;  3V7J A;  4Y2Q A;  1SL2 A;  3QUC A;  4QJF B;  4ECV A;  5ALJ A;  3GIL A;  1DK2 A;  4DQP A;  1KQQ A;  4KLM A;  4R8U A;  4M9G A;  4DL2 A;  3Q8L A;  4DFK A;  1S0V A;  3PX6 A;  3LVV A;  3M6K A;  4ED7 A;  1CRX A;  2KKV A;  1SXE A;  1X9W A;  2HHT A;  2J6T A;  4PHD A;  2BPG A;  1C7Y A;  3EPI A;  4NLG A;  4B9V A;  4ELV A;  1A6S A;  3EW9 A;  4JMU A;  2FPM A;  1LKY A;  2WF8 A;  1M6Y A;  5KFG A;  3H0M B;  2J6U A;  1IIP A;  3PX0 A;  4YP3 A;  2JZB A;  2ZIV A;  5G5G A;  4QZB A;  1PZN A;  4YD2 A;  2ASD A;  3V7K A;  5J0Y A;  3CRX A;  4FBT A;  5HR7 A;  2DKZ A;  1CEZ A;  1BVS A;  2YML A;  5J0S A;  3MR3 A;  1Q3V A;  5KL8 B;  4UAT A;  2AGO A;  4F5N A;  2VJ5 A;  2BPC A;  4KLT A;  5EE9 A;  4BUG A;  5ALO A;  2WB1 F;  4NLK A;  4QNL A;  3TQ1 A;  3TAR A;  4M9N A;  2EQY A;  4RUC A;  2P35 A;  1SV0 C;  3ZDA A;  1ZET A;  1XS9 D;  9ICX A;  3ORY A;  2KP7 A;  4I2J A;  4Z6C A;  2AGQ A;  4NV0 A;  2BQR A;  4KTQ A;  4OJL A;  4KIT B;  1RXW A;  2GOL A;  2JXJ A;  4ICA A;  2VJ4 A;  3KBB A;  4DL7 A;  8ICN A;  1N56 A;  1PVQ A;  4J9K A;  3G6V A;  4DL6 A;  5ALX A;  1ZYQ A;  1XO1 A;  3TFR A;  1MQ3 A;  4I2A A;  2NRV A;  4BXO B;  9ICV A;  3T3F A;  2F2A B;  9ICC A;  3QEA Z;  2OYY A;  4UAY A;  5KFI A;  1BNO A;  4Y2R A;  3L3F X;  2KE7 A;  2E8P A;  2I6X A;  3PW5 A;  5KFZ A;  5KFX A;  2BQ3 A;  4MF8 A;  3HRD D;  3RBE A;  9ICL A;  4C4T A;  1FO4 A;  5KT6 A;  4B9S A;  2JMG A;  2F44 A;  2WB1 C;  4F93 B;  4MHV A;  1RG6 A;  5HMM A;  4EBE A;  4ZH4 A;  5J2E A;  9ICK A;  1Q46 A;  4OCZ A;  4MEY A;  2EAP A;  2KZM A;  5KT2 A;  1J97 A;  3ONN A;  3N7P D;  4EZ6 A;  3GIK A;  7ICG A;  1KL9 A;  3UQ2 A;  5CP2 A;  3DV9 A;  5HHI A;  2KFZ A;  4RQ5 A;  2K8C B;  5HNK A;  4KX5 A;  4ECQ A;  1JRP A;  2HCF A;  2K89 A;  2HBJ A;  2FI1 A;  4F71 A;  8ICU A;  1NKE A;  5KFO A;  3I1Y A;  4RQ2 A;  1ZQJ A;  1PVP A;  1RXV A;  5CR0 A;  4R63 A;  1S8O A;  1D9F A;  2OHF A;  4E0D A;  2MA1 A;  4GIB A;  4F4Z A;  1N48 A;  1C20 A;  1X9X A;  4KLH A;  3QUQ A;  5KT4 A;  1FFV A;  3NUQ A;  1Y88 A;  3QU9 A;  3EZ5 A;  3M9M B;  1B22 A;  3TI0 A;  3A0B U;  3NTU A;  4QWB A;  2K60 A;  5BPC A;  5ALE A;  1ZD4 A;  2JHD A;  1WUD A;  1K5O A;  1RQN A;  1IM4 A;  4QZD A;  4O5C A;  2RHF A;  2W9C B;  2IOF A;  3MR2 A;  5ALM A;  1LB2 B;  3L4P A;  4ED3 A;  5J0R A;  2JEG A;  4F92 B;  2HMX A;  3WK4 A;  4JK1 A;  2L5Y A;  3AL0 B;  2ASL A;  4CF5 A;  5L1K A;  4TUP A;  4QZG A;  1BPZ A;  2W03 A;  3QU5 A;  4PL2 A;  3GU3 A;  5DGB A;  5KL1 B;  2HHX A;  5ALI A;  3KHL A;  3PW4 A;  1KFD A;  4FS1 A;  1ZQH A;  1NI3 A;  1KTQ A;  5J0W A;  2YB1 A;  3SQI A;  1L7O A;  5AKJ A;  3G6X A;  4UBB A;  1N5W A;  2ZTC A;  4U7C A;  5AI4 A;  2W7P A;  1N2X A;  1TVA A;  2BCV A;  3H0R B;  5AM4 A;  5CEH A;  5D46 A;  4OD0 A;  5CA7 A;  4USA A;  5DGA A;  2RDJ A;  4WJ3 B;  1YZ6 A;  1J2N A;  2AQ4 A;  5AKH A;  2RQ5 A;  3RJI A;  1WWV A;  5DLG A;  2YTU A;  1ZQX A;  4RQ0 A;  1TFR A;  3N97 B;  1NJZ A;  1ARO P;  3TKA A;  3C23 A;  4ELU A;  1TK0 A;  1U9L A;  5EWF A;  2WHE A;  1SWV A;  4RPX A;  2NRZ A;  4YD1 A;  3PR4 A;  4KX3 A;  2DPI A;  4LJX A;  5ALD A;  1WWU A;  3SR6 A;  5EE3 A;  4C8M A;  4K4G A;  9ICU A;  2F1H A;  3PW7 A;  3ZI4 A;  4RQM A;  1SKW A;  2EZY A;  1UHU A;  1CI4 A;  3SV3 A;  2PI4 A;  5L1L A;  4PHA A;  2W9A A;  5AKL A;  4J03 A;  5DB9 A;  4G3I A;  1LVH A;  3V6H A;  4OJ6 A;  3ETR A;  4IRK A;  2HBK A;  8ICP A;  5J0X A;  3B9J A;  4M6W B;  4HAI A;  1SXD A;  4RQ3 A;  4I2G A;  5JU5 A;  3TAC B;  3PV8 A;  1OW5 A;  4ED0 A;  8ICI A;  2PKE A;  4MFC A;  4NJ8 A;  2ZIU A;  2M9N A;  2XCA A;  2LHT A;  4QIW F;  4ECT A;  2J6S A;  2BCR A;  4Z6E A;  2WAQ C;  2ZIW B;  5JTI A;  3Q8M A;  3PR5 B;  4P0Q A;  1ZQ1 C;  3MDC A;  4RQ8 A;  2FPL A;  4PGX A;  4DQS A;  1ZQR A;  5TIS U;  3RAQ A;  3BQ7 A;  5D49 A;  1KFS A;  2XID A;  3PSF A;  5ALW A;  1URJ A;  1ZOL A;  2ODG A;  2F3N A;  3M8R A;  1QH9 A;  3Q8Q B;  1NZP A;  2D8C A;  2Y9U A;  3BS5 A;  3H4D A;  1N63 A;  3GV5 B;  2YQE A;  5TZV A;  3PSP A;  4PL1 A;  4EYI B;  3RH6 A;  8ICJ A;  3NS1 A;  3KHR A;  2AHO B;  4Q45 A;  2XVT A;  1CUK A;  3C29 A;  1T4G A;  4DL3 A;  2IA6 A;  2Y1I A;  3CNH A;  4QIW C;  1U47 A;  2BHN A;  3BQ2 A;  2EAO A;  4QWA A;  2KMD A;  1L8L A;  4I2E A;  4FZL A;  3JPT A;  3H8S A;  2NV3 A;  4ECX A;  1UT8 A;  2KEY A;  1ZQL A;  8ICG A;  2KNJ A;  2AU0 A;  5KFW A;  3AMZ A;  4YFK A;  3IRU A;  2AXT U;  1S97 A;  1ZQP A;  8ICO A;  3OJU A;  2FDR A;  2QB1 A;  2EZZ A;  1PK1 B;  2C28 A;  4AP9 A;  2H3F A;  1TK8 A;  4RNO A;  1QQ5 A;  5A0L A;  3SV4 A;  3AU2 A;  4XRH A;  3C5G A;  4YXJ A;  3PMN A;  2E5S A;  2RLT A;  2IOH A;  4RPY A;  2ZIX B;  3RB0 A;  3NRZ A;  2B0C A;  2JV3 A;  4O3N A;  3GZF A;  3D6J A;  4YR0 A;  4NLZ A;  3PO5 A;  1JX4 A;  2Y1J A;  2DWQ A;  3KZI U;  1Q3U A;  4QZH A;  2DGZ A;  3WKA A;  3MR5 A;  8ICE A;  1ZQU A;  4GFJ A;  4DFJ A;  2R8G A;  2XGQ A;  1U4B A;  4O3M A;  4GXK A;  5GTH U;  5CJ7 A;  4US9 A;  5DBA A;  1MSW D;  1TAU A;  4KN4 A;  4QWC A;  2OWO A;  4B6J A;  3NGD A;  2RRD A;  3MGV A;  3BQT A;  4I2F A;  2N1R A;  3E58 A;  1L7P A;  1DXS A;  3Q8P B;  2BZF A;  1NKB A;  5KG4 A;  7ICN A;  3HIL A;  3KKA A;  1UQV A;  1ZQA A;  2YMP A;  4QZF A;  4C8K A;  2HSZ A;  3MAB A;  3QU7 A;  3RJE A;  3AN1 A;  2PFN A;  3NVV A;  4EX7 A;  5KG7 A;  5KFP A;  2XC9 A;  2FMQ A;  2F8K A;  4FZN A;  8ICX A;  4QWD A;  2QLT A;  3BDP A;  3O0F A;  1S77 D;  1PK3 A;  3WK8 A;  3LK9 A;  2C22 A;  3PO4 A;  2BR0 A;  2YB4 A;  1Z1V A;  3H8J A;  2ES6 A;  5G5H A;  4JV1 A;  1KKX A;  1NK9 A;  3GDX A;  4YG2 A;  2G5H B;  1VDV A;  1T3Q A;  3OTQ A;  4JB3 A;  5DBB A;  1SIJ A;  3T5K A;  5KG2 A;  2W9B B;  1NNL A;  2QAR B;  2AJQ A;  5DDY A;  1S0O A;  4J9R A;  2FE9 A;  4GXI A;  1SZP A;  3BZC A;  7ICK A;  5D4B A;  3WKC A;  1F0M A;  3WKB A;  5ALU A;  4O3P A;  4JWN A;  2ZUD A;  5J2J A;  2LBO A;  1SZH A;  2E3T A;  2E1F A;  2W43 A;  4M0A A;  1UA0 A;  4BWM A;  3UM9 A;  3MGI A;  4M9L A;  4TQS A;  5DBC A;  1KDH A;  4PPX A;  2H3V A;  1TK5 A;  1DOQ A;  2GH1 A;  3GV7 B;  4ELT A;  3F2D A;  1L6N A;  2DL0 A;  5AK5 A;  4J9O A;  5KFU A;  5HP4 A;  1RYR A;  5KG0 A;  9ICS A;  3K75 D;  3UXP A;  4DSI A;  1NK5 A;  4UAS A;  5ALV A;  3HT3 A;  4EEK A;  2RP5 A;  3K1Z A;  1NK6 A;  2XY7 A;  2QKQ A;  1KLN A;  4RNN A;  1ZQE A;  1X6J A;  2E8N A;  4ECS A;  2W7O A;  4J9Q A;  4UB5 A;  3D2N A;  3UMB A;  4QWE A;  4K4I A;  4OJP A;  2HHS A;  4M6W A;  3PSI A;  1A76 A;  8ICR A;  1FIQ A;  3RRG A;  4IR9 A;  2A1J B;  3IM1 A;  2EDU A;  3RTV A;  4UW9 A;  4DWI A;  2BCQ A;  4QZC A;  9ICW A;  1ZD2 P;  4OJ5 A;  3QZ8 A;  2WF6 A;  1ZQD A;  1V38 A;  5J29 A;  2JEF A;  4OO1 J;  2KVS A;  3H0L B;  1PVR A;  2E8M A;  2W3R A;  4I2C A;  5ALL A;  3SI8 A;  2KSO B;  2YMM A;  5AI0 A;  3B0X A;  4DFD A;  3JPQ A;  4OJO A;  4EEN A;  2OXO A;  4RT3 A;  4RQN A;  2FJ6 A;  1UPH A;  5KAF U;  5AKE A;  4P0P B;  8ICK A;  2KJ9 A;  1D8L A;  3EUB 2;  4F4Y A;  1MN8 A;  2K4E A;  5DKW A;  4DLG A;  3OJS A;  4Q8E A;  4UB8 U;  5ALN A;  9ICT A;  2C2D A;  4KLU A;  4C4R A;  3EYZ A;  3SZ2 A;  1Z00 A;  1ED1 A;  4GXJ A;  5J2K A;  2W9M A;  5AIC A;  4NL9 A;  4O0I A;  1S10 A;  5ALS A;  5L1I A;  1XSP A;  2F77 X;  4Z6D A;  3TFS A;  1KN5 A;  3NVY A;  4F5O A;  2AQ0 A;  5KT7 A;  1RZT A;  4BGD A;  4JV2 A;  2FLP A;  5EWG A;  3M1Y A;  2LYA A;  1XWL A;  4QZ8 A;  3FYH A;  3N7R C;  4RQ6 A;  2V9W A;  2MUT A;  4C8O A;  3GIJ A;  1K1Q A;  3JPP A;  3K1R B;  4IRC A;  4FZM A;  4CF3 A;  5J0O A;  2OH2 A;  3QX7 A;  3ISB A;  4NLN A;  4J9P A;  1KSP A;  1HJP A;  3SAG A;  3E2E A;  3CYM A;  5F9L A;  1L7M A;  5DQH A;  3UXN A;  3RR8 A;  7ICT A;  3M7D A;  3H4B A;  1WG8 A;  2MAX A;  2XI9 A;  1GO3 F;  5AKK A;  4C4S A;  2QB0 A;  3BS7 A;  1OXJ A;  3PZP A;  5AIA A;  4I2I A;  3KKA C;  4YQW A;  4DSL A;  4LVS A;  5J2A A;  8ICT A;  4TUR A;  4DLE A;  5DG9 A;  3ZD8 A;  4PH5 A;  4BJQ A;  1BPE A;  1T3N A;  3TAD C;  4A8E A;  7ICP A;  4FO6 A;  2MU2 A;  5T14 A;  3MC1 A;  2Z7J A;  4C80 A;  4J9N A;  4CCH A;  3AEV A;  5HR6 A;  2H5X A;  3KTQ A;  3E0F A;  4O3R A;  4HYK A;  8ICM A;  3PVX A;  2HVH A;  5AM0 A;  4B9M A;  1Z3E B;  4IL6 U;  2ZUC A;  8ICW A;  4CF4 A;  1NK0 A;  2F76 X;  5ALQ A;  4ECR A;  1NKC A;  2YMQ A;  1S9F A;  5AM3 A;  3MGH A;  5KG5 A;  1NJW A;  3F53 A;  5C0Y A;  2JEJ A;  2FLN A;  4F4K A;  4ED8 A;  4ACO A;  1SWW A;  3IN5 A;  3PST A;  3BQ0 A;  9ICM A;  1BGX T;  1V97 A;  3NVW A;  3UMG A;  2LI6 A;  3QE9 Y;  4R8U B;  4O9M A;  2WFA A;  1Z4O A;  1N62 A;  2LYB A;  3RJK A;  3JPS A;  2FLL A;  2IBK A;  2BPF A;  2CN1 A;  3HJE A;  5IIK A;  1Z4N A;  5FP0 A;  9ICJ A;  3Q8R B;  1S0N A;  3F5A A;  3MDA A;  3C5F A;  3PNC A;  2KHQ A;  5DQI A;  3HW8 A;  4UB6 U;  2WAQ F;  3M6Z A;  3BZK A;  1F5S A;  1LKY B;  3OSN A;  1N60 A;  2G0A A;  3HWT A;  2ATL A;  3KZX A;  5L1M A;  2JH7 A;  4YR3 A;  9ICN A;  2GO7 A;  2YY6 A;  2KKP A;  2JZB B;  2ZIV B;  3RJH A;  5EE0 A;  2BCU A;  5J0T A;  1ZQZ A;  4RQ1 A;  5AI6 A;  7ICI A;  3RF9 A;  2KIV A;  3FM9 A;  3ZD9 A;  1X66 A;  2W55 A;  4RZR A;  9ICG A;  3Q8K A;  1JXE A;  1V85 A;  2LKY A;  3NVZ A;  4DFM A;  2A1A A;  2CRX A;  4DSJ A;  2VA8 A;  2V4R A;  1T8E A;  2ZJ5 A;  5AM5 A;  4QZA A;  4RU9 A;  2NRW A;  4ECZ A;  1L3V A;  3UXO A;  4EX6 A;  9ICQ A;  5KFL A;  3BQ1 A;  5KFD A;  1DGS A;  5AM2 A;  4MFF A;  1LV5 A;  3RJF A;  4O5E A;  4I2B A;  3L5K A;  4UB1 A;  2HHW A;  7ICR A;  2W8L A;  2P66 A;  5F9N A;  2DPJ A;  3IG8 A;  1TAQ A;  2HOI A;  2W54 A;  1NK4 A;  4YXM A;  3MFH A;  1B43 A;  1DK3 A;  5J2G A;  3GFK B;  1K1S A;  3PW2 A;  4P4O A;  4JV0 A;  1ZQV A;  5AKI A;  2LYH A;  5KFF A;  2ISO A;  4Q8F A;  5J2I A;  2I5H A;  1RDF A;  2NO5 A;  9ICA A;  5J2C A;  4KMO B;  2WF5 A;  4DS5 A;  2UVV A;  1SV0 A;  2JR5 A;  2KHV A;  2K8B B;  3H40 A;  1S0M A;  2D3D A;  4DQR A;  5IIO A;  7ICJ A;  4R64 A;  2C2E A;  3IV6 A;  4CE6 A;  5KT3 A;  4NM2 A;  2VA3 A;  2DFL A;  3VC8 A;  5ALT A;  8ICH A;  2HOF A;  1SGG A;  4KMU A;  4DF4 A;  4B9U A;  3RH5 A;  4NL9 C;  4UB3 A;  4RQ7 A;  3B0Y A;  5KFQ A;  4ED1 A;  4QZE A;  2K4I A;  5EE1 A;  4F2R A;  5KFC A;  1NJX A;  4BXO A;  4QZI A;  3QXG A;  2BGW A;  3S6J A;  2M0N A;  5F3X B;  2KSO A;  5AKG A;  1D8Y A;  1ZQT A;  4KLO A;  2KZ3 A;  2KTQ A;  2I9G A;  1X2I A;  9ICP A;  5KFM A;  5KNI A;  5HHH A;  5J0U A;  4ECW A;  5CB1 A;  1XSN A;  5ALR A;  5B5E U;  4RNM A;  2PFP A;  3WU2 U;  4R66 A;  4J9M A;  2MRL A;  2W3S A;  2JH1 A;  3RB4 A;  1A77 A;  4PGQ A;  3RR7 A;  2OM6 A;  4UAZ A;  4QW9 A;  5J2F A;  5ALF A;  2YX8 A;  1B0X A;  3RB6 A;  4P2H A;  3K4G A;  1JIH A;  7ICU A;  3AUO A;  2HVI A;  1RYU A;  2KK0 A;  7ICL A;  3OHB A;  1TAM A;  9ICI A;  1RM6 C;  2CPR A;  3ED5 A;  5DDM A;  5KFH A;  2XIC A;  5III A;  3KOO A;  3PML A;  5IIL A;  3AM9 A;  3ZDD A;  1EXN A;  3QU2 A;  1L3S A;  3AQF A;  4RUA A;  1KW4 A;  2UVW A;  1L3T A;  3SAH A;  4FE3 A;  4DF8 A;  3JPR A;  1SKR A;  2ZTD A;  1H38 A;  8ICL A;  1ZRM A;  4PZO A;  4QZ9 A;  2R8J A;  4I29 A;  3M8S A;  2BDP A;  4DSE A;  1XC9 A;  5KFE A;  5J8Y A;  1QQ6 A;  2ZTE A;  2MSN A;  4C7Z A;  3ISC A;  2W8K A;  3ALR A;  3R9K A;  5J0P A;  4PHP A;  3A0H U;  2VKQ A;  5DG8 A;  2W9C A;  4NXZ A;  1JN3 A;  1JMS A;  4NLC A;  2HHV A;  5EOZ A;  3G6Y A;  3H7I A;  1TV9 A;  3LWM A;  1JAL A;  1XU4 A;  1RQL A;  1ZQN A;  2Q0Z X;  2ALZ A;  4YMO A;  4KLD A;  4C8N A;  3F5E A;  1QCK A;  1NK7 A;  2Y9T A;  3KD3 A;  4EYH B;  1XSL A;  1COO A;  3EWA A;  1KEJ A;  2IMW P;  7ICO A;  2B21 A;  5KFS A;  1Z19 A;  1YZ7 A;  4DS4 A;  5AKZ A;  4CDG A;  2AGP A;  3H8W A;  4I2D A;  1MC8 A;  2FMS A;  4LZD A;  3D2S A;  3WK9 A;  1B4F A;  1SL0 A;  3NAS A;  4P4P A;  4R65 A;  1ZQY A;  2KOB A;  5KT5 A;  3EPG A;  4UAV A;  5AI8 A;  3H8M A;  5KFV A;  1TKD A;  1RPL A;  2NRT A;  2IOF K;  3V7L A;  1F44 A;  4TUS A;  3HPO A;  1QQ7 A;  4Y2J A;  2F1I A;  2EZX A;  3N4M B;  4EEL A;  3JPO A;  1V9P A;  4GC7 A;  4G9B A;  8ICC A;  1L8O A;  2P6U A;  4NY8 A;  2EAN A;  3VCB A;  1NZB A;  2ISP A;  2PFO A;  3PY8 A;  3RJG A;  1A0P A;  3AU6 A;  1FEZ A;  8ICS A;  4DFP A;  3KHG A;  4BDP A;  1SKS A;  3WK7 A;  2KG5 A;  4NM1 A;  3J81 j;  2LM4 A;  3GIM A;  5J2B A;  2ZIU B;  4IS7 A;  4O3S A;  4DOA A;  5AKY A;  3HX0 A;  3WKE A;  4ED2 A;  2GWS A;  2LM1 A;  4DO9 A;  4DOC A;  1U48 A;  3HP6 A;  4Y2P A;  5GTI U;  4EBD A;  5ALH A;  7ICV A;  1KRP A;  4YR2 A;  4O3Q A;  4P0Q B;  3SEN A;  5J2H A;  4F5R A;  2UVU A;  5IIJ A;  1QSY A;  2Q4T A;  4UQG A;  5KG3 A;  4K4H A;  2IHM A;  3QZ7 A;  4Q44 A;  5E79 U;  3ZDB A;  3PW0 A;  2K4H A;  1XNS A;  3I28 A;  3CW2 C;  4YN4 A;  4RQ4 A;  9ICB A;  3BS5 B;  4IQT A;  1QTM A;  4M9H A;  4KLS A;  1ZQM A;  8ICZ A;  5AK6 A;  3RRH A;  2KJ5 A;  4AYB F;  1ZXI A;  3IG5 A;  4J9L A;  2ZIW A;  4KLF A;  4B9N A;  2JEI A;  3WK6 A;  1IG6 A;  3BJY A;  4RPZ A; 
#chains in the Genus database with same CATH homology
 3IN5 A;  1L6N A;  3PST A;  2RRD A;  3MGV A;  1TAM A;  1ED1 A;  3LYS A;  2HOI A;  2N1R A;  1F44 A;  4P0P A;  2KD1 A;  2W04 A;  1MA7 A;  2CPR A;  2XVT A;  2F8L A;  2KJ8 A;  3HKZ C;  2Y0S C;  3C29 A;  2XIC A;  2A3V A;  4NV0 A;  1T94 A;  2F77 X;  2HOQ A;  1D8B A;  2LYB A;  3SAF A;  3AQF A;  4QIW C;  2JHD A;  3D2Q A;  1WUD A;  4OJL A;  3VCB A;  3ICX A;  3N7S C;  1NZB A;  1KBU A;  3IP4 B;  2RHF A;  2KVC A;  2GOL A;  3DEE A;  2CN1 A;  4ICA A;  3SAH A;  1A0P A;  2RP5 A;  2VJ4 A;  3K1Z A;  4FE3 A;  3C28 A;  4QJF B;  4KMO B;  4BX9 C;  1PVQ A;  2LYA A;  1ECW A;  3F5A A;  4FZN A;  2KHV A;  1YT3 A;  2K8B B;  2HMX A;  3N7R C;  2KIC A;  2W7O A;  4FZL A;  2KHQ A;  3AL0 B;  2ZIU B;  3O0F A;  3D2N A;  2WAQ F;  2G5I B;  2NV3 A;  3M6Z A;  4OJP A;  4FZM A;  2KEY A;  2OH2 A;  4OJ6 A;  3PSI A;  2F2A B;  3ALR A;  2KNJ A;  2HBK A;  1Z1B A;  2OYY A;  2PMZ F;  2YB4 A;  2W03 A;  2VKQ A;  4PL2 A;  4AYB C;  3SAG A;  3L3F X;  3RFA A;  3LVV A;  2G0A A;  3GU3 A;  2H3Z A;  2HBM A;  3M6K A;  3SMV A;  5KL1 B;  3VC8 A;  3CYM A;  2BDU A;  2H3Q A;  3KZX A;  1DRG A;  2HOF A;  4CGZ A;  3OPX A;  1CRX A;  4NLC A;  2JH7 A;  2KV2 A;  4IC9 A;  1P7D A;  2KKV A;  2G09 A;  3HKZ F;  2Y0S F;  2ZXI A;  4NLB A;  4P0Q B;  2JMG A;  3M7D A;  2KKP A;  2ZIV B;  2H3F A;  2D6F C;  2ZIU A;  2YB1 A;  2WB1 C;  2XI9 A;  1GO3 F;  3T79 A;  3SQI A;  1A6S A;  2K4I A;  2G5H B;  3KFU F;  2LHT A;  3LVW A;  4QIW F;  4OJ5 A;  3PZP A;  2Q4T A;  5A0L A;  3NRW A;  4JMU A;  2R18 A;  2M0N A;  4U7C A;  3F5E A;  1XO0 A;  1OUQ A;  1HEK A;  3RF9 A;  2W7P A;  4OO1 J;  2H3I A;  2K8A A;  3H0L B;  3H0M B;  4BJQ A;  1PVR A;  2DQN B;  3H0R B;  2WAQ C;  2K4H A;  2ZIW B;  1XNS A;  1IIP A;  3ONN A;  3N7P D;  4A8E A;  2E5S A;  1Z19 A;  2JGA A;  2ZIX B;  4P0Q A;  4CDG A;  5T14 A;  4OJO A;  2Z7J A;  1ZQ1 C;  2LKY A;  5CRX A;  2OXO A;  4WJ3 B;  2ZIV A;  4U6P A;  3GZF A;  5HR6 A;  3CP8 A;  2VIX A;  2K8C B;  2G08 A;  4KX5 A;  3E0F A;  3F2D A;  2K89 A;  2HBJ A;  2MRL A;  3CRX A;  1UPH A;  2KJ5 A;  2CRX A;  2JH1 A;  3D2S A;  2ZG6 A;  5HR7 A;  3F2B A;  4AYB F;  2G06 A;  1Q3U A;  4P0P B;  1PVP A;  2LBO A;  2DGZ A;  2OM6 A;  2KJ9 A;  3IG5 A;  1Q3V A;  1SZH A;  2XID A;  3PSF A;  3IG8 A;  1URJ A;  2E1F A;  2KOB A;  2ZIW A;  4NWI A;  5KL8 B;  2VJ5 A;  2YX8 A;  2K4E A;  2KIW A;  4CRX A;  4GFJ A;  2ZIX A;  4BUG A;  3AQE A;  4O3M A;  2F76 X;  2MA1 A;  2DF4 B;  2WB1 F;  4C0Z A;  4QNL A;  2H3V A;  2G07 A;  3F53 A;  3F2C A;  2ZXH A;  3NUQ A;  3PSP A;  5C0Y A;  2GH1 A;  2HBL A;  1HIW A;  2PMZ C;  4PL1 A;  2E1E A;  4KX3 A;  4ACO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...