2H4WB

Crystal structure of human caspase-1 (glu390->asp) in complex with 3-[2-(2-benzyloxycarbonylamino-3-methyl-butyrylamino)-propionylamino]-4-oxo-pentanoic acid (z-vad-fmk)
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
88
structure length
88
Chain Sequence
AIKKAHIEKDFIAFCSSTPDNVSWRHPTMGSVFIGRLIEHMQEYACSCDVEEIFRKVRFSFEQPDGRAQMPTTDRVTLTRCFYLFPGH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title An allosteric circuit in caspase-1.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords Caspase-1
total genus 15
structure length 88
sequence length 88
ec nomenclature ec 3.4.22.36: Caspase-1.
pdb deposition date 2006-05-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1470 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Caspase-like 2h4wB00
1PAUB 2QLJB 3QNWB 2H51B 4ZVUB 1BMQB 5K20B 1RWXB 4ZVOB 2QL5B 2QL9B 2FQQB 1RHUB 1QDUB 2H65B 3IBFB 3P45B 4LSZB 5IC6B 1RHKB 3D6FB 2Y1LB 5IC4B 1ICEB 3R7BB 2XYHB 2QLFB 3R6GB 2HBRB 4ZVQB 2CNLB 1SC4B 4ZVRB 1RHQB 1RWNB 3D6MB 4ZVPB 2DKOB 4JB8B 1RWOB 3SIPB 2QL7B 3KJNB 1NMEB 4ZVSB 2C2ZB 2HBYB 2C1EB 2QLBB 2XYPB 2HBZB 3IBCB 1GFWB 1RWKB 3KJQB 1QTNB 1I51B 3GJQB 4DCJB 1RHJB 1RWPB 2H48B 1IBCB 3NS7B 2CNNB 4DCOB 2H5JB 3R7SB 1SC3B 3RJMB 2CDRB 3R6LB 2XYGB 1RHRB 4ZVTB 2XZDB 3R5JB 2CJYB 1SC1B 3P4UB 1RWWB 1F9EB 2HBQB 2CJXB 2CNOB 3D6HB 3KJFB 2Y0BB 1I3OB 4DCPB 2CNKB 2H54B 2H4WB 2C2OB 2C2MB 2H5IB 3GJSB 1RE1B 3R7NB 1PYOB 3GJRB 2H4YB 3EDRB 3GJTB 2P2CB 3EDQB 1RWMB 2C2KB 1RWVB 1RHMB 2XZTB
chains in the Genus database with same CATH superfamily
1RT1B 4LF2A 3NKYA 3TW0A 4ANCA 2W4DA 3NBPA 4ETZA 5EDWA 2MGZB 3BPSP 4DUZJ 4DV1F 3GYGA 2B9YA 4G6VB 5A6WA 1B99A 3M8PA 2AJFE 2RQKA 3O3LA 3VCDA 2VG5A 3JTNA 3PKYA 3E01A 1RISA 3POTA 4ELUA 1VYAA 3KK3B 2XMVA 5B0GA 4Q45A 3EPIA 3X3UA 4WIIA 3QJJA 4UOCA 4AUKA 1CVJA 2L9NA 1R0CB 3OR1B 1SIZA 4F25A 3V4IB 1F9FA 1RT3A 2G9OA 2NYIA 1JQGA 3IBFB 1R6YA 2E9TA 4OX9F 2WVEA 2ZBCA 3CB4A 3UN2A 2SXLA 4I7FA 3H4BA 1GXTA 2IIHA 4LT6A 4MH8A 3KOAA 2UXDJ 1MG7A 5BJRA 2HRYA 1UPPA 4DR5F 1DURA 3MOZA 1KP6A 4OI1A 2MQOA 2JC1A 1NK7A 6FD1A 3K5NA 3I56S 3OFGA 5HMXA 4DR1J 2PI5A 4EI2A 1UWBA 3MM7A 4PEOA 2X1GA 1GQEA 3KNGA 4RR5A 2CQ1A 5KFNA 3R1HA 3NNHA 4K4SA 1T3NA 1Q95G 1FKOB 1U26A 1JB0C 2GGPA 4O4GB 1RZMA 3VGSA 3G4SS 4L73A 5LOQA 3MCMA 3QWUA 4DV1J 1RTDA 1B0VA 3MEGA 3JAMY 4JV2A 4JI8F 1JK9B 4WP3A 5A2QY 3QSYB 3L09A 4I2PB 1KQFB 1LW0B 2GIFA 1FRXA 3IR6B 4WJBA 1RU2A 3JSRA 4RKUC 1VQYA 3SSSA 4CDIA 2BKOA 3TP2A 5J1EA 5LSRA 2FJAB 2BQUA 1ACMB 3PYDA 3H42A 4PWWA 2EFNA 4X66J 3TANA 1YJ9S 2LMIA 2WW4A 1KVKA 1M0SA 1YWXA 2ZVSA 2W4PA 4WFXA 1S1XB 5T14A 1WKLA 3GONA 1D3WA 1UJ5A 1YSJA 3OJSA 4DR2F 2VFTA 4UOHA 4F04B 4JI2J 4N76A 3MAAB 3K57A 3OL9A 2RD5C 4NPOA 3JXOA 3NNCA 4DL2A 4P73A 1XEZA 2FZCB 2QLWA 1FRMA 1RWPB 2LEBA 5KG7A 2VBWA 3IAM9 2W2OP 1Y7PA 2LYVA 4KT0C 3CXCR 3J7A1 2LQBA 1B64A 3AXMA 1LKZA 1CJKB 1XJWB 2DRDA 2DISA 1SC3B 3PEJA 3RAQA 2D3OR 2UUBF 2EBEA 2LEAA 2OAUA 4QOTA 1T03A 4FKXA 2BR0A 3PKMA 2ZH7A 1RAFB 3H20A 5IQ6A 1V5IB 3DGVA 1WEXA 4DX7A 5IV3A 2XTJP 3FZ2A 4LBHA 1UA0A 4H4MB 1SL0A 4QYRA 2QMXA 2MHNA 2CQGA 2HK3A 1VK8A 3VQTA 4DQSA 4DL6A 3QGGA 1NJWA 5HLFB 5H9FK 2J76E 5THWA 4NZ6A 1G6BA 3KTQA 4DR2J 3RUBL 2E7VA 4A47A 2RF2B 1NB2A 2AEJA 3W2VA 4DJBA 3W8PA 1FJEB 1KSPA 2XG8A 2ZEJA 1LWEA 1BQNA 1WC0A 4K2JA 5KFGA 5HL7Q 5AE3A 4L6V3 1HWIA 1R3NA 1Y00A 4PPZA 4F02A 4FBUA 2B3TB 2HNDA 3R5AA 3VWSA 3IC1A 2E5GA 5C7PA 5E7OB 4DS5A 3RBDA 4JBCA 4LR7A 3CDBA 3DLJA 1SQFA 2HS0A 2EVZA 2M4MA 3DU6A 4I6YA 4LFAJ 4HYKA 1OQ6A 4A8KA 1TZ0A 3DLKB 2HVIA 4B3OB 1VJWA 3QLHA 4AXJA 1RHMB 4CO4A 5HJYA 4K5SA 4P74A 2QZ8A 2GVDA 4G1QB 3R2DJ 1VQSA 1TK0A 4ZVHA 3QNWB 4HHHA 3CJ2A 3KYLA 4GKJJ 2ZD1A 2XSFA 3VV2B 1Q5YA 4FYWB 3PRBA 2AW0A 3ZTSA 4I67A 2EFQA 2OEJA 2WK4A 1W2BR 4DR6F 3TEHB 1SKWA 4PUOA 2WRMA 1ZH5A 4DR7J 5KT5A 2Z2LA 1SIWB 4PWDA 3MPUB 4Q2LA 1RHUB 3QIPB 4QWCA 1QDUB 3GIKA 2M8DB 2MSTA 5DM6Q 5EUHA 2D3ZA 2K2PA 4OV6A 3JYTA 5DQGA 3Q8UA 4E8UA 2R4FA 2DNKA 2XMJA 3D6FB 2P6TA 1IUJA 3TX0A 3J81j 3J7YU 4NX9A 1UMJA 3ET6A 1BQMA 1FK9B 3CO0P 3P8BB 1ZM4A 3CCMS 5JVGQ 1C0UB 3LGHA 4LR8A 2E44A 2BYCA 1P27B 3MOJB 4K4UA 1F60B 3HVTB 2FJEB 3QGIA 4JOUA 5AXKA 1KQKA 1T9YA 4C11B 4ZLJA 4RBTA 3DLEA 1Y5NB 1APSA 4K7QA 3M30A 2M2BA 3HT0A 4LSLA 3R3TA 5HP1B 1O5JA 1KWMA 1K0VA 2JC0A 1KVIA 2AEMA 2DRAA 4HHUA 2V67A 3W1YC 2BVZA 1T03B 2AJ4A 2C2NA 5GMKa 4C8LA 1N32F 2DKOB 2B7CB 3CCSS 5KFZA 4PG6A 2JDJA 2I2YA 2R7SA 3VGUA 2J9CA 2QFIA 4DR7F 1M5SA 3KJVB 2B6AA 4QIEA 2VDHA 1P9YA 3R9LA 3QIPA 2IJRA 2DGQA 1EP4B 1KEKA 1SJ3P 4USVA 3FFIA 3TAPA 2M5YA 2KFNA 1HPZA 3DMJB 3V4MA 3OBIA 5LMUJ 2UP1A 1JLBA 2HNYB 1JKHA 3L7PA 4RW8B 3KXDA 4WTYA 1NPRA 3ET6B 3R97A 3PJXA 3ZNJ1 5HAOA 4ENOA 2FLPA 4IR9A 1MSWD 1KVJA 1GAOA 2YWKA 2JLEA 5DG9A 2BOAA 3RZAA 2R7RA 4J9LA 4USMA 1GEHA 1Q82T 3LTOA 5GMEA 3KK1B 1IBCB 2E1RA 3T3FA 4LFCF 3KLIB 4ZPCA 4CLKA 3MM8B 4DQRA 2GA7A 2UUAJ 2V0NA 5D6GA 1C1CB 3OXFA 1HQEA 2HHQA 4KH1B 3GIIA 2DNOA 1EX8A 3IR5B 2J7UA 4I7FB 2CFXA 5B0AA 2DCUB 1AZSA 3QT6A 2LA6A 5LSLA 2CQCA 1NSPA 2F4FA 3EVMA 1WEZA 1SC1B 2E29A 1BQNB 2J6UA 4WKRA 2WBMA 2DNYA 4NMXA 4OX9J 1H98A 1RWWB 1UETA 4WFNQ 1I1GA 2BW2A 4A48A 2V8HA 3JQKA 2AIRB 1N5SA 1ZAVA 2VG5B 3PRVA 5L38A 2ZKUA 4X62J 4DSEA 2DH8A 2FUG9 3QRRA 3D6HB 1Y3KA 2AYEA 2P9EA 2G0CA 3LGNA 1FXDA 1KN6A 1JLBB 3BKTA 2NQPA 2DNGA 2FJBB 2X3DA 3IWXA 1OMSA 5MLCV 1FTRA 2YNIB 4P71A 4PG7A 4DBQA 2H5IB 2HURA 1U24A 3ETMA 1RTHB 3QATA 1WHYA 3K58A 1H38A 4JYAJ 3K2YA 3TA0A 4TYAA 1B0PA 2GC8A 3IS9B 3D9BA 2ZITA 1ZYQA 5GADI 1ZM2A 3N5FA 5GAHI 2F8EX 2U1AA 2RAQA 1OPZA 3TJ9A 2LVWA 4OHYA 4X4NA 2E9ZA 3HMJG 1U7LA 2MDAA 1XTZA 3FEYB 2VPXB 2Y1RI 3PX4A 4QCLA 1XBWA 4GO5X 5J1NA 4ZJOA 4J9QA 3UD3P 1PAUB 1FRJA 2Z30B 1HBMA 2XBPA 3AQPA 4ECRA 1VRTA 2DNLA 3KUGA 1JNZB 2OPQA 1YVFA 2BE2A 3FGVA 4IOBA 2RRBA 1TV6B 3MPWA 2XI2A 4X4SA 3BBFA 1GX5A 2M8HA 4OZNA 4QIVA 5M2RA 3SMZA 1VR6A 3UDVA 4XDCA 4ZVOB 1C0UA 4OI4A 2MSSA 4W98A 4TQRA 4WK3A 1FK9A 3M2UB 4B9LA 3Q8VA 3VF0B 2E1PA 5D4NA 3A8IA 3P45B 1H2UX 1TL7A 4X4OA 3VAGA 1S72S 2LDIA 5HROB 2AJQA 1HBOB 2ZWOA 3DLEB 1F3FA 2UUBJ 2Y1LB 4NLOA 2NXUA 4RW7B 1RT6A 4LMZA 3L3CA 3CIMA 2DGOA 5ETKA 3N6LA 2JLGA 2Z56B 4RBUA 1B3TA 1G1XA 3EPGA 1H7WA 2DIVA 2NXCA 3MAAA 2VQEF 3IWNC 5ETMA 2YPYA 2HZAA 3NXZA 3KMQA 3M6UA 1UWBB 3MM7B 3D1HA 3KLFA 1EARA 2OD4A 3QO9A 4FPIA 2EKNA 3PO4A 4IH6A 1OY8A 1X4BA 4PQUA 3AOBA 4MK9A 4USIA 5B0EA 4CP5A 2QC3A 1U6FA 3SIPB 1FE4A 2OPPB 5DZ6A 4L72B 3TA1A 4A8YA 4IG3A 1WJ9A 4IFVB 3PR4A 3BGRA 4OHXA 4P10A 3VAHA 3DHWC 4LIWA 2QT7A 1GMVA 2QLBB 5C42B 1X4EA 2ZBRA 3MAHA 2PEHA 3M8SA 4G65A 2ZHOA 4HT7A 5HK4A 1DZ5A 2GVDB 4G1QA 5B0CA 4CCHA 2DYAA 3CJ5A 4CO3A 1M1HA 3KJQB 1XNRF 2LQ9A 4Y2IA 2C22A 2WTFA 4FF3A 1URRA 2EEYA 1AZSB 2G4BA 4KKOA 2HQ3A 2H48B 3NGTA 3US5A 2RQCA 1N34J 2G0IA 2ZHBA 5F8JA 4QIFA 3BS9A 5CD4A 4ZJQA 7AT1B 2MZSA 2GFFA 3GILA 3AFGA 3P96A 1M5VC 4GO7X 1FI4A 3LALA 2C42A 3DKDA 4YB7A 5DRKA 3KK3A 3JB9k 2BM0A 4WFAQ 3D67A 3PJ9A 3SQGA 5CA5A 4ID5B 2ACMA 1KD1T 1J5EF 4DQIA 2DY9A 4P72A 2VB6A 3FUYA 1IBKF 3CF5Q 4KO0B 2CJYB 3RB0A 4OYIA 4Q43A 3AODA 1WSRA 2EKYA 2OHDA 2DEJA 3AD7C 3D7SB 3MEDA 3CCTA 3ZZRA 4C97A 3KK2B 1KLMA 1RU1A 2YH1A 4JI7F 3DNCA 4H4MA 2QFJA 4M5DB 4WE1A 4ELTA 4LQ3A 3DLGA 5FJ4A 2W7OA 1PAEX 3NOCA 1RLDA 2HW3A 1NNDA 4U67Q 3H5SA 5KFXA 2R8IA 3HCXA 4JUZA 1SL1A 4LBIA 1FWPA 3OTOF 5HBMB 4K4TA 2C2OB 2J5AA 4ZIVA 2VOOA 5LXYA 2HNZA 4A8WA 1AT1B 4YP3A 3G8SA 1URNA 2QJ3A 1SCJB 3Q2SC 3P3DA 1S7IA 3IXQA 4P2XA 5HMZA 1UVJA 1HW9A 1TL7B 3OSNA 1IKXB 3ISND 5CYQB 2D7SA 1TKDA 2DCLA 2O66A 3LW5C 1TKXA 2BJ9A 3FDSA 3Q8YA 1RWUA 5E3AA 4EU0A 4JV5J 3VGTA 5B08A 3OR2B 4DU7A 3FSXA 1DFDA 4B3MF 1M5KC 3KLEA 4DV3F 4ECWA 3TAMB 3DRPB 5ETQA 4CT9A 1U1PA 1U2RA 4JI8J 2JLFA 1MMLA 1FF2A 1EETB 1TUWA 2OGUA 3MM6A 4IKAA 2AZ3A 2RUSA 3TJ8A 2QMUB 2O67A 3MEEA 2UVRA 1TUGB 2VPZB 2AZ1A 3A8EA 3CEDA 4EBDA 3QSIA 3IBWA 4C8YA 3O44A 4FPRA 2MZJA 1FKAF 1QUPA 1KR4A 2QRRA 4KQZA 2POKA 2OPSB 3UD5A 3MFIA 5IS2A 4LSZB 1WF1A 2YNFB 3SCJE 1TL3B 5DGBA 1VS3A 5D3GB 1JLEA 3OL6A 1M1GA 2KL8A 4O4GA 3IS9A 2MJUA 3PXGa 2V4QA 3AD8C 2IDLA 2ZC3A 4A4JA 3SDEA 3E2EA 4OJ1A 5M2UA 4AL5A 2CG8A 4F50A 4C7QA 2P9GA 3HM9A 2QLFB 5DGAA 2D41A 5GADU 1FRHA 5K14A 4TU8A 3LWMA 3QLHB 4KGZB 1YJNS 5D8HB 2HVEA 4ECTA 3T6JA 3UPFA 1AUSL 3CD0A 4TY8A 1U1KA 1CG2A 4DSKA 4XIUA 3W9IA 1TUVA 3KLHB 1ZBTA 2Y3YA 5B7WA 1S59A 1QAXA 1WG1A 2QMWA 3J80Y 4OHWA 1H3DA 3OFEA 1VDHA 2MZTA 2MMYA 3HVWA 3WBZA 9RUBA 4X4RA 1PC4A 1V9OA 1GTEA 1D0EA 2OTLS 1PIEA 2LU2A 2GMHA 2H9ZA 5HQMA 4B17A 2ILZA 4D3GA 2MPUA 3DM2B 4NRTA 3ILOA 3LP0A 3QJLA 3Q22A 2VG7A 3HD2A 2B5JB 2NS1B 4DV4F 2HVZA 1RA6A 4LRFA 2XHWA 4MT1A 1T7PA 1B70B 3ZZ0A 2GZOA 5AJ3F 2VONA 4JYAF 3RRHA 1U48A 2YKMB 2W9AA 3GG1A 1F5AA 2DBBA 3VVUA 1Q78A 1X5OA 3HJFA 7FD1A 4RX6A 4OJ3A 5ETRA 2CJAA 1NEEA 4QW8A 1WDDA 2YWWA 4I56A 1T3OA 2V68A 2XMKA 3CDAA 4J7CA 4I2QA 3CJQA 3M32A 4FBTA 1SJ1A 5IV4A 1NBEB 2APOA 4HTIA 3UO0A 3DOMA 2CWXA 3EZOA 1FFGB 4RW6B 4P2SA 2OFHX 4ZN3A 4JV1A 3FSYA 3C2PA 4I69A 2LXFA 4DG1A 3OPKA 1F1BB 1HNVB 3HSDA 2BJDA 5EWEA 2L48A 1HKAA 5B09A 2F7VA 1JJ4A 2BA9A 1KQGB 3ELHA 2HNZB 4NRUA 3TAMA 3H2VE 1S9GB 4M5NA 3W5ZA 2W8LA 5HBMA 2N3OA 3OR2A 3M05A 4DPYA 4RW4A 4PYDA 1B4SA 2HBQB 1UP1A 3M30B 5KFBA 1FKPB 1R0AB 2PSZA 2YWFA 2IM3A 1X4DA 2W01A 3AB2B 2C3PA 2H54B 1WC1A 5C25B 3VAMA 2AF6A 5G4DA 2WVDA 2VA2A 5DLFA 3WC0A 1RE1B 1KTVA 2CQBA 1F3VA 1HYSA 4J9KA 1XIQA 2KJVA 2RVJA 1R6VA 2KVQE 3CD7A 3G71S 2CUYA 1N33J 2W7AA 1SH3A 4OFZA 3QFWA 1A0OB 1HW8A 2RS8A 1D8YA 1FCAA 4DQQA 4F4XA 3Q2TC 5KFJA 2QIFA 2XHCA 3MDFA 1PYTA 3D1OA 3HZEA 3PYEA 4WWSA 2IAJB 1FWKA 2XZTB 4GC7A 5KT7A 1XK8A 1FX4A 1DARA 4YHHF 2IM1A 4DUYJ 2AGOA 1OIAA 3TUIC 5FLXU 4ZLLA 2IA0A 3JTOA 4ZVUB 3PIOQ 1HI8A 4GVBA 2D3UA 3IGVA 2E5LJ 4I6AA 2HFNA 4NCAA 3PTWA 3MUMP 4A8XA 3U7JA 2IM0A 1HR0F 1U1QA 1YITS 1UW9A 2FQQB 2I1RA 3ZZZA 2IRXA 2NPFA 1R89A 1U25A 2IRYA 3T41A 3NNAA 3HULA 3BGRB 2WSCC 3TZXA 5EWGA 3KHGA 1YJ7A 2IC3A 4YDXA 1NHUA 2ALYB 2R7OA 4IQMA 3HSZA 2LP4A 4IRCA 1ZOTA 3MGJA 3UVJA 3EVWA 3MD3A 2C3UA 2EBGA 3GG0A 3QIDA 4MAKA 5K8NA 3RG6A 4C8KA 2R7WA 5KTQA 3BZQA 4RNNA 3Q24A 5L1JA 1VQLS 1RKJA 4NLQA 4V19J 3LAMA 2ZM6F 4ZN1A 4AD6A 2ZH8A 3BO2A 2DR8A 4ZVRB 4IRDA 2DD8S 2CPZA 3DRPA 2EXUA 4BCAA 2VASA 3CDUA 3X1LB 3I5CA 2XNQA 4DUYF 4ED2A 4PPDA 2MTLA 3FFIB 1M1KT 2PD1A 3AY0A 3JSYA 2V8DA 2QA4S 1WUUA 1RBAA 3CUNA 2HQIA 2N7CA 2R2RA 2WB4A 3G6YA 4OQJA 1HD0A 1IKXA 3CCQS 3GFZA 3TZZA 2O3DA 4QR1A 4C3LA 1XWLA 1S4FA 2YKPA 4GC6A 2RNEA 2CQ3A 4WYWA 4OX7A 2F40A 4LF9F 2PC6A 1R0AA 4RZRA 3HFVA 1FJ7A 4OYPA 2ZE2B 1Q8KA 3ISNC 4O23A 1OYEA 5BYSA 4QIGA 2XY6A 2DH9A 1MU2A 4L76A 2DVIA 4RNHA 1UW4A 3MMJA 3PACA 5EX3A 1JJ2R 5ETVA 1IBMJ 2A1BA 3D3BJ 4RW9B 3BQ2A 4ECZA 3HX9A 3T1HF 3DC2A 4F0HA 5DQIA 4NA2A 4LIRA 4ERDA 1D09B 1G3OA 4ZHRA 1CJUA 1AUDA 5IT9U 4HLBA 2HFVA 3TQ1A 4J9NA 2XCPA 2AQ4A 1S10A 2YTCA 2PMWA 2Q43A 1NPKA 1X4GA 2ZE2A 3FC9A 1UCNA 3QQCD 5AE1A 5KT3A 1R8PA 1S1WB 1K47A 1W25A 3I6PA 3E51A 2A6MA 3ITHB 4BWMA 3TRGA 1X60A 1TK5A 2YQ1A 1IKVB 1UKUA 3A3OB 2YY3A 3DFEA 3DGPB 5KOXA 4N8OA 2YKAA 2KJWA 1RGVA 3LP2B 5KFUA 4R5PA 3I4HX 4LF6F 3W60A 1T05A 4USTA 4EO6A 1TELA 1W7WA 4KTQA 5F9LA 6AT1B 1EJ7L 2J9DA 4NLRA 5K8OA 2N4CA 5ETSA 3PYGA 4O0NA 4QPXA 1BQXA 2UXDF 3QJPA 5K8PA 4X4TA 4X4VA 4ZOSA 2DK2A 1P9QC 2ZD1B 3MMCB 2QSFA 3QT8A 4JI3J 4ID5A 3K59A 2YKNA 3CE8A 4AXIA 1M5PC 1S79A 2KXFA 2EG1A 2FVQA 3MWBA 4L3KA 1NU4A 2F65A 1WD6A 2NXEA 3OHBA 3IRWP 4ZVFA 1OQ3A 4J9UE 4HL9A 2GAGC 2B8QA 3CGIA 2XS2A 2XWYA 1WHWA 2Z4PA 4Y2CA 4NOHA 3G8TA 4PXCA 2CJKA 1VRQC 4TLQA 2KHCA 4ZS6A 5J1PA 1QTMA 2VQFJ 1UVMA 3A1YG 4ZCIA 2F5GA 4CLYA 4EZ6A 4B3SF 2RILA 4NWBA 2VBYA 2QV6A 2YKOA 3FSIA 1F0XA 2V94A 1NM2A 3PRDA 5CD4H 4CTAB 2CKWA 3CW2C 2DR9A 1ROFA 1JXLA 1PG5B 4M5IA 4ZPBA 3OXLA 3C6TB 2ILYA 4QQBA 2NYHA 1YQHA 2A2CA 3I31A 3W2WB 4C3KA 1KFDA 2MLZA 5GAGU 3PV8A 2GNKA 1YJWS 1X5PA 2EFPA 5CXTA 2FLOA 1XQIA 2XZWA 4DPOA 4JI5F 1VQNS 2P6SA 3QWPA 4KPCA 4ED4A 2QL5B 3NMRA 4B3RJ 2DTJA 2W9BA 4KYZA 4M5GA 3HPOA 1VRUB 4O44A 1RTIB 2B6AB 1NK4A 4ZPTR 2CQDA 2YX1A 3V81B 2RRAA 1NPPA 2QYCA 2JZ5A 1YBTA 1RBLA 2BW7A 5CYMB 5CYJA 4C8MA 5H1SV 2ROEA 4J90A 1NJYA 4LF4F 4USWA 2D74B 3SXLA 1JKHB 2HNYA 4RW8A 1XMQF 3BR9A 4KR0B 4RNOA 5A8WA 1ZA2B 2VU5A 1CJUB 1NAQA 3QPIA 4RO0A 2MJNA 4A8MP 3RW6A 1T95A 2B4VA 5KOWA 1WF2A 5H9FJ 3BN4A 2UU9F 1IR2A 4EBEA 1ZAWA 2CDQA 5CYQA 3S6EA 1IBLJ 3DLLQ 1S97A 5KFEA 4CLWA 4K0KF 4H4OB 4ZPAA 3TJAA 1IKVA 2JX2A 3T19A 1JMTA 5A8WB 4X64J 2ALZA 4V1Ak 1J5EJ 2QEXS 4ECXA 1NDLA 4KHPJ 1TU0B 2RS2A 1K1QA 2V2VA 4OIXA 3TAQA 1LFPA 2DITA 1C1BB 3CJRA 2ASLA 1IVZA 4HI2A 1SV5A 4DL0C 4OL8A 4WP9A 5GMDA 3TZWA 2ERRA 4JI5J 2CYYA 1SVDA 4UY85 5DM7Q 5A8RB 2RU9A 4DFPA 3IP0A 3PW4A 3DXBA 2LA4A 2C1EB 4GVLA 5D0HA 1L3SA 4B3TF 1S76D 1Y11A 2RRNA 3U1LA 4KSEB 1TVRB 2KN4A 4CLSA 2FJVA 2BJ7A 1HHQA 1HBUB 3D3CJ 1L3VA 1UWAA 4MIWA 1QTNB 4BC9A 4EFAC 4KHMA 5DDPC 2KM8B 1VHFA 1IJFB 3RR7A 1S1UA 1U49A 3GJQB 3SV3A 3KHLA 1NKCA 1R43A 1ZTTA 4ED6A 2CJ9A 3GB0A 1TMJA 3NGRA 2XQCA 2ZOMA 1IM6A 1FFSB 3L4BC 1SKRA 4GKKF 4RUHA 1L5UA 2YKMA 3WIVA 4MFBB 3HXMA 2ASJA 3HI9A 1T9TA 2IHR1 1RCXB 4TN2A 4DR5J 1YKWA 4JV5F 4JI0J 3H7HB 3Q23A 1K1SA 2RU3A 2XYGB 4MK7A 1Y5IB 3BGLA 3LP0B 4KGXB 2KB2A 4IYQA 4DS4A 4KHPF 1TL1A 4DWIA 3KUHA 3I0RA 3DI6B 3M2VB 4OYBA 3GLJA 2K8GA 2NUHA 2HVHA 3C6TA 3GV8B 2KYZA 3ZZOA 5FLXY 4Z2XA 2O1PA 4C8NA 1JJHA 2AWZA 2W2MP 3DDIA 3FEZA 4HVZA 2JJ4D 5J2NB 4LREA 5K9FA 4HEA9 5C42A 1FT8A 3DI6A 3G86A 1S1VB 4OI0A 2BKPA 3QBCA 4MIBA 4F36A 3G6VA 4ZKAA 4DL7A 1SH0A 5AE2A 5MAOA 2FVRA 2CQPA 2A0FB 2RMLA 1V3RA 2P9CA 3EICA 4WXOA 4ZP6A 3H4DA 3SEOA 3DOLA 2V4JA 2MXYA 3LWLA 4DR1F 2QX0A 1HBNB 1HQUA 3FZBA 5ETPA 2W2QP 1H0HB 2A3JA 4YS2A 5I42B 3IFEA 2CADA 3EDQB 2V5HG 3KDNA 1CJKA 1RWVB 3M8RA 1TFYA 3M8ZA 2A10A 3R5DA 2HQCA 1QSLA 1K0TA 4NLXA 4OZ2A 2IYGA 2LQ5A 2L9WA 1NJZA 1IBKJ 2C3YA 2GHVC 2ZNZA 4HR2A 1LW2B 1JJCB 1HBOA 5E3RA 4EUVA 1VJQA 2V9WA 3HKZD 2ZH2A 4RNFA 2KU7A 2OMLA 5CAAA 3QFHA 4WFBQ 1KDNA 2HQDA 4USJC 2YVSA 1S9GA 1C1BA 4O3RA 2J7WA 1R27B 3AH6A 3BKFA 4X66F 2XLJA 2R7TA 2GJFA 2PGCA 1TQLA 2QL9B 2W2NP 3ISZA 2JOQA 3J7ZT 4O3SA 1HYSB 3KG0A 1NDKA 4RL1A 4DSLA 2E1MC 5ETTA 3ZTRA 4LFCJ 1P1TA 1TTHB 5KFFA 2A2DA 2X3GA 1V6HA 2X51A 2C3OA 4FYVB 2AJ1A 1ZM9A 2XY7A 1GX6A 1FVQA 4EO8A 3NRBA 3FEXB 2YNGB 4CYUA 2VKRA 4U7UK 1AXQA 3I55S 1DQ9A 1HL6A 4WFYA 3WX8A 4TYBA 3DOKA 2KO1A 5LXRA 3HHLA 4UUWA 5I4MA 2PFFB 4I68A 1RTJB 4IFYA 5BYQA 3ULHA 4RBVA 1SC6A 2GX8A 1RHQB 4F4ZA 1S6QA 2L08A 2CRLA 3QT5A 4WYLA 4KV8A 1TKTB 1RAJA 4KBIA 4UTGA 3SZ2A 4NXMF 4GMKA 2JEFA 3BKUA 4YQWA 4JB8B 2KZZA 1WTBA 3L95X 3TQEA 1AFJA 2OLWA 2D9OA 4ECVA 4Y2MA 1XC9A 3MZIA 1RTDB 2LECA 2GMJA 2HQFA 2R3VA 5FIIA 3THTA 3KJNB 3RAXA 3Q8PB 4KFBA 2PA3A 3V4IA 3QAEA 1PBAA 2D1CA 2ZKTA 3WZ0A 2D69A 2WAQD 3JQMA 2Q6CA 3K8VA 5K8MA 4MKAA 2VQFF 4DF8A 2X1FA 5B0BA 2RHQB 1VK3A 2OSRA 3GZ7A 3KG4A 4GVBB 1E6YA 3MMCA 5KG5A 2XGPA 1U45A 1VOMA 4EYHB 2UVVA 3WQPA 3D0GE 2B5JA 3N9UC 1PYSB 1U1LA 2AV5A 3EJMA 1YG0A 2BMBA 4OJGA 5KG4A 5EGYA 4E98A 2VJVA 4Q8FA 3HZGA 3OUYB 3MUTP 1WC3A 4CLTA 4OJHA 1S57A 4KGVB 1FX2A 2MZQA 2FVCA 1YJRA 1AW0A 4X65J 1CJTB 4NXMJ 5T7LB 1KTQA 1VQ5S 2OTJS 4NMLA 2NZCA 1OSDA 2FD2A 3O1LA 1IQTA 4ZPVR 5AXMA 1E6VB 2ABYA 4J9VA 3TVKA 5LM7E 3J81Y 4AL7A 4B9UA 2ROPA 2MLXA 4K2XA 1H74A 4FVMA 4NEYA 2IDEA 2J6SA 1ZS6A 4OX8A 2HMIA 4OI2A 2J9DE 4R25A 1UA1A 3P6YC 3B6BA 2UUWA 3A8KA 4I0WA 1UVKA 4NLWA 2BANB 3DGPA 4B3OA 3RBEA 3F41A 2XMUA 4FXDA 2ZBPA 3ICLA 2QGFB 2DHXA 2RHSB 1IXKA 3OTBA 4K8RA 1FERA 1HWJA 2IY5B 1X9SA 5C25A 4N8NA 3Q8QB 2MQNA 1PYOB 3PCOB 2XMAA 3SCIE 1GNKA 3R1LA 2H4YB 5I3UB 1DY3A 3EDRB 3R27A 2XY5A 1U0HB 2XSJA 1NKBA 3W66A 1MROA 3ZTOA 4Y0FA 1IKWB 1RT5A 4Q8EA 1UVNA 2Y9HA 3D4JA 3HKWA 2GQ2A 3MR2A 1NLKL 2UUTA 3VHQA 4FF4A 1IJEB 1HQ2A 4GRSA 1DLOB 4ZA1A 2HWTA 5F0WA 4ED7A 2UUAF 3N79A 1N0UA 3UW1A 2I38A 5J2MB 1O0PA 1VISA 3QZ7A 4DV7J 2GQCA 3G96A 2VHGA 2KRRA 3BM7A 2YNHB 4ALZA 2HQGA 4DPWA 3V2UC 3DDNA 4C0HA 5LJ3Y 1XNRJ 3ZTQA 1C4AA 4ICLB 4C3MA 4DFKA 3DLBA 4J9SA 2U2FA 1TL4A 1N5VA 3MM9A 1PCAA 4FXWA 3AT1B 3KNAA 1JXEA 2GIRA 3BH7B 1RQ0A 1FKOA 3CT9A 4ZVGA 5IWAJ 3D2WA 2OD6A 3K5MA 3ENVA 2Y0SD 5IC4B 3L7UA 2G1HA 3R7BB 4AQYF 2XYHB 5HQ8A 1N33F 4BLGA 4IOCQ 3R6GB 3KHRA 2UXCF 2KG0A 1OS5A 2JEIA 4QZVB 2ADCA 1VQ6S 2B4OA 1IWGA 3RYLA 3M6XA 3GCWP 1SC4B 2Z57B 1FNXH 3CD5A 2VV5A 3ZO7A 5J2NA 1QSYA 1CJTA 1NJXA 2HHHF 4OV1A 2VFVA 3PY8A 1RK8A 2G0JA 4OYZA 4PXEA 1S7HA 3TYTA 2GV1A 3C8YA 4M5MA 4WTOB 1MMNA 1SUQA 1RWOB 1RT4A 3LPEA 1TL1B 4NLTA 2X1BA 3A3PB 4J91A 2DNRA 3J80U 5F9NA 5F3TA 2JWNA 1WTFA 2JHEA 4MKBA 2Z2YB 2VBZA 1NMEB 2FZGB 4Q2MA 4IO9Q 4CLUA 1VGYA 4UOFA 2AJ0A 2XYPB 3IGNA 2M0GB 3LF0A 4NYZA 3VR1A 4DSJA 1PILA 1RT7B 1GXUA 2I6WA 2BOPA 3MD1A 3FVYA 3W9JA 1C2PA 1MWYA 2MHEA 2MKCA 3IG1A 1NUEA 2KG1A 2L9DA 1JNRB 3UN5A 2MZ1A 4EBCA 2G13A 1I51B 1RAOA 2B4PA 3UCZP 3RBXA 4X64F 1VI7A 3OQ2A 4HKQA 4AQYJ 2BACA 3I0SB 3V6KA 2QO3A 1T94A 2F63A 2OPSA 5D4PA 3HD1A 5K5MA 1S4EA 3JSBA 2N82B 2Q3PA 3K89A 2X7IA 3K5OA 2UV8G 4EMDA 2IYIA 4EEYA 4CRJA 1QY7A 2C28A 4C2MA 1EAYC 5HROA 4B9TA 3SI8A 5B0DA 2C2DA 1ZZFA 2XZDB 3IM8A 3CCUS 1JX4A 1L3TA 5HJXA 3IA0A 5D78A 5AXNA 2WONB 2B9XA 4NZ7A 1CBKA 5DJBA 3RBZA 2HGNA 3PO5A 1GXLA 3I82A 4B9MA 1Q0NA 1F9EB 2WZ1A 3D1QA 4W4MA 4DHVA 1A9NB 2MQPA 4LUBA 4F67A 4P9SA 3H40A 3BB5A 3A13A 3V6JA 1LW2A 1SQEA 4CM0A 3N28A 4JI4F 3CJKB 3IAS9 1I3OB 3DRYA 1F9HA 4DCPB 4R8UB 3R2CJ 2Z2ZA 2KFYA 3IG1B 3QYYA 3ZFVA 2PI4A 3QRPA 3AJ2A 1ZETA 3D28A 1DTTB 3AOAA 2LLZA 4KJIA 1G7CB 3C15B 5KG3A 4CH7A 2BZ2A 4PQUB 2D9PA 4KHRA 5ETOA 5GAHU 2R9LA 1N5YB 2IVYA 4DL3A 1HI1A 4IDKA 2KT5A 3OT9A 3MHYA 5SUHA 3BQ0A 3BV8A 3CTRA 2ZBIA 2VQEJ 1LWFA 3HHEA 1NB7A 2GGPB 4LF7F 3PNIA 2KFZA 4ED1A 1X5SA 2ZBQA 1KFSA 3SV4A 3Q8RB 4PWDB 4ZVEA 2GO9A 1T02A 5ETNA 4CNZA 4K0KJ 4C0OC 1RUSA 2QLJB 5RUBA 1X0PA 3TI0A 1BD6A 2E1CA 5FDLB 1X4CA 4LFBJ 2BJ3A 1S9EB 2FJDB 3CJ0A 5GAEI 2OKQA 2VG7B 1HQUB 3EE3A 1BMQB 3AAWB 3CJ4A 4J37A 1Q8IA 3D6TB 3T6BA 1BY9A 4EGLA 1WOOA 4CQ1A 2HIYA 3U02A 4PCQA 1Y4ZB 1LQ9A 4Q7AA 3BR8A 2FHKA 2LCWA 4KFBB 2CPIA 1CSJA 3BYPA 4FF1A 3O5TB 3IMQJ 4ES2A 2AX1A 2HHUA 3GSIA 2HHTA 2WVFA 4P75A 2R2SA 4TY8B 4YY3F 5F8MA 5E3QA 1Q81T 1ICEB 4XAKA 4X65F 3WX4A 3TWZA 4DDFA 3KHHA 2HKEA 1ZAXA 1ZPWX 5KFKA 1NSQA 3KLFB 3OTOJ 4PXDA 2GVZB 5HVGA 5IM0B 4DV5J 1ZM3A 3T1YF 4KB7A 3IRXB 3SDEB 1S77D 1EIYB 1ELOA 1FNOA 2RKIB 3JSMB 1AROP 2KXHA 2M52A 3AD9C 3PZPA 1WACA 1U6BA 2LQ8A 4IG3B 9ATCB 2FVPA 3D6MB 2CZ9A 2XEXA 1T0TV 2DNPA 2ZZMA 3ZZYA 1X31C 1VIXA 2LEPA 4ID8A 3UCGA 3CC4S 1TAUA 4A46A 1H6KX 4A8QA 1TKTA 3RGIA 2RQMA 4U7CA 3PX0A 2CQ0A 4B3MJ 1X9WA 4BBYA 4Y65A 3VAJA 3Q86A 5E0OA 4LF8F 2N4DA 3TR5A 1DLOA 3PYFA 3M6WA 4FS1A 1UFLA 3KLEB 2HAFA 2K06A 4OZ0A 2PMHA 4NXNF 3PW2A 4USHA 2FGOA 5EHHA 1RT6B 3LAKA 1YLXA 3QAUA 2ZH3A 2K3IA 3WHIA 2QA1A 4QWEA 4C8ZA 2IMOA 4D3HA 4NA1A 4YHHJ 4C6AA 1H72C 1PJ5A 3BQ1A 1JIHA 5KFLA 2K3KA 2CNNB 1LEOA 1NK0A 2H5JB 4F3MA 2OI2A 2VC1A 4DPUA 1REVB 3CIZA 4HACA 1JLFA 4QWAA 4ECSA 4IR1A 1EKSA 1U47A 3TVYA 2ZH5A 3F56A 3IR7B 3WC2A 2V50A 5J1EB 4WZQA 4QR0A 3HP6A 1QAJA 2DHAA 2DHSA 5I3PA 3VZHA 1QVGR 4ECYA 3NL0A 1SB6A 4DXLA 2OSQA 5D4OA 4I4BA 2QTWA 2YPZA 1RTHA 3LA0A 4WK1A 1W26A 2UUCJ 3SFGA 3FBEA 3U27A 2BE7D 5U47A 1FO1A 1S6PA 4PG8A 2F8HA 2MZRA 3HHLC 3TUJC 3CCVS 1TMMA 3JTPA 2BJEA 3RB3A 1SXLA 3W2WA 1NCLA 5IQQA 2ZZNA 2Z58B 4PWUA 4NLYA 3TOQA 4NXNJ 2YWEA 2OH2A 1DQAA 3CCLS 4DV4J 5IT9Y 5HVFA 3P5TL 2EFGA 4PABA 2J0XA 2OPRA 1SBRA 2VFSA 4OYWA 5F41A 4UUXA 2FZKB 5C24A 2G2YA 3VTIA 3TUZC 2O5DA 3C19A 1Q86T 4YOEA 1SJ4P 5F8GA 1AYEA 2ZUAA 3KG1A 5A0YA 1GTHA 3D54A 1JLCB 2JL9A 2P2CB 1FJGF 1H2VZ 1S1TB 3IO1A 2OPRB 4ED8A 2R8GA 1TKZA 3MR6A 2PEBA 3I87A 1CC7A 2AD9A 2RH3A 3NS6A 3GYXB 2CZVC 1HLWA 4N41A 4M5LA 2K1RA 3M8WA 5A2QU 2DNQA 4NLPA 3VAFA 3MMAA 1S1TA 3AB4B 3BDPA 1QJHA 1VC0A 5KAKA 5A0YB 1U6ZA 2G2ZA 3EX7B 1Q79A 1Y9OA 2KT3A 2MKHA 2VH7A 2WCXA 3N6NA 1RWXB 3NEKA 4OLPA 4N47A 3S8SA 2BUNA 2WVCA 5KG6A 4JI1F 3PFEA 3M4XA 1C1CA 1KS2A 1NHVA 2HVDA 3WIUA 4RU2A 3C3LA 4K4VA 1EP4A 3MM8A 1D1UA 1RCOB 2CZ4A 2H65B 3BGUA 3N0VA 2Y1IA 1N52B 2MKJA 1NSKL 1NZ8A 1XNQJ 4DEZA 2WB1D 3BN7A 4JI6F 2VOPA 4IDKB 1RBOB 3Q83A 4O4RA 3OVSA 2J8SA 3BSOA 3ILJA 3HHDA 1KOHA 1T11A 2JEJA 5KT6A 4M5HA 3QGHA 2VD3A 3CDEA 2Z0GA 4H4OA 1DQ8A 1MROB 2DXFA 1Q8LA 3CJKA 3VALA 5JJBA 1YX2A 3BBCA 1FKPA 4PQAA 1YRUA 1F2HA 4BHQA 3K8WA 2H1YA 2JEGA 1VQMS 2M7SA 4H4KA 4LJMA 3RB6A 1HHTP 4Y2AA 4HDHA 8AT1B 2B7BB 1JLFB 2LKZA 3OTEA 3ZZUA 4X62F 4QWDA 1ZTWA 1T8EA 1CLFA 1CS4A 1NDCA 3NGDA 4NASA 5D0GA 1BUXA 4Z37A 1XR5A 2GAHC 3N5BA 4P7TA 4WIQA 2ZH9A 4CH1A 2AGPA 1VBZA 4K50A 4WF9Q 1MNEA 2NXJA 4C8OA 4OZJA 2MKKA 1SL2A 4O0IA 1RTIA 3L9ZA 4DU8A 3ETOA 3W61A 2IFXA 2RDIA 3O8WA 4UW2A 4USUA 3MTKA 1KHVA 2HBZB 3MEGB 2E5LF 1C0TB 4DSIA 1A6LA 4MK8A 4RUBA 1HWLA 4QYZK 1PGZA 2MQMA 3GCXP 1RKIA 2MY7A 1F5BA 1JWWA 1S1XA 4CO5A 2ZH6A 4DFMA 3I32A 4NLSA 2FC9A 4C9DA 2HS3A 4K4XA 3ADAC 4DCJB 4JP8A 2ADBA 1VBKA 2RIJA 1IN0A 3RAMA 3AQOA 2G1DA 2Q79A 3BH6B 2NSBA 4DX8H 5HN0A 4CTAA 3CCES 3RJMB 2FJXA 3NY0A 1Z2ZA 1VQ7S 2IVMA 2V2QA 4NL5A 2LU1A 1RAHB 2IC3B 1RHRB 1FRKA 5HI7A 2ZH1A 4AFFA 4B3RF 4U7UD 5FD1A 4UY8T 2DGUA 1IKYA 3U1NA 4MYUA 1Z2LA 3DRXA 3OL7A 5JXSA 1O51A 5IZHA 3OSPA 2CJBA 2VIHA 2VG6A 1RAEB 2XI3A 2YX7A 1I94J 4AYBD 4N5SA 4M94A 1EKRA 1HR0J 1S9EA 3AJ1A 1N32J 3M8YA 2WOMB 2W25A 2VPYB 3E3XA 3RW7A 4B9VA 4Q0BA 5KFRA 1WNEA 1TP7A 2DGVA 3HHNB 2DB1A 2OPPA 3SFUA 4W90B 4URSA 2UU9J 2KTQA 2W9CB 3OL8A 1DHMA 2FHJA 2FY8A 3W2VB 3KJVA 2V63A 1TL3A 2RF2A 5D3GA 2ZC4A 2F3JA 4N56A 2HFOA 1GMWD 1KHWA 2HYIB 3HVAA 2BXJA 1S1WA 4J9MA 4ZITA 1NJIT 2M70A 3QGPA 4RUAA 3T1HJ 3CJ8A 2BRLA 1U4BA 4F4AA 2J0SD 2OEKA 4DPXA 3H5YA 1YI2S 4ZPDA 4JI3F 1RP5A 2OEMA 4P7VA 4DOZA 3MI7X 3KKFA 4WU2A 3H90A 3UR0A 4LF8J 1QAYA 5KFQA 2WSFC 3FQLA 5DO2A 5L1IA 3HVRA 5C5JA 1KQSR 3KLVA 3GV7B 2IBKA 4LVNP 1S49A 4HI1A 2C2RA 3FMWA 3TARA 4DR3F 1WWHA 4ILRA 3AHPA 3TA2A 1U1OA 3LOUA 4B02A 2DIUA 4YR0A 4WP8A 1CS4B 3OFFA 4O3PA 1YTYA 3D5MA 3I4PA 1KLNA 3UE2A 3BDEA 1GK8A 5L8RC 4ECQA 3CJTA 4DR4J 5HSPA 3S7RA 4F7VA 2ASDA 1WG4A 3Q89A 4ZMMA 4GKKJ 4QR2A 4R8UA 4FZVA 1SPBP 1VRUA 4O44B 1YIJS 3DCAA 2XS5A 3GR1A 3E8OA 3H5UA 1RI7A 4G1IA 1P8GA 1WORA 4P2FA 3UQSA 4DX6A 2VJUA 2A6OA 1KNZA 1FXLA 4X4UA 4F4KA 1QE1A 3TNVA 2XWXA 2IRUA 4ZVQB 3NAIA 3OD2A 2BE9B 1BQMB 1R7IA 4I6WA 3MMAB 4DX5A 4BS2A 1VBXA 2K1RB 1HA1A 1RWNB 3G6XA 3MPDA 1YZ6A 3NLCA 1MMDA 4I64A 4P2MA 4TVAB 3DOLB 5KFHA 3PW5A 4ZVPB 5KFWA 4ED3A 4IQXA 4WPAA 1U1NA 2HS4A 4RW6A 5HMYA 2GJIA 4KO0A 5CHCB 4LF6J 2YNIA 2KT2A 3SQGB 3MXHP 2QL7B 2NCKL 3GFYA 1UVIA 2RUGA 1SJRA 3ZXWA 2J6TA 4YN3B 5C24B 4ZVSB 3NS5A 4IUFA 3IN5A 1FDNA 1NO8A 2FB0A 2GHWA 2YQ0A 3I9ZA 1QVFR 1CC8A 1RAAB 3CCWA 2WBRA 4ZPWR 4ZIWA 2CXEA 2EPIA 2HRTA 2V8PA 3UVJB 1N36J 3N01A 3UDLA 2WHOA 4OI6A 2DNNA 2MKSA 2PIIA 4LSNB 1VCTA 4M8LA 4YB5A 3M8QB 1R8CA 4ZCMA 2PO4A 3NS7B 3NCPA 3CC2S 1UJ6A 3B4MA 3CSKA 2XULA 3PDNA 4KAIA 3HSJA 2Y8YA 4R5PB 3OTDA 1HARA 1U09A 2CDRB 3HT3A 1OY9A 3AXKA 3O2IA 4I1TA 5I3QA 2ZNYA 4KGKA 5AXLA 2ZDPA 1JLEB 2CQHA 4ZVTB 5KFAA 1VLOA 1KKHA 1NK8A 2PT0A 1NZAA 1WKKA 2YWHA 3ITHA 2RSQA 5GAEU 4TNOA 3W64A 2KKHA 1K8AT 4YMEA 5HANA 4DF4A 2GHPA 1HPZB 1FDBA 3PIPQ 1C0TA 3OLBA 2NSCA 2OUGA 3C16B 4CWBA 2NPIA 3KFWX 3PJWA 1T9WA 1G4CA 2CJXB 1EETA 1M90T 3CULA 2N3LA 1MW7A 1DJ0A 2CPHA 2CWKA 3HJVA 3UCUP 1X4AA 1PJ7A 2PA8D 3BSAA 3EGWB 4RWXA 1FA0A 3NMAA 2QA4G 1HMVB 3O6QA 4ILLA 1CEZA 2C2MB 3AA9A 4K59A 1F2GA 3GJSB 2DH7A 2EG2A 1T9XA 4ICLA 2OJ3A 2COLA 4HTJA 3J7AN 1U0HA 2JNJA 2XSJB 3EZUA 3OW2R 2AU0A 2HWIA 1WEYA 3TX8A 4KC5A 2BBEA 3FRYA 2HZVA 2QSWA 3MM5A 3UNYA 4ZLPA 1PKUA 4C11A 1GT8A 1YZ7A 5SZTA 1YK9A 1HNXJ 2MYFA 1YBAA 1ZPVA 4X4PA 2BEFA 5A8KA 1UJ4A 3DRRB 2FHJD 4KE5A 5DDOC 4YR3A 3M32B 4HH1A 2MQLA 1TKXB 5AJ3J 2W7PA 3CMAS 4MJKA 4WE1B 2KXNB 2I9SA 4JI0F 5H9EJ 3JYTB 4RJVA 2XO7A 2G2OA 2DGXA 2FPHX 3A12A 3K0JA 3GMGA 3DRSA 3PG9A 4ZP8A 1LW0A 4C98A 1WOPA 2XLIA 4FP9A 5DG7A 2OIHA 2UVUA 2AGQA 1VC6A 2H3EB 3DOMB 1WDTA 3FCWA 5D0RA 1B7FA 2CVIA 2HHXA 3T9ZA 1S6UA 5EWFA 2F4VJ 4PUOB 2IA6A 2FVSA 1VBYA 1WF0A 1LV5A 2V4JB 2UXCJ 3BF4A 1ULRA 1NH8A 2W1BA 4LR9A 3OR1A 3MTJA 1N6QA 4B3SJ 2I5JB 1L3UA 2HHVA 2WVBA 2ZZTA 3BBBA 4A8SA 3MECA 5KFIA 3ONQA 3BPDA 2QYGA 3GIRA 3L7OA 1TK8A 4NZ0A 2P5VA 8ATCB 4L3NA 3DLHA 1HNWJ 4Q0BB 5LMNJ 1EQ0A 4UQTA 2NUUG 2ZJQQ 3OVAA 2GCFA 2XCAA 1F6TA 3UFCX 5EN1A 1LK7A 4G3IA 3GV5B 2Q6BA 2XMTA 3DM2A 4BC7A 2B9EA 2I5JA 5F8LA 4FF2A 2HFUA 4LFBF 1Y0HA 4X4QA 4OYOA 2VC0A 1AFIA 3C66A 4NYPA 3WDOA 4X2BA 1OY6A 1CJVA 1RDRA 2KDOA 2O01C 2YKQA 4DV2J 1HHSA 3ZTPA 2QG9B 3H25A 1U1RA 1OJ4A 5L39A 4DV3J 2DPJA 2V4RA 2RE1A 1WKJA 2C2ZB 2NLWA 3OVBA 1CULA 1LXNA 2V9KA 4HH0A 5KG0A 6FDRA 2EWHA 2HRUA 1J5OB 5CCMA 1W2IA 1HNIA 1UEUA 2IAJA 5L9NA 4DQPA 1BE4A 3MM6B 4MYTA 1U02A 1UTAA 3S1TA 1RA7A 3N6MA 5KFOA 2QLXA 4ZJLA 2VDIA 5KFCA 3DMJA 2B9WA 1T9VA 2LXUA 4CT8A 1WC5A 3QZ8A 3RR8A 1AA1B 1FEEA 1H2TZ 4N7TA 1N5YA 3HSGA 4TU9A 2WONA 2BV3A 4KPYA 4Y34A 1I6JA 4R0EA 1X0FA 1U2FA 4KV8B 2KHDA 2ZDOA 3NGSA 7FDRA 5G0RA 4U6PA 3GWCA 3JS9A 1RT2A 3LGMA 3G8QA 2X1AA 1P6TA 1U2CA 3R5JB 4FS2A 2D3O1 2W2PP 3SSQA 3W63A 1O6XA 3UN3A 1I5OB 4DV0J 1QE1B 4DR4F 1HMVA 1TAQA 3AOCA 4NI2B 4DPTA 1N0VC 4A8FA 3N4WA 2FJWA 3EYZA 5HMWA 2NXNA 4QW9A 1NH7A 4NCGB 4PYAA 3HK2A 2B43A 2CNKB 4M63A 4ED0A 3HDSA 3MR3A 4XO0A 2FY1A 3MEDB 4LF5F 3AA8A 4I2PA 1WHXA 2I8EA 1N48A 3I5BA 2XO6A 3BO3A 4CLZA 4Y6IA 1UAWA 4TY9A 2FLNA 1IWAA 1YJVA 5BYRA 5BR8F 3PHEA 1TFWA 4I2QB 3DXSX 4URGA 5GVQA 2UZAA 4NA3A 2DY1A 4DZ6A 2J7KA 2FLLA 3OUYA 2GVZA 5IM0A 2PN6A 2LQJA 2LFVA 3KK2A 4DV6J 3CNQP 4H54A 5E3CA 2CAJA 3CCZA 1HNZF 1Y3JA 4LQ9A 2V8GA 5A76A 3K7RA 3ENWA 3SBMA 1E6YB 3T5LA 3T5KA 2MKYA 1RABB 5K20B 2HFZA 4CO0A 1U0SA 4K4ZA 4UF4A 1XMBA 2ZUGA 2NR0A 1S6OA 2DHHA 1LWCA 4RLEA 3I5AA 2DGSA 5IT0A 2FYXA 2E66A 2AT1B 3A3NB 4Z7YA 5L9XA 4CH0S 1IQZA 1HWKA 1JXVA 1SQGA 2EW9A 2V2KA 3MPYA 2B51A 1N5QA 2HNDB 1MWQA 1C4CA 1PSDA 1MN9A 1RSCA 4LF5J 3G82A 4M95A 1ZZNA 1B7YB 5JVHQ 2PFDA 2YBVA 1RTZA 3ENAA 3M6VA 2RT3A 1LWEB 3KLIA 3MCOA 2VUGA 4TXSA 2RB7A 3KK1A 2YKNB 1S0OA 1FJGJ 4CI0B 2GMLA 2BX6A 3T5HA 3D68A 1KOOA 1MWZA 3ZZPA 1S1UB 1YGYA 2BJ1A 2C3MA 1WC4A 2UXBF 2HHSA 4A8OA 2C2EA 2R8KA 1CPZA 3VAIA 4DV6F 3FBFA 2YWGA 4O3OA 2DPIA 2UVWA 4ILMA 1RB0A 2YNGA 4CYUB 1KRPA 4AE5A 1VHIA 2BQ3A 2DHGA 1T05B 5M2PA 1HFEL 2VBXA 1BWVA 2K7JA 1N88A 3EXCX 3GE9A 3GSDA 3LP2A 3CMQA 1R8AA 1IM4A 1FE0A 1WOSA 3DRSB 5A8RA 1S0MA 4LF1A 5I3UA 2XMMA 1N5TA 2YNHA 4C0BA 1S6QB 1UEVA 5E5NA 2QN6B 1WSVA 3KLGB 3RRGA 1KBRA 3CCJS 1GH8A 4FN5A 2GW8A 1UFWA 4IG0B 3PW0A 2DRBA 4NYOA 3IBCB 5I42A 1SKUB 3NWGA 3LO3A 2OFGX 1GFWB 4OMFG 2XM3A 4ZHRB 3MMBB 1TL5A 4FYDA 3BJYA 2R2TA 2DR5A 2AMCB 4J9OA 3FNNA 3LPYA 4CLFA 1TV6A 3H5XA 2Y1JA 2EC0A 1FFWB 2OPQB 2IVFB 2E5JA 3EM1A 5D77A 5ITHA 4XPEA 2RDDA 5G0RB 4CO2A 1OO0B 3Q8SB 1ITPA 2DO0A 4MIAA 1XERA 3KWMA 4B08A 2CQ4A 1S99A 4OZ1A 1D9AA 5EX0A 1E6VA 3J7Z5 1U8SA 1VQ8S 4R0JA 4U8YA 2CJQA 3G2XA 1DTQA 5CYMA 3W62A 5DDQC 1VQKS 3PM9A 1G2EA 4O3QA 1YHQS 2BRKA 3NGKA 3V81A 2BANA 4M1KA 4DUZF 2H5EA 1FNMA 1N56A 2BE2B 4NCBA 4USKA 1H73A 1FESA 4OYMA 4ZCLA 1F5CA 4OYXA 1B0TA 2PE8A 1J5OA 1SI9A 4ZDNA 2ZHAA 3CCRS 2JH3A 4Y00A 1FD8A 2AX0A 4PR6A 2IBOA 4YY3J 2MLYA 1CQNA 1VLYA 4L75A 3JSMA 3RRKA 3IRXA 1HI0P 1RAIB 1KC8T 3JAMU 2BKNA 2DGWA 3EZ5A 5KFVA 3M2RA 2H4WB 4M5JA 4CM2A 4WU3A 1JLGA 3R8YA 4V19X 3MEKA 5CCLA 1TKZB 4OZLA 1M5OC 4LF9J 5IWAF 2JVOA 2KZMA 2ZWPA 2N7YA 2GQQA 3G82B 5ADZA 3KMSA 1BLUA 1A7GE 2B4UA 2DXEA 3MPVA 4OZ3A 5T41A 3V6DB 1VQPS 5LSOA 4QU6A 4NLGA 4LBPA 2HGLA 4QU7A 3LP1A 4JV0A 2ZOFA 2KRBA 3A8JA 3BEGB 3D0IE 3H2UB 1Z4UA 5KFMA 1RACB 1JLGB 3MCSA 4DV2F 5BXIA 2E7WA 3MECB 3GR0A 3BGOP 3HLUA 4K4YA 2F8MA 2OO4A 3B82A 1FRLA 3E01B 3POTB 1FD2A 1IKYB 1FEHA 2EFVA 3NGUA 4B3TJ 1NRKA 3PFOA 2H51B 4IFYB 5LL6d 3OHAA 3BSNA 3NCRA 3U1MA 1U8WA 2MEWA 2FTRA 2CPDA 3MM9B 4ES3A 2V6AA 1X5TA 1I94F 1OYDA 4F26A 1X4FA 3MR7A 2QA2A 4RU9A 2BM1A 3A4TA 4FKYA 1S48A 4UZBA 2ZJRQ 1QM9A 1WI6A 4DN9A 3M7VA 3M2RB 3MR5A 4XDDA 4P52A 1Q53A 5IC6B 3ZNUA 4YDDB 3TZYA 3CJ3A 1WI8A 2VICA 2XB2D 3FCHA 4WFZA 1JLQA 3BYRA 3DOKB 4K5RA 5E2QA 3C15A 5DZ7A 4QYZJ 3Q0AA 3HFZB 1HBUA 1RADB 5A8KB 2KH9A 3C14B 4J9PA 1BGXT 2AYGA 2GO8A 4TU7A 4OZ5A 2MQ8A 1IKWA 1RT5B 3FJ2A 3MM5B 4RW7A 5HATA 5J2PB 4U8VA 2LXIA 4DV0F 1VRTB 2I0XA 2ZOGA 2E9RX 1DTQB 1SV5B 1YBUA 1VMBA 2DNMA 3C14A 1DRZA 4IOAQ 4TQSA 4RUCA 2DO4A 2R7XA 4ECUA 4IG0A 1RYSA 2R7QA 4Q5VA 5KG1A 4MKYA 1MLAA 3J7YI 1RT2B 3TUPA 1XR7A 2HFSA 3VZIA 2HHPA 1HBNA 3UDEA 5HP1A 5DG8A 3GYNA 2MKIA 4KY3A 4RW9A 1TR0A 3H2LA 1HBMB 2CIMA 3GU0A 4YB6A 3THPA 1SKSA 3W9HA 1RWKB 1OPIA 2V8VA 3F44A 4P6QA 2FIUA 4C48A 1LNQA 1JLQB 5L1KA 3CJSA 5D15A 4OYAA 1S1VA 3THVA 1NK9A 1L3KA 4Q44A 2Z8QA 1RHJB 4NEZA 3CD6S 3MUVP 1HNZJ 4DI6A 5A6PA 3GTYX 3EMTA 2B0GA 4H4KC 4FYYB 4LF7J 1BHNA 4QIWD 2XGQA 3LP1B 3M2VA 4PG4A 5CZVA 3EUNA 5D4LA 3UR3C 1JLCA 5CABA 3CC7S 3C46A 3M8QA 3B8HA 5IFMA 3EGNA 4EK2A 3QRQA 5KG2A 1GMUA 2ROGA 4LSNA 3F73A 4JI1J 3VAKA 1N54B 2WOMA 1HQEB 1RT4B 3I96A 2AHOB 3IWLA 5KFYA 4K4WA 1UPMB 4Y2KA 1VFJA 3D66A 1DAXA 2DGTA 3P4UB 4YR2A 2CG4A 3TO8A 4WKYA 3ENQA 2FHOB 3FCVA 4AL6A 1U1MA 2KVIA 5F8HA 1SH2A 2RJZA 1UVLA 3SYZA 1S0VA 2ACYA 4ITSA 4CO1A 2AJ2A 4LRCA 3KLHA 3M8PB 2Y0BB 2F9JA 2LDYA 4N77A 2V69A 1J2VA 4EYIB 2MB0B 5IT4A 2VKZG 1S6PB 5DQHA 1DBDA 3QT7A 2B56A 1TVRA 3M1VB 3G6ES 2R42A 3DDKA 1FWLA 1K73T 1X8DA 2IJNA 3T5JA 2VFUA 3PW7A 4MFBA 3CPWR 3RU0A 4G1PA 2PMZD 4HDGA 2UXBJ 3R5BA 3ZZTA 3QO9B 4NLUA 2E5IA 3SCLE 3CMES 2HHWA 1NK5A 4OHZA 4ETXA 3T1YJ 4U95A 3GJTB 2ATLA 2DXDA 5L46A 3HHLB 2DEIA 4PXBA 1LXJA 1RWMB 5DLGA 1Y5LB 4Y28C 4EWTA 1UFKA 4XTTA 2V34A 3OTCA 5AT1B 4O3NA 4ZK7M 2AYMA 2CQ2A 3MEEB 4CIOA 1VC5A 1XMOF 4FDFA 4F0MA 3EXYA 4CNYA 2IPOB 5J2QA 1OWXA 3KDOA 4F0KA 2YQ3A 3PEHA 2OP5A 2W24A 3FQKA 4RPFA 4M5KA 3UNGC 2L41A 1Q7LB 2JRSA 1REVA 3EVOA 4HACB 3B4DA 1D9FA 1UL3A 3W5XA 5JMNA 3SQOP 3R5GA 3KLGA 1VQOS 2VF3A 3P49B 1HD1A 4NLDA 2IM2A 3EWGA 2R2UA 4QWBA 4QPTA 3VGVA 1RHKB 5J2QB 4E2FB 5J2PA 2JSXA 2W4CA 4YUDA 5IXUA 2CPFA 4QJVA 4F3OA 4CLPA 4BDPA 1ZA1B 1RAGB 2JFDA 2KI2A 3GFHA 4NI2A 4DLGA 2XMWA 3ZC4A 1VQ9S 1KONA 1PJ6A 2VFRA 3W5YA 2F9DA 1HIYA 2HBRB 2CPEA 5GAGI 2R8HA 2BDPA 2XS7A 4DL4A 5IOLA 5E33A 1S9FA 3C6UA 4DN0A 3FBCA 4M5DA 2FC8A 1HWUA 3D0HE 2BJ8A 2CVEA 2CPJA 1HNVA 1QD1A 1KLMB 1V3SA 3HF5A 3MCNA 3FBBA 4FNHA 2R7UA 4DG1B 1EZZB 3G9CA 3ILIA 1XMOJ 3QMQA 1LFWA 3UD4P 1Q8BA 4GKJF 3HO1A 1EQMA 2YX4A 3B54A 1O8BA 3NCQA 5KFTA 2Z2MA 2GS8A 3CDWA 2W9BB 5F8IA 1Q7YT 3KUEA 1WHVA 1WELA 2GJ2A 4RWWA 2HK2A 2UUCF 4DR6J 5F8NA 3V6DA 1Q1KA 5HVHA 2J8AA 1QSSA 5HQLA 1RT3B 4DLEA 2HBYB 1SUQB 3OJUA 1FDDA 1RJJA 3W8GA 1LWCB 2JFKA 3K17A 4KRWA 3IM9A 4CLLA 2VG6B 2E1AA 2P8IA 1JLAB 1PO6A 1VIOA 2AKWB 3M9MB 2ASYA 2DNHA 3B78A 1X7VA 4B9SA 4PAAA 1CULB 3MURP 2HWHA 3MAQA 2FDNA 2NZ4A 4LRDA 5LJ5Y 1BXNA 4DL5A 3JQJA 2J0WA 3NBPB 1Z1ZA 4U9RA 3V5RA 2XC9A 4ER8A 1JLAA 1NXIA 2OELA 4DCOB 1QUVA 1BWEA 1X9MA 4DMZA 1IR1A 3DYAA 3BSCA 3HHLD 2DT9A 4J9RA 1LK5A 3FK4A 3AJDA 4FXVA 4IFVA 2YNFA 1R8BA 3CVKA 1GMWA 2PDAA 3F0NA 3G87A 3K5PA 4KGMA 4LRBA 5B0FA 2IMWP 3PR5B 2WW8A 3R5CA 4RNMA 5FDLA 1REGX 1YJUA 2MGZA 1K9MT 1Q4RA 5K14B 1RLCL 1RT1A 2Q1LA 1EHWA 1SJFA 3PVXA 2R7VA 3OXGA 3HFKA 1UEKA 4KH0B 4HHJA 8RUCA 2HSEB 1OSCA 2KYXA 3FRZA 1FTCA 4J5OA 5DDRC 2ZJPQ 2VZ9A 1LWXA 4NE9C 4WBFA 2M88A 4RW4B 5LMUF 4KIAA 1D9DA 2Y8WA 1XNQF 1NK6A 1N4LA 4JI6J 3NG8A 5L1LA 3LH2S 1IBMF 4PKDB 3W7BA 2J0QD 3EGZA 5E3PA 1NSAA 3R7NB 4ATNA 1CQMA 3GJRB 4JI2F 3HHKA 2DJWA 3LANA 4C4WA 5DETA 3NP5A 4MMOA 2M3DA 2MY8A 2YXLA 2HLTA 4FVCA 1EB0A 1NKEA 3HVTA 4MKVA 3MMBA 1R8HA 5KT2A 1MU2B 3GPAA 1UZHA 2HLUA 1P1LA 2HG4A 4OX6A 2EI5A 3I0SA 5CH7B 5KFSA 3DLGB 2RKIA 3TEGA 5D0EA 5E41A 1VQ4S 4YB1P 1YJTA 3OFHA 2HEKA 3DHXA 4L74A 1MN7A 4LVOP 4ANDA 3GFXA 4YEAA 4PRFA 3CO9A 3TVZA 5DS7A 3M9NB 3OLAA 4B9NA 2AP6A 3W3SA 4F2RA 1N36F 4OHVA 4PG5A 1T9UA 1WG5A 5CQGA 2QE5A 4Z7CA 4WCEQ 2E5HA 3LQVA 4LRAA 3GQCA 3H0PA 4DSFA 1S0NA 4ED5A 4HT5A 2J9EA 2VPWB 2M9KA 1FDAA 3K5LA 3DU5A 3BGFA 3P5BP 4TKTA 1LOUA 1XN9A 4DUTA 1AB8A 4IO1A 4F4YA 4F8RA 2CA9A 2FHMA 5BR8J 2YH0A 5C2CA 5C2GA 2EK1A 3DLKA 2CNLB 2L3MA 4TLRA 4BWJA 5ETLA 3S01A 4UT4A 4WZMA 3VQSA 3EGVA 4ANEA 5CZXA 3SCKE 3RTVA 1FRIA 2A18A 2VL1A 4IH7A 3MF5A 3T9NA 2WSEC 3VVTA 1FHTA 1FVSA 2KM8C 3H59A 3UWTA 1NHKL 2F1FA 3CWJA 3H8YA 1PBUA 1S12A 3NAHA 3DYAB 2FGCA 3V6HA 3BO4A 1BC6A 4JI4J 3LUYA 4LFAF 3GP9A 3J81U 1X4HA 3I0RB 4FYXB 4IH5A 4U96A 4YFUA 2HPUA 1SJQA 1LWFB 1R31A 2ZFHA 4KKOB 1K44A 3FMBA 3BREA 3MFHA 3PX6A 1RXOB 2AYBA 4NLVA 4JI7J 5JUMA 3SSRA 5HLFA 4QBUA 1DTTA 4X84A 4XK8C 2B8PA 3UDCA 4DV7F 2EK6A 4DR3J 2EFOA 2R8JA 2VODA 1N6QB 1YDLA 4WXWA 4UZCA 5J2MA 5KFDA 1RTJA 2DNZA 4NCGA 3C6UB 2OMOA 1QAIA 1D8ZA 2HGMA 1HNXF 2VA3A 5H9EK 1M5HA 5LT5A 1RYRA 1FJCA 4EZ9A 1IR0A 4OI3A 3R7SB 1UZDA 1PC5A 2CPYA 4ZP9A 1IBLF 2V2ZA 3R6LB 3ILLA 2DR6A 1Q16B 2IJFA 3FKBA 2NREA 3H98A 2BABA 1V3ZA 4IRKA 2ZM6J 2CPXA 2GIQA 2AEFA 1R0BG 4F3QA 5F3ZA 2BQRA 2F4VF 3UI3A 4MTPA 1J27A 3DRRA 3T1AA 1YRXA 4ES1A 5KFPA 4UQGA 3I9V9 2HAIA 2DR7A 2HHHJ 4LSLB 2XNRA 4LF4J 2RQ4A 4PZVA 2EC2A 2E7XA 2CNOB 2JVRA 3KJFB 4FNIA 3PHTA 4ZP7A 2UV8A 2Q66A 4F4WA 5KT4A 3OV7A 1XMQJ 2XLKA 1YRTA 4UOGA 4W92B 3C16A 4DV5F 1WC6A 2HMIB 1Y10A 1Q5VA 1RT7A 5HO4A 4E0DA 2CQIA 3NOGA 4ZLNA 3DN9A 3NWRA 1HNWF 5LMNF 3M2UA 1QLNA 4ZCKA 2ATCB 2HIQA 3W65A 2HZCA 2ZVIA 4OLOA 3RB4A 4F2SA 3GIJA 4ELVA 2ZH4A 1XR6A 1N34F 1V5VA 5T7LA 1H7XA 4S0MA 1CJVB 4Y3CA 1N8RT 1NDPA 2W9CA 4DFJA 3M9OB 4DZDA 4CZCA 3GIMA 2W8KA 2C2KB 1FXRA 1S5ZA 4AT1B 5F0UA 4XPCA 4URQU 2K7KA 2MQQA 2RDJA 3M1VA 1HNIB
chains in the Genus database with same CATH topology
1PAUB 2QLJB 3QNWB 2H51B 4ZVUB 1BMQB 5K20B 1RWXB 4ZVOB 2QL5B 2QL9B 2FQQB 1RHUB 1QDUB 2H65B 3IBFB 3P45B 4LSZB 5IC6B 1RHKB 3D6FB 2Y1LB 5IC4B 1ICEB 3R7BB 2XYHB 2QLFB 3R6GB 2HBRB 4ZVQB 2CNLB 1SC4B 4ZVRB 1RHQB 1RWNB 3D6MB 4ZVPB 2DKOB 4JB8B 1RWOB 3SIPB 2QL7B 3KJNB 1NMEB 4ZVSB 2C2ZB 2HBYB 2C1EB 2QLBB 2XYPB 2HBZB 3IBCB 1GFWB 1RWKB 3KJQB 1QTNB 1I51B 3GJQB 4DCJB 1RHJB 1RWPB 2H48B 1IBCB 3NS7B 2CNNB 4DCOB 2H5JB 3R7SB 1SC3B 3RJMB 2CDRB 3R6LB 2XYGB 1RHRB 4ZVTB 2XZDB 3R5JB 2CJYB 1SC1B 3P4UB 1RWWB 1F9EB 2HBQB 2CJXB 2CNOB 3D6HB 3KJFB 2Y0BB 1I3OB 4DCPB 2CNKB 2H54B 2H4WB 2C2OB 2C2MB 2H5IB 3GJSB 1RE1B 3R7NB 1PYOB 3GJRB 2H4YB 3EDRB 3GJTB 2P2CB 3EDQB 1RWMB 2C2KB 1RWVB 1RHMB 2XZTB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1PAU B;  2QLJ B;  3QNW B;  2H51 B;  4ZVU B;  1BMQ B;  5K20 B;  1RWX B;  4ZVO B;  2QL5 B;  2QL9 B;  2FQQ B;  1RHU B;  1QDU B;  2H65 B;  3IBF B;  3P45 B;  4LSZ B;  5IC6 B;  1RHK B;  3D6F B;  2Y1L B;  5IC4 B;  1ICE B;  3R7B B;  2XYH B;  2QLF B;  3R6G B;  2HBR B;  4ZVQ B;  2CNL B;  1SC4 B;  4ZVR B;  1RHQ B;  1RWN B;  3D6M B;  4ZVP B;  2DKO B;  4JB8 B;  1RWO B;  3SIP B;  2QL7 B;  3KJN B;  1NME B;  4ZVS B;  2C2Z B;  2HBY B;  2C1E B;  2QLB B;  2XYP B;  2HBZ B;  3IBC B;  1GFW B;  1RWK B;  3KJQ B;  1QTN B;  1I51 B;  3GJQ B;  4DCJ B;  1RHJ B;  1RWP B;  2H48 B;  1IBC B;  3NS7 B;  2CNN B;  4DCO B;  2H5J B;  3R7S B;  1SC3 B;  3RJM B;  2CDR B;  3R6L B;  2XYG B;  1RHR B;  4ZVT B;  2XZD B;  3R5J B;  2CJY B;  1SC1 B;  3P4U B;  1RWW B;  1F9E B;  2HBQ B;  2CJX B;  2CNO B;  3D6H B;  3KJF B;  2Y0B B;  1I3O B;  4DCP B;  2CNK B;  2H54 B;  2H4W B;  2C2O B;  2C2M B;  2H5I B;  3GJS B;  1RE1 B;  3R7N B;  1PYO B;  3GJR B;  2H4Y B;  3EDR B;  3GJT B;  2P2C B;  3EDQ B;  1RWM B;  2C2K B;  1RWV B;  1RHM B;  2XZT B; 
#chains in the Genus database with same CATH topology
 1RT1 B;  4LF2 A;  3NKY A;  3TW0 A;  4ANC A;  2W4D A;  3NBP A;  4ETZ A;  5EDW A;  2MGZ B;  3BPS P;  4DUZ J;  4DV1 F;  3GYG A;  2B9Y A;  4G6V B;  5A6W A;  1B99 A;  3M8P A;  2AJF E;  2RQK A;  3O3L A;  3VCD A;  2VG5 A;  3JTN A;  3PKY A;  3E01 A;  1RIS A;  3POT A;  4ELU A;  1VYA A;  3KK3 B;  2XMV A;  5B0G A;  4Q45 A;  3EPI A;  3X3U A;  4WII A;  3QJJ A;  4UOC A;  4AUK A;  1CVJ A;  2L9N A;  1R0C B;  3OR1 B;  1SIZ A;  4F25 A;  3V4I B;  1F9F A;  1RT3 A;  2G9O A;  2NYI A;  1JQG A;  3IBF B;  1R6Y A;  2E9T A;  4OX9 F;  2WVE A;  2ZBC A;  3CB4 A;  3UN2 A;  2SXL A;  4I7F A;  3H4B A;  1GXT A;  2IIH A;  4LT6 A;  4MH8 A;  3KOA A;  2UXD J;  1MG7 A;  5BJR A;  2HRY A;  1UPP A;  4DR5 F;  1DUR A;  3MOZ A;  1KP6 A;  4OI1 A;  2MQO A;  2JC1 A;  1NK7 A;  6FD1 A;  3K5N A;  3I56 S;  3OFG A;  5HMX A;  4DR1 J;  2PI5 A;  4EI2 A;  1UWB A;  3MM7 A;  4PEO A;  2X1G A;  1GQE A;  3KNG A;  4RR5 A;  2CQ1 A;  5KFN A;  3R1H A;  3NNH A;  4K4S A;  1T3N A;  1Q95 G;  1FKO B;  1U26 A;  1JB0 C;  2GGP A;  4O4G B;  1RZM A;  3VGS A;  3G4S S;  4L73 A;  5LOQ A;  3MCM A;  3QWU A;  4DV1 J;  1RTD A;  1B0V A;  3MEG A;  3JAM Y;  4JV2 A;  4JI8 F;  1JK9 B;  4WP3 A;  5A2Q Y;  3QSY B;  3L09 A;  4I2P B;  1KQF B;  1LW0 B;  2GIF A;  1FRX A;  3IR6 B;  4WJB A;  1RU2 A;  3JSR A;  4RKU C;  1VQY A;  3SSS A;  4CDI A;  2BKO A;  3TP2 A;  5J1E A;  5LSR A;  2FJA B;  2BQU A;  1ACM B;  3PYD A;  3H42 A;  4PWW A;  2EFN A;  4X66 J;  3TAN A;  1YJ9 S;  2LMI A;  2WW4 A;  1KVK A;  1M0S A;  1YWX A;  2ZVS A;  2W4P A;  4WFX A;  1S1X B;  5T14 A;  1WKL A;  3GON A;  1D3W A;  1UJ5 A;  1YSJ A;  3OJS A;  4DR2 F;  2VFT A;  4UOH A;  4F04 B;  4JI2 J;  4N76 A;  3MAA B;  3K57 A;  3OL9 A;  2RD5 C;  4NPO A;  3JXO A;  3NNC A;  4DL2 A;  4P73 A;  1XEZ A;  2FZC B;  2QLW A;  1FRM A;  1RWP B;  2LEB A;  5KG7 A;  2VBW A;  3IAM 9;  2W2O P;  1Y7P A;  2LYV A;  4KT0 C;  3CXC R;  3J7A 1;  2LQB A;  1B64 A;  3AXM A;  1LKZ A;  1CJK B;  1XJW B;  2DRD A;  2DIS A;  1SC3 B;  3PEJ A;  3RAQ A;  2D3O R;  2UUB F;  2EBE A;  2LEA A;  2OAU A;  4QOT A;  1T03 A;  4FKX A;  2BR0 A;  3PKM A;  2ZH7 A;  1RAF B;  3H20 A;  5IQ6 A;  1V5I B;  3DGV A;  1WEX A;  4DX7 A;  5IV3 A;  2XTJ P;  3FZ2 A;  4LBH A;  1UA0 A;  4H4M B;  1SL0 A;  4QYR A;  2QMX A;  2MHN A;  2CQG A;  2HK3 A;  1VK8 A;  3VQT A;  4DQS A;  4DL6 A;  3QGG A;  1NJW A;  5HLF B;  5H9F K;  2J76 E;  5THW A;  4NZ6 A;  1G6B A;  3KTQ A;  4DR2 J;  3RUB L;  2E7V A;  4A47 A;  2RF2 B;  1NB2 A;  2AEJ A;  3W2V A;  4DJB A;  3W8P A;  1FJE B;  1KSP A;  2XG8 A;  2ZEJ A;  1LWE A;  1BQN A;  1WC0 A;  4K2J A;  5KFG A;  5HL7 Q;  5AE3 A;  4L6V 3;  1HWI A;  1R3N A;  1Y00 A;  4PPZ A;  4F02 A;  4FBU A;  2B3T B;  2HND A;  3R5A A;  3VWS A;  3IC1 A;  2E5G A;  5C7P A;  5E7O B;  4DS5 A;  3RBD A;  4JBC A;  4LR7 A;  3CDB A;  3DLJ A;  1SQF A;  2HS0 A;  2EVZ A;  2M4M A;  3DU6 A;  4I6Y A;  4LFA J;  4HYK A;  1OQ6 A;  4A8K A;  1TZ0 A;  3DLK B;  2HVI A;  4B3O B;  1VJW A;  3QLH A;  4AXJ A;  1RHM B;  4CO4 A;  5HJY A;  4K5S A;  4P74 A;  2QZ8 A;  2GVD A;  4G1Q B;  3R2D J;  1VQS A;  1TK0 A;  4ZVH A;  3QNW B;  4HHH A;  3CJ2 A;  3KYL A;  4GKJ J;  2ZD1 A;  2XSF A;  3VV2 B;  1Q5Y A;  4FYW B;  3PRB A;  2AW0 A;  3ZTS A;  4I67 A;  2EFQ A;  2OEJ A;  2WK4 A;  1W2B R;  4DR6 F;  3TEH B;  1SKW A;  4PUO A;  2WRM A;  1ZH5 A;  4DR7 J;  5KT5 A;  2Z2L A;  1SIW B;  4PWD A;  3MPU B;  4Q2L A;  1RHU B;  3QIP B;  4QWC A;  1QDU B;  3GIK A;  2M8D B;  2MST A;  5DM6 Q;  5EUH A;  2D3Z A;  2K2P A;  4OV6 A;  3JYT A;  5DQG A;  3Q8U A;  4E8U A;  2R4F A;  2DNK A;  2XMJ A;  3D6F B;  2P6T A;  1IUJ A;  3TX0 A;  3J81 j;  3J7Y U;  4NX9 A;  1UMJ A;  3ET6 A;  1BQM A;  1FK9 B;  3CO0 P;  3P8B B;  1ZM4 A;  3CCM S;  5JVG Q;  1C0U B;  3LGH A;  4LR8 A;  2E44 A;  2BYC A;  1P27 B;  3MOJ B;  4K4U A;  1F60 B;  3HVT B;  2FJE B;  3QGI A;  4JOU A;  5AXK A;  1KQK A;  1T9Y A;  4C11 B;  4ZLJ A;  4RBT A;  3DLE A;  1Y5N B;  1APS A;  4K7Q A;  3M30 A;  2M2B A;  3HT0 A;  4LSL A;  3R3T A;  5HP1 B;  1O5J A;  1KWM A;  1K0V A;  2JC0 A;  1KVI A;  2AEM A;  2DRA A;  4HHU A;  2V67 A;  3W1Y C;  2BVZ A;  1T03 B;  2AJ4 A;  2C2N A;  5GMK a;  4C8L A;  1N32 F;  2DKO B;  2B7C B;  3CCS S;  5KFZ A;  4PG6 A;  2JDJ A;  2I2Y A;  2R7S A;  3VGU A;  2J9C A;  2QFI A;  4DR7 F;  1M5S A;  3KJV B;  2B6A A;  4QIE A;  2VDH A;  1P9Y A;  3R9L A;  3QIP A;  2IJR A;  2DGQ A;  1EP4 B;  1KEK A;  1SJ3 P;  4USV A;  3FFI A;  3TAP A;  2M5Y A;  2KFN A;  1HPZ A;  3DMJ B;  3V4M A;  3OBI A;  5LMU J;  2UP1 A;  1JLB A;  2HNY B;  1JKH A;  3L7P A;  4RW8 B;  3KXD A;  4WTY A;  1NPR A;  3ET6 B;  3R97 A;  3PJX A;  3ZNJ 1;  5HAO A;  4ENO A;  2FLP A;  4IR9 A;  1MSW D;  1KVJ A;  1GAO A;  2YWK A;  2JLE A;  5DG9 A;  2BOA A;  3RZA A;  2R7R A;  4J9L A;  4USM A;  1GEH A;  1Q82 T;  3LTO A;  5GME A;  3KK1 B;  1IBC B;  2E1R A;  3T3F A;  4LFC F;  3KLI B;  4ZPC A;  4CLK A;  3MM8 B;  4DQR A;  2GA7 A;  2UUA J;  2V0N A;  5D6G A;  1C1C B;  3OXF A;  1HQE A;  2HHQ A;  4KH1 B;  3GII A;  2DNO A;  1EX8 A;  3IR5 B;  2J7U A;  4I7F B;  2CFX A;  5B0A A;  2DCU B;  1AZS A;  3QT6 A;  2LA6 A;  5LSL A;  2CQC A;  1NSP A;  2F4F A;  3EVM A;  1WEZ A;  1SC1 B;  2E29 A;  1BQN B;  2J6U A;  4WKR A;  2WBM A;  2DNY A;  4NMX A;  4OX9 J;  1H98 A;  1RWW B;  1UET A;  4WFN Q;  1I1G A;  2BW2 A;  4A48 A;  2V8H A;  3JQK A;  2AIR B;  1N5S A;  1ZAV A;  2VG5 B;  3PRV A;  5L38 A;  2ZKU A;  4X62 J;  4DSE A;  2DH8 A;  2FUG 9;  3QRR A;  3D6H B;  1Y3K A;  2AYE A;  2P9E A;  2G0C A;  3LGN A;  1FXD A;  1KN6 A;  1JLB B;  3BKT A;  2NQP A;  2DNG A;  2FJB B;  2X3D A;  3IWX A;  1OMS A;  5MLC V;  1FTR A;  2YNI B;  4P71 A;  4PG7 A;  4DBQ A;  2H5I B;  2HUR A;  1U24 A;  3ETM A;  1RTH B;  3QAT A;  1WHY A;  3K58 A;  1H38 A;  4JYA J;  3K2Y A;  3TA0 A;  4TYA A;  1B0P A;  2GC8 A;  3IS9 B;  3D9B A;  2ZIT A;  1ZYQ A;  5GAD I;  1ZM2 A;  3N5F A;  5GAH I;  2F8E X;  2U1A A;  2RAQ A;  1OPZ A;  3TJ9 A;  2LVW A;  4OHY A;  4X4N A;  2E9Z A;  3HMJ G;  1U7L A;  2MDA A;  1XTZ A;  3FEY B;  2VPX B;  2Y1R I;  3PX4 A;  4QCL A;  1XBW A;  4GO5 X;  5J1N A;  4ZJO A;  4J9Q A;  3UD3 P;  1PAU B;  1FRJ A;  2Z30 B;  1HBM A;  2XBP A;  3AQP A;  4ECR A;  1VRT A;  2DNL A;  3KUG A;  1JNZ B;  2OPQ A;  1YVF A;  2BE2 A;  3FGV A;  4IOB A;  2RRB A;  1TV6 B;  3MPW A;  2XI2 A;  4X4S A;  3BBF A;  1GX5 A;  2M8H A;  4OZN A;  4QIV A;  5M2R A;  3SMZ A;  1VR6 A;  3UDV A;  4XDC A;  4ZVO B;  1C0U A;  4OI4 A;  2MSS A;  4W98 A;  4TQR A;  4WK3 A;  1FK9 A;  3M2U B;  4B9L A;  3Q8V A;  3VF0 B;  2E1P A;  5D4N A;  3A8I A;  3P45 B;  1H2U X;  1TL7 A;  4X4O A;  3VAG A;  1S72 S;  2LDI A;  5HRO B;  2AJQ A;  1HBO B;  2ZWO A;  3DLE B;  1F3F A;  2UUB J;  2Y1L B;  4NLO A;  2NXU A;  4RW7 B;  1RT6 A;  4LMZ A;  3L3C A;  3CIM A;  2DGO A;  5ETK A;  3N6L A;  2JLG A;  2Z56 B;  4RBU A;  1B3T A;  1G1X A;  3EPG A;  1H7W A;  2DIV A;  2NXC A;  3MAA A;  2VQE F;  3IWN C;  5ETM A;  2YPY A;  2HZA A;  3NXZ A;  3KMQ A;  3M6U A;  1UWB B;  3MM7 B;  3D1H A;  3KLF A;  1EAR A;  2OD4 A;  3QO9 A;  4FPI A;  2EKN A;  3PO4 A;  4IH6 A;  1OY8 A;  1X4B A;  4PQU A;  3AOB A;  4MK9 A;  4USI A;  5B0E A;  4CP5 A;  2QC3 A;  1U6F A;  3SIP B;  1FE4 A;  2OPP B;  5DZ6 A;  4L72 B;  3TA1 A;  4A8Y A;  4IG3 A;  1WJ9 A;  4IFV B;  3PR4 A;  3BGR A;  4OHX A;  4P10 A;  3VAH A;  3DHW C;  4LIW A;  2QT7 A;  1GMV A;  2QLB B;  5C42 B;  1X4E A;  2ZBR A;  3MAH A;  2PEH A;  3M8S A;  4G65 A;  2ZHO A;  4HT7 A;  5HK4 A;  1DZ5 A;  2GVD B;  4G1Q A;  5B0C A;  4CCH A;  2DYA A;  3CJ5 A;  4CO3 A;  1M1H A;  3KJQ B;  1XNR F;  2LQ9 A;  4Y2I A;  2C22 A;  2WTF A;  4FF3 A;  1URR A;  2EEY A;  1AZS B;  2G4B A;  4KKO A;  2HQ3 A;  2H48 B;  3NGT A;  3US5 A;  2RQC A;  1N34 J;  2G0I A;  2ZHB A;  5F8J A;  4QIF A;  3BS9 A;  5CD4 A;  4ZJQ A;  7AT1 B;  2MZS A;  2GFF A;  3GIL A;  3AFG A;  3P96 A;  1M5V C;  4GO7 X;  1FI4 A;  3LAL A;  2C42 A;  3DKD A;  4YB7 A;  5DRK A;  3KK3 A;  3JB9 k;  2BM0 A;  4WFA Q;  3D67 A;  3PJ9 A;  3SQG A;  5CA5 A;  4ID5 B;  2ACM A;  1KD1 T;  1J5E F;  4DQI A;  2DY9 A;  4P72 A;  2VB6 A;  3FUY A;  1IBK F;  3CF5 Q;  4KO0 B;  2CJY B;  3RB0 A;  4OYI A;  4Q43 A;  3AOD A;  1WSR A;  2EKY A;  2OHD A;  2DEJ A;  3AD7 C;  3D7S B;  3MED A;  3CCT A;  3ZZR A;  4C97 A;  3KK2 B;  1KLM A;  1RU1 A;  2YH1 A;  4JI7 F;  3DNC A;  4H4M A;  2QFJ A;  4M5D B;  4WE1 A;  4ELT A;  4LQ3 A;  3DLG A;  5FJ4 A;  2W7O A;  1PAE X;  3NOC A;  1RLD A;  2HW3 A;  1NND A;  4U67 Q;  3H5S A;  5KFX A;  2R8I A;  3HCX A;  4JUZ A;  1SL1 A;  4LBI A;  1FWP A;  3OTO F;  5HBM B;  4K4T A;  2C2O B;  2J5A A;  4ZIV A;  2VOO A;  5LXY A;  2HNZ A;  4A8W A;  1AT1 B;  4YP3 A;  3G8S A;  1URN A;  2QJ3 A;  1SCJ B;  3Q2S C;  3P3D A;  1S7I A;  3IXQ A;  4P2X A;  5HMZ A;  1UVJ A;  1HW9 A;  1TL7 B;  3OSN A;  1IKX B;  3ISN D;  5CYQ B;  2D7S A;  1TKD A;  2DCL A;  2O66 A;  3LW5 C;  1TKX A;  2BJ9 A;  3FDS A;  3Q8Y A;  1RWU A;  5E3A A;  4EU0 A;  4JV5 J;  3VGT A;  5B08 A;  3OR2 B;  4DU7 A;  3FSX A;  1DFD A;  4B3M F;  1M5K C;  3KLE A;  4DV3 F;  4ECW A;  3TAM B;  3DRP B;  5ETQ A;  4CT9 A;  1U1P A;  1U2R A;  4JI8 J;  2JLF A;  1MML A;  1FF2 A;  1EET B;  1TUW A;  2OGU A;  3MM6 A;  4IKA A;  2AZ3 A;  2RUS A;  3TJ8 A;  2QMU B;  2O67 A;  3MEE A;  2UVR A;  1TUG B;  2VPZ B;  2AZ1 A;  3A8E A;  3CED A;  4EBD A;  3QSI A;  3IBW A;  4C8Y A;  3O44 A;  4FPR A;  2MZJ A;  1FKA F;  1QUP A;  1KR4 A;  2QRR A;  4KQZ A;  2POK A;  2OPS B;  3UD5 A;  3MFI A;  5IS2 A;  4LSZ B;  1WF1 A;  2YNF B;  3SCJ E;  1TL3 B;  5DGB A;  1VS3 A;  5D3G B;  1JLE A;  3OL6 A;  1M1G A;  2KL8 A;  4O4G A;  3IS9 A;  2MJU A;  3PXG a;  2V4Q A;  3AD8 C;  2IDL A;  2ZC3 A;  4A4J A;  3SDE A;  3E2E A;  4OJ1 A;  5M2U A;  4AL5 A;  2CG8 A;  4F50 A;  4C7Q A;  2P9G A;  3HM9 A;  2QLF B;  5DGA A;  2D41 A;  5GAD U;  1FRH A;  5K14 A;  4TU8 A;  3LWM A;  3QLH B;  4KGZ B;  1YJN S;  5D8H B;  2HVE A;  4ECT A;  3T6J A;  3UPF A;  1AUS L;  3CD0 A;  4TY8 A;  1U1K A;  1CG2 A;  4DSK A;  4XIU A;  3W9I A;  1TUV A;  3KLH B;  1ZBT A;  2Y3Y A;  5B7W A;  1S59 A;  1QAX A;  1WG1 A;  2QMW A;  3J80 Y;  4OHW A;  1H3D A;  3OFE A;  1VDH A;  2MZT A;  2MMY A;  3HVW A;  3WBZ A;  9RUB A;  4X4R A;  1PC4 A;  1V9O A;  1GTE A;  1D0E A;  2OTL S;  1PIE A;  2LU2 A;  2GMH A;  2H9Z A;  5HQM A;  4B17 A;  2ILZ A;  4D3G A;  2MPU A;  3DM2 B;  4NRT A;  3ILO A;  3LP0 A;  3QJL A;  3Q22 A;  2VG7 A;  3HD2 A;  2B5J B;  2NS1 B;  4DV4 F;  2HVZ A;  1RA6 A;  4LRF A;  2XHW A;  4MT1 A;  1T7P A;  1B70 B;  3ZZ0 A;  2GZO A;  5AJ3 F;  2VON A;  4JYA F;  3RRH A;  1U48 A;  2YKM B;  2W9A A;  3GG1 A;  1F5A A;  2DBB A;  3VVU A;  1Q78 A;  1X5O A;  3HJF A;  7FD1 A;  4RX6 A;  4OJ3 A;  5ETR A;  2CJA A;  1NEE A;  4QW8 A;  1WDD A;  2YWW A;  4I56 A;  1T3O A;  2V68 A;  2XMK A;  3CDA A;  4J7C A;  4I2Q A;  3CJQ A;  3M32 A;  4FBT A;  1SJ1 A;  5IV4 A;  1NBE B;  2APO A;  4HTI A;  3UO0 A;  3DOM A;  2CWX A;  3EZO A;  1FFG B;  4RW6 B;  4P2S A;  2OFH X;  4ZN3 A;  4JV1 A;  3FSY A;  3C2P A;  4I69 A;  2LXF A;  4DG1 A;  3OPK A;  1F1B B;  1HNV B;  3HSD A;  2BJD A;  5EWE A;  2L48 A;  1HKA A;  5B09 A;  2F7V A;  1JJ4 A;  2BA9 A;  1KQG B;  3ELH A;  2HNZ B;  4NRU A;  3TAM A;  3H2V E;  1S9G B;  4M5N A;  3W5Z A;  2W8L A;  5HBM A;  2N3O A;  3OR2 A;  3M05 A;  4DPY A;  4RW4 A;  4PYD A;  1B4S A;  2HBQ B;  1UP1 A;  3M30 B;  5KFB A;  1FKP B;  1R0A B;  2PSZ A;  2YWF A;  2IM3 A;  1X4D A;  2W01 A;  3AB2 B;  2C3P A;  2H54 B;  1WC1 A;  5C25 B;  3VAM A;  2AF6 A;  5G4D A;  2WVD A;  2VA2 A;  5DLF A;  3WC0 A;  1RE1 B;  1KTV A;  2CQB A;  1F3V A;  1HYS A;  4J9K A;  1XIQ A;  2KJV A;  2RVJ A;  1R6V A;  2KVQ E;  3CD7 A;  3G71 S;  2CUY A;  1N33 J;  2W7A A;  1SH3 A;  4OFZ A;  3QFW A;  1A0O B;  1HW8 A;  2RS8 A;  1D8Y A;  1FCA A;  4DQQ A;  4F4X A;  3Q2T C;  5KFJ A;  2QIF A;  2XHC A;  3MDF A;  1PYT A;  3D1O A;  3HZE A;  3PYE A;  4WWS A;  2IAJ B;  1FWK A;  2XZT B;  4GC7 A;  5KT7 A;  1XK8 A;  1FX4 A;  1DAR A;  4YHH F;  2IM1 A;  4DUY J;  2AGO A;  1OIA A;  3TUI C;  5FLX U;  4ZLL A;  2IA0 A;  3JTO A;  4ZVU B;  3PIO Q;  1HI8 A;  4GVB A;  2D3U A;  3IGV A;  2E5L J;  4I6A A;  2HFN A;  4NCA A;  3PTW A;  3MUM P;  4A8X A;  3U7J A;  2IM0 A;  1HR0 F;  1U1Q A;  1YIT S;  1UW9 A;  2FQQ B;  2I1R A;  3ZZZ A;  2IRX A;  2NPF A;  1R89 A;  1U25 A;  2IRY A;  3T41 A;  3NNA A;  3HUL A;  3BGR B;  2WSC C;  3TZX A;  5EWG A;  3KHG A;  1YJ7 A;  2IC3 A;  4YDX A;  1NHU A;  2ALY B;  2R7O A;  4IQM A;  3HSZ A;  2LP4 A;  4IRC A;  1ZOT A;  3MGJ A;  3UVJ A;  3EVW A;  3MD3 A;  2C3U A;  2EBG A;  3GG0 A;  3QID A;  4MAK A;  5K8N A;  3RG6 A;  4C8K A;  2R7W A;  5KTQ A;  3BZQ A;  4RNN A;  3Q24 A;  5L1J A;  1VQL S;  1RKJ A;  4NLQ A;  4V19 J;  3LAM A;  2ZM6 F;  4ZN1 A;  4AD6 A;  2ZH8 A;  3BO2 A;  2DR8 A;  4ZVR B;  4IRD A;  2DD8 S;  2CPZ A;  3DRP A;  2EXU A;  4BCA A;  2VAS A;  3CDU A;  3X1L B;  3I5C A;  2XNQ A;  4DUY F;  4ED2 A;  4PPD A;  2MTL A;  3FFI B;  1M1K T;  2PD1 A;  3AY0 A;  3JSY A;  2V8D A;  2QA4 S;  1WUU A;  1RBA A;  3CUN A;  2HQI A;  2N7C A;  2R2R A;  2WB4 A;  3G6Y A;  4OQJ A;  1HD0 A;  1IKX A;  3CCQ S;  3GFZ A;  3TZZ A;  2O3D A;  4QR1 A;  4C3L A;  1XWL A;  1S4F A;  2YKP A;  4GC6 A;  2RNE A;  2CQ3 A;  4WYW A;  4OX7 A;  2F40 A;  4LF9 F;  2PC6 A;  1R0A A;  4RZR A;  3HFV A;  1FJ7 A;  4OYP A;  2ZE2 B;  1Q8K A;  3ISN C;  4O23 A;  1OYE A;  5BYS A;  4QIG A;  2XY6 A;  2DH9 A;  1MU2 A;  4L76 A;  2DVI A;  4RNH A;  1UW4 A;  3MMJ A;  3PAC A;  5EX3 A;  1JJ2 R;  5ETV A;  1IBM J;  2A1B A;  3D3B J;  4RW9 B;  3BQ2 A;  4ECZ A;  3HX9 A;  3T1H F;  3DC2 A;  4F0H A;  5DQI A;  4NA2 A;  4LIR A;  4ERD A;  1D09 B;  1G3O A;  4ZHR A;  1CJU A;  1AUD A;  5IT9 U;  4HLB A;  2HFV A;  3TQ1 A;  4J9N A;  2XCP A;  2AQ4 A;  1S10 A;  2YTC A;  2PMW A;  2Q43 A;  1NPK A;  1X4G A;  2ZE2 A;  3FC9 A;  1UCN A;  3QQC D;  5AE1 A;  5KT3 A;  1R8P A;  1S1W B;  1K47 A;  1W25 A;  3I6P A;  3E51 A;  2A6M A;  3ITH B;  4BWM A;  3TRG A;  1X60 A;  1TK5 A;  2YQ1 A;  1IKV B;  1UKU A;  3A3O B;  2YY3 A;  3DFE A;  3DGP B;  5KOX A;  4N8O A;  2YKA A;  2KJW A;  1RGV A;  3LP2 B;  5KFU A;  4R5P A;  3I4H X;  4LF6 F;  3W60 A;  1T05 A;  4UST A;  4EO6 A;  1TEL A;  1W7W A;  4KTQ A;  5F9L A;  6AT1 B;  1EJ7 L;  2J9D A;  4NLR A;  5K8O A;  2N4C A;  5ETS A;  3PYG A;  4O0N A;  4QPX A;  1BQX A;  2UXD F;  3QJP A;  5K8P A;  4X4T A;  4X4V A;  4ZOS A;  2DK2 A;  1P9Q C;  2ZD1 B;  3MMC B;  2QSF A;  3QT8 A;  4JI3 J;  4ID5 A;  3K59 A;  2YKN A;  3CE8 A;  4AXI A;  1M5P C;  1S79 A;  2KXF A;  2EG1 A;  2FVQ A;  3MWB A;  4L3K A;  1NU4 A;  2F65 A;  1WD6 A;  2NXE A;  3OHB A;  3IRW P;  4ZVF A;  1OQ3 A;  4J9U E;  4HL9 A;  2GAG C;  2B8Q A;  3CGI A;  2XS2 A;  2XWY A;  1WHW A;  2Z4P A;  4Y2C A;  4NOH A;  3G8T A;  4PXC A;  2CJK A;  1VRQ C;  4TLQ A;  2KHC A;  4ZS6 A;  5J1P A;  1QTM A;  2VQF J;  1UVM A;  3A1Y G;  4ZCI A;  2F5G A;  4CLY A;  4EZ6 A;  4B3S F;  2RIL A;  4NWB A;  2VBY A;  2QV6 A;  2YKO A;  3FSI A;  1F0X A;  2V94 A;  1NM2 A;  3PRD A;  5CD4 H;  4CTA B;  2CKW A;  3CW2 C;  2DR9 A;  1ROF A;  1JXL A;  1PG5 B;  4M5I A;  4ZPB A;  3OXL A;  3C6T B;  2ILY A;  4QQB A;  2NYH A;  1YQH A;  2A2C A;  3I31 A;  3W2W B;  4C3K A;  1KFD A;  2MLZ A;  5GAG U;  3PV8 A;  2GNK A;  1YJW S;  1X5P A;  2EFP A;  5CXT A;  2FLO A;  1XQI A;  2XZW A;  4DPO A;  4JI5 F;  1VQN S;  2P6S A;  3QWP A;  4KPC A;  4ED4 A;  2QL5 B;  3NMR A;  4B3R J;  2DTJ A;  2W9B A;  4KYZ A;  4M5G A;  3HPO A;  1VRU B;  4O44 A;  1RTI B;  2B6A B;  1NK4 A;  4ZPT R;  2CQD A;  2YX1 A;  3V81 B;  2RRA A;  1NPP A;  2QYC A;  2JZ5 A;  1YBT A;  1RBL A;  2BW7 A;  5CYM B;  5CYJ A;  4C8M A;  5H1S V;  2ROE A;  4J90 A;  1NJY A;  4LF4 F;  4USW A;  2D74 B;  3SXL A;  1JKH B;  2HNY A;  4RW8 A;  1XMQ F;  3BR9 A;  4KR0 B;  4RNO A;  5A8W A;  1ZA2 B;  2VU5 A;  1CJU B;  1NAQ A;  3QPI A;  4RO0 A;  2MJN A;  4A8M P;  3RW6 A;  1T95 A;  2B4V A;  5KOW A;  1WF2 A;  5H9F J;  3BN4 A;  2UU9 F;  1IR2 A;  4EBE A;  1ZAW A;  2CDQ A;  5CYQ A;  3S6E A;  1IBL J;  3DLL Q;  1S97 A;  5KFE A;  4CLW A;  4K0K F;  4H4O B;  4ZPA A;  3TJA A;  1IKV A;  2JX2 A;  3T19 A;  1JMT A;  5A8W B;  4X64 J;  2ALZ A;  4V1A k;  1J5E J;  2QEX S;  4ECX A;  1NDL A;  4KHP J;  1TU0 B;  2RS2 A;  1K1Q A;  2V2V A;  4OIX A;  3TAQ A;  1LFP A;  2DIT A;  1C1B B;  3CJR A;  2ASL A;  1IVZ A;  4HI2 A;  1SV5 A;  4DL0 C;  4OL8 A;  4WP9 A;  5GMD A;  3TZW A;  2ERR A;  4JI5 J;  2CYY A;  1SVD A;  4UY8 5;  5DM7 Q;  5A8R B;  2RU9 A;  4DFP A;  3IP0 A;  3PW4 A;  3DXB A;  2LA4 A;  2C1E B;  4GVL A;  5D0H A;  1L3S A;  4B3T F;  1S76 D;  1Y11 A;  2RRN A;  3U1L A;  4KSE B;  1TVR B;  2KN4 A;  4CLS A;  2FJV A;  2BJ7 A;  1HHQ A;  1HBU B;  3D3C J;  1L3V A;  1UWA A;  4MIW A;  1QTN B;  4BC9 A;  4EFA C;  4KHM A;  5DDP C;  2KM8 B;  1VHF A;  1IJF B;  3RR7 A;  1S1U A;  1U49 A;  3GJQ B;  3SV3 A;  3KHL A;  1NKC A;  1R43 A;  1ZTT A;  4ED6 A;  2CJ9 A;  3GB0 A;  1TMJ A;  3NGR A;  2XQC A;  2ZOM A;  1IM6 A;  1FFS B;  3L4B C;  1SKR A;  4GKK F;  4RUH A;  1L5U A;  2YKM A;  3WIV A;  4MFB B;  3HXM A;  2ASJ A;  3HI9 A;  1T9T A;  2IHR 1;  1RCX B;  4TN2 A;  4DR5 J;  1YKW A;  4JV5 F;  4JI0 J;  3H7H B;  3Q23 A;  1K1S A;  2RU3 A;  2XYG B;  4MK7 A;  1Y5I B;  3BGL A;  3LP0 B;  4KGX B;  2KB2 A;  4IYQ A;  4DS4 A;  4KHP F;  1TL1 A;  4DWI A;  3KUH A;  3I0R A;  3DI6 B;  3M2V B;  4OYB A;  3GLJ A;  2K8G A;  2NUH A;  2HVH A;  3C6T A;  3GV8 B;  2KYZ A;  3ZZO A;  5FLX Y;  4Z2X A;  2O1P A;  4C8N A;  1JJH A;  2AWZ A;  2W2M P;  3DDI A;  3FEZ A;  4HVZ A;  2JJ4 D;  5J2N B;  4LRE A;  5K9F A;  4HEA 9;  5C42 A;  1FT8 A;  3DI6 A;  3G86 A;  1S1V B;  4OI0 A;  2BKP A;  3QBC A;  4MIB A;  4F36 A;  3G6V A;  4ZKA A;  4DL7 A;  1SH0 A;  5AE2 A;  5MAO A;  2FVR A;  2CQP A;  2A0F B;  2RML A;  1V3R A;  2P9C A;  3EIC A;  4WXO A;  4ZP6 A;  3H4D A;  3SEO A;  3DOL A;  2V4J A;  2MXY A;  3LWL A;  4DR1 F;  2QX0 A;  1HBN B;  1HQU A;  3FZB A;  5ETP A;  2W2Q P;  1H0H B;  2A3J A;  4YS2 A;  5I42 B;  3IFE A;  2CAD A;  3EDQ B;  2V5H G;  3KDN A;  1CJK A;  1RWV B;  3M8R A;  1TFY A;  3M8Z A;  2A10 A;  3R5D A;  2HQC A;  1QSL A;  1K0T A;  4NLX A;  4OZ2 A;  2IYG A;  2LQ5 A;  2L9W A;  1NJZ A;  1IBK J;  2C3Y A;  2GHV C;  2ZNZ A;  4HR2 A;  1LW2 B;  1JJC B;  1HBO A;  5E3R A;  4EUV A;  1VJQ A;  2V9W A;  3HKZ D;  2ZH2 A;  4RNF A;  2KU7 A;  2OML A;  5CAA A;  3QFH A;  4WFB Q;  1KDN A;  2HQD A;  4USJ C;  2YVS A;  1S9G A;  1C1B A;  4O3R A;  2J7W A;  1R27 B;  3AH6 A;  3BKF A;  4X66 F;  2XLJ A;  2R7T A;  2GJF A;  2PGC A;  1TQL A;  2QL9 B;  2W2N P;  3ISZ A;  2JOQ A;  3J7Z T;  4O3S A;  1HYS B;  3KG0 A;  1NDK A;  4RL1 A;  4DSL A;  2E1M C;  5ETT A;  3ZTR A;  4LFC J;  1P1T A;  1TTH B;  5KFF A;  2A2D A;  2X3G A;  1V6H A;  2X51 A;  2C3O A;  4FYV B;  2AJ1 A;  1ZM9 A;  2XY7 A;  1GX6 A;  1FVQ A;  4EO8 A;  3NRB A;  3FEX B;  2YNG B;  4CYU A;  2VKR A;  4U7U K;  1AXQ A;  3I55 S;  1DQ9 A;  1HL6 A;  4WFY A;  3WX8 A;  4TYB A;  3DOK A;  2KO1 A;  5LXR A;  3HHL A;  4UUW A;  5I4M A;  2PFF B;  4I68 A;  1RTJ B;  4IFY A;  5BYQ A;  3ULH A;  4RBV A;  1SC6 A;  2GX8 A;  1RHQ B;  4F4Z A;  1S6Q A;  2L08 A;  2CRL A;  3QT5 A;  4WYL A;  4KV8 A;  1TKT B;  1RAJ A;  4KBI A;  4UTG A;  3SZ2 A;  4NXM F;  4GMK A;  2JEF A;  3BKU A;  4YQW A;  4JB8 B;  2KZZ A;  1WTB A;  3L95 X;  3TQE A;  1AFJ A;  2OLW A;  2D9O A;  4ECV A;  4Y2M A;  1XC9 A;  3MZI A;  1RTD B;  2LEC A;  2GMJ A;  2HQF A;  2R3V A;  5FII A;  3THT A;  3KJN B;  3RAX A;  3Q8P B;  4KFB A;  2PA3 A;  3V4I A;  3QAE A;  1PBA A;  2D1C A;  2ZKT A;  3WZ0 A;  2D69 A;  2WAQ D;  3JQM A;  2Q6C A;  3K8V A;  5K8M A;  4MKA A;  2VQF F;  4DF8 A;  2X1F A;  5B0B A;  2RHQ B;  1VK3 A;  2OSR A;  3GZ7 A;  3KG4 A;  4GVB B;  1E6Y A;  3MMC A;  5KG5 A;  2XGP A;  1U45 A;  1VOM A;  4EYH B;  2UVV A;  3WQP A;  3D0G E;  2B5J A;  3N9U C;  1PYS B;  1U1L A;  2AV5 A;  3EJM A;  1YG0 A;  2BMB A;  4OJG A;  5KG4 A;  5EGY A;  4E98 A;  2VJV A;  4Q8F A;  3HZG A;  3OUY B;  3MUT P;  1WC3 A;  4CLT A;  4OJH A;  1S57 A;  4KGV B;  1FX2 A;  2MZQ A;  2FVC A;  1YJR A;  1AW0 A;  4X65 J;  1CJT B;  4NXM J;  5T7L B;  1KTQ A;  1VQ5 S;  2OTJ S;  4NML A;  2NZC A;  1OSD A;  2FD2 A;  3O1L A;  1IQT A;  4ZPV R;  5AXM A;  1E6V B;  2ABY A;  4J9V A;  3TVK A;  5LM7 E;  3J81 Y;  4AL7 A;  4B9U A;  2ROP A;  2MLX A;  4K2X A;  1H74 A;  4FVM A;  4NEY A;  2IDE A;  2J6S A;  1ZS6 A;  4OX8 A;  2HMI A;  4OI2 A;  2J9D E;  4R25 A;  1UA1 A;  3P6Y C;  3B6B A;  2UUW A;  3A8K A;  4I0W A;  1UVK A;  4NLW A;  2BAN B;  3DGP A;  4B3O A;  3RBE A;  3F41 A;  2XMU A;  4FXD A;  2ZBP A;  3ICL A;  2QGF B;  2DHX A;  2RHS B;  1IXK A;  3OTB A;  4K8R A;  1FER A;  1HWJ A;  2IY5 B;  1X9S A;  5C25 A;  4N8N A;  3Q8Q B;  2MQN A;  1PYO B;  3PCO B;  2XMA A;  3SCI E;  1GNK A;  3R1L A;  2H4Y B;  5I3U B;  1DY3 A;  3EDR B;  3R27 A;  2XY5 A;  1U0H B;  2XSJ A;  1NKB A;  3W66 A;  1MRO A;  3ZTO A;  4Y0F A;  1IKW B;  1RT5 A;  4Q8E A;  1UVN A;  2Y9H A;  3D4J A;  3HKW A;  2GQ2 A;  3MR2 A;  1NLK L;  2UUT A;  3VHQ A;  4FF4 A;  1IJE B;  1HQ2 A;  4GRS A;  1DLO B;  4ZA1 A;  2HWT A;  5F0W A;  4ED7 A;  2UUA F;  3N79 A;  1N0U A;  3UW1 A;  2I38 A;  5J2M B;  1O0P A;  1VIS A;  3QZ7 A;  4DV7 J;  2GQC A;  3G96 A;  2VHG A;  2KRR A;  3BM7 A;  2YNH B;  4ALZ A;  2HQG A;  4DPW A;  3V2U C;  3DDN A;  4C0H A;  5LJ3 Y;  1XNR J;  3ZTQ A;  1C4A A;  4ICL B;  4C3M A;  4DFK A;  3DLB A;  4J9S A;  2U2F A;  1TL4 A;  1N5V A;  3MM9 A;  1PCA A;  4FXW A;  3AT1 B;  3KNA A;  1JXE A;  2GIR A;  3BH7 B;  1RQ0 A;  1FKO A;  3CT9 A;  4ZVG A;  5IWA J;  3D2W A;  2OD6 A;  3K5M A;  3ENV A;  2Y0S D;  5IC4 B;  3L7U A;  2G1H A;  3R7B B;  4AQY F;  2XYH B;  5HQ8 A;  1N33 F;  4BLG A;  4IOC Q;  3R6G B;  3KHR A;  2UXC F;  2KG0 A;  1OS5 A;  2JEI A;  4QZV B;  2ADC A;  1VQ6 S;  2B4O A;  1IWG A;  3RYL A;  3M6X A;  3GCW P;  1SC4 B;  2Z57 B;  1FNX H;  3CD5 A;  2VV5 A;  3ZO7 A;  5J2N A;  1QSY A;  1CJT A;  1NJX A;  2HHH F;  4OV1 A;  2VFV A;  3PY8 A;  1RK8 A;  2G0J A;  4OYZ A;  4PXE A;  1S7H A;  3TYT A;  2GV1 A;  3C8Y A;  4M5M A;  4WTO B;  1MMN A;  1SUQ A;  1RWO B;  1RT4 A;  3LPE A;  1TL1 B;  4NLT A;  2X1B A;  3A3P B;  4J91 A;  2DNR A;  3J80 U;  5F9N A;  5F3T A;  2JWN A;  1WTF A;  2JHE A;  4MKB A;  2Z2Y B;  2VBZ A;  1NME B;  2FZG B;  4Q2M A;  4IO9 Q;  4CLU A;  1VGY A;  4UOF A;  2AJ0 A;  2XYP B;  3IGN A;  2M0G B;  3LF0 A;  4NYZ A;  3VR1 A;  4DSJ A;  1PIL A;  1RT7 B;  1GXU A;  2I6W A;  2BOP A;  3MD1 A;  3FVY A;  3W9J A;  1C2P A;  1MWY A;  2MHE A;  2MKC A;  3IG1 A;  1NUE A;  2KG1 A;  2L9D A;  1JNR B;  3UN5 A;  2MZ1 A;  4EBC A;  2G13 A;  1I51 B;  1RAO A;  2B4P A;  3UCZ P;  3RBX A;  4X64 F;  1VI7 A;  3OQ2 A;  4HKQ A;  4AQY J;  2BAC A;  3I0S B;  3V6K A;  2QO3 A;  1T94 A;  2F63 A;  2OPS A;  5D4P A;  3HD1 A;  5K5M A;  1S4E A;  3JSB A;  2N82 B;  2Q3P A;  3K89 A;  2X7I A;  3K5O A;  2UV8 G;  4EMD A;  2IYI A;  4EEY A;  4CRJ A;  1QY7 A;  2C28 A;  4C2M A;  1EAY C;  5HRO A;  4B9T A;  3SI8 A;  5B0D A;  2C2D A;  1ZZF A;  2XZD B;  3IM8 A;  3CCU S;  1JX4 A;  1L3T A;  5HJX A;  3IA0 A;  5D78 A;  5AXN A;  2WON B;  2B9X A;  4NZ7 A;  1CBK A;  5DJB A;  3RBZ A;  2HGN A;  3PO5 A;  1GXL A;  3I82 A;  4B9M A;  1Q0N A;  1F9E B;  2WZ1 A;  3D1Q A;  4W4M A;  4DHV A;  1A9N B;  2MQP A;  4LUB A;  4F67 A;  4P9S A;  3H40 A;  3BB5 A;  3A13 A;  3V6J A;  1LW2 A;  1SQE A;  4CM0 A;  3N28 A;  4JI4 F;  3CJK B;  3IAS 9;  1I3O B;  3DRY A;  1F9H A;  4DCP B;  4R8U B;  3R2C J;  2Z2Z A;  2KFY A;  3IG1 B;  3QYY A;  3ZFV A;  2PI4 A;  3QRP A;  3AJ2 A;  1ZET A;  3D28 A;  1DTT B;  3AOA A;  2LLZ A;  4KJI A;  1G7C B;  3C15 B;  5KG3 A;  4CH7 A;  2BZ2 A;  4PQU B;  2D9P A;  4KHR A;  5ETO A;  5GAH U;  2R9L A;  1N5Y B;  2IVY A;  4DL3 A;  1HI1 A;  4IDK A;  2KT5 A;  3OT9 A;  3MHY A;  5SUH A;  3BQ0 A;  3BV8 A;  3CTR A;  2ZBI A;  2VQE J;  1LWF A;  3HHE A;  1NB7 A;  2GGP B;  4LF7 F;  3PNI A;  2KFZ A;  4ED1 A;  1X5S A;  2ZBQ A;  1KFS A;  3SV4 A;  3Q8R B;  4PWD B;  4ZVE A;  2GO9 A;  1T02 A;  5ETN A;  4CNZ A;  4K0K J;  4C0O C;  1RUS A;  2QLJ B;  5RUB A;  1X0P A;  3TI0 A;  1BD6 A;  2E1C A;  5FDL B;  1X4C A;  4LFB J;  2BJ3 A;  1S9E B;  2FJD B;  3CJ0 A;  5GAE I;  2OKQ A;  2VG7 B;  1HQU B;  3EE3 A;  1BMQ B;  3AAW B;  3CJ4 A;  4J37 A;  1Q8I A;  3D6T B;  3T6B A;  1BY9 A;  4EGL A;  1WOO A;  4CQ1 A;  2HIY A;  3U02 A;  4PCQ A;  1Y4Z B;  1LQ9 A;  4Q7A A;  3BR8 A;  2FHK A;  2LCW A;  4KFB B;  2CPI A;  1CSJ A;  3BYP A;  4FF1 A;  3O5T B;  3IMQ J;  4ES2 A;  2AX1 A;  2HHU A;  3GSI A;  2HHT A;  2WVF A;  4P75 A;  2R2S A;  4TY8 B;  4YY3 F;  5F8M A;  5E3Q A;  1Q81 T;  1ICE B;  4XAK A;  4X65 F;  3WX4 A;  3TWZ A;  4DDF A;  3KHH A;  2HKE A;  1ZAX A;  1ZPW X;  5KFK A;  1NSQ A;  3KLF B;  3OTO J;  4PXD A;  2GVZ B;  5HVG A;  5IM0 B;  4DV5 J;  1ZM3 A;  3T1Y F;  4KB7 A;  3IRX B;  3SDE B;  1S77 D;  1EIY B;  1ELO A;  1FNO A;  2RKI B;  3JSM B;  1ARO P;  2KXH A;  2M52 A;  3AD9 C;  3PZP A;  1WAC A;  1U6B A;  2LQ8 A;  4IG3 B;  9ATC B;  2FVP A;  3D6M B;  2CZ9 A;  2XEX A;  1T0T V;  2DNP A;  2ZZM A;  3ZZY A;  1X31 C;  1VIX A;  2LEP A;  4ID8 A;  3UCG A;  3CC4 S;  1TAU A;  4A46 A;  1H6K X;  4A8Q A;  1TKT A;  3RGI A;  2RQM A;  4U7C A;  3PX0 A;  2CQ0 A;  4B3M J;  1X9W A;  4BBY A;  4Y65 A;  3VAJ A;  3Q86 A;  5E0O A;  4LF8 F;  2N4D A;  3TR5 A;  1DLO A;  3PYF A;  3M6W A;  4FS1 A;  1UFL A;  3KLE B;  2HAF A;  2K06 A;  4OZ0 A;  2PMH A;  4NXN F;  3PW2 A;  4USH A;  2FGO A;  5EHH A;  1RT6 B;  3LAK A;  1YLX A;  3QAU A;  2ZH3 A;  2K3I A;  3WHI A;  2QA1 A;  4QWE A;  4C8Z A;  2IMO A;  4D3H A;  4NA1 A;  4YHH J;  4C6A A;  1H72 C;  1PJ5 A;  3BQ1 A;  1JIH A;  5KFL A;  2K3K A;  2CNN B;  1LEO A;  1NK0 A;  2H5J B;  4F3M A;  2OI2 A;  2VC1 A;  4DPU A;  1REV B;  3CIZ A;  4HAC A;  1JLF A;  4QWA A;  4ECS A;  4IR1 A;  1EKS A;  1U47 A;  3TVY A;  2ZH5 A;  3F56 A;  3IR7 B;  3WC2 A;  2V50 A;  5J1E B;  4WZQ A;  4QR0 A;  3HP6 A;  1QAJ A;  2DHA A;  2DHS A;  5I3P A;  3VZH A;  1QVG R;  4ECY A;  3NL0 A;  1SB6 A;  4DXL A;  2OSQ A;  5D4O A;  4I4B A;  2QTW A;  2YPZ A;  1RTH A;  3LA0 A;  4WK1 A;  1W26 A;  2UUC J;  3SFG A;  3FBE A;  3U27 A;  2BE7 D;  5U47 A;  1FO1 A;  1S6P A;  4PG8 A;  2F8H A;  2MZR A;  3HHL C;  3TUJ C;  3CCV S;  1TMM A;  3JTP A;  2BJE A;  3RB3 A;  1SXL A;  3W2W A;  1NCL A;  5IQQ A;  2ZZN A;  2Z58 B;  4PWU A;  4NLY A;  3TOQ A;  4NXN J;  2YWE A;  2OH2 A;  1DQA A;  3CCL S;  4DV4 J;  5IT9 Y;  5HVF A;  3P5T L;  2EFG A;  4PAB A;  2J0X A;  2OPR A;  1SBR A;  2VFS A;  4OYW A;  5F41 A;  4UUX A;  2FZK B;  5C24 A;  2G2Y A;  3VTI A;  3TUZ C;  2O5D A;  3C19 A;  1Q86 T;  4YOE A;  1SJ4 P;  5F8G A;  1AYE A;  2ZUA A;  3KG1 A;  5A0Y A;  1GTH A;  3D54 A;  1JLC B;  2JL9 A;  2P2C B;  1FJG F;  1H2V Z;  1S1T B;  3IO1 A;  2OPR B;  4ED8 A;  2R8G A;  1TKZ A;  3MR6 A;  2PEB A;  3I87 A;  1CC7 A;  2AD9 A;  2RH3 A;  3NS6 A;  3GYX B;  2CZV C;  1HLW A;  4N41 A;  4M5L A;  2K1R A;  3M8W A;  5A2Q U;  2DNQ A;  4NLP A;  3VAF A;  3MMA A;  1S1T A;  3AB4 B;  3BDP A;  1QJH A;  1VC0 A;  5KAK A;  5A0Y B;  1U6Z A;  2G2Z A;  3EX7 B;  1Q79 A;  1Y9O A;  2KT3 A;  2MKH A;  2VH7 A;  2WCX A;  3N6N A;  1RWX B;  3NEK A;  4OLP A;  4N47 A;  3S8S A;  2BUN A;  2WVC A;  5KG6 A;  4JI1 F;  3PFE A;  3M4X A;  1C1C A;  1KS2 A;  1NHV A;  2HVD A;  3WIU A;  4RU2 A;  3C3L A;  4K4V A;  1EP4 A;  3MM8 A;  1D1U A;  1RCO B;  2CZ4 A;  2H65 B;  3BGU A;  3N0V A;  2Y1I A;  1N52 B;  2MKJ A;  1NSK L;  1NZ8 A;  1XNQ J;  4DEZ A;  2WB1 D;  3BN7 A;  4JI6 F;  2VOP A;  4IDK B;  1RBO B;  3Q83 A;  4O4R A;  3OVS A;  2J8S A;  3BSO A;  3ILJ A;  3HHD A;  1KOH A;  1T11 A;  2JEJ A;  5KT6 A;  4M5H A;  3QGH A;  2VD3 A;  3CDE A;  2Z0G A;  4H4O A;  1DQ8 A;  1MRO B;  2DXF A;  1Q8L A;  3CJK A;  3VAL A;  5JJB A;  1YX2 A;  3BBC A;  1FKP A;  4PQA A;  1YRU A;  1F2H A;  4BHQ A;  3K8W A;  2H1Y A;  2JEG A;  1VQM S;  2M7S A;  4H4K A;  4LJM A;  3RB6 A;  1HHT P;  4Y2A A;  4HDH A;  8AT1 B;  2B7B B;  1JLF B;  2LKZ A;  3OTE A;  3ZZU A;  4X62 F;  4QWD A;  1ZTW A;  1T8E A;  1CLF A;  1CS4 A;  1NDC A;  3NGD A;  4NAS A;  5D0G A;  1BUX A;  4Z37 A;  1XR5 A;  2GAH C;  3N5B A;  4P7T A;  4WIQ A;  2ZH9 A;  4CH1 A;  2AGP A;  1VBZ A;  4K50 A;  4WF9 Q;  1MNE A;  2NXJ A;  4C8O A;  4OZJ A;  2MKK A;  1SL2 A;  4O0I A;  1RTI A;  3L9Z A;  4DU8 A;  3ETO A;  3W61 A;  2IFX A;  2RDI A;  3O8W A;  4UW2 A;  4USU A;  3MTK A;  1KHV A;  2HBZ B;  3MEG B;  2E5L F;  1C0T B;  4DSI A;  1A6L A;  4MK8 A;  4RUB A;  1HWL A;  4QYZ K;  1PGZ A;  2MQM A;  3GCX P;  1RKI A;  2MY7 A;  1F5B A;  1JWW A;  1S1X A;  4CO5 A;  2ZH6 A;  4DFM A;  3I32 A;  4NLS A;  2FC9 A;  4C9D A;  2HS3 A;  4K4X A;  3ADA C;  4DCJ B;  4JP8 A;  2ADB A;  1VBK A;  2RIJ A;  1IN0 A;  3RAM A;  3AQO A;  2G1D A;  2Q79 A;  3BH6 B;  2NSB A;  4DX8 H;  5HN0 A;  4CTA A;  3CCE S;  3RJM B;  2FJX A;  3NY0 A;  1Z2Z A;  1VQ7 S;  2IVM A;  2V2Q A;  4NL5 A;  2LU1 A;  1RAH B;  2IC3 B;  1RHR B;  1FRK A;  5HI7 A;  2ZH1 A;  4AFF A;  4B3R F;  4U7U D;  5FD1 A;  4UY8 T;  2DGU A;  1IKY A;  3U1N A;  4MYU A;  1Z2L A;  3DRX A;  3OL7 A;  5JXS A;  1O51 A;  5IZH A;  3OSP A;  2CJB A;  2VIH A;  2VG6 A;  1RAE B;  2XI3 A;  2YX7 A;  1I94 J;  4AYB D;  4N5S A;  4M94 A;  1EKR A;  1HR0 J;  1S9E A;  3AJ1 A;  1N32 J;  3M8Y A;  2WOM B;  2W25 A;  2VPY B;  3E3X A;  3RW7 A;  4B9V A;  4Q0B A;  5KFR A;  1WNE A;  1TP7 A;  2DGV A;  3HHN B;  2DB1 A;  2OPP A;  3SFU A;  4W90 B;  4URS A;  2UU9 J;  2KTQ A;  2W9C B;  3OL8 A;  1DHM A;  2FHJ A;  2FY8 A;  3W2V B;  3KJV A;  2V63 A;  1TL3 A;  2RF2 A;  5D3G A;  2ZC4 A;  2F3J A;  4N56 A;  2HFO A;  1GMW D;  1KHW A;  2HYI B;  3HVA A;  2BXJ A;  1S1W A;  4J9M A;  4ZIT A;  1NJI T;  2M70 A;  3QGP A;  4RUA A;  3T1H J;  3CJ8 A;  2BRL A;  1U4B A;  4F4A A;  2J0S D;  2OEK A;  4DPX A;  3H5Y A;  1YI2 S;  4ZPD A;  4JI3 F;  1RP5 A;  2OEM A;  4P7V A;  4DOZ A;  3MI7 X;  3KKF A;  4WU2 A;  3H90 A;  3UR0 A;  4LF8 J;  1QAY A;  5KFQ A;  2WSF C;  3FQL A;  5DO2 A;  5L1I A;  3HVR A;  5C5J A;  1KQS R;  3KLV A;  3GV7 B;  2IBK A;  4LVN P;  1S49 A;  4HI1 A;  2C2R A;  3FMW A;  3TAR A;  4DR3 F;  1WWH A;  4ILR A;  3AHP A;  3TA2 A;  1U1O A;  3LOU A;  4B02 A;  2DIU A;  4YR0 A;  4WP8 A;  1CS4 B;  3OFF A;  4O3P A;  1YTY A;  3D5M A;  3I4P A;  1KLN A;  3UE2 A;  3BDE A;  1GK8 A;  5L8R C;  4ECQ A;  3CJT A;  4DR4 J;  5HSP A;  3S7R A;  4F7V A;  2ASD A;  1WG4 A;  3Q89 A;  4ZMM A;  4GKK J;  4QR2 A;  4R8U A;  4FZV A;  1SPB P;  1VRU A;  4O44 B;  1YIJ S;  3DCA A;  2XS5 A;  3GR1 A;  3E8O A;  3H5U A;  1RI7 A;  4G1I A;  1P8G A;  1WOR A;  4P2F A;  3UQS A;  4DX6 A;  2VJU A;  2A6O A;  1KNZ A;  1FXL A;  4X4U A;  4F4K A;  1QE1 A;  3TNV A;  2XWX A;  2IRU A;  4ZVQ B;  3NAI A;  3OD2 A;  2BE9 B;  1BQM B;  1R7I A;  4I6W A;  3MMA B;  4DX5 A;  4BS2 A;  1VBX A;  2K1R B;  1HA1 A;  1RWN B;  3G6X A;  3MPD A;  1YZ6 A;  3NLC A;  1MMD A;  4I64 A;  4P2M A;  4TVA B;  3DOL B;  5KFH A;  3PW5 A;  4ZVP B;  5KFW A;  4ED3 A;  4IQX A;  4WPA A;  1U1N A;  2HS4 A;  4RW6 A;  5HMY A;  2GJI A;  4KO0 A;  5CHC B;  4LF6 J;  2YNI A;  2KT2 A;  3SQG B;  3MXH P;  2QL7 B;  2NCK L;  3GFY A;  1UVI A;  2RUG A;  1SJR A;  3ZXW A;  2J6T A;  4YN3 B;  5C24 B;  4ZVS B;  3NS5 A;  4IUF A;  3IN5 A;  1FDN A;  1NO8 A;  2FB0 A;  2GHW A;  2YQ0 A;  3I9Z A;  1QVF R;  1CC8 A;  1RAA B;  3CCW A;  2WBR A;  4ZPW R;  4ZIW A;  2CXE A;  2EPI A;  2HRT A;  2V8P A;  3UVJ B;  1N36 J;  3N01 A;  3UDL A;  2WHO A;  4OI6 A;  2DNN A;  2MKS A;  2PII A;  4LSN B;  1VCT A;  4M8L A;  4YB5 A;  3M8Q B;  1R8C A;  4ZCM A;  2PO4 A;  3NS7 B;  3NCP A;  3CC2 S;  1UJ6 A;  3B4M A;  3CSK A;  2XUL A;  3PDN A;  4KAI A;  3HSJ A;  2Y8Y A;  4R5P B;  3OTD A;  1HAR A;  1U09 A;  2CDR B;  3HT3 A;  1OY9 A;  3AXK A;  3O2I A;  4I1T A;  5I3Q A;  2ZNY A;  4KGK A;  5AXL A;  2ZDP A;  1JLE B;  2CQH A;  4ZVT B;  5KFA A;  1VLO A;  1KKH A;  1NK8 A;  2PT0 A;  1NZA A;  1WKK A;  2YWH A;  3ITH A;  2RSQ A;  5GAE U;  4TNO A;  3W64 A;  2KKH A;  1K8A T;  4YME A;  5HAN A;  4DF4 A;  2GHP A;  1HPZ B;  1FDB A;  3PIP Q;  1C0T A;  3OLB A;  2NSC A;  2OUG A;  3C16 B;  4CWB A;  2NPI A;  3KFW X;  3PJW A;  1T9W A;  1G4C A;  2CJX B;  1EET A;  1M90 T;  3CUL A;  2N3L A;  1MW7 A;  1DJ0 A;  2CPH A;  2CWK A;  3HJV A;  3UCU P;  1X4A A;  1PJ7 A;  2PA8 D;  3BSA A;  3EGW B;  4RWX A;  1FA0 A;  3NMA A;  2QA4 G;  1HMV B;  3O6Q A;  4ILL A;  1CEZ A;  2C2M B;  3AA9 A;  4K59 A;  1F2G A;  3GJS B;  2DH7 A;  2EG2 A;  1T9X A;  4ICL A;  2OJ3 A;  2COL A;  4HTJ A;  3J7A N;  1U0H A;  2JNJ A;  2XSJ B;  3EZU A;  3OW2 R;  2AU0 A;  2HWI A;  1WEY A;  3TX8 A;  4KC5 A;  2BBE A;  3FRY A;  2HZV A;  2QSW A;  3MM5 A;  3UNY A;  4ZLP A;  1PKU A;  4C11 A;  1GT8 A;  1YZ7 A;  5SZT A;  1YK9 A;  1HNX J;  2MYF A;  1YBA A;  1ZPV A;  4X4P A;  2BEF A;  5A8K A;  1UJ4 A;  3DRR B;  2FHJ D;  4KE5 A;  5DDO C;  4YR3 A;  3M32 B;  4HH1 A;  2MQL A;  1TKX B;  5AJ3 J;  2W7P A;  3CMA S;  4MJK A;  4WE1 B;  2KXN B;  2I9S A;  4JI0 F;  5H9E J;  3JYT B;  4RJV A;  2XO7 A;  2G2O A;  2DGX A;  2FPH X;  3A12 A;  3K0J A;  3GMG A;  3DRS A;  3PG9 A;  4ZP8 A;  1LW0 A;  4C98 A;  1WOP A;  2XLI A;  4FP9 A;  5DG7 A;  2OIH A;  2UVU A;  2AGQ A;  1VC6 A;  2H3E B;  3DOM B;  1WDT A;  3FCW A;  5D0R A;  1B7F A;  2CVI A;  2HHX A;  3T9Z A;  1S6U A;  5EWF A;  2F4V J;  4PUO B;  2IA6 A;  2FVS A;  1VBY A;  1WF0 A;  1LV5 A;  2V4J B;  2UXC J;  3BF4 A;  1ULR A;  1NH8 A;  2W1B A;  4LR9 A;  3OR1 A;  3MTJ A;  1N6Q A;  4B3S J;  2I5J B;  1L3U A;  2HHV A;  2WVB A;  2ZZT A;  3BBB A;  4A8S A;  3MEC A;  5KFI A;  3ONQ A;  3BPD A;  2QYG A;  3GIR A;  3L7O A;  1TK8 A;  4NZ0 A;  2P5V A;  8ATC B;  4L3N A;  3DLH A;  1HNW J;  4Q0B B;  5LMN J;  1EQ0 A;  4UQT A;  2NUU G;  2ZJQ Q;  3OVA A;  2GCF A;  2XCA A;  1F6T A;  3UFC X;  5EN1 A;  1LK7 A;  4G3I A;  3GV5 B;  2Q6B A;  2XMT A;  3DM2 A;  4BC7 A;  2B9E A;  2I5J A;  5F8L A;  4FF2 A;  2HFU A;  4LFB F;  1Y0H A;  4X4Q A;  4OYO A;  2VC0 A;  1AFI A;  3C66 A;  4NYP A;  3WDO A;  4X2B A;  1OY6 A;  1CJV A;  1RDR A;  2KDO A;  2O01 C;  2YKQ A;  4DV2 J;  1HHS A;  3ZTP A;  2QG9 B;  3H25 A;  1U1R A;  1OJ4 A;  5L39 A;  4DV3 J;  2DPJ A;  2V4R A;  2RE1 A;  1WKJ A;  2C2Z B;  2NLW A;  3OVB A;  1CUL A;  1LXN A;  2V9K A;  4HH0 A;  5KG0 A;  6FDR A;  2EWH A;  2HRU A;  1J5O B;  5CCM A;  1W2I A;  1HNI A;  1UEU A;  2IAJ A;  5L9N A;  4DQP A;  1BE4 A;  3MM6 B;  4MYT A;  1U02 A;  1UTA A;  3S1T A;  1RA7 A;  3N6M A;  5KFO A;  2QLX A;  4ZJL A;  2VDI A;  5KFC A;  3DMJ A;  2B9W A;  1T9V A;  2LXU A;  4CT8 A;  1WC5 A;  3QZ8 A;  3RR8 A;  1AA1 B;  1FEE A;  1H2T Z;  4N7T A;  1N5Y A;  3HSG A;  4TU9 A;  2WON A;  2BV3 A;  4KPY A;  4Y34 A;  1I6J A;  4R0E A;  1X0F A;  1U2F A;  4KV8 B;  2KHD A;  2ZDO A;  3NGS A;  7FDR A;  5G0R A;  4U6P A;  3GWC A;  3JS9 A;  1RT2 A;  3LGM A;  3G8Q A;  2X1A A;  1P6T A;  1U2C A;  3R5J B;  4FS2 A;  2D3O 1;  2W2P P;  3SSQ A;  3W63 A;  1O6X A;  3UN3 A;  1I5O B;  4DV0 J;  1QE1 B;  4DR4 F;  1HMV A;  1TAQ A;  3AOC A;  4NI2 B;  4DPT A;  1N0V C;  4A8F A;  3N4W A;  2FJW A;  3EYZ A;  5HMW A;  2NXN A;  4QW9 A;  1NH7 A;  4NCG B;  4PYA A;  3HK2 A;  2B43 A;  2CNK B;  4M63 A;  4ED0 A;  3HDS A;  3MR3 A;  4XO0 A;  2FY1 A;  3MED B;  4LF5 F;  3AA8 A;  4I2P A;  1WHX A;  2I8E A;  1N48 A;  3I5B A;  2XO6 A;  3BO3 A;  4CLZ A;  4Y6I A;  1UAW A;  4TY9 A;  2FLN A;  1IWA A;  1YJV A;  5BYR A;  5BR8 F;  3PHE A;  1TFW A;  4I2Q B;  3DXS X;  4URG A;  5GVQ A;  2UZA A;  4NA3 A;  2DY1 A;  4DZ6 A;  2J7K A;  2FLL A;  3OUY A;  2GVZ A;  5IM0 A;  2PN6 A;  2LQJ A;  2LFV A;  3KK2 A;  4DV6 J;  3CNQ P;  4H54 A;  5E3C A;  2CAJ A;  3CCZ A;  1HNZ F;  1Y3J A;  4LQ9 A;  2V8G A;  5A76 A;  3K7R A;  3ENW A;  3SBM A;  1E6Y B;  3T5L A;  3T5K A;  2MKY A;  1RAB B;  5K20 B;  2HFZ A;  4CO0 A;  1U0S A;  4K4Z A;  4UF4 A;  1XMB A;  2ZUG A;  2NR0 A;  1S6O A;  2DHH A;  1LWC A;  4RLE A;  3I5A A;  2DGS A;  5IT0 A;  2FYX A;  2E66 A;  2AT1 B;  3A3N B;  4Z7Y A;  5L9X A;  4CH0 S;  1IQZ A;  1HWK A;  1JXV A;  1SQG A;  2EW9 A;  2V2K A;  3MPY A;  2B51 A;  1N5Q A;  2HND B;  1MWQ A;  1C4C A;  1PSD A;  1MN9 A;  1RSC A;  4LF5 J;  3G82 A;  4M95 A;  1ZZN A;  1B7Y B;  5JVH Q;  2PFD A;  2YBV A;  1RTZ A;  3ENA A;  3M6V A;  2RT3 A;  1LWE B;  3KLI A;  3MCO A;  2VUG A;  4TXS A;  2RB7 A;  3KK1 A;  2YKN B;  1S0O A;  1FJG J;  4CI0 B;  2GML A;  2BX6 A;  3T5H A;  3D68 A;  1KOO A;  1MWZ A;  3ZZP A;  1S1U B;  1YGY A;  2BJ1 A;  2C3M A;  1WC4 A;  2UXB F;  2HHS A;  4A8O A;  2C2E A;  2R8K A;  1CPZ A;  3VAI A;  4DV6 F;  3FBF A;  2YWG A;  4O3O A;  2DPI A;  2UVW A;  4ILM A;  1RB0 A;  2YNG A;  4CYU B;  1KRP A;  4AE5 A;  1VHI A;  2BQ3 A;  2DHG A;  1T05 B;  5M2P A;  1HFE L;  2VBX A;  1BWV A;  2K7J A;  1N88 A;  3EXC X;  3GE9 A;  3GSD A;  3LP2 A;  3CMQ A;  1R8A A;  1IM4 A;  1FE0 A;  1WOS A;  3DRS B;  5A8R A;  1S0M A;  4LF1 A;  5I3U A;  2XMM A;  1N5T A;  2YNH A;  4C0B A;  1S6Q B;  1UEV A;  5E5N A;  2QN6 B;  1WSV A;  3KLG B;  3RRG A;  1KBR A;  3CCJ S;  1GH8 A;  4FN5 A;  2GW8 A;  1UFW A;  4IG0 B;  3PW0 A;  2DRB A;  4NYO A;  3IBC B;  5I42 A;  1SKU B;  3NWG A;  3LO3 A;  2OFG X;  1GFW B;  4OMF G;  2XM3 A;  4ZHR B;  3MMB B;  1TL5 A;  4FYD A;  3BJY A;  2R2T A;  2DR5 A;  2AMC B;  4J9O A;  3FNN A;  3LPY A;  4CLF A;  1TV6 A;  3H5X A;  2Y1J A;  2EC0 A;  1FFW B;  2OPQ B;  2IVF B;  2E5J A;  3EM1 A;  5D77 A;  5ITH A;  4XPE A;  2RDD A;  5G0R B;  4CO2 A;  1OO0 B;  3Q8S B;  1ITP A;  2DO0 A;  4MIA A;  1XER A;  3KWM A;  4B08 A;  2CQ4 A;  1S99 A;  4OZ1 A;  1D9A A;  5EX0 A;  1E6V A;  3J7Z 5;  1U8S A;  1VQ8 S;  4R0J A;  4U8Y A;  2CJQ A;  3G2X A;  1DTQ A;  5CYM A;  3W62 A;  5DDQ C;  1VQK S;  3PM9 A;  1G2E A;  4O3Q A;  1YHQ S;  2BRK A;  3NGK A;  3V81 A;  2BAN A;  4M1K A;  4DUZ F;  2H5E A;  1FNM A;  1N56 A;  2BE2 B;  4NCB A;  4USK A;  1H73 A;  1FES A;  4OYM A;  4ZCL A;  1F5C A;  4OYX A;  1B0T A;  2PE8 A;  1J5O A;  1SI9 A;  4ZDN A;  2ZHA A;  3CCR S;  2JH3 A;  4Y00 A;  1FD8 A;  2AX0 A;  4PR6 A;  2IBO A;  4YY3 J;  2MLY A;  1CQN A;  1VLY A;  4L75 A;  3JSM A;  3RRK A;  3IRX A;  1HI0 P;  1RAI B;  1KC8 T;  3JAM U;  2BKN A;  2DGW A;  3EZ5 A;  5KFV A;  3M2R A;  2H4W B;  4M5J A;  4CM2 A;  4WU3 A;  1JLG A;  3R8Y A;  4V19 X;  3MEK A;  5CCL A;  1TKZ B;  4OZL A;  1M5O C;  4LF9 J;  5IWA F;  2JVO A;  2KZM A;  2ZWP A;  2N7Y A;  2GQQ A;  3G82 B;  5ADZ A;  3KMS A;  1BLU A;  1A7G E;  2B4U A;  2DXE A;  3MPV A;  4OZ3 A;  5T41 A;  3V6D B;  1VQP S;  5LSO A;  4QU6 A;  4NLG A;  4LBP A;  2HGL A;  4QU7 A;  3LP1 A;  4JV0 A;  2ZOF A;  2KRB A;  3A8J A;  3BEG B;  3D0I E;  3H2U B;  1Z4U A;  5KFM A;  1RAC B;  1JLG B;  3MCS A;  4DV2 F;  5BXI A;  2E7W A;  3MEC B;  3GR0 A;  3BGO P;  3HLU A;  4K4Y A;  2F8M A;  2OO4 A;  3B82 A;  1FRL A;  3E01 B;  3POT B;  1FD2 A;  1IKY B;  1FEH A;  2EFV A;  3NGU A;  4B3T J;  1NRK A;  3PFO A;  2H51 B;  4IFY B;  5LL6 d;  3OHA A;  3BSN A;  3NCR A;  3U1M A;  1U8W A;  2MEW A;  2FTR A;  2CPD A;  3MM9 B;  4ES3 A;  2V6A A;  1X5T A;  1I94 F;  1OYD A;  4F26 A;  1X4F A;  3MR7 A;  2QA2 A;  4RU9 A;  2BM1 A;  3A4T A;  4FKY A;  1S48 A;  4UZB A;  2ZJR Q;  1QM9 A;  1WI6 A;  4DN9 A;  3M7V A;  3M2R B;  3MR5 A;  4XDD A;  4P52 A;  1Q53 A;  5IC6 B;  3ZNU A;  4YDD B;  3TZY A;  3CJ3 A;  1WI8 A;  2VIC A;  2XB2 D;  3FCH A;  4WFZ A;  1JLQ A;  3BYR A;  3DOK B;  4K5R A;  5E2Q A;  3C15 A;  5DZ7 A;  4QYZ J;  3Q0A A;  3HFZ B;  1HBU A;  1RAD B;  5A8K B;  2KH9 A;  3C14 B;  4J9P A;  1BGX T;  2AYG A;  2GO8 A;  4TU7 A;  4OZ5 A;  2MQ8 A;  1IKW A;  1RT5 B;  3FJ2 A;  3MM5 B;  4RW7 A;  5HAT A;  5J2P B;  4U8V A;  2LXI A;  4DV0 F;  1VRT B;  2I0X A;  2ZOG A;  2E9R X;  1DTQ B;  1SV5 B;  1YBU A;  1VMB A;  2DNM A;  3C14 A;  1DRZ A;  4IOA Q;  4TQS A;  4RUC A;  2DO4 A;  2R7X A;  4ECU A;  4IG0 A;  1RYS A;  2R7Q A;  4Q5V A;  5KG1 A;  4MKY A;  1MLA A;  3J7Y I;  1RT2 B;  3TUP A;  1XR7 A;  2HFS A;  3VZI A;  2HHP A;  1HBN A;  3UDE A;  5HP1 A;  5DG8 A;  3GYN A;  2MKI A;  4KY3 A;  4RW9 A;  1TR0 A;  3H2L A;  1HBM B;  2CIM A;  3GU0 A;  4YB6 A;  3THP A;  1SKS A;  3W9H A;  1RWK B;  1OPI A;  2V8V A;  3F44 A;  4P6Q A;  2FIU A;  4C48 A;  1LNQ A;  1JLQ B;  5L1K A;  3CJS A;  5D15 A;  4OYA A;  1S1V A;  3THV A;  1NK9 A;  1L3K A;  4Q44 A;  2Z8Q A;  1RHJ B;  4NEZ A;  3CD6 S;  3MUV P;  1HNZ J;  4DI6 A;  5A6P A;  3GTY X;  3EMT A;  2B0G A;  4H4K C;  4FYY B;  4LF7 J;  1BHN A;  4QIW D;  2XGQ A;  3LP1 B;  3M2V A;  4PG4 A;  5CZV A;  3EUN A;  5D4L A;  3UR3 C;  1JLC A;  5CAB A;  3CC7 S;  3C46 A;  3M8Q A;  3B8H A;  5IFM A;  3EGN A;  4EK2 A;  3QRQ A;  5KG2 A;  1GMU A;  2ROG A;  4LSN A;  3F73 A;  4JI1 J;  3VAK A;  1N54 B;  2WOM A;  1HQE B;  1RT4 B;  3I96 A;  2AHO B;  3IWL A;  5KFY A;  4K4W A;  1UPM B;  4Y2K A;  1VFJ A;  3D66 A;  1DAX A;  2DGT A;  3P4U B;  4YR2 A;  2CG4 A;  3TO8 A;  4WKY A;  3ENQ A;  2FHO B;  3FCV A;  4AL6 A;  1U1M A;  2KVI A;  5F8H A;  1SH2 A;  2RJZ A;  1UVL A;  3SYZ A;  1S0V A;  2ACY A;  4ITS A;  4CO1 A;  2AJ2 A;  4LRC A;  3KLH A;  3M8P B;  2Y0B B;  2F9J A;  2LDY A;  4N77 A;  2V69 A;  1J2V A;  4EYI B;  2MB0 B;  5IT4 A;  2VKZ G;  1S6P B;  5DQH A;  1DBD A;  3QT7 A;  2B56 A;  1TVR A;  3M1V B;  3G6E S;  2R42 A;  3DDK A;  1FWL A;  1K73 T;  1X8D A;  2IJN A;  3T5J A;  2VFU A;  3PW7 A;  4MFB A;  3CPW R;  3RU0 A;  4G1P A;  2PMZ D;  4HDG A;  2UXB J;  3R5B A;  3ZZT A;  3QO9 B;  4NLU A;  2E5I A;  3SCL E;  3CME S;  2HHW A;  1NK5 A;  4OHZ A;  4ETX A;  3T1Y J;  4U95 A;  3GJT B;  2ATL A;  2DXD A;  5L46 A;  3HHL B;  2DEI A;  4PXB A;  1LXJ A;  1RWM B;  5DLG A;  1Y5L B;  4Y28 C;  4EWT A;  1UFK A;  4XTT A;  2V34 A;  3OTC A;  5AT1 B;  4O3N A;  4ZK7 M;  2AYM A;  2CQ2 A;  3MEE B;  4CIO A;  1VC5 A;  1XMO F;  4FDF A;  4F0M A;  3EXY A;  4CNY A;  2IPO B;  5J2Q A;  1OWX A;  3KDO A;  4F0K A;  2YQ3 A;  3PEH A;  2OP5 A;  2W24 A;  3FQK A;  4RPF A;  4M5K A;  3UNG C;  2L41 A;  1Q7L B;  2JRS A;  1REV A;  3EVO A;  4HAC B;  3B4D A;  1D9F A;  1UL3 A;  3W5X A;  5JMN A;  3SQO P;  3R5G A;  3KLG A;  1VQO S;  2VF3 A;  3P49 B;  1HD1 A;  4NLD A;  2IM2 A;  3EWG A;  2R2U A;  4QWB A;  4QPT A;  3VGV A;  1RHK B;  5J2Q B;  4E2F B;  5J2P A;  2JSX A;  2W4C A;  4YUD A;  5IXU A;  2CPF A;  4QJV A;  4F3O A;  4CLP A;  4BDP A;  1ZA1 B;  1RAG B;  2JFD A;  2KI2 A;  3GFH A;  4NI2 A;  4DLG A;  2XMW A;  3ZC4 A;  1VQ9 S;  1KON A;  1PJ6 A;  2VFR A;  3W5Y A;  2F9D A;  1HIY A;  2HBR B;  2CPE A;  5GAG I;  2R8H A;  2BDP A;  2XS7 A;  4DL4 A;  5IOL A;  5E33 A;  1S9F A;  3C6U A;  4DN0 A;  3FBC A;  4M5D A;  2FC8 A;  1HWU A;  3D0H E;  2BJ8 A;  2CVE A;  2CPJ A;  1HNV A;  1QD1 A;  1KLM B;  1V3S A;  3HF5 A;  3MCN A;  3FBB A;  4FNH A;  2R7U A;  4DG1 B;  1EZZ B;  3G9C A;  3ILI A;  1XMO J;  3QMQ A;  1LFW A;  3UD4 P;  1Q8B A;  4GKJ F;  3HO1 A;  1EQM A;  2YX4 A;  3B54 A;  1O8B A;  3NCQ A;  5KFT A;  2Z2M A;  2GS8 A;  3CDW A;  2W9B B;  5F8I A;  1Q7Y T;  3KUE A;  1WHV A;  1WEL A;  2GJ2 A;  4RWW A;  2HK2 A;  2UUC F;  4DR6 J;  5F8N A;  3V6D A;  1Q1K A;  5HVH A;  2J8A A;  1QSS A;  5HQL A;  1RT3 B;  4DLE A;  2HBY B;  1SUQ B;  3OJU A;  1FDD A;  1RJJ A;  3W8G A;  1LWC B;  2JFK A;  3K17 A;  4KRW A;  3IM9 A;  4CLL A;  2VG6 B;  2E1A A;  2P8I A;  1JLA B;  1PO6 A;  1VIO A;  2AKW B;  3M9M B;  2ASY A;  2DNH A;  3B78 A;  1X7V A;  4B9S A;  4PAA A;  1CUL B;  3MUR P;  2HWH A;  3MAQ A;  2FDN A;  2NZ4 A;  4LRD A;  5LJ5 Y;  1BXN A;  4DL5 A;  3JQJ A;  2J0W A;  3NBP B;  1Z1Z A;  4U9R A;  3V5R A;  2XC9 A;  4ER8 A;  1JLA A;  1NXI A;  2OEL A;  4DCO B;  1QUV A;  1BWE A;  1X9M A;  4DMZ A;  1IR1 A;  3DYA A;  3BSC A;  3HHL D;  2DT9 A;  4J9R A;  1LK5 A;  3FK4 A;  3AJD A;  4FXV A;  4IFV A;  2YNF A;  1R8B A;  3CVK A;  1GMW A;  2PDA A;  3F0N A;  3G87 A;  3K5P A;  4KGM A;  4LRB A;  5B0F A;  2IMW P;  3PR5 B;  2WW8 A;  3R5C A;  4RNM A;  5FDL A;  1REG X;  1YJU A;  2MGZ A;  1K9M T;  1Q4R A;  5K14 B;  1RLC L;  1RT1 A;  2Q1L A;  1EHW A;  1SJF A;  3PVX A;  2R7V A;  3OXG A;  3HFK A;  1UEK A;  4KH0 B;  4HHJ A;  8RUC A;  2HSE B;  1OSC A;  2KYX A;  3FRZ A;  1FTC A;  4J5O A;  5DDR C;  2ZJP Q;  2VZ9 A;  1LWX A;  4NE9 C;  4WBF A;  2M88 A;  4RW4 B;  5LMU F;  4KIA A;  1D9D A;  2Y8W A;  1XNQ F;  1NK6 A;  1N4L A;  4JI6 J;  3NG8 A;  5L1L A;  3LH2 S;  1IBM F;  4PKD B;  3W7B A;  2J0Q D;  3EGZ A;  5E3P A;  1NSA A;  3R7N B;  4ATN A;  1CQM A;  3GJR B;  4JI2 F;  3HHK A;  2DJW A;  3LAN A;  4C4W A;  5DET A;  3NP5 A;  4MMO A;  2M3D A;  2MY8 A;  2YXL A;  2HLT A;  4FVC A;  1EB0 A;  1NKE A;  3HVT A;  4MKV A;  3MMB A;  1R8H A;  5KT2 A;  1MU2 B;  3GPA A;  1UZH A;  2HLU A;  1P1L A;  2HG4 A;  4OX6 A;  2EI5 A;  3I0S A;  5CH7 B;  5KFS A;  3DLG B;  2RKI A;  3TEG A;  5D0E A;  5E41 A;  1VQ4 S;  4YB1 P;  1YJT A;  3OFH A;  2HEK A;  3DHX A;  4L74 A;  1MN7 A;  4LVO P;  4AND A;  3GFX A;  4YEA A;  4PRF A;  3CO9 A;  3TVZ A;  5DS7 A;  3M9N B;  3OLA A;  4B9N A;  2AP6 A;  3W3S A;  4F2R A;  1N36 F;  4OHV A;  4PG5 A;  1T9U A;  1WG5 A;  5CQG A;  2QE5 A;  4Z7C A;  4WCE Q;  2E5H A;  3LQV A;  4LRA A;  3GQC A;  3H0P A;  4DSF A;  1S0N A;  4ED5 A;  4HT5 A;  2J9E A;  2VPW B;  2M9K A;  1FDA A;  3K5L A;  3DU5 A;  3BGF A;  3P5B P;  4TKT A;  1LOU A;  1XN9 A;  4DUT A;  1AB8 A;  4IO1 A;  4F4Y A;  4F8R A;  2CA9 A;  2FHM A;  5BR8 J;  2YH0 A;  5C2C A;  5C2G A;  2EK1 A;  3DLK A;  2CNL B;  2L3M A;  4TLR A;  4BWJ A;  5ETL A;  3S01 A;  4UT4 A;  4WZM A;  3VQS A;  3EGV A;  4ANE A;  5CZX A;  3SCK E;  3RTV A;  1FRI A;  2A18 A;  2VL1 A;  4IH7 A;  3MF5 A;  3T9N A;  2WSE C;  3VVT A;  1FHT A;  1FVS A;  2KM8 C;  3H59 A;  3UWT A;  1NHK L;  2F1F A;  3CWJ A;  3H8Y A;  1PBU A;  1S12 A;  3NAH A;  3DYA B;  2FGC A;  3V6H A;  3BO4 A;  1BC6 A;  4JI4 J;  3LUY A;  4LFA F;  3GP9 A;  3J81 U;  1X4H A;  3I0R B;  4FYX B;  4IH5 A;  4U96 A;  4YFU A;  2HPU A;  1SJQ A;  1LWF B;  1R31 A;  2ZFH A;  4KKO B;  1K44 A;  3FMB A;  3BRE A;  3MFH A;  3PX6 A;  1RXO B;  2AYB A;  4NLV A;  4JI7 J;  5JUM A;  3SSR A;  5HLF A;  4QBU A;  1DTT A;  4X84 A;  4XK8 C;  2B8P A;  3UDC A;  4DV7 F;  2EK6 A;  4DR3 J;  2EFO A;  2R8J A;  2VOD A;  1N6Q B;  1YDL A;  4WXW A;  4UZC A;  5J2M A;  5KFD A;  1RTJ A;  2DNZ A;  4NCG A;  3C6U B;  2OMO A;  1QAI A;  1D8Z A;  2HGM A;  1HNX F;  2VA3 A;  5H9E K;  1M5H A;  5LT5 A;  1RYR A;  1FJC A;  4EZ9 A;  1IR0 A;  4OI3 A;  3R7S B;  1UZD A;  1PC5 A;  2CPY A;  4ZP9 A;  1IBL F;  2V2Z A;  3R6L B;  3ILL A;  2DR6 A;  1Q16 B;  2IJF A;  3FKB A;  2NRE A;  3H98 A;  2BAB A;  1V3Z A;  4IRK A;  2ZM6 J;  2CPX A;  2GIQ A;  2AEF A;  1R0B G;  4F3Q A;  5F3Z A;  2BQR A;  2F4V F;  3UI3 A;  4MTP A;  1J27 A;  3DRR A;  3T1A A;  1YRX A;  4ES1 A;  5KFP A;  4UQG A;  3I9V 9;  2HAI A;  2DR7 A;  2HHH J;  4LSL B;  2XNR A;  4LF4 J;  2RQ4 A;  4PZV A;  2EC2 A;  2E7X A;  2CNO B;  2JVR A;  3KJF B;  4FNI A;  3PHT A;  4ZP7 A;  2UV8 A;  2Q66 A;  4F4W A;  5KT4 A;  3OV7 A;  1XMQ J;  2XLK A;  1YRT A;  4UOG A;  4W92 B;  3C16 A;  4DV5 F;  1WC6 A;  2HMI B;  1Y10 A;  1Q5V A;  1RT7 A;  5HO4 A;  4E0D A;  2CQI A;  3NOG A;  4ZLN A;  3DN9 A;  3NWR A;  1HNW F;  5LMN F;  3M2U A;  1QLN A;  4ZCK A;  2ATC B;  2HIQ A;  3W65 A;  2HZC A;  2ZVI A;  4OLO A;  3RB4 A;  4F2S A;  3GIJ A;  4ELV A;  2ZH4 A;  1XR6 A;  1N34 F;  1V5V A;  5T7L A;  1H7X A;  4S0M A;  1CJV B;  4Y3C A;  1N8R T;  1NDP A;  2W9C A;  4DFJ A;  3M9O B;  4DZD A;  4CZC A;  3GIM A;  2W8K A;  2C2K B;  1FXR A;  1S5Z A;  4AT1 B;  5F0U A;  4XPC A;  4URQ U;  2K7K A;  2MQQ A;  2RDJ A;  3M1V A;  1HNI B; 
#chains in the Genus database with same CATH homology
 1PAU B;  2QLJ B;  3QNW B;  2H51 B;  4ZVU B;  1BMQ B;  5K20 B;  1RWX B;  4ZVO B;  2QL5 B;  2QL9 B;  2FQQ B;  1RHU B;  1QDU B;  2H65 B;  3IBF B;  3P45 B;  4LSZ B;  5IC6 B;  1RHK B;  3D6F B;  2Y1L B;  5IC4 B;  1ICE B;  3R7B B;  2XYH B;  2QLF B;  3R6G B;  2HBR B;  4ZVQ B;  2CNL B;  1SC4 B;  4ZVR B;  1RHQ B;  1RWN B;  3D6M B;  4ZVP B;  2DKO B;  4JB8 B;  1RWO B;  3SIP B;  2QL7 B;  3KJN B;  1NME B;  4ZVS B;  2C2Z B;  2HBY B;  2C1E B;  2QLB B;  2XYP B;  2HBZ B;  3IBC B;  1GFW B;  1RWK B;  3KJQ B;  1QTN B;  1I51 B;  3GJQ B;  4DCJ B;  1RHJ B;  1RWP B;  2H48 B;  1IBC B;  3NS7 B;  2CNN B;  4DCO B;  2H5J B;  3R7S B;  1SC3 B;  3RJM B;  2CDR B;  3R6L B;  2XYG B;  1RHR B;  4ZVT B;  2XZD B;  3R5J B;  2CJY B;  1SC1 B;  3P4U B;  1RWW B;  1F9E B;  2HBQ B;  2CJX B;  2CNO B;  3D6H B;  3KJF B;  2Y0B B;  1I3O B;  4DCP B;  2CNK B;  2H54 B;  2H4W B;  2C2O B;  2C2M B;  2H5I B;  3GJS B;  1RE1 B;  3R7N B;  1PYO B;  3GJR B;  2H4Y B;  3EDR B;  3GJT B;  2P2C B;  3EDQ B;  1RWM B;  2C2K B;  1RWV B;  1RHM B;  2XZT B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...