2H4WA

Crystal structure of human caspase-1 (glu390->asp) in complex with 3-[2-(2-benzyloxycarbonylamino-3-methyl-butyrylamino)-propionylamino]-4-oxo-pentanoic acid (z-vad-fmk)
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
173
structure length
168
Chain Sequence
TSSGSEGNVKLCSLEEAQRIAEIYPIMDKSSRTRLALIICNEEFDSIPRRTGAEVDITGMTMLLQNLGYSVDVKKNLTASDMTTELEAFAHRPEHKTSDSTFLVFMSHGIREGICGKKHSEQVPDILQLNAIFNMLNTKNCPSLKDKPKVIIIQACRGDSPGVVWFKD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title An allosteric circuit in caspase-1.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords Caspase-1
total genus 49
structure length 168
sequence length 173
ec nomenclature ec 3.4.22.36: Caspase-1.
pdb deposition date 2006-05-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1460 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2h4wA00
4IEFB 1RWNA 3GJRA 2FUNB 4HVAA 4NBLA 2H65A 2H48A 1I51A 4M9RA 2H5JA 4JQZA 1PYOA 5IBPA 3D6MA 4LSZA 1NMEA 2CJYA 2FP3A 1CP3A 3SIRA 4ZVTA 1GQFA 2QLBA 4AW9A 2J32A 2AR9A 4NOMA 2H4YA 2HBYA 1F9EA 2C2ZA 3H13A 4HQ0A 4JR0A 4JJ8A 4NBKA 4ZVSA 3R7BA 5IASA 2WDPA 1RHMA 1RWXA 3IBFA 4NOLA 2J30A 4QUIA 2CDRA 2XYHA 3H11B 4JJEA 4QUHA 4ZVPA 4N6GA 1CVRA 1JXQA 1I4EB 2QL5A 1RHUA 3R5JA 2HBRA 3R6GA 3NS7A 1RHRA 1RWWA 1RHJA 3PD1A 2CJXA 3R5KA 4D3XA 3S8EA 1QX3A 1SC4A 4HQRA 3KJFA 1I4OA 4QUDA 1F1JA 4QU9A 3E4CA 1K88A 3H0EA 3V3KA 3KJQA 2CNOA 1KMCA 3BIJA 3GJQA 4JR1A 3D6FA 3EDRA 2J33A 4EHAA 2QLFA 1QDUA 5IAJA 3RJMA 5IANA 5IAEA 1NMSA 4JQYA 4I1RA 5I9TA 5IABA 4ZVOA 3KJNA 4DCJA 3P45A 2CNNA 2QL9A 3V6LA 2H51A 4DCOA 3PCXA 5JFTA 3SIPA 3V4LA 4QU0A 4FEAA 4NOJA 3UOAB 2HBZA 4QULA 2C1EA 4QUJA 5IAKA 4EHLA 2K7ZA 2XYPA 3DEKA 5LUAA 2CNKA 2XZTA 1RHKA 5IARA 4EHFA 4JJ7A 2H54A 2DKOA 4QUAA 2H5IA 2NN3C 1BMQA 4I1PA 1K86A 3R6LA 3EDQA 4AWAA 3S70A 4ZVQA 1SC1A 1RWVA 4QUBA 3GJSA 5IBCA 1NMQA 3UO8B 4IYRA 4PRYA 3H1PA 5IBRA 3IBCA 4DCPA 2CNLA 1QTNA 1RWMA 3OD5A 1RE1A 1RWOA 3DEHA 3PD0A 1SHLA 5I9BA 4QUEA 3V4OA 5LU9A 4N7MA 4FDLA 4JR2A 4EHDA 3D6HA 5IAGA 4QTYA 4N6NA 3H11A 4PRZA 4N7JA 4EHHA 2Y0BA 2FQQA 1RHQA 3K7EA 4NBNA 4FXOA 4QU5A 4ZVRA 2QL7A 2P2CA 4ZVUA 4QU8A 4PS0A 5K20A 5IC4A 4EHNA 4QUGA 4AWBA 4PS1A 1GFWA 1PAUA 2Y1LA 4D3ZA 3V6MA 1RWKA 1SC3A 2C2KA 2QLJA 2C2MA 2J31A 3DEIA 3P4UA 2HBQA 2H4WA 1M72A 2XZDA 4JB8A 4N6OA 2XYGA 1RWPA 1IBCA 5IC6A 3DEJA 4FGUA 2C2OA 3R7SA 4EHKA 5H0IA 4NOKA 3GJTA 4D3YA 4EJFA 3QNWA 1NW9B 3NR2A 4QTXA 3V55A 5LUBA 3R7NA 3ITNA 5LU8A 1SHJA 1ICEA 3NKFA 1I3OA 4N5DA
chains in the Genus database with same CATH superfamily
4F45A 3B5IA 1J8MF 1XEAA 3CEAA 3OEHA 1C3OB 1R10A 2QRNA 2ZBDA 1O95A 2AXNA 1KI6B 3CR3C 3LQ1A 4HAVA 4BQEA 10MHA 3UMGA 3SS7X 4LVOA 1BFKA 4Q02A 3KSAC 1UXIA 2E5FA 2DVMA 1RI5A 2I7VA 2X9NA 4CF3A 3LYLA 3KBOA 1TQDA 4GQIA 4L8GA 2JFQA 3SI7A 1E9AA 3FUTA 3DB2A 4I55F 2P2DA 3E8SA 1R12A 1P39A 2B25A 2P2NA 2PVSA 3J7TA 4I5IA 1A9XB 2HX1A 3F46A 2RK3A 2QN3A 3HYNA 1EVQA 5FEMA 1CY0A 3OKCA 3WLEA 1W36C 2G9VA 1BD4A 1C0PA 1SBTA 1AKMA 4GSYA 4QDZA 1JKMA 1TZMA 4NE2A 3TLGB 3P52A 4F85A 1Z8NA 2M6LA 4AECA 2BI8A 3CLUD 4Q1AA 2QZJA 2G8NA 3MT8A 4D3XA 2HU7A 1SKQA 1HE5A 3S68A 4UC0A 4YRJA 1XVIA 1C0IA 4JBGA 3V3KA 1N5JA 1FXSA 2B92A 3AFOA 2WPDD 4KQKA 1GG8A 1OYWA 5LKRA 1VDMA 1S3FA 1VCNA 2JLAA 2P8JA 3DWEX 3PIIA 4QLAA 4EHAA 1EZ1A 2EGHA 3GO4A 3M89A 5ILGA 1YUNA 4LEIA 4DGQA 5IAEA 2HDOA 5KREA 1ZGGA 3FCOA 3RYFB 2H92A 2XCLA 3GQVA 1ZOSA 1SC9A 3URKA 2JLZA 1UMCB 2DTXA 3KAKA 1Z7GA 3WISA 1L4KA 5TQ2A 1L9KA 4M1EA 2CVQA 3LCVB 5BMVB 2GVZC 2I3ZA 4RF4A 4DMFA 1MJHA 2QTNA 4LIPD 4PSAA 2VWHA 4RAOA 4NQZA 5BSKA 4R31A 4C4XA 3VYRB 5TF0A 3R6LA 2WG0A 3JAWB 4MKXA 4UU0A 3HH8A 3BDIA 5T4FA 4DJTA 2ZRCA 2G5CA 4HXYA 2Q8PA 2WD9A 4QATA 5CH5A 4LZNA 5CA1B 3KXPA 2IXDA 3CLKA 3L6BA 3B36A 5T8KA 4D0LB 1VGQA 4L15A 4C1BA 1LTKA 5JDIA 4PBTA 5HKOA 1FFXB 4H3SA 4URWR 2GPAA 4PRLA 3IE2A 4HNTA 1OU4A 3O8NA 1DNPA 3PQ2A 4RDIA 1IHUA 4UCXA 2VJMA 3TIVA 1RYBA 1LLCA 4JX8A 5GZ6A 1NASA 4EL0A 3L7KA 2OAEA 2DLCX 3CLVA 2HAEA 3RVKA 1OFTA 4UPDA 2GCOA 2QT9A 1JHRA 1YZQA 4ZVRA 4GR9A 2QTBA 1K8XB 1H5QA 1P2TA 5JO9A 3V42A 3VH1A 2P7IA 3EXHA 3JALB 4NBUA 1F48A 1Z4MA 2PR2A 1E9CA 1ZUHA 3KR2A 3R3UA 1ZUD1 2EBWA 4EF5A 5FEUA 5E7JA 3ZW9A 2OCXA 3GN2A 1WV1A 5CG1A 4HB3A 4X6YA 2EW2A 3JAKA 4IQ4A 4BOYA 2Y1XA 1RAHA 5HTKA 4JI5B 2IEZA 4ZANA 5EJ8A 3R5HA 1DZ3A 1TYCA 4GMXA 3QKUA 3B2EA 2NUAA 4F6RB 3BCSA 1N6LA 5TARA 3CW9A 3KLNA 4JGGA 3HBLA 1E79A 5E6RB 4IO0A 4UPVA 5JCPA 2QRQA 3WIEA 4EO4A 2F2TA 2BMEA 2A4KA 3VGJA 3ZBTA 2DHQA 2X7JA 5IKPA 2RMKA 4BLVA 4BNIA 1J97A 4MDEA 4HS4A 3QE0A 4ZHQB 5JAUA 2XWQA 4F9FA 4GKAA 4G4SO 4LY9A 5F5NA 1JKFA 4TQAA 2GZAA 2GNPA 3WLTA 1WW8A 2QWXA 1IVYA 1I2ZA 2PMCA 1F0NA 3GL9A 1E60A 4AN0A 4E94A 3ZH2A 3RTDA 1TYDE 4C01A 2PFGA 2C9CA 4D98A 4JAVC 2OCPA 3AHFA 4JH0A 5CNJA 5J4LA 5FWDA 3EZNA 3UN1A 4QPNA 4BDSA 5CDSA 4LNUA 4RK1A 2R7NA 1Z6ZA 4AMVA 5BR1A 5KUTA 3TXYA 4E0BA 5AVOA 3W9YA 2KM1A 3M6AA 5BQPA 1P77A 3EPJA 1B8NA 3FJ1A 4JI1B 4C2TA 2HHCA 2ZZNA 1CVRA 3IAM1 4JENA 4IGAA 5ESXA 1PG5A 2ZATA 4LJ9A 3LL4A 4LV5B 2XRYA 5BSMA 2WDZA 3USCS 3HCNA 5CX4A 4JUFA 4FNOA 4ZAWA 3SBXA 4BX3A 5I7OA 3BJIC 1H1TA 2I2WA 3D7RA 3Q9LA 1AHPA 1W2HA 2AOWA 1B8PA 3HDGA 2K87A 4MVJF 4B4VA 2FW7A 4B46A 5ARBA 4KO3S 4XE5A 2W00A 3ZV3A 1U3FA 3O6VA 3V4FA 1ZGJA 4MV7A 1P2FA 3MWEB 2X6RA 3A26A 4NF2A 4B3RB 2FG5A 2O2CA 2NMVA 4N7RA 4M36A 1ISMA 2BDTA 3ZZNA 3S2FA 1H9AA 1SVSA 3DOJA 4X1KA 4CZ2A 1LLDA 1RZUA 1RP7A 3L41A 4YWJA 3DMTA 1OWLA 1PFWA 3GXOA 4JJGA 3ASUA 4D0NA 1UZMA 1AY0A 2FA9A 2HCTA 3LUJA 3I6MA 2HEGA 4WCFC 1P5JA 4P86A 1XZPA 2PTHA 4FYHA 1PZEA 1GNQA 1IB0A 1K63A 1MQ8B 4P33A 4IIJA 4JROA 1KYWA 2PMEA 1R5JA 2ZTVA 1CFZA 3EAGA 4DCVA 2O3RA 4DXAA 3K9WA 3ELBA 1GAJA 2EVWX 4OHXA 3JQ9A 4GIBA 1XZNA 4RH1A 2PXXA 4FS3A 4GI5A 1J7KA 1NY6A 4GX5A 2FZEA 4OHWA 5KHAA 1SXIA 4OKSA 2W8BA 4RD3A 1E1RA 3EUEA 1VMAA 2IPXA 2HWUA 1XLVA 4EBBA 2JAOA 1ND5A 2QX6A 4TXNA 2QGFA 2XUGA 2HMAA 1JR3E 3R41A 4HMOA 4E5MA 2OXCA 4Q1DA 4C21A 2GFQA 5MGNA 5FO1A 3F5FA 2HKIA 1XHFA 4Z4QA 4XXHA 1YUBA 3LFTA 1QS0B 3PB3A 4ETIA 1Q57A 3BWMA 2ZB4A 4RTMA 2PZLA 4GSKA 4PR3A 4EW3A 1U5BA 1W0JA 3UXEA 1AN0A 2JLWA 5ALIA 2CE2X 3T12A 4BZQA 1IG0A 2FR8C 2YV2A 2YWGA 1D1QA 2PX8A 3OCYA 4HX2A 3W8DA 2QIOA 5GGXA 4EGJA 1QIDA 2ZWVA 2R47A 5ALHA 3MBIA 3U60B 4LPKA 2B4TO 5ED0A 4D3ZA 5IJ0A 3P7MA 5LN1A 1V95A 1E63A 4L4RA 1JVSA 1NVDA 3F74A 4G0QA 1W29A 2PUAA 4KKXB 3UCEA 1T9HA 2JLVA 3VX3A 4AC9A 3GGJA 1N0HA 5CA1A 2HWWA 1U0JA 1NZDA 2CWWA 3SSOA 1HT2E 1Z25A 3CRVA 4IG9A 1UBNA 2Q9UA 2WM3A 1PGOA 5ESDA 2JFUA 2HLNA 3EIEA 4W6ZA 1QDEA 3IXMA 4MV6A 2PEYA 5LQMA 2J5KA 3DL4A 1GLVA 2CLOB 2EFGA 4EARA 1MX1A 2ONYA 1N8NA 3LUDA 3TXAA 2DQYA 2ADMA 3EMBA 2JAUA 4CMHA 4O2BA 4RV4A 2YZGA 3SM3A 1TQ2A 2N3ZA 1NI3A 1V9LA 4HXFB 3TG8A 3CUUA 3ESAA 2Z5FA 4MJ7A 3EEBA 1W4LA 2C0PA 2XZPA 2IOHA 1L7MA 3DJYA 3K20A 2QRJA 3D4OA 2JFXA 3LCRA 1V4VA 3D2LA 4JYCA 5EPOA 5IEBA 5A06A 2UZ0A 1U6KA 1XRJA 4XPZA 4YJ2A 2IHTA 2VCEA 2CXOA 3V7YA 4Y1EA 1J2RA 2CHQA 2WSBA 2E1RA 3LUBA 3OEEA 4UUQA 4O59O 3CUVA 3PITA 4XIYA 3QPVA 2JIDA 2KBFA 5AJZA 3VR1A 1K8QA 4ZDKA 1T1GA 2FF7A 1PI3A 1NXSA 5DLDA 3R7WA 3ITEA 1ZK2A 3HBFA 4H0NA 2E48A 2OTCA 2Z09A 1S2DA 4GPBA 1DI0A 3FROA 3NM5A 4I4LA 1EFKA 2JI4A 1TMGE 3SF8A 4YRIA 1RQPA 2ZXEA 3DVRX 4HL6A 4U00A 4KRXA 1MOQA 4QTUB 3DZHA 1SCBA 2CVHA 5H8WA 3RG2A 2OCLA 3LOQA 1XZIA 2IUUA 3TDMA 4A15A 1SIUA 4OO3A 1J1UA 3I05A 1TM7E 1YK1A 1NMSA 5IJWA 5ADHA 2EX1A 3O03A 4M87A 3CLTD 4EUHA 4Z1MA 2R7MA 2DR2A 2QD4A 2QAIA 2HA7A 4FD3A 3S2UA 3SGLA 1TMOA 2GYVA 3D4IA 5IKOA 4BFYA 4RL6A 1CTQA 3IA2A 3WS7A 2H8GA 1NVMB 1J9GA 3MRSA 5ALUA 4CM9A 4Q7MB 1BJKA 4IDFA 4JC0A 5MF6A 3GV0A 2GCIA 4UHBA 3QFCA 1E2MA 4U9HS 3SS8A 3P9NA 4CF5A 1QG0A 3SQOA 3WLIA 4WAUA 3DTNA 3RVRA 3L6RA 3WWPA 3ROKA 3SKXA 4Z7JA 1I0ZA 1OTXA 2IC5A 4G2NA 4AD8A 4NJEB 3TVTA 3IMFA 1H4SA 1EJ0A 2RGCA 4N54A 1E4OA 1XVTA 4WLEA 3IO5A 3HB0A 3TM4A 3D6HA 3WQHA 1ZN9A 2NU6B 1WW2A 3SHTA 3I92A 3A27A 4UU7A 4YT2A 1T4CB 2BMDA 1W36D 1OX4A 4JLPA 5A7FA 4JBXA 2EIXA 5DGIA 2BSQA 2OM6A 2H2IA 3TZ6A 1IN1A 3O7MA 5B37A 1Q83A 3CLUC 1T8WA 1S3GA 1FP2A 2XWJI 4XIFA 3TNYA 3IKMB 3RWOA 2FW9A 2XIQA 3W6OA 1FA9A 5C52B 4KV9A 4OHZA 1KXJA 5ELLA 5EIBD 4W5QA 2WD7B 1PZGA 2WHPA 1YC5A 4WZAA 1MPXA 1N1MA 3I52A 4BVKA 1GDTA 1JIVA 1ZVMA 2FEXA 2OXTA 2ODWA 1UKVY 1WKCA 3MWLA 4NOKA 1ZXLA 5GONF 3TFOA 3A2MA 4G5QA 4QYIA 3EC1A 2A88A 1G6HA 2CL5A 3D8RA 3K09A 4J0IA 4QE3A 4XWYA 4CTOA 5EIXA 1Z47A 4JKYA 4YUYA 4RZQA 5F4BA 3L7OA 3V8PA 1J6UA 5BNZA 1X7YA 5BVHA 4RKRA 2UXBB 4W5TA 3ZU4A 2YRWA 3EGXA 4NMXB 2D62A 3DVSX 4NPCA 4IFBA 3WL5A 1QM5A 2PIAA 4EP1A 1T36B 1GEEA 3BT7A 2FEKA 5AVWA 1JB9A 1YGYA 4XVHA 1EYZA 1WF6A 4IILA 4JB2A 1IJFA 1EP1B 1UP7A 3UVEA 3ZWNA 3U48A 2C7QA 4DVJA 4FW9A 3ZV5A 2QVXX 4HH4A 1CQZA 2QTRA 1PDWA 3K5HA 1R15A 4WX2B 1CEXA 1U7XA 3O3NB 3WAGA 5EG5A 4WZZA 2Z8ZA 1IM5A 2WIFA 3WK4A 5JNSA 3OQOA 1L7VC 4CMJA 1T3HA 4C7JA 2HEIA 3GAFA 3ZWYA 2FUEA 4MVJP 1H4TA 2QTCA 1ELOA 3H3JA 4DPKA 2X4DA 3QBJA 1W8IA 1MC8A 3PD1A 1AB6A 5DP1A 2H00A 3IOMA 2WPNA 4PSVA 1ETUA 4J49A 1TM1E 3RBAA 2P9EA 3IV9A 5KSYA 2ZDGA 4NPHA 1G7SA 3HGQA 4IHJA 4TT3A 3OZTA 1TLLA 5BQ5A 3WLRA 2P6NA 2Q3DA 3W4IA 5CTAA 2VT2A 3GZJA 3M70A 4ND5A 5KWEA 1U7TA 1G2IA 5IANA 2IIQA 2BDUA 4TPKA 2HRBA 3G1WA 4MVWA 5DXFA 4Z5XA 1G19A 3BXHA 3WGJA 1VSVA 1SCQA 1Q22A 5EKUA 1QMPA 2X6QA 2PHZA 1RCFA 2ZTHA 4R6WA 3SXUA 4CIWA 1VKZA 3P1JA 3RFFA 2VSOA 3FIUA 3LT1A 4GI2A 4IHAA 5TPWB 4B8YA 4ICIA 2Q27A 2A5LA 4YVFA 5CM2Z 3VU9B 1NUUA 2PSJA 5K4AA 4ZCPA 3ZJ5A 3NEAA 3TMYA 4KAFA 4GX2A 4OB8A 2FSFA 3NHWA 1WA5A 1ZY2A 4X6LA 3BFKA 5KDOA 2H31A 3THYB 2BBSA 1G7TA 2GN6A 1YKGA 4A36A 1P8AA 1RABA 3KTAA 5HNKA 3GJSA 4NV3A 2IYYA 1DP4A 4LX8A 1FBNA 3INNA 3ZBPA 1F5NA 1WQ1R 4QGBA 3R8CA 3EZFA 6LDHA 1UKYA 3EDCA 2J45A 4M6WB 4P9NA 3QVWA 5LBTA 3FWYA 5LA6F 3KKMA 3SQMA 3AR3A 3P9XA 2TSYB 5KTSA 1QHSA 3OQIB 1UM9A 2G9NA 4FHZA 4AY3A 5I4KA 3ABSB 1E2DA 3IUJA 1XTZA 3AKDA 2QR2A 2CF6A 3FKJA 2P9ZA 4QXMA 1YZUA 2RHGB 1KYVA 3IFSA 3DBVO 3R3WA 4UATA 3WQRA 2CB9A 2XYQA 4JS0A 5BUSA 1II9A 4HK4A 1EUCA 1WOYA 4C6SA 2W42A 2ZWMA 2J7KA 3DCIA 1OXXK 3G85A 3MINB 2XMQA 1I3MA 3WL7A 4BV3A 2PS9A 1DFHA 1W6UA 3PUZA 4I9UA 2RG7A 1U2PA 3G5UA 3KQOA 1RIIA 1DQZA 4TWZA 4BNWA 1JQJC 4UDNA 1ZA1A 2BBTA 3CRRA 5JASA 4ZHQA 1NIPA 2ZSJA 4IINA 3MYYA 4OFWA 1YDMA 3C6YA 3D7NA 2E4WA 4UHDA 3WRVA 1E1NA 3CRQA 1OC2A 1XMSA 3P2MA 3LD9A 2FVYA 2Y1KA 1CQIB 2WSMA 1U0EA 1FNCA 1AE1A 1GGVA 2FWPA 1AIPA 3PFNA 4LRYA 5EWLA 2YFQA 1CZLA 3HNOA 4NYIR 3SHFA 2WAXA 4OI4A 3LF2A 4HWPA 4XSHA 4XSGA 7REQB 1CR2A 3ZZUA 2LNDA 3QYFA 1OREA 3DDSA 1PYOA 3KD2A 3NBUA 4ZXPA 2FX2A 2YJZA 3P4XA 3ZJUA 3EIOA 2AD5A 4NYJR 4XJVA 5B4VA 2DEUA 1JR6A 4TSFD 1COWD 3W05A 2CVOA 3AC0A 3CWQA 1E7SA 4HPXB 4KX3A 1PW7A 2HHJA 3BXFA 2JCSA 4NBKA 3VISA 3ZDQA 3FYTA 3QUTA 4AURA 3T1TA 4PAMA 2HHAA 2ENWA 4WGFA 4X6XA 4LS3A 2F3QA 4YV1A 3EEYA 3BSYA 3FOZA 4AJ2A 1MNQA 2NU7A 2B5VA 2NXCA 1LQUA 4JLNA 1NG9A 3HFJA 2GB4A 4X1IA 4AJKA 3DV0B 2VSNA 1Z2DA 2UUPA 1I2AA 3L7CA 5HKAA 4LKRA 4ESEA 2L18A 3FPAA 2DAPA 1TC1A 2IZOA 3U2QA 2QAGA 4CVNA 4DC0A 4L51A 1CE8B 3NRCA 3A70A 1O94C 3WK9A 1I7PA 4RK7A 3U3KA 2JLQA 1LK7A 2D1YA 2E4AA 2GZSA 3FDZA 5EFZA 2A84A 2J07A 5JSZA 4PG6A 3QU7A 4UNIA 4K3VA 3VNVA 3E3OA 2ZJ0A 3DKKA 3IE1A 1CNFA 2MU1A 3U3RA 1DUVG 4PFJA 4I0WB 3B6EA 2H57A 2QNRA 1YDGA 4MVJG 3D6TB 1UUFA 5J2TF 1WLSA 1J0CA 3MW8A 4RY9A 5ALOA 5C34B 2X9VA 5J2UA 1LVGA 2NTNA 4JHXA 3KTAB 4BWFB 4RTOA 1U5CA 4GO1A 1IC6A 3UHOA 2Z1DA 3A6EA 4FFVA 4H6PA 3MWDB 4TXJA 3U3DA 3B70A 1XEWY 5AKJA 1JG3A 2E89A 3BOSA 3KQMA 4FFBB 1E9RA 1PJTA 3W90A 2C9YA 3DB1A 4E32A 3UOGA 4FT2A 3PRKE 5KTMA 2EGGA 2OESA 1YL5A 3D6JA 5F1PA 4PQYA 1WEHA 3AR4A 3FNHA 1JSXA 3EGIA 4UJ5A 3PA8A 4NX2A 3AVPA 4LF5B 2O8CA 2IU6A 5IM4A 4BEWA 1ZLXA 2FZLA 1T2CA 3U3MA 1PT7A 1T2NA 4FQ7A 2R2GA 1CR0A 4ZYTA 4XQCA 2ZAMA 1N9GB 2AC2A 4E88A 3N2KB 2HXYA 3PXAA 2GF9A 1I5OA 3B6IA 3ROQA 1T8RA 1W93A 5AXDA 3BMQB 3EQ6A 5DCUA 2VO1A 1W5TA 2FG7C 2IZ6A 2XT6A 3LBIA 3M5DA 1P6QA 3MQ4A 4NYMR 4OQLA 4OXQA 3CX8A 3ZWAA 4WZAB 5CLIA 1UMBB 1E5DA 3DBHB 3JYQA 5AW9A 1U80A 4OX9B 1JAXA 3KZ1E 2WTMA 4FCTA 5T57A 1FTNA 1XXLA 4CLOA 4OJTA 4DFDA 3NHFA 4HNQA 4PGGA 5YASA 1EQUA 4RQAA 1HKUA 3SC2B 4XQGA 1GOTA 3G2HA 1R3UA 4CV1A 3JQFC 3CZ4A 4N5HX 2VXBA 1UP6A 5G4LA 3RE1A 5KYWB 3QI2A 2AXPA 2G28A 1ODKA 2GD1O 2KBEA 1GVHA 2GM9A 1YJBA 3EXG1 5CB4A 2NP7A 3X3HA 3RGWS 2B1RA 4RZXA 5E9QA 2OVFA 3UJCA 3AYXB 2SECE 1YFKA 4W99A 2IPAB 4PE5B 3RUCA 4LJAA 1V37A 1HE8B 1WXGA 3RHSA 16PKA 1J70A 3IQZA 3G23A 2WABA 4DLNA 1YR2A 1Y4ZA 3WR5A 1QRSA 3KP1A 4IEEA 3CE6A 4D4HA 1F2TB 5KJFA 3A8TA 1FTSA 2CHFA 3MFYA 1NMZA 3GA0A 1MC5A 1R2QA 2DBQA 3HWX1 1KARA 2Z2XA 3P2KA 3QH4A 2SHKA 5BN5B 4DCOA 1ULZA 3V7FA 3C2QA 3MT9A 3L5OA 3PHHA 4RFLA 2EWMA 3R3HA 2J9GA 1VRCA 3CEMA 1IVNA 1V7PC 5EXDA 2EL9A 2IGBA 5F23A 2ABWA 2ISQA 4G07A 4QUHA 5JXJA 3TF5A 3S5JA 4R2HA 2QN9A 2CJPA 2EBHX 2G77B 3IPXA 5E7MA 1RD4A 4L73A 1BJRE 4CTMA 2ZUFA 3HV2A 1JHDA 1Q95A 2WFZA 2A58A 3OQBA 3GLVA 3A9WA 3KJIA 4GKBA 2MT9A 5F52A 1JFRA 1REQB 2FSVC 2JFBA 2QMYA 2AQ8A 3EXEB 1PT9A 3H6HA 1Y0BA 5AM0A 4DV4B 1SXGA 1PR3A 2EFDB 4NV1A 2A4MA 4P81A 5CTJA 4YAEA 1CNMA 3NGLA 4OI2A 4P83A 3H5VA 4ROSA 1ULUA 3ZDYB 3KWFA 4YAOA 4HMQA 5CXXA 3GJ6A 3X43A 1J99A 2FNAA 1NSFA 3QUSA 5HGJA 4I5EA 1TVKB 5DX0A 4CR6A 4L1KA 3VU9A 2OYRA 2VH5R 2RDMA 4YR9A 2AFIE 5K6AA 2ZANA 1GN8A 5HF6A 1T91A 5EXSA 2IDJA 5D86A 2P90A 3HDVA 2DSNA 5BURA 1P44A 3MPUA 3P9YA 3LXRA 3ME5A 1UDCA 4JD5A 1Y5IA 4MI3A 4PFQA 1ECFA 3RVSA 3SHWA 3V8VA 2C0QA 4HLNA 5JD4A 4OL9A 1BWQA 1KYXA 1T9CA 3TBKA 3CF6R 3GAZA 1CRZA 4OJKA 4QYSA 2ZS7A 1MHTA 2WP0A 1XJ0A 1S01A 3EPRA 4JBNA 4NFYA 4CQLB 3EA5A 1SAYA 4EFKA 3GVPA 4RFSB 3VBCA 1KF0A 5G1OA 4ZEWA 3TSWA 2REQA 1KTVA 2YY7A 1XCBA 2ET6A 2XGOA 4ISCA 1IY9A 3N6XA 1EPUA 2I2AA 1DB3A 1DBVO 1JPUA 4QUEA 5LU9A 1K5DA 2G9RA 2P5UA 1P9OA 2VJPA 3E4DA 3QF4B 5AJWA 3DFFA 3U0BA 3PENA 5JCZA 1LPMA 3KT8A 4BMPB 2WJPA 3UK0A 3DXZA 1C1DB 4CEIB 4IXNA 4C0SA 1GSOA 4P58A 2ZU6A 1S2LA 4UQLA 3O47A 4KO1S 3DOFA 3VKFA 1CUAA 1JDBB 2QIPA 3LUGA 4G1MB 4I1SA 1G3MA 4ACBA 1TVMA 3GJ5A 1R16A 1UZLA 4YUXA 3NVKI 3AZOA 4U7DA 2VTDA 1S7CA 2VZLA 3DWFA 3JR3A 3M4ZA 3D3QA 4WCFB 4A1OA 4BNGA 5JO0A 2X7XA 1TJPB 5CVJA 4A8HA 4XZ3A 4OHVA 1ACLA 4WJKB 2JIOA 4TWIA 2W6QA 3IESA 1J9ZA 1GRVA 5H0IA 3ZKWB 3RFTA 4EUSA 2YWXA 3BORA 5C5EA 1IMJA 2IYUA 2O4UX 4OQFA 3WL4A 2WHRA 2JGLA 4U9UA 5JTTA 3ZN2A 4B7XA 3FYUA 3MWGA 1TJYA 1KRHA 3FRHA 3CEPB 4F9EA 1N2OA 3NJRA 4HAUA 2FN4A 3RRBA 2YYSA 2ZUSA 2X3FA 4Q00A 5CNIA 5D84A 2QTVB 1CSEE 4K3UA 3BQNB 1GAEO 4NKRA 1JYSA 3WRXA 2A0UA 4E5VA 3LAWA 1ISFA 4F6LA 5IJAA 1HDCA 3WGVA 2ZAYA 1CUDA 1TO2E 2BTQB 3OJFA 5ICGA 1VKJA 2Z4TA 3U13A 2VQFB 4S0XA 1J5EB 5EESA 2WDPA 2XX3A 3G8AA 5HA5A 4RH3A 1Z73A 1J22A 1Y1QA 4BQIA 1OVGA 4EBFA 3PWKA 1O87A 4I1VA 2HA0A 1EWVA 2H1WA 5CIYA 1S2IA 3JQGA 4JEMA 1B41A 1MTOA 1EZZA 1ZMRA 4ZAGA 4HNSA 4NZOA 1Q1BA 5HCNA 3TDKA 4EI8A 5TMPA 4HVTA 1EFLA 3IERA 2UZIR 1H2YA 1Q0QA 4KI0A 2N1MA 3SJ7A 3IL2A 3OQVA 4R81A 2D13A 3DE5X 2WE7A 1K98A 4IDAA 2WJHA 1S9DA 3UWKA 3CUSA 3W8NA 4U5QA 2A7XA 3PXDA 2PGJA 4YP1A 3W5SA 4B3TB 4UHEA 5DTJA 3FLAA 1NFRA 3RLIA 5CDTA 3VV3A 3CNQS 3LO8A 3ADOA 1XC7A 4D9KA 5A4JA 2ZJ3A 4YJ2F 2CYBA 1LPPA 1CDZA 4MS1A 1CYDA 4RESA 1UEIA 2Z6QA 3PVSA 1XVUA 3QNMA 4M1OA 4BB9A 4CLHA 3CLSD 1E5QA 3TLZA 4PC1A 1AT1A 1VHWA 8GPBA 2C58A 2HRCA 4JB3A 2ZIEA 4RKWA 1P1BA 1FU7A 2VLBA 3L5KA 3M6UA 2J9RA 3IB6A 4H7EA 4HOYA 4JCCA 5DNAA 1NVBA 3EWSA 1RLTA 2BFFA 3T3IA 4E12A 3FNFA 3LYAA 4FYKA 5IBCA 3FPHA 4JOCA 5D7BA 3DMFA 4B3FX 1JR3D 3BAFA 1P1FA 3BGDA 4F9GA 4RIGA 3QENA 3TR5A 4PC7A 2YIDA 1ZICA 4QQNA 4L6IA 1QKJA 2VAXA 4LOIA 5FBWB 2DQ4A 1Q1GA 2D0PB 1VL2A 4PYLA 1UDBA 4HRXA 4J7XA 2EQ5A 5NLLA 4KUHA 3WWDA 3U1BA 3WKBA 3R3YA 1SVMA 3HB5X 2G4LA 1JEQB 2VP0A 2BFDB 4WPGA 4ZQCB 5MGBA 2RGBA 1T29A 4EHBA 4UNRA 5IN5A 4FI3C 2ATXA 5BN4A 3MCUA 1D2MA 1PVVA 1DKQA 2B8WA 2IGTA 4FYXA 1OY1A 2ZVQX 1SC3A 2WKQA 4KNVA 2QPOA 4P8RA 3ZXYA 3QKIA 2EJWA 2XB9A 3Q3EA 5CLGA 2V0CA 3D8SA 3OWXA 5TJ9A 2FZVA 2X8AA 4EVRA 1AGNA 4FSXA 2VDVE 3QI7A 4KXYA 1GZ5A 1QQ5A 4I6JA 2VHQA 4QTXA 3VMFA 3FUCA 5H3LA 4G84A 2NPOA 3BILA 2HZ7A 1QHHB 2CXUA 4CF7A 2WSIA 3ETEA 4FZVA 2Q2VA 4AIRA 1Z7EA 3ZOKA 3UF0A 3SEAA 1F0YA 3NRJA 3SJAA 4J2TA 3X1WA 5I9NA 4PZDA 4B3DA 2JGDA 1PSWA 2UDPA 4Q47A 1H9CA 2KSQA 2GA9A 3WDKA 1QVRA 3AV3A 4C6RA 2ZBQA 1IQPA 2BEWA 3ORFA 3HCPA 2QRHA 1V43A 3GFTA 1U0GA 3VR2A 4DA7A 4GFDA 1G64A 5FPQA 2NV6A 3CF2A 1FPQA 4OKIA 4QPJC 3UT5B 2V8OA 4DADA 2QAGC 3B48A 5DK6A 4QXRA 2A5FA 1R74A 1JQ3A 4UHJA 1GYPA 1EXWA 3RU7A 3LP8A 1EVKA 1JIKA 2OZKA 1DQSA 2Y1OA 3KYCA 4L85A 4P4TA 4E03A 1EXNA 1RQ7A 3KAPA 5K51A 3GLFE 3D0RA 1HSOA 2VF7A 1DCMA 4GT1A 4Q9DA 4ZRMA 5FNZA 3U19A 1TTPB 4AJLA 4QU9A 1Y98A 3BK7A 3JVUA 1KBQA 1R0RE 3N2ZB 4R83A 1YFZA 5IZCA 4AZTA 6Q21A 2OAP1 2XUAA 2JGAA 3KHTA 3IQDB 3ND8A 1HDOA 1BWPA 3EFBA 4XH9B 4JJ4A 1ZITA 5ITWA 5IVDA 3KJZA 3A4MA 1XQYA 1ECJA 4N48A 4JYPA 3KWMA 5LDHA 2FEPA 5CITA 2IH2A 3NUZA 3IUPA 3N58A 1DV2A 1ZU4A 3VVCA 1HETA 1H2WA 2QD2A 1WMEA 5JJCA 4S1TA 5IARA 1SZJG 2DPXA 4NBRA 4IYJA 4YH1A 3OF5A 4MB6A 1P1KA 1X1QA 2V5VA 5HZKA 4CDRA 4QUBA 3TFQA 4G63A 5DYGA 3A9RA 1NBEA 2LV8A 2PL9A 2ZI7A 2H2WA 3I9FA 3Q1KA 1P17A 5GADl 2DXIA 1SVOA 1TZ2A 4DC1A 4OQEA 3OD5A 2G80A 2HK7A 3ZU2A 1R3DA 1E6UA 1JFLA 4FGKA 5E7QA 3AESA 3R6WA 5MN6A 1TZJA 3ASZA 4RM2A 4ENPA 3AF1A 2PH7A 2W0MA 4RSRA 1B74A 2QRUA 4FMCB 1HEUA 4J0JA 4KYUA 4UBKA 1EWYA 3ILHA 1Z0UA 4N1AA 3R0VA 3GFRA 5FBHA 5FCDA 1DHTA 1PWYE 1SEPA 1YQ9A 4BNXA 1IZYA 2ACVA 3DUFA 1H93A 2QD5A 4RWZA 3G8CA 2LD4A 2JCXA 4FNMA 4IW3B 3LUHA 5AKEA 3SX2A 2IHBA 5J4VA 1BX1A 5JJKA 1T24A 3HP4A 1E2FA 2GK4A 2GXAA 3QLUA 3SZGA 2IYEA 3T9CA 3A37A 3QNWA 3STTA 3ZCUA 3DCYA 3CN9A 1YVRA 1VL1A 1KZ1A 4FGLA 1JAYA 5DIZA 1VECA 3UTDA 1RBMA 1ADYA 1YB7A 3JQ8B 1K4MA 4ZOQI 1SVNA 3VR0A 2F3SA 3SN6A 3HUTA 1MV8A 3N87A 3GBPA 1E3WA 3GR6A 4Y30A 4OHBA 5BOVA 4HWSA 4YJ3A 1M6WA 4CCYA 4JJKA 1B16A 3FTCA 4YDSA 3T7DA 4HWOA 4WFJA 4HKTA 2ZBEA 2HDNB 4F6CA 2BRUC 3IQHX 4R9VA 2UZ1B 4EB8A 5TR9A 1V8PA 5K0SA 2DB3A 3JQAA 2K2QB 3SEZA 3YASA 2QVCA 5DKFA 4BB6A 1N2JA 2J5RA 5TVGA 3FAKA 2DWPA 1H8HA 3B1JA 1PSDA 1W52X 3CYFA 2BFMA 4G65A 4KACA 3AP1A 3L1VA 2PUVA 3ZR4B 1PL0A 1YNSA 5AVYA 2WTEA 4H4CA 2I78A 1X7WA 1V8BA 4BNLA 2AI2A 1LNZA 3H97A 2BOVA 4UUNA 3WRYC 1RZRD 2Q29A 3OM1A 2OYSA 3EEIA 1Z2NX 3VPXA 2DMRA 5LB4A 1E1LA 3WL8A 2J0QA 3COWA 1WHSA 3N39C 2JIPA 4RPJA 4QUDA 4X3CA 1TCCA 3A1WA 1D6SA 1RSZA 2B0CA 3EQ2A 3H0EA 4PPQA 1QVVA 1W5FA 4Q9NA 1OU0A 5FB3A 1MW8X 1BVUA 4OQMA 5JJIA 2Y71A 3I6ZA 1ZWKA 3IT3A 4NBWA 4AI6A 4PQFA 3NB0A 3RB8A 4C05A 4C7OB 3F5MA 4YO8A 4LJ6A 5IABA 1WX1A 1ZVJA 1SU8A 5K3EA 1MN6A 3ZLBA 1D9XA 2QR3A 4HPJB 1G98A 3NEJA 2GJSA 4LE0A 4DM7A 1GZ4A 1DAHA 2HQBA 3SNHA 2OT3B 1Q1EA 4MRAA 2EFCB 1FXWA 1ISHA 2CNKA 3DEKA 4ZVMA 3RU9A 2NZJA 3ZLJA 1L7QA 2IOFK 1UBGA 2G76A 3CSUA 1X9IA 3LGSA 3LOPA 5AHOA 3RJ9A 4A26A 4Q19A 3VU0A 1ZISA 3G2PA 5C4IA 3QXCA 3TTVA 2VRCA 2JIRA 2Z2ZA 3SDSA 4Z86A 4ZHSA 3FMOB 4R7ZA 2PLFA 2VSQA 3C7CB 1IN8A 2HH9A 2P2YA 2EC5A 3GK3A 3MSCA 3FTNA 4I66A 4NMLA 4BTVA 4QSHA 4DPLA 3H19A 4EG8A 2PUBA 1FPMA 3B7WA 2NVBA 2YYZA 3K9GA 3BL6A 3BMCA 3GCZA 5I7AA 5TC4A 1PS0A 1P6XA 1Z29A 2HMWA 3RYTC 3BF8A 3KYCB 1FU8A 2L17A 1ZC4A 2IL1A 4HYQA 3B1KA 1Y1TA 1X7GA 3A1EA 3QOYA 1KAMA 5BN4B 2DTDA 1IE3A 1UJNA 3ZW8A 3Q9UA 4TLEA 1SZDA 3HP7A 1OR8A 3U6KA 1DAMA 3UBTA 2V96A 4M46A 2ASEA 3UC5A 3QPWA 4CF6A 1EFVA 1Q92A 1WVIA 4J3NA 1ZHFA 2RHTA 3AEKA 1U3CA 3G13A 2JZOA 3LP5A 1R0SA 4RO0A 1KK0A 2QYSA 4OUKX 4C2BA 1XRNA 3PKZA 3TRIA 4NCAA 1VMKA 1T1IA 1X7ZA 2QUKA 1F9AA 3IE0A 4G2TA 1F8FA 4MB0A 5KVQA 4NULA 5HCIA 4DMKA 2Z08A 4PLWA 1PR4A 1UJ5A 1NW9B 3HY3A 1E4EB 2BF7A 4JJIA 4UHFA 1E96A 2OYCA 3R0IA 4QM7A 2DJ5A 3ESQA 3ITNA 5KU7A 2RHWA 5FBKA 1TJ3A 4BC1A 1P80A 1ZSYA 3D5QA 4N9QA 2GS9A 2VJYA 3FOAA 4X1KB 1Z28A 1GQRA 4CFYA 3H83A 1Q6YA 1Z6PA 2H5JA 3UH1A 1Y42X 2JBAA 2P78A 4W8GA 4BEVA 1NFQA 4YMUA 3BXGA 1PLKA 1YAHA 4US0R 5AVUA 3I3OA 4BVAA 1CZHA 2O48X 1ILEA 1TVEA 4UBOA 1UIRA 2Y1EA 5KINB 3QEAZ 3ED1A 1ORIA 4G1FA 4GLFA 4O4JA 4KN5A 1CS0A 5A2QA 3FNEA 2ZBFA 2P1DA 3QE3A 4L28A 2YV1A 3FGOA 4LWPA 4TLCA 3V5NA 1A2OA 3A4YA 3NEPX 4K9DA 3UJ9A 2I9PA 2F90A 1GPDG 4ZDWA 2OV4A 1SCKA 1SXJA 2G1JA 3I45A 4X7PA 1H2AS 1RWWA 2CKDA 3W77A 1ZGBA 4IZHA 4TXLA 4BPRA 1TO6A 3NM6B 1BKDR 2LP4Y 3N0RA 3DVAA 1N7IA 4H1UA 2G82A 5D5QA 5JCJD 5JC8A 3DFKA 1BZYA 3UGKA 3KL2A 4EGAA 1H4VB 4KMOA 4RJ2A 3DLAA 5C7YA 4DV6B 2WHYA 3RS2A 4JJ6A 4KU4A 1Z88A 3SZLA 1T2VA 1SUEA 1EFAA 2VP2A 3H0CA 5JD5A 2OZLA 2P6UA 3TRDA 1MB0A 4DSNA 3ENQA 1O5TA 1TIKA 4LRSB 5DW3A 4AKGA 1W1UA 2Q6OA 4U2BA 3I01M 3R75A 2UZ1A 4MRSA 2W93A 1U8AA 5EJ2A 3VOTA 2O2XA 5FR1A 1VLJA 4B4WA 2WHXA 3O2SB 1KHTA 3PGMA 3TDNA 4YJ3B 3MJ4A 2AB0A 4JVOA 2ZS8A 3VPAA 3GGOA 1LPNA 4BP3A 3OCWA 1XVVA 1M83A 2VP9A 2WWIA 1WDWB 3KKEA 4X71A 2B1JA 3FWPA 1U7HA 1OHHA 1YTUA 5HZMA 1UOQA 3HY6A 1YJ8A 1XRQA 1PEAA 3SQXA 5B7NA 2FPRA 3ZGNA 3F7NA 3UZUA 2WKRA 5EYPB 4F4DA 1PR0A 4ZALA 2R0QC 1NJ5A 4B2PA 3KKPA 1G9XA 2ETXA 2V6IA 4DNQA 3T5GA 4L5IA 1M33A 1MRSA 1YOVB 2CDCA 1I6MA 1HX7A 2R6CA 1MFZA 1HQKA 1OT5A 1GEGA 3I1JA 4EHDA 3VPFA 3MJEA 4TTVA 3VYSB 3OTOB 4O02B 3Q12A 4OHKA 3QKSA 3WG9A 3QVUA 3WWEA 3U3XA 1KFJB 5DYTA 1IPFA 1C4KA 1FX0A 2PGNA 3TX6A 2Q99A 3IT1A 3ASVA 3GCGA 3EH1A 4FMDF 2HRRA 2QRPA 1V16B 4L02A 3A06A 3PUXA 3TSAA 4GI1A 5TSDA 3RVJA 4EMSA 4N0PA 4HQKA 4XD7A 5A5DA 1YDEA 4WK6A 3K0AB 4U7TB 5LKAA 1O7JA 5DOVA 1T6ZA 2LZ0A 1MB4A 2ZEJA 4A2WA 4D8WA 3V7UA 2IY8A 4X8LA 3IHTA 2AE1A 3H17A 3Q41A 1LA2A 4TS4A 5JUWA 4HMPA 5H4GA 1C7IA 2FTKE 3PDJA 4RMIA 1Z4PX 4WHMA 4D43A 3HJRA 2HT6A 4BWYA 1T0JB 3PT5A 2PQ0A 3TLCA 1B4DA 4EG5A 3PDIB 1XCGB 2C4TA 4XVQA 1Y4SA 5IWAB 1DFIA 2CBXA 3B9RA 1XTRA 1PEKE 1ZN2A 3WBJA 5B2FA 1R4NA 2HXSA 1XQWA 3TSZA 3BBLA 3P9IA 2BUCA 2VNIA 1CP3A 1RADA 5F98A 1P75A 1L5QA 3SJUA 2OE2A 4LC9A 1T3LA 1E5VA 1P91A 1JMYA 1Y7TA 5EMKA 1C9NA 3R5SA 3NBXX 2CW5A 2PGOA 3SS9X 3SC4A 3IBFA 4RX1A 3LY7A 1ZMBA 2JI6A 3E7WA 4KQ2A 2Q8NA 1UC4B 2GI4A 1ZFNA 3HXKA 1M2VB 2IS1A 1MXHA 4MUMA 2V6BA 2C5EA 2Y05A 3GARA 2W6JA 4HRAA 5FYQA 5A62A 2C4UA 5E4TA 2O8BA 4NJMA 2E55A 3QPUA 4YJ2B 3F6BX 3OFSA 3K9BA 3IAHA 1GSHA 3N86A 3MS4A 4WK4B 1XWFA 2IW1A 4YFVA 1UKCA 5DEIA 4RANA 3RSCA 1Z6YA 3IA7A 4WDRA 2PD4A 3H8VA 4YUVA 1IBSA 4KTVE 4U7WA 2PBLA 5TGZA 1OFGA 3ZD9A 3TNJA 2Z2IA 3HZHA 3GPDG 4Q16A 4DM3A 4Z53A 1AZLA 3GJYA 4GLBA 2YZ2A 1H3FA 3RJMA 4Y1GA 3ANXA 2ETVA 3HA5A 1ZRNA 2IDZA 1HR0B 1X9HA 5CVDA 5EKXA 5HKKD 4EJMA 1GG9A 1D4FA 1PJLA 2OSVA 3OMWA 2A3RA 2QN6A 3G3EA 4JLSA 4M7PA 3TTSA 3DOIA 4XDYA 4UDOA 3WI7A 1VBFA 3WLJA 4OXYA 4CG3A 4LFBB 4C03A 1G291 4Y3UA 1MOZA 2YY6A 3MGAA 2FN7A 5B4TA 3FHCB 2J6BA 2Q4DA 5D2CA 2PE5A 3BDVA 1QFYA 1XL1A 4G5OA 1U99A 1P1CA 1ZCFA 3EGOA 3S70A 1QNLA 4MS3A 1A0OA 1YAJA 1NRXA 3HEAA 4YCAA 1QH0A 4XGNA 4OXNA 5FWYA 3Q1LA 3M6IA 4HLUA 4G24A 2O2HA 3ZE6A 1PEDA 3QX3A 1V1MB 3I9OA 1RLMA 5EI5A 1NTOA 1TCUA 5FA8A 1F8UA 2AN4A 1VJTA 2ZVDA 3FZGA 3MGGA 4TKVA 2YV3A 3A4VA 3B3JA 3UAVA 4AKEA 4BNVA 2OLJA 3NWOA 4B47A 1EK0A 1PFQA 4UXJA 1HE2A 1J2UA 1J1IA 1ZYUA 2P67A 4TL7A 5JY6A 5AJHA 2VFAA 3UXYA 2IYPA 1QSGA 3PDCA 1CP2A 2Y68A 3NHKA 5EHNA 1N5OX 3PQ6A 4PN7A 3LCCA 1UBOS 1ISPA 3H04A 4WOPA 1MVLA 1P1JA 2W2QA 3N7UA 5A3JA 1KDYA 5BSGA 1V5WA 1YR3A 2Q5EA 4RIHA 4UW9A 2X4IA 2AI3A 2Y99A 4P0QB 1MJGM 4H9GA 4CL0A 1BMDA 2CXPA 1F38A 3L0SA 3G9QA 4IIFA 5AK4A 5EUCA 2CLHB 3OHSX 3UUEA 2PSDA 1BN6A 1QR6A 2G3YA 3FKSA 3ONFA 4OJQA 4YB8A 3WDLA 1QHFA 1DXQA 4WZ6A 2ROQA 3L4KA 2QA5A 2DFDA 5FDFA 3SWWA 1K1EA 4LMRA 4JIGA 1L5RA 3EULA 3PUJA 3KQKA 2BRUA 1NNLA 2PRIA 3FVTA 3PIDA 1BXGA 2QXUA 4PIMA 4L9RA 1ZC3A 4CL3A 5DMXA 4MRNA 4J16C 3IDAA 3UK1A 2ZI6A 5FAKA 5HM8A 5J5CA 5JEEA 2VQDA 3OQNA 3X1MA 2G5TA 3WGIA 2AEEA 4LXIA 1F2DA 3DEFA 4L7QA 1VJ0A 3MOIA 2YMLA 4YLYA 5AVSA 4ZIRA 3O95A 3D5TA 3P9SA 3HLKA 2GARA 3BA1A 4QOHA 2JCBA 1C4WA 2CLLB 3OPVA 3LA8A 2BFAA 2DC1A 5D01A 4C6TA 4LDPA 2XXAB 2NU8B 5EJIA 4PLPA 3UV6A 1VE3A 3FPKA 4CM1A 4CV0A 1Q77A 1I4EB 2ENUA 4U2GA 4BKOA 5KNDD 4QDTA 4MQUA 3GPBA 3F3YA 4JI3B 1OFVA 1GT6A 4QTTB 2C5LA 4G1BA 4AO7A 2AK2A 1AQLA 4OLHA 4CBVA 2EKBA 4BKPA 3MIIA 1IWBB 4PO8A 2XUQA 2J41A 4R2MA 2YZ7A 2QS9A 2RBEA 4ZODA 5E1BA 2O2DA 5FTNA 2LDBA 3OZCA 4JGIA 5AXCA 4F97A 2VJDA 5FTWA 4GC9A 1GP2A 5EQFA 2Z6AA 2I4LA 3R3VA 2OCKA 5FQOA 1KORA 2GAJA 3TZCA 4B6PA 4EMTA 2Y0CA 5F7XA 3RAJA 2P9BA 1TYEB 2QU7A 1NM5C 1T0IA 5K0LA 2VZ8A 2AMVA 1DEKA 4B7CA 5JYCA 3FPBA 4DV1B 3M9XA 1RI3A 3C3DA 1VRWA 3D2AA 3P8ZA 1MC1A 1HT1E 4NK4A 2JCGA 3S40A 5KTYA 2WF8A 1JL3A 1VP9A 2XTMA 3DAHA 3TQSA 4MJXA 2H1OA 4X84A 4CMGA 3A9SA 4CKBB 1P73A 2OHIA 3ANMA 5CT5A 3ZDBA 4CQNA 1GQQA 4EY7A 4TXHA 4HB0A 4XJTA 1A04A 5EPEA 5B30A 1IZ7A 3DC7A 3EF3A 4ZVQA 4B0OA 3QVVA 5K7SA 1P60A 1L4UA 2ZRIA 3OTQA 1N5MA 3R9XB 4FFWA 5KIAA 2J0EA 2GMWA 3NKLA 1C9YA 5CB8A 3IP5A 2IYRA 4MCHA 1W76A 2A0FA 3AF2A 4J0QA 3S6JA 3GZ4A 1JEQA 5P21A 1YONA 3AG5A 1QQBA 3ASYA 3HXQA 4P7BA 2AJDA 2XGMA 4YASA 3AM1A 2PLWA 1YH3A 2R00A 3HFRA 1F06A 3RU2A 3IMGA 5LD2C 4V03A 2F3TA 3CH4B 1FEZA 5LL6P 3GG2A 4Z54A 5B7GA 3AK4A 4OFZA 3LBNA 1H65A 3HN6A 5IH3A 4B83A 2E7ZA 2HM7A 2Q7XA 2WVHA 3RRFA 2H59A 1PTJA 4F2PA 3D7MA 2P11A 3GJ3A 3ESXA 1EJBA 4MS4B 1I32A 3G5TA 3M83A 3KKLA 4NR0A 1U7WA 1KGSA 1R64A 2ZPTX 4YDHB 3DBRA 3KT3A 2BFCB 3KV3O 5A4DA 1BXKA 3GYBA 2V0GA 5A4FS 1D4AA 3LDAA 1I9GA 3I9KA 3DAOA 1IY8A 1ECGA 4FMPA 4Y7CA 5EIFA 4F2WA 3BSWA 5IZ4A 4K8RB 5FV4A 3IYLW 4EJSB 1FSZA 3ZXXA 1WB9A 2W6MA 1KOLA 2ZSEA 5L7WA 2W2NA 4BO1A 1RYMA 3DA8A 3EW7A 4PPGA 4WK0B 4BQOA 5CFRA 2O8BB 2WMNB 5CK4A 4E2FA 1ODJA 3AB8A 3NXSA 5KYYA 3EIHA 5T64A 1J4AA 2NZXA 2JL1A 3WOHA 2R62A 2C77A 3KOYA 4KR6A 2ISCA 2RH5A 1X7WB 3EZLA 4AUNA 2WE8A 2JLUA 1GZVA 2J32A 2J7PD 1SD1A 3CXRA 3GIDA 4Y0VA 2OXIA 2FMUA 4KI7A 3DVAB 3ZLTA 4DDWA 3OEWA 3B9PA 4ZI7B 1OT3A 1P5HA 1P2DA 2EG9A 5BQOA 3UG7A 3W2TA 3TLEA 3ZHXA 5A05A 3H05A 1WLYA 4UD2A 4L7VA 1UH5A 3NHJA 4G5RA 3TX2A 3NAGA 1UKEA 4PANA 1LSJA 1KO1A 1RAEA 4DQUA 3X1XA 3BIXA 1CB0A 2BBOA 2HBRA 2OXEA 3C6ZA 3QVOA 5JTUA 3X1YA 3RYCA 4K6HA 4UCQA 2XRZA 3QX8A 2PV7A 1RBYA 3MTIA 2Z3WA 4QDKA 3E22A 2FUKA 4FOTA 4FGZA 4MUBA 5M2QA 1QQ6A 5HE9A 4DB2A 2DQKA 3O74A 3B1VA 4C4YA 2GCPA 1KEEA 4D97A 2IBTA 4CHTA 4DBLC 3WYEA 1YE8A 3JR7A 4XR9A 2WF9A 1BU8A 1I3NA 2FXVA 3EARA 5KYUA 3D1LA 4XB6B 3VDNB 3VZBA 2QZPA 4E6PA 3AH8A 4JYMA 1Z26A 3IPCA 1ZK0A 2AMLA 3RF6A 3S3TA 3SJCA 3ZGLA 3ER6A 6GPBA 3GGDA 3GEMA 4F2DA 3AOGA 2IIVA 3N8NA 3OY7A 3QVKA 1PQWA 2BBWA 4GE3A 4GM1A 4N03A 4PZ0A 4C4TA 4RZ2A 5EJEA 1LWOA 1N2EA 4P3YA 3IKJA 5CB6A 3UA3A 2FZCA 3WGOA 4BNDA 2V7QD 4LXUA 2N46A 4JN6B 3EEFA 3BFPA 1O95C 3O38A 1DWQA 4G89A 4BIMA 3FHLA 1O6GA 4ER3A 2Y66A 3NM4A 2HOQA 3UJHA 3W2FA 4YCCA 5C51B 4C2UA 2VJCA 1JG6A 2IYNA 4WLVA 3GD5A 3C6QA 3PP8A 4Y6LA 1M2OA 5DLYA 1QTNA 3LO5A 4IIHA 2JNWA 5JD3A 3SBDA 1SD2A 4ZJUA 1ZM7A 2J3KA 4Q21A 3PCRB 1N2CB 3RKUA 1HM5A 1C1YA 1VCMA 2GKGA 1YACA 1CQWA 3QEJA 5EE1A 1G18A 3T6KA 4EO9A 5K8JB 2IW3A 2MYUA 3E0XA 4ZT3A 2PZEA 3EVTA 4X00A 3ORSA 3VPDA 1AM4D 2Q3BA 1NXTA 4H4EA 2Z3VA 2WJIA 1M1YB 1WQ4A 2D59A 4OQZA 2QUZA 5JT1A 4R4JA 4ZJPA 3GJ7A 1RWKA 3F2IA 1AZTA 1T2EA 3DEIA 3K2BA 3TSCA 1P5ZB 3IBYA 4JX9A 3H9BA 4KXXA 1YMQA 1GU0A 2IBMA 4RTRA 2L2QA 4MW1A 2QVZX 5CMLA 5K3CA 3NTVA 1F14A 1RYDA 3FMVA 2V4UA 3U7QB 4CG2A 5K6TA 3RVOA 4CM5A 2IEAA 3H2BA 5P8WA 1ZQ1A 5HX7A 1DUIA 4LBZA 1OFUX 1AKWA 3PICA 4JNKA 3DMTC 1E18A 5K3FB 3G59A 5KSOA 2VAMA 1ZH4A 4ZREA 5GJVC 2OO5C 4KPUA 1I5RA 3ZX4A 2Q1XA 3I39X 4YO7A 3OOJA 3RS5A 4OM8A 3SJZA 2RGRA 2W4MA 3W9BA 3DUWA 3RYFA 2FMXA 3L0DA 1D3AA 4MS4A 4QM6A 4YMSA 1E2BA 3PC2A 1GIAA 1IHOA 4L8YA 4CJXA 1P2GA 5DX8A 4RHYA 1QIIA 3FFTA 5HGXA 4FZ5A 1TAUA 1Z37A 3EXAA 4I14A 4R51A 2C8LA 4Y2PA 3T1QA 4OL0A 1K6MA 4OUDA 1NUHA 1LBQA 2OMEA 2VNJA 4BVHA 1X7HA 1RHJA 4Q4DA 2PNFA 1A1SA 4WESB 3WBFA 3C7DB 5DBOA 4ZI7A 1WB6A 4RZUA 3IVMA 1LPBB 1SUPA 4HEHA 1VLVA 3OLQA 1DDOA 2IXEA 4ITUA 1KMCA 3OC6A 2GRAA 5G2OA 1D8TA 4FBGA 3UKOA 1JIIA 2A78A 4WZBB 5FOSA 2ZBRA 4YRFA 5KX5B 1ARZA 3KG2A 3U3OA 1MVNA 3ZZMA 2WUWE 5M34A 3CURA 3G0HA 5GMOA 3GUCA 3EJWA 3FPFA 3BERA 3CH7A 3I1YA 4IH4A 4DDKA 1IOWA 2LDXA 2RI0A 3VDXA 5COQA 1NTRA 2X2PA 4KW7A 1MXFA 1Y8RA 4IDGA 1GUAA 1EX7A 4EHIA 3SMVA 5HJ5A 3RRNA 4XUCA 1F2VA 4J1SA 4PGFA 5BNTA 1NMXA 5A7HA 2VS1A 4LF8B 4YMVA 4B87A 1E6EA 1CUYA 2G5PA 4H08A 2HR1A 4WL0A 1C9JA 2VUUA 5LYYA 1O1YA 3JQEA 4WLNA 1DAKA 2RGWA 1UBLS 2G6TA 3SPXA 3EISA 4EYKA 3EEOA 2ALJA 1UOEA 2DUUA 3CLSC 3E18A 5A1JA 1QHXA 3PV0A 3R7LA 3REQA 5JW6A 1XI2A 5LMUB 3F3KA 3ESBA 1RXSA 2JRLA 4C3ZA 5FWAA 1EI9A 5I9SA 4ZJZA 1PZXA 3A7DA 1DBPA 1TI7A 3Q0TA 3TAUA 1QIHA 2QN1A 4YROA 3ETLA 2BE7A 4P34A 1NOIA 2V5UA 4ZRDA 5IAGA 1XZMA 1PGQA 1SB8A 3QU5A 3KQYA 2UYHA 3GZNA 4DIDA 1E2HA 3DDNA 3GA5A 1M6VB 2X40A 5KX5F 3O8CA 1NHGA 1J24A 1W49A 2OVBA 4MXDA 1NVAA 2I0FA 3C74A 2C0CA 3E82A 4IVPA 5IT5A 2BZ1A 2WWGA 4REQB 1DHRA 1YV9A 3LPLA 5DMHA 2CV1A 3CH6A 1XQ6A 3AY3A 4WXRA 1HKHA 1RJ9B 3L8YA 5F2NA 4C22A 5LXTB 5KVVA 1WVMA 4ML3A 1E59A 2ZWOA 5K3FA 5H3HA 3B8EA 3TPFA 3EXHC 3CW2A 1GR0A 4DM4A 5CD9A 3DEJA 13PKA 2O1EA 4IMPA 1FFHA 1E0AA 4ZYUA 1JZSA 1LTHR 1OW3B 1TA0A 3PQ5A 1NLFA 2YIMA 3FMIA 5CHEA 2BKVA 5CDFA 3R8FA 3CIOA 1C7JA 4C0AC 4W5NA 2NVOA 1VHQA 4IF4A 1B6GA 1SQGA 3OKAA 4UBNA 5EXXA 4BU0A 4C14A 3GH3A 4ZWNA 1WAMA 3JQAB 4G3XA 2VDMB 3QPAA 2JJ2D 4IXTA 5LQKA 2RONA 4N47A 1B0PA 2D1SA 2X4LA 3L01A 3CUYA 3DV9A 3N8IA 3P5BA 3C16C 3UWOA 3LYHA 3PGVA 3E15A 1G8FA 3G88A 3TRKA 5G0SA 2IYZA 4QODA 1NBOA 4C4OA 2JFOA 4YCDA 2WF6A 2ZKLA 1MNAA 3R7BA 2WC1A 4WXEA 5CW1A 5IKMA 1JHPA 1KH2A 1JILA 3TFWA 1N33B 3ZVRA 1WB5A 3KBBA 2BVNA 5C7OO 2AJTA 5B2EA 1TA9A 1FL9A 3U7EB 4F04A 5CBKA 2QTHA 4GD3Q 1PX2A 3PA6A 4LJKA 1QTRA 5BRJA 1GU1A 5GTDA 5EJ4A 2QVLA 3EOZA 4JLMA 2WHEA 3L06A 2G1KA 5G0UA 2C9OA 1H69A 3AY7A 1NXPA 3NTXA 4MWEA 4QD3A 4KO2S 1KEZA 4IOMA 4L2IB 3TEMA 2BGIA 1VPEA 5TJHA 4LBWA 4DSZA 1DQRA 2VBIA 4LQ4A 1TJNA 2PQ6A 5EGNA 1ND6A 4X5OA 2GA8A 2R96A 3NMUF 4ZV9A 4YV2A 3P97A 4OK3A 1ZW6A 3UAYA 1CE8A 3F78A 4UTVA 4JITA 5M04A 4WWHA 5H4HA 3C15C 3WXMA 2DH6A 4Q82A 4WKOA 3HNPA 4L74A 3ESYA 5AFSA 3P45A 2CNNA 2RAPA 5A5GA 4DLVA 2V6JA 3LU1A 5JFTA 3QUBA 1IFXA 3I04M 3H42B 4X97A 2J3EA 3EF0A 4MITA 1US8A 2Z2JA 1RT9A 4PTZA 4DWWA 3MEQA 1DDGA 3TIXB 4HHEA 5CBPB 3REQB 3FUVA 4DQDA 1B73A 2XQJA 3A6GA 5LP6A 1IEXA 3FTQA 4LBYA 4DILA 1BMQA 1FE8A 2GKSA 4LSGA 4I55B 1O4VA 1MRZA 1NVFA 1AK9A 4NMMA 3FRJA 1QGAA 3HJAA 2AR0A 4ED9A 4YIKA 1LWNA 3CZQA 3LFHA 3V9PA 5F1YA 4CEJA 4JSTA 4Q05A 4TKVB 1Q15A 2ZRLA 5JR3A 3U7FB 2WYOA 2PZGA 1PQPA 2UV8A 4XR4A 3RVQA 3PLRA 5AQEA 3U3ZA 4A6PA 5IS2A 1HO3A 3W3ZB 4F4HA 4EB0A 2HCJB 2GDJA 3FBTA 3QUQA 4D0SA 5I7HA 1NVXQ 3GT0A 3RIXA 2XCQA 1H1LB 3WQSB 2X5NA 1KJ8A 4PRKA 5GV8A 4WLOA 4BAGA 1R8SA 1FYXA 1JWBB 4BO0A 1SPXA 5KOHB 5ERGB 1T9DA 4B35A 3JQCA 1BDJA 1SZCA 3OT4A 1UZAA 4ER7A 4C0KA 4YS6A 1PCXA 4UHHA 4HAOA 2XBUA 2VDJA 3D7LA 3WGGA 3F97A 1NGSA 3FRIA 3O4JA 5IC5A 5AHWA 4OHOA 4EH1A 3TNDA 3OU2A 4P54A 1C2YA 2QD1A 4QOJA 1PQUA 3F49S 4R54A 3LFUA 4EA9A 2EG5A 3CWZA 3OZBA 3HN7A 3N2GB 4MEJA 4OB7A 4OSEA 3ITDA 1M54A 3PR2B 3SLKA 5AD1A 5LDDC 5GIPE 5J43A 1AQ6A 4DQXA 3AO0B 5A03A 3OPYI 5JISA 3AHEA 3TVDA 2CL0X 3JU3A 4EHKA 3T41A 1TOAA 4RLHA 5FBVB 1RVV1 1M7BA 1O8CA 2OBBA 1P7ZA 1DIRA 2ORVA 3ABQB 2II6A 4O63O 2C98A 1M1XB 2BW0A 3PG5A 2PS0A 1FP1D 2P1ZA 4MWCA 4ZMBA 2HSZA 2YCBA 1V5GA 3WKEA 2YVLA 2CLKB 2QUBA 2CSUA 1SHZA 3UHAA 4JEIA 1JYFA 1WMSA 4W5WA 2ZVPX 3G2IA 4GRAA 4PFSA 4ALIA 4B3GA 3TCNA 3JX9A 1VJRA 4HR7A 3NDPA 4QOSA 1NOJA 4R5HA 4YC7A 2WY2D 4ALJA 4B31A 4WY5A 5DM2A 3KIPA 2VL7A 3DD1A 2Y9PB 4L4YA 1GGKA 1X8KA 1GZ7A 1B1CA 2NXWA 1JHVA 4HTAA 2BTEA 4YMIA 2XH8A 5BT8A 1G16A 2R87A 4K88A 3F3MA 2QYHA 4H15A 4WBNB 2CDRA 3RUAA 4CE6A 3QHPA 3GLKA 1S96A 5T4HA 4MULA 1JQLB 1O6CA 2PVCA 4RCVA 1MTZA 3L9WA 2EP5A 1ZCJA 2B1IA 3F8WA 3E9QA 2KLBA 4YP6A 1GM5A 4ZT7A 1SCIA 3H1FA 3KVOA 3X1KA 4MUYA 3NV7A 4L72A 3H5IA 3IO3A 1A76A 1QK3A 2PY6A 3A28A 5HDBB 2WP8J 3VTFA 4PM4A 5HMMA 4IGKA 1PS8A 1T3TA 1H9BA 1RLIA 3HXLA 5D1HA 5ES3A 5JPIA 3UENA 3ZU5A 3ZWCA 4DRXB 3PYMA 3AVVA 3ILSA 4H7HA 2WIJA 4MCAA 1ZSVA 3FAZA 3W34A 4GECA 1JMVA 2A1TS 2OQRA 1GPH1 2VT7A 4MUNA 3T34A 3A0RB 4YRRA 4KQGA 3NTRA 5GV7A 4RORA 3OBBA 1JU3A 4ETNA 2HPZA 2EZ4A 3LHFA 4O5OA 3FB1A 4B32A 1HFEL 1PR6A 2X5OA 1NNUA 5HYVA 3NBKA 4JJFA 1UFQA 4UULA 3QELA 4GZ3A 4YY3B 4N18A 1N3BA 3WB1A 4G0XA 4W7HA 3EIXA 2XYPA 3PE6A 4LZWA 3CUEF 4A73A 4BVLA 1LGYA 1SVKA 3GFOA 2Q5JA 2IYTA 4MP8A 2B69A 3SOPA 3TWOA 2NN3C 3TM5A 1QHGA 4HZIA 5KPJA 1V39A 4LYEA 1QG6A 4RHXA 2HSJA 4BMZA 1VYHA 5LYJA 2AA3A 2XD4A 4LOLA 1YQEA 2O2IA 4BNTA 2GASA 2VBCA 4IGEA 3Q3CA 1QF6A 4AS1A 4KQIA 2IU4A 3A4LA 3B85A 2HGSA 5G02A 2P9QA 3K09C 1TDJA 5LQDA 1XDUA 2BE9A 2RGXA 3ONDA 1QAMA 4P4LA 4V02A 4QG7A 4S12A 4E51A 3U16A 4JY7A 4TYPA 5HS6A 3V1YA 3DBOB 4DCGA 4G09A 1XCMA 1K8ZB 3MT7A 4DUPA 4Q4HA 2YIVX 4D4IA 1EHIA 3OJLA 3S2IA 1SHKA 1HLPA 3NT4A 1O57A 3D59A 3P0RA 5BW5A 3GJXC 3CFYA 3BJEA 2XNHA 4FBLA 4MQFB 4K9SA 5BPFA 4CL2A 4FT4A 1WXWA 2YHUA 1R9MA 1BFUA 2WOJA 4ENWA 5HF9A 1QG4A 1SPBS 3ABZA 5LQAA 1R4AA 2R44A 2WLTA 5K99A 4WN9A 4DXDA 1C4OA 4L4ZA 4LVCA 2IZ7A 3SMQA 4BZPA 1JDNA 1HBJA 1QYVA 2VRNA 3O3OB 4TWAA 2Q5OA 2ICAA 5CT4A 1JLRA 2OUKA 3IEXA 2TYSB 5EVCA 3RFUA 5AVVA 2CUNA 1VP3A 3WZ2A 2PL3A 1WXQA 2PWYA 1T25A 3NGMA 3GLHB 4BGEA 3KQWA 3W1EA 3TZLA 3FGZA 3MTBA 5FUXA 3CLHA 2VNAA 4FJ2A 5JROA 3Q7EA 3A6LA 3BWCA 1I6LA 1Q0UA 2VLIA 2YJNA 5BV7A 5K9ZA 2QTFA 2XMPA 1N6RA 3D6MA 3KOUA 2IHJA 1NN5A 3JQFA 1UMDA 1XN4A 1KVTA 3G02A 1FJ2A 1PJ2A 3W79A 1F2UB 2FGKA 2DECA 2FWJA 1EFVB 3TXXA 3UW1A 4RTSA 3IUQA 1MD9A 4P4GA 4P3PA 5C4MA 1UPUA 1Y3BE 1WIWA 1KDTA 2JJ1D 1MVOA 1RHMA 4GXRA 4RYDA 3DEZA 2AZ4A 3GXBA 3T35A 1Q14A 3HVHA 3WLOA 4CXMA 3O4FA 1KOJA 3PZRA 2Q1SA 3M6LA 2CLCX 3ECSA 3B78A 3FSRA 1W4RA 3GX1A 1KEKA 1TEZA 3LKVA 4KN8A 4YRGA 1GPLA 4IDEA 3O3CA 1TZKA 3LQ2A 1AHHA 3K6JA 4R9RA 4X1IB 2HQRA 3GJQA 4QQ8A 2FOIA 3PT9A 3GLIE 4G0NA 2A9OA 2QQ5A 2VEOA 1XZAA 2ZW9A 5T3UA 4H7JA 1NL3A 1JAZA 4UTOA 3S27A 3T3EA 3VC1A 4A0SA 4DDTA 2B20A 1U5AA 3F5DA 4ZV7A 5ILQA 2FPGB 4FIZA 4WUTA 3HJFA 4XPIB 1A98A 2P5SA 2WIBA 2FFHA 3LK7A 3WIVA 3DYIA 4QUJA 1DBRA 5BORA 3D8HA 1NX9A 1JRLA 4O4HF 1E2NA 4DIKA 1YQGA 1TEVA 3AB7A 2KLHA 5B2ZA 1GNTA 2VHJA 5FWYB 1BHSA 1JBQA 3EA0A 2CUZA 1E7RA 5F9FA 1Z4JA 4ITVA 4GGMX 4KIUA 1W47A 1GTMA 5FIUA 4B75A 1P0CA 1VPLA 3MD9A 3A4TA 2O8NA 1PTJC 2F9MA 1TC2A 3L93A 4PZZA 1B6SA 2BHTA 5IEJA 1NLYA 1Z6GA 2WA2A 4URHA 3WGQA 1SBZA 3K94A 4XWWA 1RJGA 5I3ZA 1M6VA 4FU0A 1SHLA 2JGEA 3E5HA 3H2JA 3LZ6A 2VHTA 1QE0A 4RNDB 3DBRB 4OQNA 3BE8A 1BWRA 5IHPA 2AC7A 2X13A 3F9RA 5ICMA 1LPOA 4B9AA 2DOKA 2FXIA 1HC7A 4PLCA 3C5HA 4UASA 1PL8A 3QVJA 5E6SB 5TMBA 1EH5A 3ABRB 1LS6A 1AQNA 3WJ2A 2CKMA 5FPPA 2RE8A 4MYTA 1VB3A 3WOVA 3DPSA 3W3AA 1VL6A 4RKYA 1ZM2A 3RCBA 3BSSA 3J7AC 3K9FC 1YO6A 1ZL2A 4D9CA 1FXUA 3MBKA 1RJFA 3FD8A 5ALLA 1G21A 5ISMA 3HKEA 3LPCA 1G8AA 2C9DA 3AF4A 5F5XA 4KYTA 4JI8B 4OHRA 1VYUA 2XB4A 1LNSA 1I6KA 2BFEA 3P94A 3T1NA 2X4GA 3NJ8A 3Q8WA 2I6FA 3CCCA 5IW8A 4E5SA 5IG2A 3K70B 3KQPA 4ZQBA 3U4GA 5IM4F 4K5QA 3HCFA 4TUYA 4ZDJA 1VSBA 3NDIA 4U2FA 3K6RA 1YK0A 3IPAA 3Q8LA 5BSTA 2H1SA 3VGPA 4EECA 3JVEA 3ZNNA 1AS3A 3BICA 2IEYA 1JB1A 1ZJWA 5H9VA 4H60A 4NARA 1CY2A 4S05A 2W2TA 2HA5A 4N82A 1XXHA 2Y1DA 4TV8F 4YI3A 3HG7A 3T1VA 4W9RA 3T9BA 4GU5A 2W6NA 1XO1A 2W8ZA 2H48A 3G0OA 4M21A 3JQ9C 4M1WA 4FNGA 4PIPA 5EOVA 3RVLA 3T5BA 3T95A 2I2FA 3CSSA 2VDNB 4IQ8A 1QGZA 4JDPA 2ZTLA 3ADBA 4MS1B 5K3AA 4EIWA 1FDVA 1AH2A 4NBVA 4NNJA 1G5PA 1ZH0A 1WM1A 1VYTA 4RABA 1NDQA 3RO7A 3W3AD 1OTYA 2OFFA 4BWGA 2CK3A 2M6SA 4WESA 3DFZA 2C82A 1IHXA 1U2QA 4L07A 5J40A 1XZLA 4F91B 3QLEA 3MFQA 4MUGA 4BS9A 2CL7X 3I1IA 2BJWA 4DW8A 3HM2A 1DVRA 3KJEA 4KVAA 5G4KB 4CKXA 2QL6A 4JXJA 4AJJA 2O7NA 3TJRA 1PHRA 4ARZA 4EEZA 1VQ1A 4OHUA 3G5MA 4IO1A 4NU0A 2AJLI 2H29A 2H85A 2FR8A 3DXYA 1V5IA 4DAEA 4F8YA 4U9IS 4H0CA 4ARAA 2BGGA 1K3UB 1R9NA 4FQ8A 3HHPA 1YI1A 5AW2A 2WOOA 3L7YA 4DIBA 3BXOA 2ZXUA 2G7MC 2VXCA 4W7IA 3CUWA 4BUZA 1NG1A 4ITRC 3ZC3A 2FB9A 1WZ2A 2O54A 4TROA 4BO7A 4MINA 3CN7A 5EHGA 3ZQ4A 1T2UA 3IILA 3K4HA 5EKTA 2ZIXA 2ZYVX 1EWKA 5D87A 2V6MA 4EZIA 1TM3E 3SZ3A 2FGJA 4DV2B 2NV2B 3NX4A 4KOAA 2XZTA 3OQ6A 4MV4A 2MYNA 2O14A 1QUFA 3KJGA 4O0MA 4DQKA 3HDYA 2XMBA 4J3JA 3TUJC 4WXPA 4B7ZA 4GR4A 4FX2A 4J2OA 1BGXT 4EA7A 4ZI7F 4BGDA 4TTIA 5AK6A 1EVJA 1P2UA 3KK0A 4L75A 5IT4A 1SC1A 1OASA 1UJBA 2W6ID 2QENA 3BFJA 3KWLA 1VGVA 3GD7A 4M0MA 3SC6A 1E2EA 3KVVA 3T7JA 1Q7GA 1FZTA 3RLFA 2PFSA 3HJCA 3CTMA 1S2GA 1KFBB 4ZMRA 2EKZA 4B7AA 3KQSA 1FSFA 1KVSA 1MO2A 4G4JA 1NULA 3O1JC 4ZI2A 3O4RA 4I99A 3G2LA 2XOKD 4E6EA 4H7DA 4OA5A 3TIIA 3HVIA 4CM6A 4QGGA 4B2YA 3GN1A 1O08A 2O8VA 5FOQA 3BTSA 4IIUA 3AG6A 3OOWA 4MLPA 5G0TA 1SOAA 3O5AA 2H0QA 4XIIA 1X14A 4ZYVA 4E5PA 1U3TA 2HJSA 5HSGA 3DAGA 1CHDA 3MS7A 2BEWB 3K1JA 4JP2A 3RU3A 3KE9A 3VO9A 4EJSC 3OJXA 1I0IA 4ENQA 5IULC 3WB0A 2XQKA 3MRTA 2BIFA 5EZSA 3IQEA 5HEKA 2FN8A 3DHWC 5LD2B 3E9NA 1M3SA 1F12A 4MQEA 4KPEC 1POXA 1SVUA 2HIAA 3ESCA 3IDQA 5AVQA 1W44A 2C95A 3UMMA 3WLNA 3ZHZA 4TMXA 2IYXA 1IOZA 3L0PA 2V03A 4X60A 2QVBA 1YE3A 2BH9A 1E62A 2QX9A 3ZQKA 3UEOA 3CV3A 2PX3A 3ZGXA 2NZ8A 3V8MA 5AKYA 1NYQA 2OK8A 3KJHA 4MYSA 4R2JA 3TI7A 1E2GA 3GLTA 1MF7A 1KIFA 2NO7A 1SOUA 1V9SA 4QRDA 2F3RA 4CG0A 1MIOA 4ZI5A 3AFIA 3UANA 1TTQB 4WY8A 1EEHA 1UDRA 4OPMA 3ZD8A 5FI1B 1TJ4A 1H2ZA 1QH1A 4LGMA 3VV2A 2D5LA 2BY4A 4M1TA 4F2GA 4WNCA 1S7GA 1NMEA 3GROA 5T6MA 4DY6A 1H3NA 3RSLA 2CZGA 1T13A 3AOEC 3MWKA 2PUCA 2A5GA 3PQCA 3PDIA 4MR7A 4OREX 521PA 4JOQA 4C7BA 2XGJA 3PDHA 3V97A 1ZXBA 1QG2A 1KYIA 1RTTA 1JPVA 1U98A 3P96A 2NUBA 4X1YB 3WYBA 2RGEA 3HA3A 2MR5A 3N05A 1QO9A 1IUKA 5FA6A 3P0HA 5HRAA 4J0CA 3R9KA 1L8XA 5TRTA 3FCUB 2B8NA 4EY8A 1DTEA 1CEYA 5BN5A 1PV1A 2DF8A 1GRCA 1OLSB 3P0JA 3KQVA 1XG5A 2BM9A 1SXHA 3MCVA 1SO8A 1A88A 1D0VA 4YR7A 4BN5A 3RUFA 3SU8A 1BDMA 4XDZA 4MO2A 3WSWA 5I45A 4IRMA 3OLCX 3D6AA 1XWWA 5CLLA 1G42A 1YRBA 4GYJA 3W6UA 2V5AA 2VH1A 3T7EA 1ADFA 4AQ7A 4NU6A 2I62A 5E3IA 3B9QA 5AJYA 2JAPA 1Y6RA 3N9IA 2JVIA 3TQRA 3RF7A 1NNSA 3PPWA 3A9UA 4FDTA 4OKNA 1HPLA 2E4XA 2G6BA 4MR9B 3EMDA 7GPBA 3KQNA 3NIDB 4WKNA 4R68A 1J06A 4JLAA 2G9UA 4NECA 4RF5A 4JU9A 4X94A 4ZP1A 3MWYW 5H70A 5B3AA 5I9MA 1KJNA 4UJ3A 3TW8B 1FRQA 1HMYA 2EZ8A 3HCWA 4B45A 1M2NA 4MDYA 1CUSA 2ZRQA 1HTBA 2DY1A 2C4HA 3JQ8A 4O3FA 3BXEA 1XJ5A 3CZPA 1LZLA 1VZ2A 3QX9A 4OSOA 1EWTA 3SR3A 1T1SA 3P9CA 4B80A 3VR3D 2PR7A 5KCMA 5DH9A 2NWQA 1UKZA 4NAUA 2CC2A 3SBOA 5JSUA 3FVQA 3P32A 3QIAA 1AC5A 4PX3A 4PYJA 4HGNA 4R40A 4BUJA 3WB9A 5BNIA 3LY9A 4A9AA 3BKXA 4YWHA 1VE6A 1X8JA 4UDXX 2R1VA 1X1TA 1W0KA 3NETA 2YJ5A 4K6MA 3QXGA 4YNBA 4A91A 1TZCA 4TM7A 5L4LA 1SHTX 3SICE 4LX0A 3L79A 5ESWA 3CONA 5MFPA 5FA5A 4DMLA 4D42A 1ODTC 2KX7A 1EX9A 4UMDA 4LPSA 1NBAA 3T3DA 3A1CA 1Y5MA 4FB5A 1KKMA 5BWCA 1O0SA 1WD5A 2EP8A 1JEEA 1DIBA 2QQGA 2DE0X 1R8JA 1WHSB 2G9QA 3FCCA 1IY0A 1T8YA 2H6EA 3IURA 1JECA 1KEUA 4Y9SA 4E1AA 1XMQB 4L5YA 3W0LB 1IXSB 1THGA 2Q9BA 2YQZA 4FHGA 2I54A 5GOTA 2FP4A 4GRIA 5DT2A 4FGUA 4C0BA 3QVMA 4LZZA 1XXHB 2WIGA 2WKSA 4GOJA 3W6ZA 2IEDA 2XZLA 2W8BB 3TOCA 1J2YA 3I01A 3GLGB 4JBIA 2X86A 1XK6A 4RUKA 2AWNA 3EBPA 5E38A 2ECPA 1M76A 1YIDA 1RC1A 4OOFA 4EPRA 2C7BA 2J9FB 5BYKA 2BR4A 1BXRB 1YB6A 5JXHA 1SNYA 1TYAE 2P91A 2XOXA 4KIWA 3M2PA 4KMRA 5K0ZA 5LPNA 1AG9A 4MOWA 3R40A 4HGZA 2O6LA 1KYQA 4O4LB 5LCXA 3CNHA 5ALZA 1W5AA 3SYNA 2WSYB 1WDLA 2QN7A 1WKBA 1NXXA 3O9ZA 4M99A 2EBUA 3H13A 1C0EA 3JW8A 2FZ4A 9ATCA 3F2VA 2BMVA 1DAGA 1X77A 2JD1A 2H9YA 4H35A 1M8GA 2DCMA 4QUIA 4RADA 3TZBA 2ATVA 2QLMA 1U0SY 2IYSA 4EG7A 4Y6GB 1ZONA 4RXUA 1NATA 1YS2X 4WDQA 5DHAA 4B48A 1ZHOA 5BVGB 3I42A 3AF0A 1RHRA 1A4RA 3EWIA 4E08A 1IN4A 2Y1GA 3ZHQA 5FX2A 2UUBB 1USGA 1EXDA 2K7FA 2KE5A 1UJ2A 4B4KA 5KYXB 4PCUA 3U7HB 3QWFA 4KDEA 2H07A 4QKQA 1XNJA 2PWZA 2CFOA 4O2BF 2MSEB 3C97A 3MCWA 4CMIA 4ZV4A 1UK6A 3BIJA 3IVXA 3PNKA 3SZOA 1RYZA 4BO5A 1QE5A 4QBHA 4TYQA 1G6Q1 5JNWA 2ZR7A 2GM5A 4M3NA 2FZGA 4F38A 2QTWB 2VNHA 3UK7A 1U90A 4KB5A 2PUHA 3DWGA 1Q11A 4U02A 3VAYA 1N5RA 4GRDA 4CEJB 2R9VA 4BAUA 2X9GA 4UAJA 4DNXA 1RP1A 1SUBA 3DVQX 5AI4A 1GRNA 3L84A 1SN7A 3DOCA 1FW8A 4S2EA 5LMCA 1AKQA 2WFLA 2O7QA 2RHMA 4OGLA 4B5LA 4E13A 5B12A 2O2SA 3D54D 4DT1B 4EG3A 3K6SB 4TYMA 5B3LA 3T61A 4EJSA 2PX5A 3DCNA 3X2FA 4U39A 5B4UA 5JSQA 1GWNA 4GEGA 4QGSA 2GN2A 5A4MS 4AJ4A 1M66A 5CFOA 3QMWA 2UXDB 4QDXA 1LI7A 2BL4A 4RFVA 4DUYB 1T6YA 2MSCB 5EMNA 2EYQA 5KI6A 3IP7A 3PYLA 2GAIA 2YHBA 1P0MA 4MWZA 5DI9A 1U1IA 3T7RA 1NVVR 2GLXA 4RPGA 4AYTA 3GFBA 3ZY4A 2PKEA 5CGQB 1M8FA 1ZZGA 2GTPA 4J6FA 4KQCA 2CLEB 1ETHA 5FNVF 5GM2A 3CQ9A 1LS1A 4RA9B 2JATA 5JS6A 4A8JA 3OUZA 4C7MA 2HDHA 3ZWOA 3F5QA 1XCPA 3MVEA 2GHTA 3EBLA 1HFKA 5F1KA 1AURA 2Y77A 3BX1A 1OKKA 2VTVA 2YYYA 5LOVB 4WFIA 2W2MA 1U11A 4UVIA 3A58B 2YDXA 3GMDA 3D3WB 2HDWA 3BN3A 2ZG6A 2BFBB 3NP9A 5FNVB 4R8KA 2DLNA 3B1XA 2D4AA 2WV7A 2XUZA 5EEGA 2YN2A 2YR0A 1HYGA 2GEUA 1SEVA 4TV9B 5DP2A 4Z7OB 2H9IA 2VDWB 1B2RA 3JQRA 1J0EA 3DKVA 4EGFA 4IIXA 2IYWA 3R09A 1X80B 3EVZA 4HDSB 1YWGO 3TGWA 1DADA 2RH4A 1G0NA 4FGSA 3QOFA 4ASUA 4E5DA 1FRVA 3ISTA 1L8QA 1RM4A 4EGSA 4CM4B 2VTBB 3PUIA 3AZPA 2FEWB 3FR8A 1ISSA 3N28A 1ZCZA 2ZDHA 4INJA 4CRWB 1Y81A 1DRJA 1KOFA 2BKLA 2IT1A 4ALMA 1ID8A 2GN0A 1Z34A 2QE6A 4GI3A 2RI6A 1Q5PA 4LRTB 4B79A 4CKWA 4AKIA 3ZCVA 3IJRA 2CHVA 1KRXA 4OHCA 3N2GA 3ONNA 3M4NA 3EQ8A 4AJNA 4O4IB 1LDNA 3FZYA 3KXLA 1CWUA 2OPBA 4B3BA 6PFKA 1VOTA 3B2QA 2R8RA 4MPRA 2WF5A 1XBTA 1LDYA 4D9MA 4WH0A 4J94A 2WZBA 4FEEA 4L78A 2QG9A 4G41A 1XQVA 5B6PA 1VSQA 5IK2A 3J81k 4K9OA 3U7GA 4FFLA 2GEVA 3JQGB 1J8YF 1WTCA 4OFXA 5IMBA 4YCMA 3AI7A 2B3DA 4I9GA 4X1OA 3M3DA 3NOXA 3VUEA 4EL5A 4B85A 1DWUA 1XUOA 1VLQA 1YOVA 4CV3A 3HWWA 4BJHB 1CJTC 4YPVA 4DR3B 1AGYA 1V1RA 2CDNA 4R8LA 1Q44A 1WEKA 2IV7A 4D4MA 3RC9A 3ZWWA 1RAIA 3KR1A 2B30A 2ZSFA 3TD2A 3UJ6A 4RW0A 4FEAA 2ZJ6A 2RJNA 1K97A 4LNAA 3N59A 1AUQA 1TAGA 3UKJA 2J4FA 1ULSA