2H4WA

Crystal structure of human caspase-1 (glu390->asp) in complex with 3-[2-(2-benzyloxycarbonylamino-3-methyl-butyrylamino)-propionylamino]-4-oxo-pentanoic acid (z-vad-fmk)
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
173
structure length
168
Chain Sequence
TSSGSEGNVKLCSLEEAQRIAEIYPIMDKSSRTRLALIICNEEFDSIPRRTGAEVDITGMTMLLQNLGYSVDVKKNLTASDMTTELEAFAHRPEHKTSDSTFLVFMSHGIREGICGKKHSEQVPDILQLNAIFNMLNTKNCPSLKDKPKVIIIQACRGDSPGVVWFKD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title An allosteric circuit in caspase-1.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords Caspase-1
total genus 49
structure length 168
sequence length 173
ec nomenclature ec 3.4.22.36: Caspase-1.
pdb deposition date 2006-05-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1460 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2h4wA00
4DCPA 4QULA 3GJTA 2C1EA 2FP3A 2CNLA 4IYRA 1NMQA 2CJXA 4NBLA 1RWNA 1RWKA 3IBFA 4NBNA 4QUJA 1RWVA 4N7MA 5IAKA 1F9EA 3PCXA 1RWPA 2C2KA 4IEFB 3RJMA 2QLBA 1GQFA 3IBCA 4EHHA 1GFWA 3GJQA 3H1PA 3P45A 2J32A 4AWAA 3QNWA 1RHRA 3DEKA 4N6NA 2CNNA 2XYHA 5IC4A 1K88A 1RHJA 1SC3A 4N6OA 4QUIA 5IBRA 4PS1A 1NMSA 4EHLA 3H0EA 2FQQA 4NOMA 3EDRA 5IC6A 5LUBA 4FEAA 4ZVOA 2J31A 1SHLA 4NOLA 1RHUA 2C2ZA 2NN3C 3V4OA 3H11B 4HVAA 2CJYA 1SC4A 3E4CA 1NW9B 4HQ0A 1IBCA 1QTNA 2HBZA 4JQZA 3UO8B 1NMEA 5IASA 4M9RA 1SC1A 4NBKA 2CNKA 4PRZA 4NOJA 4ZVSA 5I9TA 4QTXA 3R6LA 3EDQA 3S70A 4N5DA 4DCOA 4ZVPA 2K7ZA 4I1PA 4D3YA 2H54A 1ICEA 3D6FA 3R5KA 4QUEA 2J30A 4EHAA 2H48A 4FGUA 3ITNA 1BMQA 1I4EB 3R7NA 3V55A 3S8EA 3OD5A 4JR0A 4JJ8A 5IBCA 2H4WA 5LU8A 3PD0A 3V3KA 4QUAA 4D3ZA 2P2CA 4HQRA 2Y1LA 2H5JA 4FDLA 1PYOA 3KJQA 4QU9A 2CNOA 2HBYA 3D6HA 1F1JA 1I3OA 2C2MA 4EHNA 4N6GA 2HBQA 5LU9A 1QDUA 4EHKA 4QU5A 2H51A 1I4OA 1QX3A 4JB8A 3DEHA 3DEJA 2C2OA 3KJNA 3SIRA 1KMCA 5IANA 5IABA 2QLFA 5LUAA 2XYGA 1RHQA 4NOKA 4QUBA 2WDPA 4QUDA 4QUHA 2XZTA 4JJEA 3V6MA 4ZVQA 5IAEA 3GJRA 4N7JA 3GJSA 1K86A 4QU0A 5IAGA 1M72A 1RWWA 4QU8A 3V4LA 4ZVTA 4AW9A 2XZDA 1JXQA 4ZVUA 4EHFA 3SIPA 3H13A 3K7EA 1SHJA 5JFTA 3D6MA 3UOAB 1RHMA 2QL9A 5K20A 3R5JA 2H5IA 2DKOA 4QUGA 4EHDA 4JQYA 3V6LA 5IARA 3R6GA 4JR2A 4FXOA 3H11A 2XYPA 4ZVRA 2J33A 2HBRA 3NS7A 3PD1A 4I1RA 1RWOA 5H0IA 3R7SA 1RWMA 2FUNB 4AWBA 4JR1A 1CP3A 3R7BA 5IAJA 4LSZA 4DCJA 1PAUA 2QL5A 1RHKA 4JJ7A 4PRYA 4PS0A 3NKFA 2H65A 5IBPA 1CVRA 2H4YA 3P4UA 2Y0BA 3DEIA 4QTYA 2QLJA 2QL7A 3BIJA 1RE1A 3NR2A 4D3XA 5I9BA 1RWXA 4EJFA 1I51A 3KJFA 2CDRA 2AR9A
chains in the Genus database with same CATH superfamily
3HSSA 4F96A 5ALHA 4ZVNA 3LFTA 2XGGA 2W6JD 5HKAA 1K6JA 4XKJA 2IIQA 2OLEA 4EI7A 1MABB 3T7JA 3TW8A 3HB1A 1FMJA 4F56A 3ZR4B 2JD2A 2QKYA 2EATA 5JBQA 3PJDA 3I4CA 4FMCF 1WZ2A 2Q4TA 5A4MS 4TQAA 3K0SA 2BDEA 1BEEA 1GSOA 1U6KA 2R4UA 1HE5A 2RHMA 4MYDA 4CMAA 1OKKA 4BO9A 3TDKA 5H4GA 2RK3A 3SSMA 3RHZA 4J1NA 2DJIA 1N0WA 1W4LA 3UA4A 3NHBA 3I5AA 5A9RA 3I76A 4HDQB 4EVIA 5IULC 2EBWA 2WZQA 4IF6A 2A30A 4HF7A 1BKDR 2P1RA 1NNEA 4YFVA 4C0KA 4F6CA 3NHPA 3TAUA 4H31A 1TKRA 4PX5A 3FDFA 3UF0A 3X0DA 1RAEA 3KR2A 2PA3A 4NYMQ 2H1WA 5T67A 4Z4FA 2PGJA 3BK2A 4X3PA 3SI7A 1Y4AE 4MO9A 2J1LA 4BRZA 3K71B 3AILA 3B6EA 4QM7A 2WP8J 4LJAA 3S40A 1CE8B 4HGZA 5IWAB 1O08A 3N6XA 2XXBA 2EU8A 4HGQA 4ZAYA 2HSGA 2PV7A 2H6EA 3GZTB 1TCVA 2DFVA 1R6XA 1S9DA 4WK2B 4D3YA 5ISMA 4TVSA 1QMGA 1Y8CA 1D6MA 1MX9A 2O8FB 3L8ZA 3W6PA 2WSYB 3URKA 2YINC 1NVDA 3DDNA 2GESA 1V43A 2GZDA 4C0JA 3IYLW 3PD7A 1B74A 2QX8A 1YB4A 1E92A 1N5KA 2IL1A 3A4LA 3UK1A 4LWZA 1XN4A 1PYOA 6YASA 3TMYA 4FGWA 2COUA 4MR8A 2OFOA 1MNAA 1N2ZA 4Q7LA 4NHOA 5D7NA 1ESZA 5LMZA 4XGIA 5HF5A 1E98A 5JVDA 4YJGB 4A2QA 3SC4A 3VR3D 4AN1A 1Z0KA 1N1EA 2Z9DA 4XIIA 2JD1A 1E3SA 2SKCA 1EX1A 4NG5A 1JEYA 5JS8A 1PFWA 3O3MB 4IUDS 4BGUA 1SVSA 1NXTA 2ISCA 4DPKA 2CFTA 4MHOA 4CV2A 2V65A 4F91B 1C4WA 2NU6B 2XOEA 2OECA 1F8UA 1Z63A 3ID6C 5I9SA 1IQPA 4P86A 1U28C 1QF7A 3VBCA 4WBNB 1LFDB 2RG7A 1TKCA 4PSUA 5I5EA 4LJ9A 2CZQA 2XZDA 1L3BA 2UZ1B 4GOKA 1SOWA 4IJMA 4NCJA 2E55A 1PWZA 3K32A 3KB1A 4OXRA 2Z6AA 1PHRA 5B64A 1QP7A 5ICSA 1E3WA 1AN9A 4DLSA 1DELA 4N3AA 1W0JA 2GPTA 4Y6SA 3TSCA 1JDBC 1XA4A 3UV7A 2CSUA 3KUCA 4RETA 4LX8A 1YJBA 1C14A 4B3FX 4EYOA 4RPGA 3GYGA 3V8PA 1J99A 2HJWA 4QBGB 1JIQA 3F9IA 2AN4A 4HUQB 1PSZA 3K1AA 4JI0B 2A1TR 2GD6A 4C3UA 3LLMA 4IDNA 2DR2A 2RAPA 1WMBA 1EFVA 2NYVA 1XVIA 2R87A 4ZDKA 4PFJA 3A9TA 2Y92A 4QATA 4UHCA 1QIJA 3EGOA 3STYA 5A06A 5JCXA 1SIWA 3A1TA 3N59A 5CIQA 5DDIP 5EJ6A 3M9WA 4R16A 5BSEA 1DRUA 3OT1B 3TGLA 3KQUA 1X1BA 4EJFA 1H94A 2B36A 2CMHA 2F4NA 4LGYA 3RHFA 4A1OA 1SQ0A 2D1TA 3ESAA 3STUA 2FR0A 3O9VA 4IMJB 1CUGA 2A9VA 3A3OA 3BHMA 4TUYB 5H83A 3JD0A 1SA0A 5A3VA 4EHDA 1U6IA 1MKYA 5IWCA 1UP4A 2RONA 4K9RA 1Z36A 2EL7A 1KPGA 2F8TA 1D9XA 2C4MA 2VXYA 4IDDA 4DIBA 3LF2A 4F4JA 4MCHA 5EKUA 1FTNA 1L5YA 3PS9A 3TLEA 2PIDA 2Q4RA 1ULTA 3BBLA 4KSCA 3ANNA 1DQYA 3F73A 5IT9A 2YS7A 3AL2A 2FQQA 1UPFA 1E1CB 3MUEA 4J2HA 2A5FA 4OKSA 4E22A 5AW0A 5HJ5A 3W6UA 2B3DA 3T4XA 3PXAA 4TX1A 1AIPA 1AOXA 4DC9A 4J7AA 1S2GA 4Q9JA 3SQNA 4CLRB 1ODIA 1PJRA 2COKA 4LRYA 2WTBA 2ZIWB 1NP6A 1U5BA 3RLFA 4NU0A 4QQRA 5DASA 1WL8A 1SVKA 3KHTA 4G81A 4EL5A 3TLJA 1R0ZA 4BQOA 1GZ3A 1FQKA 4XUDA 4QPZA 1ZA1A 2JKZA 3UIEA 1K6IA 3ZKWA 3RYCB 1XMQB 4AZ0B 2UUBB 1QHNA 1TMGE 4NWIA 2ZVQX 2WE7A 3K2BA 1GYRA 4INJA 2HV8A 3SICE 1SZJG 1XQ6A 5CK5A 1ICEA 2CXQA 2JFHA 3CLVA 4HS9A 3TFWA 1H8EA 3THYA 1Z17A 3ZX5A 4R0NA 2ECOA 4O4LF 8GPBA 1T9DA 3WGKA 1JIKA 1RZUA 1ARZA 3W3AD 2OQ2A 2X1VA 4GLOA 1CFZA 4C4AA 1D2AA 5CUQA 3U0VA 2BFEA 3EGXA 2WF5A 2IYRA 3OQPA 3PTAA 2QB5A 1M7HA 4JJ6A 1ZN2A 1PTKA 4H2DA 1NLYA 3DPSA 3PQ7A 3BKWA 2MINA 4CKWB 1KI7A 1QIEA 1RJ9A 1XRPA 2A14A 2VDPB 3A9RA 3RVPA 1FQWA 5HMMA 1G1AA 2BLLA 2H1RA 2H0RA 2V7BA 4UXHA 1PV4A 2PX4A 5FNVB 3L1KA 4G8BA 1U99A 3GZNA 4F2DA 5CYGA 1W36C 2XH8A 3EXG2 4QUHA 1KJNA 1JA9A 1WIWA 5EPOA 1N2GA 1SCKA 3CF0A 3AJDA 3ISVA 2XBMA 3OZCA 4I66A 2GPAA 2VCEA 4HYEA 3KXDA 2QGFA 1L5VA 1M72A 2W8BB 2WR8A 3BUSA 2QZSA 1ZOPA 2NT3A 5JCJD 2YICA 5H81A 4P36A 3CIOA 5LQCA 2HY7A 4GP9A 5TLSA 4CQMA 2IY9A 4I4TA 3K4PA 3G1WA 4EUFA 2OCPA 1PX2A 1X74A 1MHTA 4JLBA 1DZIA 1N2EA 2Q3JA 3IQHX 4AECA 2MU1A 1W73A 3WO0A 1AM4D 4DRXB 5HK9A 4XGKA 1JKJA 2P69A 5KQPA 1VQ1A 2JGNA 4ILKA 5GJCA 1B23P 1R8SA 4HGOA 1YS4A 3NTUA 4IDCA 4HAIA 1KOFA 1MV8A 1RKXA 1AA9A 3CRNA 3EFBA 3HBMA 4GX5A 4TTQA 4BJ1A 1N36B 2XDWA 2YY6A 1V3VA 2ORED 3Q3CA 1WCXA 1K5DA 5EXXA 3OO0A 4MUIA 5TJ9A 4MUEA 1YRWA 1KEEB 5CP8A 3KG2A 4YRPA 4RE5A 3M5DA 4I9HA 4LZLA 5F12A 4D9NA 1F8YA 1SBTA 3EVFA 5ALIA 4Z3KA 4B7AA 2AUNA 3RCBA 1H1LA 4YRDA 2ERXA 1HQDA 3O74A 4O8CA 4X6YA 4MQEB 2DH5A 5KQLA 1K7EB 2D1SA 2WJ3A 1FDSA 4NMMA 4DTCA 1EZZA 2UV8A 1FNBA 5KCZA 1SBNE 2C04A 4LF6B 2R8EA 2FNAA 2Q3EA 3HV2A 1NUUA 4YO8A 2H9AA 2JEZA 1J70A 3DFUA 1DQNA 1MEOA 3DXZA 4RFLA 1ICIA 1Y81A 1K4KA 1TYBE 1L7NA 2RSLA 4YROA 2NU9A 4R2MA 1JQ5A 1S8FA 4AJHA 4R7GA 2GM4A 1RW4A 3EZ9A 3SIXA 4CT5A 3JPYA 2PRKA 1VKJA 1LW6E 4JNCA 1JAZA 4QUIA 3CZRA 5T3YA 4ZCLA 4DM4A 3QJGA 1XLWA 2X2PA 4HI0E 3ZDFA 4WXPA 1PR6A 1T9KA 2L19A 3PFWO 2IYPA 4L7QA 3W79A 1PJZA 2C0QA 2FHPA 3P2YA 5ENZA 5BSWA 4HEQA 1FFBA 1XXHA 2XYRA 2I62A 3PNSA 2PANA 2W6IA 4J1SA 4ABTA 1YS9A 2ZT6A 5KTKA 1EVEA 4KTVE 2VP3A 4IFIA 2GN0A 1SXJB 3HDVA 2JA2A 3QKSA 1ELOA 1ZSVA 3EZ2A 1VSVA 2V7GA 2Y1EA 4HQ0A 1PUIA 4ZT3A 1Y7TA 1L5MA 5P8WA 4DLLA 3CC8A 4UQLA 1LRKA 1PKXA 1QM5A 3PPIA 4G4SO 1GKYA 1QS0B 1LBEA 1MT3A 2VYFA 4HLCA 1EM8A 4DGQA 5C37A 4N0QA 3EX7C 4M8IA 4QXMA 1DKNA 2ZS7A 4I50F 2H1SA 2VJDA 3WGZA 3ADDA 3VNVA 3BG5A 4GPEA 1PTJC 3PDIA 3GGDA 1EB9A 4EG5A 4ZDJA 4OQ4A 3S8EA 5HP4A 2FSVC 2EKQA 1EK5A 3TLBA 1EK1A 2HF7A 3PRHA 4HG2A 4X5OA 4Y6PA 3KVYA 5TC4A 4OA5A 3ZDAA 1Y7LA 1ZAKA 2Y1LA 3SD7A 3P0EA 1W34A 4W1PA 5AQEA 1JKXA 4D9GA 3R9XB 1JQ3A 1IIRA 2BUCA 1L4YA 3RANA 2GKSA 1YZ3A 2LE0A 3FLMA 3WSWA 4H1WA 2XY4A 3DCIA 3AXTA 4H7DA 4EJ2A 1G9SA 2PBZA 3HB9A 4I8DA 1PT6A 4JZYA 3I9V1 4GBJA 4NDNE 4RYDA 5M3BA 4D98A 1D6NA 1FL9A 2V98A 2QI9C 3HDYA 4WESA 4DB2A 1LA2A 3P9NA 3MS4A 5JY1A 3HCFA 4JGGA 3VMMA 3I30X 2WF6A 2P6OA 3P9SA 3H4TA 4P3PA 3WDMA 4UCQA 2Z1MA 2EV9A 2XCRB 2QRUA 1VECA 2GJKA 3LHIA 2ZJ3A 3SK0A 1RBMA 1OLXB 1YVEI 3HXKA 1WSBA 4OBBA 4PSKA 3TUIC 5JANA 2EZ4A 2AA3A 1YWGO 1R12A 3OE4A 1VGQA 4X63A 3S4YA 4WNYA 4LF9B 1QRUA 2HT1A 2NYUA 5EQFA 2HL6A 2Y1OA 3DV0B 4LE0A 1B76A 5FV4A 2C8KA 3RO7A 1M83A 3DKPA 1MFZA 4YH1A 2L0XA 4HB0A 1U0SY 1XK7A 1ZEMA 2P9BA 2H2AA 3VX3A 1J4AA 4LTMA 4Y9UA 2ONKA 2FUNB 3ZE7A 4RABA 1EKXA 4PYNA 4BNHA 4YRJA 3OTOB 5EKXA 4MRMB 3LQRA 2GO1A 1FJHA 2VSYA 2XCOA 3OETA 3ZI0A 3A11A 4MV1A 4M1TA 4NYMR 4ESHA 1PR5A 5J47A 3WK7A 3PPWA 1RFLA 2H7CA 3NJ8A 2RAFA 1IK4A 3A4VA 3HYCA 4KDEA 3T3GA 2XNCA 3E3LA 1H2WA 2NLOA 2R1TA 1KNXA 3HCPA 3KCQA 3W3AH 5FBRB 4A92A 5AESA 5LP6A 1X8LA 4PEVA 2G80A 2PMBA 2VC2B 3Q9NA 2GBGA 1QPBA 3ZWWA 4C07A 3R74A 3DO5A 2R4QA 3DUFB 4IV5A 1Q19A 4NYIQ 2JHCA 4B8WA 1T9ZA 4AF8A 2R6DA 3N2GB 4FZRA 5DM4A 5KPJA 4HBGA 4CGZA 3GK3A 2Q3HA 3QUCA 5TEWA 5K8VA 3TGPA 4WSOA 1UJCA 3A9VA 3VU1A 1RHJA 1T36A 4B9AA 1FVOA 1Y9DA 4OAOA 2W9XA 3BMNB 1I7PA 4WJZA 3EDRA 2F1JA 3U1VA 4NAUA 5FR1A 5CCEA 4Y1GA 3KV1A 4AZWA 5KQGA 4QWWA 1VIVA 3O8NA 3BSYA 4D8XA 2BMAA 2C99A 2IPMA 3GFVA 4DLZA 4DTIA 1P18A 3IJ5A 3IQIX 2QG4A 1XA0A 4RGQA 4PCAA 3H05A 1H5QA 4V38A 5THXA 3T1HB 1ZC4A 4UQPA 5HVNA 1VPTA 2JI4A 4OX9B 3MLEA 4MW5A 4UKDA 3TBHA 1ZJJA 2EFEB 4LK2A 4B4UA 4EM6A 1GDTA 4JUBA 3I3SR 1I24A 3UMJA 3FUWA 1TADA 2R48A 3PEVA 3VPCA 1M8PA 2IW1A 4FGUA 2B8NA 4DLXA 3IDZA 1W8IA 3QKUA 2ZROA 3GLFB 4GP7A 2ZTLA 1KERA 1A1SA 3UJ6A 4JI7B 5BSMA 2EJCA 2VPQA 4FYWA 4UVIA 3SY8A 1NW3A 1KSJA 2R00A 4GR9A 1PI3A 4PYRA 3ZWQA 4R1QA 4ZK2A 2HHHB 3Q8KA 4HDSB 2R8RA 4QPDA 2E6KA 4IGEA 1DHRA 4KOAA 2P78A 4N6GA 3A1EA 1PEAA 4RM3A 2XZPA 4PNZA 4CU2A 3OQJA 2BPOA 4F3RA 5ESRA 1RZRD 2HIHA 4R7ZA 5EP1A 3HN7A 3K0HA 1DOHA 5EIBD 5MFZA 1EX7A 3F6SA 1CUFA 1NXOA 5SYAA 2OBLA 2ZI5A 1Z6QA 1RDFA 2I3AA 5IVHA 1QTRA 2I8AA 5DHUA 1KHHA 4MYUA 1T10A 3WAKA 3KL2A 1AHIA 3CUKA 2Q7DA 3R75A 2Q6LA 5I7WA 1K8QA 2PXAA 2PLNA 3R76A 4F3NA 5U9CA 1KO1A 3WGLA 2GFIA 3L7OA 5FWXA 4B34A 4KPUB 4PYJA 3IUEA 1HYEA 4FE7A 5H3HA 3WGQA 2DMRA 2XT9A 3PNKA 1G8HA 4BV9A 3FAKA 3ETLA 3KP1A 4RLSA 3OZUA 1NBMD 4ZANA 1UWCA 5ER9A 3F6RA 4H0NA 7MHTA 1JLLB 1Z83A 2PKQP 3R4CA 4BO0A 3HXQA 1C9KA 1Q0QA 1X8JA 4HRVA 4G25A 2DHDA 2F62A 5EZYF 2BRUC 4LC1A 4MUMA 5IUNC 2QL5A 4MUBA 5C8YA 3FVQA 3T7CA 2FAXA 5FL3A 3E05A 5JSHA 5EMKA 3A4NA 2I3BA 4XR9A 5FTKA 1SBIA 2PWZA 1WMDA 2IS6A 3ZXUB 6REQB 5AI4A 4ZO7A 3GUZA 2Z3VA 1QYXA 1EGAA 1R74A 2BJHA 3NZEA 4MTLA 1VPEA 1P9WA 1NSFA 1TKAA 2ASEA 5J2TA 2NP7A 3AUJB 3ZGYA 1PDWA 2FYTA 1NW7A 3LT0A 5EWJB 1GKIA 3QWFA 2YYZA 2TYSB 4HFMA 4BCCA 3UKJA 5G4LA 4BMDA 3V46A 5ALVA 4K40A 4M1ZA 1QV6A 3QF4B 4GUDA 4FHGA 1UL1X 1OHHD 1AA6A 3FNGA 3QW2A 4W8OA 4BMXA 4Y67A 5C1BA 2C3UA 3DQQA 2C9DA 3TK1A 4Z9FA 1C9YA 3RJZA 4QNNA 4Q1BA 1OWLA 5DGTA 1L5HB 2PCLA 3H4VA 2V0GA 6GPBA 2WYWA 1V6SA 2WOJA 2YHIB 5EAIA 4EDFA 2EZTA 2C8LA 1KNQA 4ZARA 1TF7A 1B6RA 1PGQA 3CH5A 4C7MA 1M5UA 1F60A 1GPYA 3U4CA 4XQ0A 1WXEA 4C0SA 2PGAA 1M2OB 5LUBA 1P1HA 1SIBE 1U0JA 4TS4A 1YT5A 3VPSA 4KH1A 4OV6B 5U4QA 1JFTA 2IXDA 4KQ9A 2H0QA 4C7BA 2UUCB 2JFXA 4L95C 1QG6A 3LIIA 3E9QA 1WETA 4HVAA 2UZ3A 4ZU6X 1LJUA 1R0BA 1NUQA 2HRDA 4IH4A 3O8QA 4QTXA 1F2UB 3DE7X 1OFVA 2VUHB 4AYTA 4L0QA 4OHPA 1Q74A 1PJSA 5EJ4A 5FEUA 1O0BA 1P7PA 2IXEA 1XRMA 2XT6A 3MTAA 4W63A 5A6SA 3UB2A 2QRVA 5JXGA 1IDN1 2QX6A 1Q7BA 1UOQA 3O2QB 1R6UA 3TH5A 2GXAA 2QBYA 5CHYA 5EGSA 1UP7A 2E5LB 1YFZA 1EFTA 2PMFA 4RMHA 4GSYA 4QBTA 4ZC1A 4MR9A 4U2CA 1UJ6A 3SG0A 2IDZA 5MFPA 4U7GA 3WBFA 1DSSG 3AVOA 4L9SA 3K92A 4C29A 1ANKA 2OD2A 4P5EA 3O8BA 5CX1B 3FJYA 3F6BX 3C3BA 4AJ2A 3II6X 1P72A 1XQXA 3GUUA 1IULA 2XT0A 3DE0X 2JGKA 3GEIA 2PUTA 1JH9A 2X42A 1GTG1 1Z28A 2H2DA 3TR0A 2H06A 2JIMA 1XCBA 3GLIB 1DE0A 3AKYA 1QH8A 3CLRD 3IRVA 5J5VA 3V9PA 3VPHA 2X23A 1U2SA 3EPHA 1WUYA 1YAJA 1DBSA 4FTWA 4EQZA 5CYPA 5EHGA 3UUWA 4GT1A 1ZWLA 1T2FA 3S5JA 2AFIB 3NO4A 3T5TA 1W5SA 3COPA 2JI8A 5JS6A 3EXEB 2Z6VA 4HLQB 4DARA 2QL9A 3AFMA 3HO8A 5JATA 2WWFA 1H66A 3B51X 5JXIA 4NYIR 4YHHB 2LIPA 4BMNA 1GDDA 1VHLA 3LFHA 2HTEA 1F6WA 3S7TA 3EWIA 1E3WB 2V5AA 3B7WA 4DWVA 4EUKA 1BKYA 1ZGHA 4WXRA 4B6GA 3U81A 3MUOA 3ZXXA 2J0UB 4P54A 2CJWA 1NR5A 3TOXA 1BD3A 3GLSA 4WCDA 5CLQA 3B6MA 4ZCRA 2J87A 5IT5A 4BX8A 4QAQA 1QKKA 4ERXA 1FE8A 4B47A 5G3ZA 5LDDC 1VA5A 1U0HC 2ESRA 5M34A 2F9FA 4RD3A 3HU1A 4AYWA 1L4FA 1PWHA 3OTHA 4IKEA 1CR1A 3W2EA 1IFXA 4DBZA 1CYEA 3OE5A 1MRNA 4KIWA 3AKZA 1YR7A 2A5LA 2N9UA 2QDKA 4GDMA 2FSIA 4MV8A 4XGNA 2H0AA 5E4FA 1WBBA 1G20B 1DC7A 3HHPA 1CHDA 5DT2A 4BBAA 3GMSA 3ZXSA 4G37A 2ABWA 2B25A 1O0CA 3DJFA 3HSYA 1Z5GA 4D7AA 2VQEB 2O8EA 4MKZA 2OLJA 2X8LA 4PNEA 2NXJA 3L4SO 4NNJA 3IMFA 4MUYA 5EWLB 3G2QA 4YDHB 2C29D 3GQBA 3A7DA 4H1HA 1CCWA 2KM1A 4XTCS 3AWDA 2H59A 3QE0A 4EF6A 4XWGA 3O8LA 3PXUA 3CNQS 4NCIA 3BCSA 3LVQE 4HAYA 4JEUA 4RDXA 3KX2A 3KE8A 4B3JA 2ZIVB 4B43A 1E64A 4OU5A 5G1PA 5I7OA 2ZYVX 1D0IA 3FWYA 1UBOS 1UK6A 1ZICA 1GPH1 4LJ5A 721PA 1EEXB 1TECE 1TC1A 1VRVA 1HFJA 1OXKB 3GJXC 5HFAA 1H3EA 4WASA 4Y6OA 3TXYA 4HSGA 1LD3A 1Z29A 2W2VA 5JD4A 3HBFA 3PFHA 1GRCA 4WY8A 3RTEA 1N5RA 2ZYGA 4QAJA 1L7PA 2Q2OA 3UEOA 4IDBA 4IPTA 1WB5A 3M3DA 3ZZMA 2O5RA 1B6TA 5JO9A 5HR5A 1DWQA 1SC1A 2OV1A 2JAHA 5DOVA 3ZHQA 4E5UA 3ANSA 1BCRB 3QU4A 4BEWA 2YWHA 3CVOA 1IH8A 2DRIA 4UUBA 5HKOA 4I50B 1FQOA 2BFCA 2EWMA 1CVIA 1KI2A 2O52A 3K5WA 4G4JA 4YYZA 2F2TA 3MC1A 1JQLB 1EE2A 3MN1A 4MROA 3B70A 4L5JA 2PT7A 3LUKA 3O8QB 2X5NA 3TS1A 3ZVLA 2FU5C 3Q5GA 1GAQA 3F3SA 3DMRA 3KAQA 4YJ3F 1PJCA 4B79A 4O25A 4E1BA 1K2WA 5A1TA 1W75A 2NSYA 1QGYA 2PQ6A 3AG5A 3EVEA 4MLPA 4AY4A 4DQDA 3EXIB 2ET6A 4OL0A 2OVFA 1DKPA 1JTEA 2J3MA 1CX9B 2P9JA 5EIBC 1ZIYA 2HUPA 2QTNA 2ZATA 3M4JA 3OPVA 5JYCA 3L0PA 5T7BA 1FX0B 3NHLA 1O4WA 4IUYA 4BZZA 4N76A 1N6PA 4QYIB 3Q8MA 3IUBA 1BHSA 1VPWA 1ZI8A 3GR6A 4L3OA 1EGQA 4ZHQF 3F1LA 2HV9A 1EE9A 2C2GA 4XWKA 4UDXX 4O2BA 5BMVB 2GN4A 4WOBA 4KP7A 4Y9DA 4YIKA 3M34A 1N5DA 3H99A 2NZYA 4RJ2A 1FFSA 2J0VA 3L82B 1S4MA 4PU0A 4PZAA 2GAOA 3IQGX 3KT0A 1JQJC 3BA6A 4AXBA 4ZQCB 1JHRA 4N03A 1BE0A 5KU7A 1KORA 5K3FB 3C7KA 3ZWOA 5E0OA 1K6XA 4DLBA 3UOAB 4JSTA 1JU3A 4QFMA 3ZD9A 5BVGA 1LLFA 1Z7YA 3EF3A 5LA6F 4N3GA 1BVYF 1YA8A 2JVKA 2ZIXB 5IMBA 4A6XA 3RYFB 1KWKA 2PEYA 3E9EA 4C2UA 2FSSA 4G86A 1AXGA 2OK7A 4NV0A 4Z4CA 4DPLA 1I2CA 1L7OA 2QENA 3D7MA 4JI2B 3BGSA 2PNJA 2G7MC 2UUAB 4FKZA 1T13A 4CV0A 1NU6A 5IKMA 1ZSYA 3LCRA 2QTVA 1QGOA 3PENA 4JB2A 4CKYA 1RYBA 4Z9YA 4I19A 4II7A 1CIJA 1T29A 3NVDA 4RYLA 4AJ1A 4HV4A 2O06A 5IBPA 4CW7A 3DZKA 4BTEA 3U5ZB 2CJWB 4YTEA 1WB9A 1GT91 2D74A 1DFGA 1JFFA 1VSUA 3QVUA 4EX7A 2BZ0A 1GA4A 4G2NA 4LQDA 1M34A 3PXDA 1FNSA 1L8OA 5K09A 1LBQA 2G40A 3RT1A 4MWGA 1JLMA 3BXPA 3EW9A 1YGPA 3GX1A 5ALUA 3O3OB 1RMYA 4E94A 1YR2A 3PF9A 3V8MA 1IU9A 2FMHA 3EAGA 3RRFA 3G0BA 2Q27A 3QQPA 3U3DA 5CEJA 1D3AA 1RADA 1OBVA 4XSGA 3KR9A 2PUDA 1RC8A 2J08A 5GQSA 4JQOA 1LK0A 3GRYA 1JXMA 3DE2X 2NOAA 4EG8A 1GTVA 1WSDA 2ZYAA 3OLVA 2AWNA 1UOPA 2OZKA 4KN8A 3SDSA 4D0RA 4LECA 4D74A 3FMFA 3F8WA 1OLXA 1IDOA 1JDBB 2PH3A 1TEZA 2XGSA 4IX9A 1I80A 2BGTA 1MG0A 2YJNA 4L27A 3UNXA 4F5ZA 4D9FA 2FOIA 1ZBQA 3PQEA 1KY5A 3K2IA 4BNVA 2LUOA 2RK4A 1VHDA 2PK3A 4FYPA 3NNSA 1K5PA 2NQ8A 2AMJA 2UZIR 3E84A 1C9EA 5DLEA 4LY6A 2OA0A 4AMVA 4NU6A 5LP6F 1X1EA 1G6HA 5F9MA 2WMYA 1NF9A 2FK8A 3E9YA 3R8CA 3T8YA 1DARA 1RAGA 1STOA 3MMZA 5KOYA 3SE7A 3ZBUA 2OLKA 1OAKA 3H5RA 3H8SA 3JY6A 5CG2A 2DVMA 5DHRA 1UMBA 3ZV7A 3S7ZA 2HQOA 2PJUA 3GRKA 4RCVA 3VR4D 4EHAA 3ITNA 3KVOA 2EJUA 4AURA 1HEIA 4MJLA 1TVKA 1CKEA 2H4WA 3RGWS 3VVBA 1EWRA 1BCRA 3A6HA 1ZPDA 3A58B 4M8KA 1VJ1A 4E07A 2ZITA 1XVTA 2OMEA 4QNMA 4XYLA 5CA1A 3UHFA 2ZYIA 1P0IA 4DSOA 4YAJA 2PO5A 2BELA 1I14A 3H5NA 2HO4A 4Q4HA 3RS9A 3ICCA 3MWEB 4XX1A 4TXLA 2QV7A 4DA0A 3FUUA 4YP5A 3G0IA 2HD4A 2FI1A 3EVGA 3K5PA 2IKSA 3I2HA 3LZDA 5BN4A 3H9JA 2GO7A 2P2NA 3K16A 4M1OA 4PSDA 5CH5A 1YOVB 4TLEA 1FMCA 2ZUCA 3GDOA 1GJRA 3IELA 3FKJA 1HUQA 4EECA 3WJ2A 1K86A 2WMDA 4CU5A 1EVJA 1RWWA 3KVVA 4YMSA 1W88A 3RYTC 3TE7A 4R98A 1SUBA 3ZXYA 2FHSA 5C7LO 1P33A 3C5EA 3CJQA 2AC2A 4TUYF 1ISSA 4J0CA 3L7DA 4YUXA 1G3RA 2OCBA 3DF9A 3PT9A 2AV6A 3CX8A 2VUTA 4NJEA 4ZHQB 2VDWA 3Q6NA 3ANLA 4KVGA 4OMUA 4NFYA 4Y1FA 1C9MA 4HEHA 3TNFA 1I0ZA 4Q05A 4RHCA 4FFOA 5E6RA 3O8RA 1GNSA 5JSZB 5SYNA 4J90A 1BVRA 4QICA 5TV2A 1JDJA 3BZBA 3R0XA 3PEYA 8MHTA 2GCEA 3MGAA 2ZSHA 4EATA 2EZUA 4P22A 4EPTA 4MB0A 2O48X 3WL8A 1BDIA 2D54A 3N0WA 2TRSB 2WA1A 3NKFA 3R3VA 3I1FA 1Y8QA 1JGTA 2GBIA 2QN7A 2VF4X 3FHOA 2ADMA 3BXGA 4I9GA 3KQNA 1IRXA 1FX1A 3L92A 3I5UA 1HF3A 4IO0A 2WJAA 2VHZA 3MWDA 1WHTA 2QTVB 4F97A 1Z8HA 1TVMA 2I8LA 3KVNA 3KAJA 1SAYA 4JSRA 5GV8A 3FM9A 5GV7A 5B57C 2DUJA 2RI0A 4UCXA 4Z9XA 2NZUG 4BLOA 1DU4A 4MYTA 3SXPA 2A35A 3NKVA 2WF8A 2V6MA 4LXIA 4AULA 4DCVA 4W5RA 1CUYA 3FGPA 5A7HA 4DXAA 1VHJA 3R6WA 4LSGA 2FMTA 3PNYA 3R9WA 4G4GA 1D5CA 2C84A 3KM0A 4QJ4A 3UK2A 4OHOA 1LPPA 7REQA 3HXTA 1QTIA 3HEAA 5JLJA 2EGHA 3B3QA 4XZ3A 3WLEA 3BT7A 2VHYA 2AC4A 2Z4TA 1LQ2A 3NOQA 3QKRB 3U40A 4ZYTA 5K0FA 1WUJS 2NW6A 3A31A 2O1WA 3L8MA 4D02A 4E5DA 3SZGA 2ZB3A 2QUIA 3D6VA 2DULA 4D9IA 1QJ4A 4JD5A 3TIXB 3AP3A 4UJ3A 4Y2XA 1QQ5A 4TSRA 2JH3A 2AG6A 2GBFA 3ZHBA 4ZVSA 3CGGA 3C3WA 1II8B 3G0CA 3L5KA 4JJAA 4E30A 1OFTA 3BHIA 5F3WB 3PC2A 4BATA 5EHIA 1AQ6A 4LGVA 4PSCA 4MW9A 5FFFA 2IY7A 2PA0A 2ZI3A 4JBLA 3V1YA 4EABA 5JJLA 2XXJA 5KJEA 4R71A 1LGYA 2PL1A 3KOZA 1EUQA 4FDLA 2J59A 1ONOA 3VPGA 2J3DA 1Q3HA 1GGNA 4GSLA 3TLGB 4CMGA 4C7JA 5JARA 4OYYA 1MABA 1NNLA 1E6WA 3GEEA 1V96A 1RI4A 2IPXA 3I45A 2C2OA 4ETWA 4ZOCA 3ULKA 2EZ8A 3T3IA 2AG0A 2X9NA 3UGJA 4WDQA 4OGFA 4PR0A 3Q41A 3I4FA 1LBTA 4J49A 1E7MA 2HK7A 2XMZA 3H65A 2C0PA 3EF1A 4JKYA 4PHFA 4LXXA 4GZ6A 5IJXA 1KJ9A 4K9LA 2VP0A 1D7AA 3LVRE 1L3IA 3BMCA 4J3NA 4YV2A 1I4DD 1G59A 4RHYA 3RS5A 3VAZA 1S4QA 1SZCA 1HGXA 1K6MA 1N3IA 1TZBA 3AR9A 3LUHA 4ZMBA 4RL4A 3C2QA 4JLVA 5DHTA 5JPDA 5KYTA 1XCMA 1TQHA 3NNDA 4FBGA 1TJYA 5AHOA 4UOZA 1QHIA 3LPAA 1XRNA 4DMHA 5JXHA 1BA2A 3PQ4A 4B6FA 3GPBA 5BN5B 4BAGA 3CFYA 4ARIA 4LPSA 2J33A 1I3KA 3MA0A 4QRIA 1ORRA 2P3SA 3LP8A 3OI7A 4J1QA 4CTMA 4J16C 4W6ZA 5D5PA 4JEMA 1R0YA 3E7XA 4GX2A 3DBOB 3PTZA 3S2IA 4Q12A 3LO8A 4B6SA 1M33A 3AEKA 1O77A 1S2NA 4R8LA 5AOVA 1BXZA 3ANTA 2GEUA 3WKAA 1JP7A 2A0XA 1HTTA 4DLAA 5FWYA 3P4UA 3A04A 5BV1A 1H22A 3AESB 3K5IA 4NEQA 4Z99A 4O2RA 2VPTA 5LIRA 5GP1A 4LXTA 1NN3A 1SZPA 4O1IA 1XPJA 2AVDA 2ZB8A 5AVYA 4UVEA 3PPYA 4XB6B 3DBRB 4ITUA 4KW7A 4XWTA 3TLZA 5J2TB 3MF4A 4GU5A 4UFPA 1GUBA 4GW3A 2GGSA 5AT1A 4C6TA 1YQTA 2WTNA 2G25A 4B2IA 3K15A 3B7PA 1XEFA 3F5FA 4D3FA 3KAKA 3F97A 5DP2A 1HXHA 2NU6A 2VQ3A 3O38A 2B20A 1KYTA 1R6AA 3A25A 3GBVA 2E1PA 4TXJA 2DERA 2GJAA 4YUWA 3ROPA 3VKWA 1CJMA 5B2ZA 3RS2A 3Q0IA 4OMDA 4PS1A 2FN3A 1VCHA 3L6BA 4I5EA 4DJAA 3PDJA 1F2TA 4UHEA 2IXGA 3VR2D 4JCOA 3BWYA 5B1HA 1NUHA 1MJFA 2E4WA 1FY2A 1MQ8B 1F2DA 3EXEA 2H8KA 3IV9A 4JVNA 2HDOA 1DHTA 4MEJA 4X1YB 3TG8A 4QOIA 4HO1X 3H04A 3CEJA 5G3YA 2QN9A 1VLZA 2CDAA 2H52A 3CO0S 2V4UA 2CFRA 2Q4BA 2B1IA 2OBXA 2KJQA 3ABQB 2BFBA 3FVRA 1MPTA 3LOQA 4JLNA 1P1KA 4JUFA 4B2YA 2AOWA 4DQUA 3P94A 3Q3IA 1RPZA 3N2EA 3WKCA 4PGGA 4R4JA 4TWJA 4KC0A 3L0DA 2EBHX 1OC4A 4GI1A 2IU3A 1EEHA 3NOVA 5DSXA 5LMUB 4MVJD 1JEOA 1ZUWA 3L40A 2WWWA 3T34A 1QORA 1I9CA 2CCJA 2VBFA 2AJ8A 1VE3A 1MBZA 3GRAA 3WB9A 4AZTA 4EY8A 3B9RA 4BB9A 4Q3KA 2FGKA 3PBKA 4DA7A 5HPYB 1UM9B 5KREA 5KYWA 3PLAE 1A2KC 1I3MA 4UBIA 1FRZA 4D97A 2PKEA 3U7HB 3Q1KA 4PXAA 4G0WA 2XNDD 2AN9A 2R96A 1WDMA 4H77A 4JFRA 1J5XA 4KV7A 5HZHA 4R2KA 3UHOA 1JJ7A 2C5BA 1OX4B 4OYRA 5CDSA 3EVTA 4URVR 1T4DA 3UMFA 2GLTA 1BQ3A 1XDBA 3VSBA 1TTPB 1NGSA 2V54A 2VWQA 4HLNA 4EW2A 2H00A 3F3YA 4ZCQA 3BCUA 3DGFC 3W5BA 2R5FA 2BEWB 2B92A 4AQDA 3GNSA 3TCNA 4ZVTA 2ZT8A 1BA3A 1NN1A 3KYBA 5CFRA 4P4LA 1HE3A 4RV4A 3RSGA 3E3MA 1CDDA 2EP8A 2IEDA 1X7HA 3E8XA 2RFLA 4C05A 3UAVA 4K9OA 7ADHA 4UHFA 2X13A 1PLKA 1KFEB 3WGGA 3M5WA 1JKFA 1QV7A 2EG5A 4YWJA 4Y6LA 3T0GA 4NXMB 2GUGA 3SQXA 4MVXA 2WM2A 2EBUA 1RWOA 3GLHB 1AGRA 4JOCA 2QLMA 4FN4A 1B4DA 1OLSA 4CM8A 2OESA 2VJKA 2ETXA 1TB4A 3JQCA 3EWSA 3EXG1 4NABA 4PIVA 4UNNA 3PC8C 4PFKA 4YN3A 2AN1A 4QYWA 3U56A 2JHGA 6LDHA 4Q9HA 4RVFA 3MSCA 3L7NA 1VG1A 4OG2A 1PNRA 1QF6A 3KKEA 1TVEA 1J2EA 2JGAA 1TPZA 4N49A 4JZKA 5E3JA 5FEMA 3WQBA 5BR4A 2HEIA 3C3CA 1HDCA 1A97A 1T3LA 4BYMA 2XGOA 3H87A 4WJKB 3SX2A 3GJTA 4GQAA 4KHPB 2PQ0A 1KBZA 2C7QA 1K66A 3IOEA 3HA7A 3RVKA 1EFKA 3HMQA 1T8WA 1JVBA 2Q3CA 1X9GA 3T6KA 4FCVA 2COEA 1N9KA 1EXNA 1Z6XA 3JWIA 3M1YA 3QQ5A 5IBQA 1E89A 2BJVA 1KBQA 5DH9A 4MR8B 4XM1A 1JEAA 1N32B 1YCGA 3OY7A 1Z6YA 3F74A 4IGIA 4OEHA 5B3AA 3U49A 5BMVA 2GCPA 3V8VA 4IX1A 3WL3A 2A4KA 4AK9A 1RQXA 2ZS8A 5DKFA 1KQNA 2WUWE 3H1FA 1LU9A 5EIWA 4W5OA 3CT6A 4UU7A 1L5NA 1N33B 4IEEA 3ZI7A 1UMBB 4MYCA 4YPOA 2PD4A 1FUIA 3NM4A 4F9GA 3H11B 2CCGA 3IP6A 5LMNB 2I1QA 3E3NA 2EDCA 2OZEA 4OM7A 3WGJA 2ATEA 2UVDA 1QTNA 3B3AA 3BTSA 4YJHA 3RUDA 2A7QA 3RM3A 4C5CA 4CQNA 5TJHA 4KN9S 4RAQA 1QYWA 4TLMB 1W94A 3H19A 5T5QA 3I73A 3I01M 3SU8A 4A6DA 3IAM6 5IF9A 5AJZA 1Y1TA 3SJBA 3NYWA 2P77A 3L6DA 1U63A 3GY0A 1YHZA 1TCCA 3CINA 4OH7A 4Q1VA 2O54A 5FRDA 1TO1E 2DYKA 3V55A 2GK6A 4MULA 4Q9AA 4G4IA 3SM9A 3W1VA 1A9PA 4D96A 1P2BA 5BN4B 1J0CA 1ISIA 4GOXA 4HH4A 2VO1A 2C77A 2OWDA 4ML3A 1XDZA 2BFFA 2Y27A 1ZIXA 2ZDHA 4EUEA 1Q6ZA 4KPYA 3GV0A 4DB4A 1OLUB 4QHYA 1JPUA 4L15A 1R50A 1DRWA 1JE1A 1LV7A 2P1ZA 3HJAA 1VJCA 4I55B 1EB8A 5ER6A 3RFUA 3Q7PA 2WPDD 2X58A 5AM4A 4KLCA 2A33A 3P0RA 1XLTA 4IMPA 4S1NA 5KC9A 1L7BA 2ZI9A 5DNWA 3NTXA 3SOPA 1L1RA 2FEXA 3HBAA 4BGDA 1JB9A 4H27A 3DOEA 1YAHA 4X3CA 1RQNA 5F76A 4WV3A 4MGIR 3U7EB 4F6LA 3DTVA 5C1DA 4H35A 1JS1X 2IUYA 3A37A 4KVAA 1WXXA 4CIXA 4Q21A 1PUXA 2QRJA 2LDBA 1OFHA 4N7BA 1N5MA 4QBHA 1R9MA 1N7IA 2A0KA 2XEDA 4O2AA 4RPLA 4YP0A 2GF9A 2Q6VA 3UAOA 2MHCA 1OBHA 2VI5A 4RJLA 2W0MA 4PZDA 4XRGA 4OHMA 4EI2A 3T38A 4P7JA 4UPEA 3OZXA 3PU6A 4MV6A 1SM4A 4NZ9A 5L7TA 2D00A 4LHYA 4UNIA 5E6SB 5AVZA 5TSDA 2ZJ0A 3A1UA 3IC5A 1UIMA 3CRZA 4RVUA 4HRXA 1HT0A 3ILXA 3UJ8A 3S99A 1SKAA 1ZM3A 4TMFA 1NX6A 3OHMA 4KWTA 3ASVA 4BNNA 3BGOS 5AP9A 3G9QA 1GR0A 1YE5A 1JNYA 2JAWA 1GZUA 5IM4A 3WTBA 1JHMA 1G16A 1Q2XA 2I7XA 3F6PA 3I92A 5BQFA 5JSQA 2GSWA 5I7VA 3CLUC 3K6JA 2O8EB 3FOWA 2HSWA 4KFUA 1Z0FA 2VDQB 3FJOA 3TVYA 3R3HA 3OIFA 3THXA 1EVQA 5NLLA 3A6LA 2C2YA 1Q0ZA 2BMFA 5HTKA 6AT1A 3X1YA 4DCNA 2PUBA 3ZJUA 3AZOA 1YKGA 5A02A 3DJYA 4Z4EA 1J97A 3AT1A 3VGPA 4JFAA 4YAWA 2VK1A 3WWDA 4WXEA 1D2GA 2QAGB 2ATIA 2V7UA 3GDWA 1OE0A 2OILA 3HL4A 4MQLA 4RENA 1AHPA 4QQNA 5E8JA 4M99A 4L7VA 4B44A 2ZJ4A 2RH4A 3LXUX 4KXVA 3D5EA 3K9HA 1QRTA 5HS4A 4LHWA 4BC0A 4I9NA 1KDVA 2HRBA 1D4AA 4ARZB 4PQGA 1G6OA 2ZVPX 2AOVA 1ZGZA 1I36A 2B4TO 2P3QA 4L0MA 4URZR 5HA5A 4XWOA 4G0VA 4M38A 4R8MA 3DHNA 4EO9A 2ZSBA 2HMUA 3AERB 5JCOA 4N0DA 1VE1A 5GGYA 2HRZA 3IT3A 1UKZA 2GFHA 3REGA 4XVCA 2ZDGA 4ALLA 4MW7A 4X91A 5LYJA 2OV3A 1Q20A 1VJ0A 2P79A 4S0ZA 4H3SA 1T1GA 3UCXA 2C1ZA 5EXPA 2BFCB 3PGMA 4WKNA 3UOGA 2OYSA 4FU0A 5LQAA 2RJOA 2VA8A 1M2FA 3FX2A 4KTTE 3WNQA 5FPTA 1UZNA 3P27A 4WOKA 4F38A 1KQOA 3PITA 4H4DA 1T5IA 1R8XA 1XTJA 5DT9A 1FMFA 2G4VA 1Z0IA 1VHQA 3ESRA 2P2CA 4XR4A 4BNLA 3UJ7A 1LDMA 4DHWA 8ABPA 1YC5A 3HSKA 1NUAA 4PLYA 5LP6C 3VFDA 4YAOA 3T3EA 4OHXA 5CDHA 3GPCA 3K1ZA 2XZLA 1W8DA 4KFCA 4EZBA 2BUBA 5BQPA 1CSEE 1Z2PX 4M9XA 1KEPA 2VAXA 3D3QA 3DVQX 3H2IA 3OT1A 2PSHA 1GG2A 3R8XA 1YB7A 2RGUA 1NBHA 2XX3A 1CQJB 3HKEA 4O4JB 4C7KA 4JJEA 5KOIA 5DLQC 4ZO6A 1XTPA 2RKOA 4F8EA 4XPZA 3HN2A 3U09A 2BM9A 1BWQA 2JLAA 4CKZA 4PINA 4LYDA 2REQB 3EGDB 1BE1A 1WOMA 1COWD 2JFFA 4OIMA 4NDZA 4WECA 1ZL0A 4KXMA 3OM8A 3PQ3A 4DQKA 3OZ7A 3IEXA 1S7GA 4KXQA 4F45A 1RAHA 2VEDA 3QYAA 1QYIA 5BVGB 1E4OA 3INTA 3TLCA 1WS6A 2BV3A 2R60A 2JFBA 1Y3IA 4RK6A 2A94A 1B93A 4LXUA 4ZHQA 4LISA 5FNVF 4G5RA 3IHLA 1H6CA 1BKSB 1WSWA 2ZW9A 2VOJA 4HUJA 2OHXA 1ZNWA 4BMPB 1RPTA 2Q2WA 3QXXA 4JC8A 2WZDA 3NRJA 4LGCA 4N9QA 4ND8A 5B6IA 3ZCSA 5IM4F 3H3XA 1RZ3A 1C50A 3BFVA 3HRIA 2V3WA 1EGHA 1CY8A 5P21A 1OXSC 5B58T 5CB4B 3LDFA 2BEVB 2BFDB 2ZRFA 4M7WA 5DGDA 2X41A 2CV0A 4K26A 2HREA 2J0EA 2RGNA 3GLTA 4Y7DA 1ODSA 3RU9A 2DPLA 1CY0A 4PXSA 5ESWA 3WL7A 4Z1MD 3CVXA 1JIIA 2ZTHA 1CUDA 3ZGOA 4OKNA 3KB8A 4CFZA 4TMYA 1CUCA 2X2OA 1AX9A 1CQPA 2YZMA 4JB3A 4XJSA 2A2ZA 3A0RB 1GN8A 1WCV1 2JJ2D 1DC5A 1QH1A 1SBZA 1U2EA 2OHHA 3OTGA 4MV7A 2Z5GA 5F23A 2WU0A 1L5WA 5CXUA 1USWA 2I4RA 3PQ6A 3MMPA 2GH1A 3U17A 3HQ4O 1JBKA 5EINA 4GGMX 5EQTA 3ZNPA 2ADFA 4L07A 4EJMA 4F3KA 4XOIA 2DUMA 2QJFA 3C16C 3I6QA 2VYCA 3A2KA 4FSXA 4AN0A 1K75A 1KH2A 3AGPA 2GBCA 4R1MA 4R8VA 1DLIA 1E1CA 5ALMA 2RH5A 4NEGA 1PL8A 2E48A 1KAHA 1GZDA 3GLGB 2QK4A 4CQMB 4M60A 1WPRA 2PL3A 2C9OA 2FW1A 3DTVD 2P11A 3KLBA 3Q3HA 4GNRA 4K0KB 1ADFA 3OJLA 1BQEA 1TU0A 1XU4A 3PR3A 2ATXA 1CU1A 1SU8A 2ZRMA 4JQZA 4E4TA 4XX0B 4KFSA 4LOIA 4YMUA 1N0VC 2O5EA 2A0WA 3TQFA 1YGYA 2W2QA 3P0FA 2IUUA 5BYAA 2F1HA 1SUFA 1TX4B 2WPDA 5BMVF 5KYKA 2PGOA 5BT9A 2V5UA 1IBSA 1OVMA 4M8SA 4MB6A 4QUEA 1GCGA 2FKAA 3WWZA 3L7BA 1XWIA 1JUDA 3THYB 3PHJA 2V6FA 4KDFA 2RKBA 5DBIA 3BIFA 4FYKA 4NZYA 3MW8A 3HVKA 2HMSA 1WKCA 2C4UA 4G67A 3IE2A 4YUZA 3O3CA 1UFRA 3LYUA 3OWHA 3VR0A 5CEFA 2I2AA 4ZPJA 5FQOA 3VR5A 4GDFA 4HEA6 4RZHA 3KKKA 2VJNA 4JC4A 1IBMB 4XWWA 2R6ZA 3NTQA 2XE7A 3L6CA 2H1HA 1DEOA 2F4VB 2Z2XA 3JWGA 1RPNA 3MGKA 1WUTA 2R1TB 4II3A 4CKBB 3KAPA 2OV2A 2FFQA 1UT5A 2A84A 1SCDA 3G9XA 5DP1A 1KMHA 4MWEA 2J46A 3G17A 5L3SA 3DUFA 1MB3A 1YTUA 4EHFA 4TVKA 3H5IA 3TB6A 3H8WA 1V8DA 1U8UA 4BC1A 3K6RA 4OUDA 4HDNB 1I2AA 4GKKB 4YR7A 3HB0A 3FIUA 4JQCA 2OE2A 4P6VF 4ZZ1A 1EWVA 1UPXA 4HXGA 2ZBGA 4M37A 4YK7A 2R751 4F4FA 5CCXA 4P98A 3IVGA 3RPEA 5AKIA 3DYVA 3WIDA 4B45A 5BN5A 1LNQA 3C3MA 4R8SA 4EYKA 3T0FA 3TKYA 2DJ5A 2Y1GA 2P4QA 1R6BX 3IFSA 4BQRA 3I8OA 3QVJA 4E6PA 1DI0A 5KYNA 3FG9A 1BRTA 2Q5HA 3P9XA 4NK4A 3THRA 2FGJA 4ZQIA 2Q45A 3KYJB 3G7NA 3ROFA 1Q2UA 4IIVA 4CM7A 5CH8A 2Y0BA 1ZVMA 5IN5A 1G64A 2FB9A 1W5AA 4UFNA 4RK5A 2IKQA 5G2OA 4OQFA 5AUNB 3PVSA 1BXRA 1ACMA 3FZYA 3FYUA 3GP5A 4XYBA 2B1RA 4D4KA 1RS0A 3F7NA 4KH0A 3DEAA 4KIFA 1LX6A 4UFOA 1ZCZA 2QMEA 3JSAA 3QE2A 2F1OA 4I55F 4IR7A 2CFCA 1Q7RA 4M8NE 4MYSA 4UMFA 3TUJC 4M88A 3QVGB 5EJAA 4RJIA 4DAEA 2FKNA 1VE6A 3ADOA 3UMRA 3O93A 3OQVA 3UT5A 4RVCA 1XPRA 3PE4A 3GXOA 3GHHA 1EFAA 4LHXA 3KWMA 1PR3A 5K03A 1U9IA 3HBLA 1WTCA 4BV3A 1OILA 2IPLA 1DC8A 1E2KA 4LWPA 5DV9A 3ZTYA 1CT9A 1R15A 2JF0A 4NOMA 2C95A 1U28A 4UARA 5D3ZA 4ZHSA 5AW4A 5JAMA 2Z2JA 1DAHA 1OW3B 2HQRA 5KTRA 2JLVA 5EMHA 2YFHA 3D2LA 2A88A 3I8XA 2PWAA 1J00A 4PLZA 3LWNA 2Q99A 4MRSA 2II6A 3E9NA 3SAJA 2YXPX 5M7EA 2QR3A 4NV3A 4ZIRA 4W5TA 4Z3OA 3B5IA 4MUXA 5GOTA 2RIRA 3ZK8A 2CBZA 5FORA 1ORIA 3JR3A 4EY7A 1G2IA 1H0RA 1KK0A 2X7HA 3GELA 3P0IA 3SP1A 2ZE8A 2XUHA 4YASA 3UGTA 1YZUA 4ZZ3A 1QHXA 4DLWA 3OZDA 3NJ4A 5CNKA 4JUDX 1PQYA 3FMVA 3JATA 3WLPA 5KNCA 1DJOA 5E1OA 5DF1A 1XOIA 6Q21A 1PR0A 2O1SA 1O9HA 1OWMA 1TPYA 3EA0A 2AN3A 3K70B 4C2AA 2XAAA 3MG9A 2GZ3A 4TKMA 1X6VA 3SFTA 3UTDA 1ZGGA 3L1UA 1MOPA 3LXXA 3ZQJA 1WEHA 2R7NA 3MYYA 5BSUA 2VNJA 3FWKA 4PO1A 4AVYA 2QRLA 2K2WA 2ZLBA 3CUEF 2G3YA 2HIGA 4K9QA 4BN5A 4GL2A 3UKDA 3EBPA 2I7VA 5EZYA 4DCCA 4GKBA 2QPOA 4LZAA 4CKEA 3RR2A 1RJWA 2JBAA 2XZTA 4WT7A 4D5EA 2C54A 1CR0A 4RORA 2ZRDA 4EKIA 1NE2A 3FR8A 4Q3LA 3V33A 4KKXB 3MWJA 3OTQA 2FR8A 3AY6A 2H4HA 3E18A 3TPCA 1J8QA 5AW9A 6CHYA 3R3JA 2OUKA 2RGEA 1UEXC 1E8NA 3SXJA 3D6MA 1OY1A 4WZBA 2WIFA 1DCTA 5B3JC 1L2TA 1ZK2A 4MO2A 2HIMA 2OM6A 4WAUA 1HT3A 5BW6B 4CCYB 1FSPA 2PX5A 3QUQA 1UXJA 5DMXA 3HLKA 3USES 4D57A 4L8FA 3NIDB 3RUIA 4CEIB 4H3VA 4F1KA 4QDJA 3HMKA 3GDGA 3SX0A 8LDHA 3AEKB 1YIOA 3N7AA 4NV1A 3S6JA 3KS9A 4DSUA 1P4RA 4MR7B 1KARA 1L4MA 3RD5A 4FOOA 3QPBA 1HTBA 5AVUA 1JHUA 1V9LA 3AESA 4DQLA 3UMYA 4G63A 1PL6A 3M81A 3ZNQA 3IV6A 1LFAA 2G7ZA 4S2EA 3ZJ5A 4HNUA 4LKOA 5CFPA 1ZAYA 3LBIA 2ZTUA 4XFKA 3LT4A 3CCBA 4BUZA 4ZVPA 4A6PA 3NNNA 4FONA 5IYZB 1P2UA 2A8YA 4N48A 1U8XX 3LT2A 1FX0A 4A0QA 4E5PA 2E49A 4RSMA 3SZMA 2Y4OA 3BRSA 3CM0A 5CAEB 1UH5A 3FGNA 4BNWA 2WB2A 1CQIB 4MAAA 4QOFA 2O3SA 3LDHA 1VG0B 2R1VB 4ES6A 5HUJA 5I3CA 5IXSA 1THZA 4X7RA 4IILA 4OP2A 5CNMA 5I9IA 2EP5A 3T4PA 5BUZA 2OO7A 2XQGA 1ZOLA 1AHNA 4GGPA 4ZEWA 2W98A 1QO0D 2FSHA 4ZT7A 1WCIB 3D5TA 3VNAA 1XTRA 4PC2A 1AT1A 2H17A 2OYRA 4BKPA 1G42A 2OCIA 1F2UA 2NYAA 4WXHA 3WS7A 3LAWA 3NHRA 4EA6A 2PL5A 2BYTA 3JRWA 3LPDA 3VPAA 3TBFA 3EG9A 2X3YA 2VHJA 3WFJA 1OROA 4MX8A 3PEUA 3LHKA 4B5LA 3UJNA 3F6EX 4NP6A 4O0LA 1BCSA 4M6WB 3OE1A 4OHRA 4RNCA 1T9GS 2EAUA 1NATA 5DFAA 1WXWA 4X8MA 1J25A 3D8BA 4YIHA 1OBOA 5EHQA 5K0LA 3EQ6A 1EFLA 5LBIA 4Y7CA 2YMPA 3CNBA 2YJ6A 1RU3A 3DOOA 3NBFA 2D1RA 2K7ZA 1GUZA 3R5KA 3ESDA 3AIIA 1L8AA 4P31A 3KQHA 1MB4A 3AF4A 3EDYA 4JR0A 4D4LA 1R88A 1QGUA 1RVDA 2FPXA 2XV1A 4YRNA 5C7OO 3IPCA 3JASB 4PNHA 1ODTC 2H1CA 5H80A 3FTNA 3JVDA 1PV2A 2C2MA 4H3HB 2ERYA 1YL5A 4YY3B 1XCJA 1I30A 2QSJA 4HOYA 3MJTA 5F3RA 2PX8A 3JPWA 2CC2A 1DIRA 1EDDA 2A0YA 3EZGA 4CIVA 1VLMA 2BN4A 3RSLA 1O96B 1O89A 4REQA 1N2CA 4UBMA 2HA7A 4J6FA 1GAJA 2AEEA 4MV5A 4AP9A 2B34A 3SBOA 5IAEA 3M5PA 3DB1A 2C7RA 2OBMA 2C88A 2H1VA 4I9UA 4D80A 1ULUA 4DVGA 1OFUX 1I2DA 1JQDA 5ITSA 3WGIA 4M55A 1K2VN 1EQAA 2HB6A 3ER8A 4ENRA 2V0NA 5FBZA 2B8WA 1KZGB 1LV8A 4KK4A 5EMLA 2ZVDA 1V1RB 3DV2A 3UQYS 2XJ9A 3TDNA 1PG5A 2JFGA 1AQLA 3OG9A 3ZWBA 4ZJYA 1W4ZA 1KS9A 1DVRA 3BKXA 3S1AB 4JWTA 1IBKB 5E38A 1ZOSA 2GPNA 1JHYA 2WJ6A 3STVA 1MAVA 3ZLVA 4M1MA 3I52A 3UPUA 2ZBUA 3IUSA 3ZCVA 1U7DA 1JG4A 2A57A 1P5HA 4BO7A 2B7LA 1FDTA 1US8B 2A9OA 2N46A 1WWKA 2RGNC 3P5SA 4X61A 4XEUA 3MT7A 3V4RA 2V9CA 2IVFA 2IYFA 2OM2A 2VPZA 4C21A 1W93A 4MB2A 5FT9A 3FHLA 1IJBA 1ZD4A 2FW7A 4ZGWA 3EW7A 4GLJA 1QQAA 2ZQYA 5D84A 3PGA1 4FCTA 4ID9A 5LLTA 3T9FA 4YMVA 5BWMA 2RBKA 4A15A 1Z0UA 1LC0A 1CNFA 1H4QA 3IBFA 3CURA 1N2BA 4CYMA 4EKGA 3EGCA 4LNHA 4MR9B 3TL3A 3P2OA 1C9NA 4YYEA 4BQIA 1H6BA 5J4KA 5DB4A 1YOVA 1W49A 3BMOB 1LTQA 1UJBA 4N40A 2GK7A 2IJGX 5I8ZA 1NVVQ 1K89A 5TEVA 4ESEA 2NTVA 1F48A 2D13A 5EJFA 3IR6A 4MQFA 1FW8A 5DNDA 1QLJA 2FPIB 5T4FA 5JS7A 3GP8A 1I94B 1EUCB 1Y63A 1Y9JA 4IY1A 3ND9A 2ONYA 5IT4A 3Q88A 4MQ4A 1EGVB 1VMDA 2Z43A 1XNQB 1JDVA 3D3EA 2QRHA 1MN6A 4CMBA 3H5VA 1J23A 1A7JA 2FJUA 2VHTA 1G5FA 3I2GA 4HX5A 3BWDD 3NAQA 4OMCA 4W8GA 4H0CA 1GDHA 1GV1A 3BZWA 3RC7A 2RK6A 4JUAA 4RXMA 5JS2A 1FDOA 2DPMA 4DEYA 4M9RA 2C97A 1I1QB 5EYPB 4BB5A 4Z7QB 2P35A 2PE5A 2V1UA 3N75A 2PVPA 2LKDA 4KJXA 3TLXA 1DG1G 4XDGA 3I8SA 3R7AA 4DLYA 5DNVA 4TGLA 4GKVA 1Q77A 3W4JA 3LHDA 4LHZA 2CNDA 3L7KA 1RCUA 4BPBA 2O1XA 1OLUA 2OWEA 3Q7QA 2QRZA 4FNMA 1MC5A 2VUIB 3GJZA 1SXJE 2V0CA 3BE8A 5BSGA 2AQHA 2NTEA 1F1JA 3TWOA 3I23A 1JHOA 3PEEA 1ID1A 3WLOA 3FB4A 5LU9A 4RSRA 2H51A 3IDOA 3HCWA 3HEMA 3REOA 3E3AA 1FS6A 4MUHA 3FWPA 4K9MA 1NQUA 4UU8A 3RU2A 3DM5A 3FNHA 3LU1A 4FB4A 2B4KA 2J3JA 4FDTA 1QQ6A 2DQSA 1EG7A 2X0NA 3CMMA 1L7RA 3LUAA 4I3FA 1Y1KE 2JJQA 2QJTA 3R5FA 3MAJA 2UUPA 1WNFA 2G6BA 1AK9A 2DKNA 2XIQA 5F35A 4C6HA 5K8JB 3G1TA 4EI9A 4IL5A 4UEQA 1E2EA 2BZSA 3IBGA 3BL5A 2HJHA 4YDSA 5EZQA 5A0FA 2PZLA 4BCDA 3RU3A 1GZ4A 5IEJA 4FXOA 1SWWA 4YAKA 2P8JA 4OQZA 4BNJA 1L4NA 3Q11A 2WWGA 3CR8A 3CF4A 5C35A 4WCVA 2BFNA 3WLTA 2EYUA 2HJSA 4KXUA 2YUIA 4R3UC 1N5OX 4CMCA 1Z88A 4QOEA 1VL0A 1YSCA 3PX2A 4XM0A 2XCQA 3EIQA 4UZEA 2O0MA 3FPJA 4JKIA 4REOA 2GK4A 3CA8A 1EX6A 3UV6A 3MGGA 3OEHA 1GPKA 2ORIA 2BEVA 1NVGA 1ZO8A 5I9BA 3WLFA 3OD5A 4G89A 1XNRB 1DQZA 1KPIA 1RQRA 1SCNE 2HLDD 3EIXA 1OJLA 2O0HA 3F4BA 4IZ6A 5L3VA 4RZSA 3ZLJA 4YAGA 3ICOA 1E1KA 4HB3A 3VH3A 2FUKA 1RWVA 2ZB2A 4ALIA 1E3MA 3GAZA 2NNLD 3W5JA 1OH6A 1X7ZA 4YCAA 3VUFA 3N5KA 1BRMA 1GFWA 1SD1A 2J7PA 2XMRA 2VH1A 1UOEA 3BMCB 2FMXA 4FFLA 4OLJA 4PY2A 1BOOA 3EPRA 2KE5A 1IZ0A 1K88A 2O6LA 4LTNA 4E1VA 1D2NA 2YQ5A 4IDOA 4ROTA 3ZBPA 1G66A 5IF3A 5B1YA 4PHTA 1P3DA 2QMYA 1S8OA 3SYMA 2FSVA 2GZ2A 4Y0VA 5JSFA 1AUXA 2RI6A 2WAOA 1N8SA 2FETA 1IOLA 2Q6IA 4GR4A 3R24A 3TQCA 1ZM2A 1F51E 1Q1QA 2P5SA 3H9CA 3P9RA 4G0YA 1PQPA 3GLQA 3MRSA 3MWYW 1XLTC 2WQ7A 3P9ZA 1HSZA 1UJNA 3GEGA 3D5QA 1KZ6A 3ZU4A 2V6GA 5GJWC 2GCIA 2HJVA 4WA8A 2DT5A 5DIFA 2HSZA 1E6KA 1ZH8A 3RAGA 4EIWA 3ZY4A 2ZQ5A 5BN3B 1P6UA 4IO1A 3TQOA 4DILA 5J40A 1Z7WA 5E95A 4OQQA 3V9AA 4EW6A 3KWJA 2H9YA 2Z08A 3WK5A 5A4IS 4HFRA 1A5ZA 3O5AA 1U2QA 1MRSA 4FDAA 1XMVA 3BTUA 4X0EA 1CY7A 2F3RA 1E6EA 3CWCA 3NIBA 2JEYA 4TSFD 2X0DA 4US2R 5JYBA 4XWAA 2WFZA 5F1YA 1UEIA 5CLIA 3EXHB 1U9ZA 4GOND 4N82A 4OXYA 2XXAA 1CUHA 3CNEA 3U0BA 1BXRB 3FYUB 3ORRA 5AM2A 2CMGA 3OT5A 1NAHA 5EEGA 3NCHA 4R1NA 1JAYA 1L5GB 1E1DA 2XDQA 3T52A 1YU6A 1E69A 2W48A 3LQFA 4WLFA 4B6RA 5BUQA 1XROA 4O4LB 2VSQA 4OMFG 3NLLA 1Q0UA 3DEYX 5CR9A 4B5KA 4DSZA 1XHEA 2WINI 2XUKA 3LGSA 5JJCA 1IPEA 5H68A 3O1IC 2DWCA 1VRCA 2C98A 2KLBA 2AOUB 2UDPA 4QA9A 3AM4A 1XZKA 3B85A 2W6MA 5KB3A 4DV1B 1V2HE 3ERCA 1WY5A 3THWA 1ZHFA 4K9KA 1HEYA 2X19A 1BFUA 4CEIA 3AL3A 1ZK4A 4XRRA 3LYHA 3WR5A 1J1IA 5IJ0A 1U9IC 3IR5A 4D0LB 3N70A 2W5UA 4MK4A 1MJHA 3ECCA 4AI6A 3F4LA 4FFVA 1LTKA 4ND8B 4E13A 4UDOA 1S3IA 5I3ZA 2Z9CA 1PT8A 3ZIUA 1W35A 4E03A 2TECE 1QE5A 1I1OA 2WG1A 1BG6A 3MCUA 4XJXA 4XCXA 3NBQA 1UBLS 3HV0A 5GVRA 2XUJA 4ZI3A 4UZFA 4EGFA 4YT5A 1C80A 1NUTA 2DBYA 2G9VA 1DG3A 5CPBA 5GINE 3WGYA 4PAGA 4G9EA 4CM5A 2QORA 4URUR 4MQMA 3JVIA 1DEXA 1U90A 1JXAA 2VJBA 1WU7A 2P67A 2VAPA 3BRQA 2EFGA 1Q14A 3CJRA 3I6YA 5JG7A 2FDCA 3KLNA 3V48A 2JZOA 5EE0A 3FOEC 3ZDCA 2HR1A 2IOQA 1KZ7B 1IHDA 2V8OA 3MERA 4LCJA 4PAQA 2YXNA 4NICA 5JZOA 4XASA 4CI9A 4XW2A 2XTNA 3B20A 5KJCA 1FFDA 1PYGA 3QNMA 4P53A 1Z06A 2H63A 3INRA 4B0OA 1PJ8A 1QYCA 1V45E 1X1AA 5IK2A 2P9GA 3CCCA 1NOIA 2GNPA 1KMQA 1MQ9A 2QVYX 3MNFA 2C2KA 2C4TA 3P9KA 1TIPA 4GRIA 4P08A 4RF4A 1PLJA 4AJLA 5ICGA 2WWIA 3UXHA 1LDNA 3DKRA 4G85A 3ZU2A 1I1HA 5SY4A 3BB4A 1ODFA 3SCZA 2BHNA 3VZPA 2Z1NA 3S5UA 4CM4B 2YIMA 1SMKA 1XD8A 1VZ2A 3H3FA 4X60A 1NKTA 3OJCA 2CL7X 2QZPA 4X6XA 2V7WA 5DULA 3AR5A 3CEMA 4DJFC 1NFRA 2F43B 5FULA 3W9SA 1AS3A 3JQ6A 4JJZA 4M76B 2H5LA 3GBSA 4I2VA 1LPSA 4U39A 1QHYA 1QFZA 2NVWA 2OHGA 4LBWA 3H83A 1T9GR 3ZYZA 5JCJA 3OECA 1DUSA 4BLRA 2OEPA 2QPAA 3SHFA 3DAHA 1GLGA 4L0DA 1JDPA 2OHVA 1CY4A 3L1JA 3R3UA 4GI2A 4EF4A 1EVIA 2HCRA 2X77A 1MX1A 3EEFA 4WBNF 5KYXB 1CUEA 2BC9A 1HX7A 3U3KA 2AD1A 2FW6A 3LX5A 3H6GA 3CB4A 5K6RA 3L6UA 3OQIA 2DAPA 1ZCFA 1MB9A 3MOGA 1JFSA 2PRJA 4RD6A 4C06A 1CZLA 4GPBA 2Y77A 3OWXA 2ATCA 3FDXA 4TKUB 3VVMA 3W77A 4D3DA 3KZVA 2NU8B 3IA2A 1F0KA 1TM5E 1ACLA 1R0RE 2CXRA 2BBWA 2QTRA 3CH6A 3GEBA 3NANA 4JHXA 2WPNA 4WKOA 4NS4A 1TMOA 3K0CA 4K1XA 3QMVA 3GP3A 1FP2A 2WNIA 3RYHB 5ADUS 4DIOA 2EFDB 4U02A 4NXNB 4C1NA 2HC9A 3B53X 1RI3A 5A6VA 4LYYA 3EGVA 3EY4A 1BWSA 1AN0A 3R20A 4P35A 2XMSA 4F11A 4QGGA 5K8TA 1Q0PA 4NJMB 4NCKA 3NPAA 2WSMA 4LI0A 1MLDA 2AXEA 3UWSA 5A71A 1H1LB 2RE8A 3I9LA 1N5JA 4ZVQA 3RASA 2Z56A 4CN9A 4D8WA 4EARA 4IIYA 1R7RA 2D1YA 2AG5A 4IDPA 1IB0A 1P2VA 2ZCUA 4IUCS 4KR0A 3AFIA 4UAVA 3RVSA 4BEJA 3B9PA 3KHKA 3Q9SA 5INTA 2I4IA 3LVFO 4P93A 1UK7A 2O05A 2QTFA 3INNA 3ET4A 2PZ8A 2HNBA 1DUVG 1PK8A 2Y1KA 3OBIA 4GOLD 3V4VB 2GJ8A 4L4SA 3RC3A 5BOSB 4WN9B 2O3TA 3UJBA 5JS1A 1PW7A 3ND6A 2BOVA 4N5LA 4KQ2A 2JKVA 1WDLA 3EUAA 2AFRA 2D4AA 2WWRA 3DXFA 1T0PA 2F8MA 4S0XA 5E6RB 2AK2A 1TM1E 3D4OA 4LNUA 1SH7A 5LPNA 3AEQB 1Z3CA 2XDAA 1AQJA 4ZRNA 1FU7A 2PXCA 4ZYWA 4N3CA 3P4XA 4OJYA 5GONB 1XRRA 3GL9A 4FYHA 1FMLA 3IEPA 3VNBA 1LF5A 3H18A 1VGRA 2QTLA 1YS7A 3ZDXB 1UBCA 2FEKA 4LDJA 3ZWMA 4BQPA 3ON5A 3U7JA 1HT2E 5H9VA 2DP4E 3JZFA 5EESA 1Y6ZA 3ABIA 4V0MA 3WYEA 4JY7A 3I5XA 3BF7A 3OJEA 3UHPA 4RK7A 4Q1CA 4IYRA 3FPAA 3DR3A 4KI0A 4ZZ2A 3UJ9A 3WYFA 2G09A 1RWNA 5G53C 3EEYA 5A3QA 4IHJB 5AK4A 2BFEB 4U6QA 4BMVA 4L4ZA 4EK9A 5HUHA 4QSHA 3ZY5A 4PQYA 4TYWA 2YJTD 4L74A 2GZRA 2I67A 2ZJFA 4RTMA 2DHEA 2VF8A 5B3LA 4AS3A 1CRLA 1GUFA 1TKBA 1U5AA 2D4HA 3CE9A 2D59A 4KQEA 3TSYA 2RARA 4EVRA 4BGIA 4PZEA 4ZTUB 2M1XA 5KUTA 3GRVA 2F3PA 1WSAA 5TARA 2M6RA 1AS2A 1OXBB 2PIAA 1ZW6A 1DDIA 2VPPA 1D4FA 4U63A 1SOVA 3QE4A 3TD6A 1NYRA 1TQDA 3X43A 2IGTA 1SKYB 1DMRA 2IU4A 5DTIA 4BY9E 1OH5A 3DTNA 4K6OA 2NAPA 1YQGA 1L9XA 2ZT5A 3RB8A 5DN6D 2A78A 5ETJA 5J43A 5GIPE 5DSZA 1HDXA 4BGVA 2XGJA 2A9QA 4BVJA 1GTJ1 1OBFO 2QTTA 3SS9X 421PA 1DC4A 1GTMA 1V39A 1MOZA 3JATB 3IB6A 2PZBA 4CCWA 5C81A 1XB2A 5JFOA 2O8BB 2YZKA 3AFGA 3DHEA 3MJEA 4DSNA 3IDFA 2IIVA 3HP1A 3ILVA 3HWSA 1KSGA 5AHWA 3QVLA 4BBZA 2GPYA 2I3DA 4KWIA 1B15A 2NG1A 4FN5A 5AJXA 2YFKA 5KQRA 3GLHE 3HADA 3AV3A 2W43A 4V2UA 5DM0A 3CLKA 2PD3A 4HDAA 4U7TB 1YE8A 1N0IA 4RMNA 1L7AA 3RC2A 1V3UA 3A1VA 3BDAA 1Y48E 4AKEA 3LDUA 4K9PA 2ZUWA 3NB0A 1P81A 2AR7A 4LOHA 5KTPA 1L5FA 2HMTA 3KEQA 3RS7A 1RCTE 1ADCA 5JH7B 3OZEA 4M1YA 4WUVA 3X1JA 1C7ZA 4CI0B 5MGNA 2DSNA 5D8DA 5TF4A 5KHAA 3IAM1 4OP3A 3KIPA 3OZFA 3FGZA 4OSOA 1SXJD 1IMJA 3AM5A 4BO4A 4JP1A 1YB5A 4MQEA 5JSKA 3UANA 5TMPA 5LQMA 5KQMA 2PRZA 2FTKE 2YHIA 1E3IA 3VC3A 2AJTA 2X9GA 1PS9A 4OATA 4OQYA 1XZDA 3WHPA 1SGWA 3I0ZA 3VU0A 4QG7A 1YZYA 4WQMA 3SJAA 3V4SA 3RVBA 1JF8A 4E51A 1W85B 1TTTA 3D81A 3WFZA 1UBKS 2K2QB 4MWTA 1TZCA 1ZL2A 4B4OA 7ABPA 4Z9BA 3ZDZB 2H11A 1KIFA 2WKQA 3HUEA 4YXWA 5TY0A 2PUCA 3W7VA 1OKKD 1I1NA 2ZYHA 4O5OA 4IZIA 4DADA 2ZETA 1Z5NA 3RRJA 2UZ0A 2Q0XA 2C9ZA 2I2DA 2R7MA 4QRHA 1K8RA 5CDYA 5JAPA 4MR7A 1JEQB 4Q7KA 1CERA 2QD5A 1PHPA 1PFVA 1Q1BA 4MOWA 5DHPA 3F90A 4HZGA 2R5NA 1K97A 1KGSA 4UTNA 2V7TA 1V5EA 3EZLA 4JT8A 4BFVA 1DUIA 4ON9A 2ZXFA 3OOWA 1USIA 1ADYA 4IWNA 3JQAB 1Y3HA 4LGMA 2RGCA 5DN9A 5M5BA 1ZRSA 3MCZA 3GU3A 3GZNB 3HUUA 3QEMA 4I2NA 1EXDA 2FK7A 3DVRX 5KO2A 3OAAA 1OOEA 1ST2A 3JQFC 1UDBA 4EEZA 2I7CA 2XNSA 1VMEA 2E1RA 4QBFA 1XKQA 4QQKA 2MCFA 2NGRA 5I8PA 3BL6A 4CM1A 1ZJ5A 4PZYA 3VUEA 1YHYA 3R6TA 1DRVA 3TPFA 3CHYA 1QFXA 2HTFA 3FB1A 4WY2A 5K0BA 1GQRA 3RRNA 3QSGA 1X39A 3TZEA 1YXMA 2PGDA 4K28A 2VTDA 1EAMA 3U3OA 1DAMA 1E3EA 4KQMA 4WESB 5EFZA 3RTAA 1NVMB 1VKZA 2I71A 5L6MB 4X9XA 4C0XA 2BE7A 1FUKA 3L8GA 4KX5A 5H02A 1EMDA 1N3BA 2XSZD 4QJ5A 4OF4A 1OV6A 2VJMA 2WJIA 2HA3A 3DTTA 1XRSB 3RE1A 1FLAA 1LDEA 1YJAA 5DEIA 3NV9A 2W2MA 1O87A 2AVNA 3QIAA 1T8YA 4BVLA 4HDRA 2XA2A 3OUUA 3KSAC 1K4MA 2I54A 4J0FA 4TV8A 5KMGB 4KO8A 1R0CA 5I8WA 4C08A 1EK2A 1TJPB 4OB8A 2JK1A 1UDXA 2F1KA 4RVNA 3W90A 4RTNA 2OAGA 1TEHA 1UXKA 1W5EA 2C5HA 3AKDA 5IVDA 4CF4A 4FT2A 2OYCA 4YCSA 1TDJA 4R9VA 2H54A 1CJTC 2LD4A 3Q72A 1UPBA 4KE9A 1UXOA 1QK4A 4GR5A 3DWEX 1A77A 2PKYX 1HKUA 1ZBDA 3OQOA 1WULS 1YTLA 3LOPA 4MPJA 3R09A 3TQQA 1J2TA 1SVOA 4HTFB 5FTLA 3ZUGA 4W9RA 2YJ4A 5KS2A 2C5LA 3H0KA 1VCOA 3D3NA 3R8FA 1NRWA 1ECCA 3UYLA 3NVKI 4CFYA 1N6HA 2WAYA 3O4FA 1EA7A 4PAOA 2CXOA 2X6QA 2H16A 3AFHA 3NH9A 1BH2A 2HPAA 4WKCA 1RJFA 3NIFB 4XYEA 4G0QA 5JZ9A 1KU6A 2QIOA 4KBFA 2ZI7A 3W78A 1C41A 4Z51A 3P0JA 4KWEA 1L6RA 1FFYA 4QDXA 1CLEA 3WLJA 1IHUA 2J5BA 3BMXA 3QVSA 5GZ1A 5H70A 4D5GA 3QV1A 1OPRA 1U0LA 4F2PA 3Q2OA 3RK1A 2QRMA 2A0FA 3K7EA 3LH5A 4V1CA 2XW6A 1R5NA 5HIKA 3EVDA 2NMVA 4RY9A 3H8VA 5A4JA 1NBIA 4IINA 2WVGA 4TZTA 1YCDA 4HQOA 4G5YA 3EN0A 2H7YA 5CIWA 4FYXA 1LCIA 3DO8A 1S8AA 2ZIAA 3H11A 4DNOA 2CWDA 2GVZC 4P0QB 1FUUA 1Z8DA 2G8LA 3DH0A 4WH0A 1K0UA 4MEBA 4II2A 4EO7A 1AKEA 1M2OA 4HH3C 1ENYA 2J41A 4Q4JB 1P1IA 1DRKA 4C3OB 5JWHA 3SKVA 1UBEA 1T3ZA 1VB5A 2F8SA 3AC0A 4D99A 2WKSA 5C2JB 1DX6A 1C3OA 3DL4A 3FCEA 4WFQA 3L8YA 1G2OA 5K1ZA 3BIJA 4N54A 3BF8A 3Q3EA 1PCXA 4MINA 1IZZA 4DJDC 4UTRA 1ZQ9A 2WYHA 1PV1A 4JIGA 1LX7A 2FZEA 5LKRA 5EP2A 2HGSA 3VTFA 2PMWB 1YR1A 2PR7A 3P9PA 2FP3A 3SBDA 3W05A 3WMWA 1IK6A 1DDOA 1G8JA 2NXNA 3EH1A 5ADVA 2PTGA 3VAAA 1ABBA 1RYMA 2RMKA 4IDFA 2CVHA 1XZQA 1RLOA 1U8AA 5DO9A 5C5EA 5L3QB 1GPLA 1E6CA 5LBUA 4KXYA 3J7TA 5T8KA 3TMKA 1W52X 4LFAB 4RDHA 4WGGA 1E1LA 3GOQA 5LJLA 3C1OA 1Z0DA 3KUDA 1YMVA 2WZCA 3KXIA 5GM2A 2ZAYA 4L76A 4B83A 4DEVA 3THWB 1KJQA 1AUOA 3WIUA 1W47A 3BICA 3JAKB 3SQLA 1XCLA 1FPQA 5ESDA 4IEIA 1H65A 1YO6A 4ITVA 3IHWA 3SR4A 4FKBA 4ZV9A 3E5HA 3DAFA 5AI0A 5K8LA 3DHVA 4H59A 4JVSB 1LLDA 3ENWA 1CQWA 3PFFA 1IUNA 2W2TA 3P32A 1E7YA 3RVMA 1EG2A 4IHJF 3D3WB 1T6BY 1ZKDA 3O83A 9GPBA 4M0MA 4RC9A 4F0JA 4YJHB 5FWXB 2SKEA 1DEHA 1C9JA 4P92A 2DUUA 3AUSA 1M0WA 4N5DA 4Y2GA 1IHXA 3D6FA 5DXAA 1T5LA 1C30A 3KQYA 4YFYA 3DKVA 2DPXA 4AIIA 2DUWA 1H4VB 3HKCB 1SXIA 1GHTA 1MGPA 5AI5A 4B46A 3O8OA 4D42A 4HLUA 3NW9A 1IHYA 4POOA 5BSFA 5JHHB 5BMOA 2PKRA 1IB6A 3DFIA 1MVLA 3W3AA 5FPQA 4AKTA 4AG6A 2HBQA 1LBIA 5IC5A 3NWJA 3THXB 1K7YA 1PT9A 1XGKA 3KKNA 1RR6A 3C5WP 3EXAA 4G36A 3VV2A 4IG4A 4R2JA 1FSSA 1HM5A 1RAIA 1BWPA 1DKLA 1Z74A 2H2HA 4BO8A 3T5CA 1T1RA 2QAGA 3L8HA 5IDXA 1ZHHA 1E9VA 1HQCA 5K6AA 2W58A 4JITA 1YBFA 3OPQA 4F71A 5ADWA 5IN4A 1DKUA 4CN8A 5JNRA 3CRW1 1PJTA 1BAPA 4H3KB 3JQRA 1AUPA 3C6QA 3IQEA 3NPMA 3PLNA 2Y99A 4R1OA 4WUTA 5TR9A 3WI7A 2JGEA 3L41A 2XUPA 3A1DA 1Y37A 5BVHA 4BLUA 1OUMA 2CYBA 3D54D 3FBWA 3CVWA 1U81A 3TSOA 3DULA 1VI6A 3FDJA 4NFHA 4OJNA 4Z8XA 5TRTA 4RVOA 3WLHA 1GM5A 1E2PA 5LWQA 2Y0PA 4I1RA 4RAOA 3WMRA 1T0JB 1YQWA 3U13A 1V5IA 5KZMB 2WTUA 4PAMA 1NYTA 4WY5A 1TW3A 3ELDA 1Z6TA 2ZQZA 1HDZA 3D43A 3QFSA 4BJ3A 4RIIA 4JJ7A 4DC1A 3TTXA 1VBFA 2ZU0C 5B7GA 3IPRA 3FZGA 3NEAA 4I5FA 2C31A 3CS3A 2VAMA 3KT3A 3E35A 1V4VA 3EC7A 4HDKB 1IRIA 5F73A 2Q5CA 1DIBA 1VIDA 1FMTA 5FFNA 1CZOA 1N8KA 3LA8A 4Y98A 1Z13A 4O2BF 1DBQA 1GPUA 4MPRA 4TTVA 4MKXA 3SF8A 1H3FA 1GFSA 3DZBA 5C5IA 2YJGA 1NVXQ 2C42A 1QB8A 5LZ2A 1USVA 4GMKA 1FDIA 3QKIA 4RD1A 2G1AA 1T6XA 3DSRA 1MC4A 1V47A 4ND6A 3AM3A 4W5WA 5LL6P 4ARCA 3AM1A 5U1PA 2C8VA 4NE9A 5E1MA 2HOQA 4N41A 2N0SA 1P4GA 4AJ9A 1Y6GA 2I3GA 1SD2A 3WP0A 3K53A 1HYQA 3RIMA 2QTCA 4WKBA 5DTRA 1ISRA 2J7KA 3CPJB 3WMEA 3LBAA 4D56A 2XWBF 1D1PA 1NMSA 2FA9A 2Y9MB 4LYEA 1M7GA 1SPXA 1YI8A 3NWEA 1O03A 3K3PA 4MNTA 4L9WA 1UKVY 5EKSA 4QRDA 1N0UA 3VSDA 5EJ5A 3FNEA 4WINA 1T2VA 1EXWA 4AO6A 4B1FA 5JROA 2XQJA 2DWUA 2CMDA 3D8SA 3K8ZA 3ODGA 4LYJA 5AJYA 4GOMD 1W19A 4LDNA 4DV7B 4EAAA 5AI8A 4HADA 3A10A 4BWGA 5ALXA