2H4WB

Crystal structure of human caspase-1 (glu390->asp) in complex with 3-[2-(2-benzyloxycarbonylamino-3-methyl-butyrylamino)-propionylamino]-4-oxo-pentanoic acid (z-vad-fmk)
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
88
structure length
88
Chain Sequence
b'AIKKAHIEKDFIAFCSSTPDNVSWRHPTMGSVFIGRLIEHMQEYACSCDVEEIFRKVRFSFEQPDGRAQMPTTDRVTLTRCFYLFPGH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Caspase-1
publication title An allosteric circuit in caspase-1.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/hydrolase inhibitor
total genus 15
structure length 88
sequence length 88
ec nomenclature ec 3.4.22.36: Caspase-1.
pdb deposition date 2006-05-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1470 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Caspase-like 2h4wB00
3KJNB 3D6HB 2Y1LB 1QTNB 3NS7B 3GJRB 1RHKB 1RHUB 4ZVRB 2FQQB 2P2CB 2XYPB 1F9EB 3GJSB 3GJTB 1RHJB 1RWNB 1RE1B 2Y0BB 4ZVUB 1RWKB 1SC4B 2C2KB 2QL7B 4ZVOB 1RHRB 4LSZB 2CNNB 5K20B 3R7NB 5IC4B 2H65B 1I51B 2HBQB 2C2ZB 1RWVB 2XZTB 2DKOB 1RWXB 2QL5B 1RHMB 1QDUB 3EDRB 1I3OB 2C1EB 2HBYB 3R5JB 3GJQB 2H48B 2C2OB 2XYGB 3QNWB 2QLJB 2CJYB 3R6GB 3RJMB 4ZVPB 3D6FB 1BMQB 2H5IB 3IBCB 2QL9B 1RWPB 1SC1B 2CNOB 2HBRB 2CJXB 1IBCB 1RWMB 2HBZB 4ZVQB 3R7SB 5IC6B 1RWWB 2CNKB 3KJQB 3P4UB 2H51B 3R7BB 3IBFB 1ICEB 1SC3B 3P45B 3KJFB 3D6MB 2H5JB 2H4YB 2H4WB 2H54B 1NMEB 4JB8B 1PAUB 1RHQB 4DCPB 1GFWB 3EDQB 2QLBB 1RWOB 3R6LB 2QLFB 1PYOB 2XZDB 4ZVSB 4DCOB 4ZVTB 2C2MB 2CDRB 2XYHB 2CNLB 4DCJB 3SIPB
chains in the Genus database with same CATH superfamily
2UUBJ 4O4GB 1RUSA 3RUBL 1B64A 4NXMF 4DSEA 3MMJA 3FNNA 3RBZA 3CJ2A 2I0XA 3D1HA 1PCAA 1URNA 3M9NB 2XLJA 1GEHA 1SKSA 2E7WA 2G4BA 2HQDA 1F5AA 1VRUA 3QAUA 2DCUB 3RTVA 2FHOB 1B3TA 2WBMA 1RTHA 5D0RA 4OI6A 4DL4A 1SL2A 2IM1A 1NLKL 3KNAA 4R25A 4ZLPA 2Z57B 4FPIA 2IRXA 3PYDA 3BPSP 4LSNB 4F3MA 1VQNS 3DDKA 4HT7A 3QO9A 3V4MA 3PZPA 2COLA 3UD5A 4LR8A 2CQ3A 4P9SA 3RAXA 5C2GA 3ZZZA 4OZJA 2BJEA 3DLLQ 5E3PA 1LWCA 2NREA 3AXMA 1B70B 5DDPC 3R7BB 2HRTA 5B7WA 1FHTA 4UQGA 2RRNA 2CJQA 1FJCA 2BX6A 2CG4A 1GFWB 1XMQJ 3KK2B 3EYZA 4DX5A 2J7KA 5L9XA 3RW7A 1IBMF 4ZITA 1YJVA 3MHYA 4ZHRA 5BXIA 3NS7B 1X9WA 3KLGA 5F8MA 1FNXH 3FQLA 5B0GA 2KKHA 3QIPA 1AROP 1VBZA 3T1YF 3PM9A 2VF3A 2DNOA 2NXJA 2YWWA 1VQ7S 2HNZB 3MPWA 2VG5A 2IVMA 2QG9B 5B0AA 3K5LA 2NSCA 5AE1A 3NRBA 3EXYA 1VQ4S 1K1QA 1S1WB 4LFCJ 2HVIA 1E6VA 1J5OA 3IGVA 1YITS 3NGSA 2LFVA 1Q0NA 4NL5A 2B7CB 1ZA2B 3N6MA 5GADU 1X7VA 4OFZA 3GQCA 4Y2IA 3UR3C 3HVTB 3V4IB 2GGPA 3IR7B 1IBLJ 2G0JA 3EE3A 1Q81T 1T9TA 3MCNA 3T19A 4EBEA 1SKWA 5GADI 5HLFB 2KM8C 4BC9A 2X1BA 2RHQB 4ZPCA 3PX6A 4RUAA 3G4SS 1VQOS 4FXVA 8ATCB 2WONB 1X4FA 4AQYJ 3Q8RB 2BM0A 4Y2CA 2LYVA 3KG4A 1YQHA 3A13A 3W9HA 2FTRA 3IC1A 3M05A 1RK8A 1XEZA 3PFOA 2I8EA 1KVIA 2J9CA 2DR5A 3OL6A 1BWEA 3UI3A 4KV8B 2IA0A 2E1MC 3LANA 1VQKS 1HA1A 3QGHA 1U0HB 2E5LJ 2A2DA 2EG1A 4DPYA 2FVRA 5CYMA 2ZE2B 3M7VA 2AW0A 2E1AA 2AJ2A 3OVSA 1I94J 5D0EA 2OI2A 2CQCA 3JXOA 4RW6A 4WKYA 3GIKA 2BJ9A 3P6YC 4R5PA 4IG3A 3IM9A 3KLVA 3OW2R 2MZJA 2ZJQQ 4W90B 5EWGA 3SFUA 3N28A 1HI0P 4K0KF 5G0RB 5DDRC 4R0JA 3HHLB 4F67A 3H5UA 2WSCC 4NE9C 3NGTA 3C46A 4G1PA 5F8NA 5LMUJ 4LVNP 4NI2A 4USMA 3J81Y 2A6MA 2YH0A 1NJZA 2IVFB 4DUZJ 2ZITA 4P2FA 4USIA 1O8BA 5IT9Y 4Q7AA 4QCLA 1RKIA 2CXEA 2M7SA 4B3TJ 1GMUA 4BC7A 1RT6B 2CKWA 2ROGA 4K2JA 2QFJA 2DHSA 2F4VF 2NXUA 2FVQA 3R3TA 3CDWA 4KJIA 4HT5A 4PRFA 1WKKA 5DLFA 3BZQA 2VA3A 1N48A 3M1VA 1T95A 3IBCB 1U45A 5HBMB 5KG1A 3D28A 4K4ZA 1RWMB 5DGAA 3V81A 2XS2A 2BE2B 2DR9A 4RU9A 2H4YB 1HWLA 1XNRJ 1XR6A 2V5HG 3QJLA 3OLAA 3DRSB 3E2EA 1M5HA 1VYAA 3H4DA 5HMXA 3NAHA 4DUTA 3PW0A 2RSQA 3OR1B 1FF2A 2GVDA 2ADBA 2IJFA 3KK3B 3FBFA 4NLYA 5F41A 2XHWA 3Q24A 4ILLA 5KFRA 1FWPA 1Q7LB 2F63A 4KH0B 4IRDA 3U27A 1M90T 3G6YA 2AIRB 3L09A 1Q5VA 2VG7A 2ZFHA 3TNVA 3K7RA 2YNGA 3Q89A 1FRIA 1RAJA 4JI1F 1QTMA 4X4OA 2JRSA 3GCXP 2GFFA 4EZ9A 2WVEA 4NLPA 4DV7J 3JB9k 4O3SA 4NLOA 3IO1A 3RBDA 1NDKA 3CCJS 3VAFA 3NLCA 2VG6B 5ITHA 2G2OA 1SV5A 4Q44A 4ZOSA 1L3VA 3RYLA 4TQRA 1PO6A 5K5MA 2UUAJ 1U25A 3W9IA 1ACMB 1U1LA 3BDPA 3Q0AA 2J0QD 2ASYA 2LA6A 5HI7A 2MPUA 1JLAA 2RU3A 2IMWP 4NOHA 3SSSA 2FJWA 4RW7A 1VFJA 1UA0A 1XR5A 1TKZB 2B0GA 4XAKA 3LH2S 1R8HA 4EBDA 1UPPA 1RE1B 2ZD1B 5KFGA 4K4VA 4FZVA 2ZC3A 3ETOA 3HHEA 3QIDA 2MJUA 3BYRA 1RT5B 1HWJA 1HQEB 5KFXA 2CFXA 2FIUA 1D9AA 2CZVC 3NGUA 5FIIA 2RF2A 4D3GA 3JSRA 5A8RB 2XZTB 4JI5F 1HR0F 2LEBA 2IMOA 2HEKA 3FFIB 4DV0F 2EI5A 2YX1A 4ED7A 4ER8A 3VHQA 3GR0A 5I3UA 3VZHA 4DV3J 2QL9B 5KFKA 3C16A 1WTBA 1U1PA 3UE2A 5BYQA 2BANA 2MY7A 3ILOA 2VPZB 4JI7F 1FXLA 4I68A 4CZCA 2H4WB 5D78A 1Q8KA 4LF2A 2IYIA 2V6AA 3UVJB 1UPMB 1JNRB 1Q95G 1WORA 3VZIA 1Z2ZA 4FVMA 3MAAB 1GTHA 1NHKL 1M5PC 2FJVA 3EX7B 4L3KA 3GIRA 3Q8QB 1T3NA 2I5JA 5DO2A 3EM1A 5KAKA 4NLUA 1YGYA 4Z2XA 5KG0A 3D1OA 2OMOA 2X1FA 2QO3A 4LSZB 5AE3A 5IC4B 1NKBA 2UV8G 3U1MA 4AUKA 1VMBA 3ZTPA 2ZZMA 2HIYA 4QU6A 5F3TA 2CPYA 4HLBA 3GJQB 4O44A 2BQUA 1YJ7A 4WK1A 3CNQP 5LJ3Y 2YH1A 5THWA 3I6PA 4ZPBA 3VAGA 4ZCLA 5B0FA 2VU5A 3BO2A 1X4EA 4S0MA 1HNIA 3D4JA 1N6QA 4QW9A 2O3DA 4QWBA 4CLLA 3NWGA 2HNDA 4Y3CA 1JLFB 4OHZA 2XY6A 1R43A 2OMLA 1S59A 1K73T 1FK9B 1JLQA 5DZ6A 4G1IA 1JIHA 2J0XA 4Y34A 4FBUA 1OY6A 3D68A 3EICA 1WKLA 2XMWA 3FBBA 1NCLA 1OPZA 2ZOFA 3JSMA 2XG8A 1U8WA 4KFBB 3DU6A 5DM7Q 2W4PA 3GYGA 3CC7S 1KQKA 2VQEF 3KUGA 2HHUA 1P1LA 1NPPA 1IJEB 1QLNA 4U6PA 3DMJB 4RBVA 3L9ZA 2HAFA 4TXSA 4PKDB 4EI2A 2BXJA 1HWUA 4ZP7A 1IWAA 1KR4A 5DRKA 1XK8A 3KJQB 3DLKA 2MQOA 4OX8A 3TEGA 2V50A 2DGUA 1U6FA 1RT3A 4L75A 2MSTA 1RKJA 1Y3KA 2X7IA 1FKOB 3A1YG 1RT7A 2KRRA 4RW8A 5HVHA 4OYIA 4X2BA 3CCRS 2UUTA 3VGVA 4CI0B 4DXLA 1S4FA 1HMVA 3BEGB 2B8QA 2XY7A 2AD9A 2V4QA 1VRUB 1Y4ZB 3HLUA 3J81j 1UJ5A 3L7PA 2ADCA 2K3IA 3CTRA 1N56A 2A6OA 2RAQA 2KRBA 4LF1A 2OEJA 4J90A 3NS5A 3GFYA 2UVRA 1IXKA 2J76E 4NA1A 2LU1A 5IM0B 2Y0SD 3QO9B 3CE8A 3UDCA 4L73A 1LWEA 2NS1B 4A4JA 1IQZA 1GXLA 3QQCD 4B3MJ 3UNGC 1YG0A 1IWGA 5IC6B 1FJEB 3FCWA 5KFEA 1KN6A 1KBRA 1WTFA 1OSDA 3ZZOA 2R7SA 3MMCB 5ETTA 2VQFF 2L08A 2DNMA 4PWWA 3W9JA 5K8NA 4RR5A 1JNZB 4LQ3A 3EGZA 2W9BB 5L1LA 1EX8A 4ZHRB 5J1PA 3MM6B 4ZLLA 1LXNA 1VQ6S 3KLGB 1RHUB 4YB5A 4J9UE 3Q83A 3QIPB 1AB8A 2RHSB 1J2VA 4DJBA 2VG5B 1OQ3A 1I51B 5E33A 3FCVA 3GU0A 4YR3A 1HLWA 2DNYA 4ANDA 4N41A 1UEUA 1J5OB 3FBEA 4X65F 3BSAA 3L3CA 4LF8F 1SXLA 1QM9A 3HSGA 2DITA 3CJ4A 2CJXB 5HVGA 2GGPB 1NRKA 1W2IA 1UJ6A 1VBKA 4V19X 3GLJA 3S1TA 1T94A 3D2WA 3AHPA 2MQNA 3LAKA 5CAAA 1W2BR 1VQMS 2Y9HA 3PEHA 3PJXA 4LFAJ 4NZ7A 3ZTSA 4ALZA 1TTHB 4FVCA 1HNXJ 1N34J 4BLGA 3J7AN 3DU5A 3K5MA 3FDSA 1RT1A 2ZH4A 3PYGA 2P9EA 5KFMA 3JTOA 3VV2B 1L5UA 3D67A 4DUYJ 2XYPB 3QT8A 3B78A 2L48A 1LWFA 2ZC4A 4FNHA 1HD1A 2ACYA 1EP4A 1R8BA 2PO4A 1UA1A 4FYXB 2N82B 1ZM3A 1TL3A 4M5LA 2MKKA 5EUHA 2D1CA 1LEOA 1U0SA 2AV5A 9ATCB 3M6XA 2UXBJ 1C0UB 1LW0B 2DXEA 3TWZA 2XTJP 3DRRB 5KT4A 4IG3B 2M9KA 1REGX 1UWBB 2B9YA 3GYXB 1WOOA 2U1AA 2R7XA 2OPPA 2OHDA 3IS9A 2ZVSA 1UVNA 1IR2A 1XBWA 4K4XA 5GMDA 1KQGB 4HDHA 1FCAA 2QSWA 1B4SA 2HZAA 3BBCA 2KG1A 5JVGQ 4K50A 2GZOA 4NWBA 2XYHB 4DZDA 4X4TA 2PE8A 3EPGA 5ETSA 1N0VC 2EFNA 1HWKA 2PEBA 1FRXA 3ETMA 2RQMA 4MH8A 2Y3YA 2Y1JA 1LKZA 4RWXA 1SL0A 2YWHA 3Q22A 1N54B 1PKUA 4AXJA 2R7UA 4ZLJA 4LIWA 1VR6A 4AT1B 1NK8A 3UPFA 2FZCB 2WB4A 1QDUB 2CVIA 1IVZA 2RS2A 3QMQA 4L6V3 1UFKA 2GQ2A 2N4DA 5KFWA 3AOBA 2K06A 4ZDNA 2XZWA 4NRUA 1SJFA 2QIFA 4P52A 3A4TA 4XO0A 1RU1A 1G2EA 4DV1J 4RW4A 4F50A 1QAXA 2JC1A 3K57A 2MGZA 4ZS6A 4N56A 4N77A 1N32J 4V1Ak 2CPEA 2HZCA 3IA0A 1QSYA 5C42B 3KOAA 4QR0A 3M8WA 2BQ3A 1KRPA 2Y0BB 3PRBA 2QL7B 3CIMA 2DGWA 4M5MA 3PIOQ 1H73A 1S0NA 3KFWX 2V0NA 3BGUA 1TAUA 1BQMB 3BJYA 4FKYA 3NG8A 4ZA1A 1CSJA 2CQ0A 1IKXA 1LK7A 2YNGB 2VODA 1CJKB 5CZVA 4DQPA 2HVHA 1KLMA 4ECSA 2FGOA 5IFMA 1GMWD 2HBZB 3CCUS 4C11A 5LMNF 3GONA 3RRHA 4C98A 4UF4A 4ZN3A 3GYNA 4PQUB 3MEKA 3W60A 4MIBA 1ITPA 4F36A 3CO9A 4JB8B 1WOPA 4TNOA 4C4WA 5A8KA 2XZDB 1GQEA 1JLAB 1X4BA 2P9GA 5FJ4A 1B7FA 4RW7B 2EPIA 3I82A 4OI4A 2HG4A 1IBKJ 5J2NA 1G6BA 2DNNA 3ENVA 1HBOA 2FQQB 1BQXA 3CWJA 5GAEU 4U8YA 4ZVUB 3SDEA 1NZ8A 4JI8F 2L9WA 2WOMA 1K0TA 1ZPVA 5KT7A 4Q2LA 4A8WA 4MFBB 1MWQA 1VK8A 1HHSA 1AXQA 3T41A 3MOZA 2FJBB 4C3KA 2HK3A 3TQ1A 2C2NA 5I3UB 6FD1A 4LIRA 3IN5A 2YNFA 3C16B 3TA0A 5ETKA 4C97A 4FF3A 4NA3A 3ZZTA 2CNKB 4LSLA 2R42A 1FERA 4JI2F 1VK3A 1Y00A 2VBXA 4OYZA 1S57A 4I69A 4DDFA 2BJDA 3CCQS 2OIHA 1NJXA 4I2PB 2M5YA 2XEXA 4KBIA 4Q2MA 1CVJA 2RQCA 3MM9A 1RT2B 2IJRA 2Z2ZA 5G4DA 4J9VA 3J7ZT 2Z8QA 4WTYA 1S1TB 3GB0A 2E5HA 5HL7Q 3W2VA 1URRA 4XDDA 1JLEA 2CA9A 2HHHJ 2QFIA 3LP0B 3GIJA 2BA9A 2BJ7A 1T3OA 4IH7A 2BJ1A 4FNIA 4X66J 3R8YA 5MAOA 4LF9J 1VRQC 5EGYA 2V68A 3PTWA 1UTAA 3MMBA 4HYKA 1JXEA 4IFVA 3O2IA 5KFZA 3PEJA 1WC3A 1HNIB 3H98A 2DEJA 4CP5A 4C8YA 2UVWA 4H4KC 2KHCA 3CGIA 1K0VA 3OL9A 3QT7A 2UXCJ 4C2MA 4PG5A 1WSRA 1T05A 3CCMS 3HM9A 1JLQB 1RAAB 2YBVA 1M5SA 3MTJA 4RL1A 1APSA 4AL7A 1N33F 3GJRB 2LA4A 1YX2A 1WHYA 4X64F 3NMAA 2KL8A 4ED0A 1K1SA 2VKZG 2JEJA 2AQ4A 4Y2KA 3DDNA 2D41A 4IFYB 4NRTA 3H59A 4PYDA 2EK6A 2DIVA 4DSFA 3O1LA 4M63A 2QMWA 1SJQA 3TW0A 4J9LA 4FYVB 1WHVA 5IQ6A 5L8RC 5HJYA 3V5RA 4NMXA 1Z4UA 4RNMA 2B3TB 1U26A 4J9SA 1S0MA 4WU2A 3DLKB 3K5OA 3QGIA 4CNZA 2K2PA 1FDBA 4WE1B 1PAUB 2DBBA 2Q3PA 1VQLS 3BSOA 4HHHA 1RHQB 3MPUB 2KG0A 3MR2A 1CJTB 3CJ5A 3M8QB 3MM7A 2BOPA 2MMYA 1T9UA 3QGGA 1RT7B 4HVZA 4RW8B 3IWNC 1UJ4A 5E3AA 8AT1B 4NEZA 5C5JA 2WZ1A 3U7JA 1HMVB 1QSLA 3NNHA 5AXLA 4DN0A 3GE9A 4F2SA 4A8KA 2VHGA 1RISA 2GC8A 1RTIA 1CULA 1FI4A 1FKPA 4YP3A 2LDIA 2YQ1A 1TZ0A 2GCFA 3CDAA 2U2FA 1N5QA 4NYZA 2IRYA 2PSZA 4WF9Q 5DQHA 3SCJE 3DKDA 3TUJC 3VQSA 4URSA 3G8SA 4I6AA 4KHPJ 3ET6A 1U1MA 2V4JA 2ZDPA 2ALZA 2JEFA 3R27A 1R8AA 3D6MB 1BHNA 5EWEA 2FD2A 4K5SA 3DOMA 4LMZA 1IR1A 3CD7A 2XO6A 5BJRA 4M5IA 3I4HX 4OLPA 4B3SJ 3OFEA 1KONA 2V9WA 4PXEA 3KJNB 1TQLA 4RBTA 3K0JA 2J7UA 1RHKB 5CHCB 4DR1F 1C1CA 4ED6A 3M32A 5HP1A 2E29A 2E9ZA 4JV0A 1EZZB 4O3RA 1YZ7A 2IM3A 2NR0A 2R2RA 4ENOA 3DLJA 4LF6F 1XN9A 4HL9A 2MZRA 2M0GB 2BZ2A 2ZZTA 2VOOA 3DLEA 2C2DA 4ECUA 1KHVA 2LEPA 4ZCMA 1X5OA 1SL1A 4OZ5A 1YJWS 1U1QA 2OPRA 1UMJA 5HO4A 1CJVA 4P75A 3PY8A 2IC3A 4CDIA 1RXOB 3WBZA 1VHIA 4QIVA 2X3GA 4PPDA 3W2WA 4WFYA 3UFCX 1YRUA 2DXFA 4ED3A 2DISA 4FYYB 2FLNA 3QSYB 2XSJA 2KXFA 4ZKAA 4ZVTB 1NDPA 3Q8YA 4NZ6A 1RABB 1RT1B 3VGSA 1BD6A 3BH6B 2G9OA 1OQ6A 4UTGA 1S1VA 1VQ9S 2LLZA 2KT2A 2CWKA 5DQIA 2LXUA 2UXDJ 1MMLA 1ZYQA 4DF8A 5KFIA 2C2KB 2O5DA 1TKXA 2MY8A 1LQ9A 3DXSX 2LP4A 4CIOA 2KFZA 3C2PA 5I4MA 4G1QA 2FPHX 2KZZA 4DPTA 3PG9A 5SZTA 4L76A 3BO4A 1Q79A 2O01C 2ATCB 2EFQA 3ZTRA 1BQNA 2F40A 4C0OC 3KHRA 1X4HA 2GQQA 1ZPWX 2F4VJ 1S1UA 4U96A 4U7UD 5L1IA 1FE4A 5CYQB 3SCKE 4CWBA 1TR0A 3T5HA 2RUGA 4OMFG 5D4PA 2DRBA 3IS9B 2CQHA 5HMZA 3OSNA 3BSNA 4O4GA 4G6VB 4X62F 1FNOA 4C3LA 3W7BA 2M8DB 5KT2A 3I5BA 2HMIA 2RQKA 5EN1A 1MROB 3M8RA 1NSQA 2JZ5A 4LF4J 3RR8A 3UCZP 1WDDA 4I1TA 5HMYA 2JX2A 3UN3A 4AYBD 5E3CA 2BJ3A 3SI8A 5A6PA 2HS4A 4DR2F 1D0EA 3AFGA 3KK1B 1B0PA 5K20B 2GJ2A 3MR5A 2HGNA 3MFIA 2OP5A 3GSIA 1ZH5A 4OYBA 1PJ7A 1IKWA 3HVRA 2M70A 2MLYA 4IOCQ 2BMBA 4GO5X 4LBHA 4X84A 3AD7C 1RHMB 1KP6A 1KDNA 2VBWA 2XY5A 4JI3F 3EWGA 1I1GA 3HDSA 2ZH6A 4P2XA 1T9VA 4OZLA 1HL6A 1FFGB 3I5CA 4ED8A 4WZMA 2QX0A 1Z2LA 1GT8A 2AEFA 2QZ8A 3I87A 2MGZB 4P72A 2HNYB 1IUJA 2YXLA 2KM8B 1KKHA 4DL2A 4JI6J 3QSIA 2VA2A 4WU3A 1F9EB 5C7PA 5SUHA 2BDPA 1ZAVA 3ICLA 1VC5A 2CIMA 4WIIA 1R31A 3G71S 2B7BB 2SXLA 1Q4RA 2F4FA 3AT1B 2DNZA 3GCWP 2BQRA 1VQSA 3V4IA 3SZ2A 1NHUA 3DRPA 2G2ZA 2C1EB 3MCMA 3AB4B 1TVRA 5HLFA 1V3SA 1S76D 1TKDA 4IO9Q 3OQ2A 2HHTA 4RKUC 2XYGB 4JI5J 4QPTA 1KOOA 2NPFA 1KLMB 3G6XA 4I64A 2C3PA 2CNOB 2F8HA 3JS9A 2E1CA 1YDLA 3LGHA 1FNMA 1WG5A 4C11B 2RNEA 3D5MA 4LRAA 1FFWB 2FC9A 4B9UA 1CEZA 1RT4B 4GKJJ 5F8IA 2XMUA 4P73A 3DGPB 2DY9A 4JYAF 2Z0GA 3BO3A 4OZ3A 3RB3A 1I5OB 1U0HA 2FJEB 5A8KB 4ILMA 2VL1A 4F4WA 3QRRA 1M5OC 1WG1A 2RJZA 2E44A 2IRUA 2ZE2A 2QA2A 3TZWA 2MXYA 5HQLA 2UU9F 1U1NA 1HBOB 4J7CA 3NP5A 4P7TA 4ZJOA 3CPWR 4RO0A 3MI7X 2WOMB 3W65A 1IJFB 3LA0A 3R7NB 1FJGF 1T8EA 2DGVA 3VAKA 1M5KC 1C2PA 4B02A 3G6ES 3CDBA 4PXDA 3TAMB 2R3VA 2DNLA 1XC9A 1I6JA 3V6DB 2YQ3A 5GAHI 5BR8F 4KQZA 1RBAA 3ELHA 3GV5B 3TI0A 3HHLA 3GZ7A 2E5GA 3MAHA 3QPIA 2V8GA 4DQRA 2E66A 2YNFB 3LWLA 4RBUA 2AJQA 2VBYA 1HNWF 2KT3A 3ITHB 2Y8WA 3OJUA 2VFTA 2MKSA 4LRBA 2MQQA 4OX9F 4DR6J 4LFBJ 3G8TA 3UD4P 2CQGA 3IM8A 1KFDA 5I42A 5L1KA 1R3NA 3CB4A 3KLHB 3BV8A 3MM9B 4OZ1A 2RB7A 4P10A 1RT6A 5HQ8A 2JFKA 5D0HA 3W66A 1GXUA 2UUBF 2QLXA 2VOPA 1W26A 2H5EA 1NJIT 7FD1A 3NOCA 4JV2A 1NH8A 3AXKA 3W2VB 2PFDA 1JLEB 4USKA 4ITSA 3OL8A 2HURA 2ASDA 3NY0A 3TUPA 4DFMA 3AA8A 3J7YI 2AJFE 3PNIA 4RNOA 1FKAF 4B08A 3R5CA 5J2QA 1OY9A 2D3UA 3MMBB 2VH7A 5JXSA 1JLBB 4TQSA 4IFVB 4ZP6A 3I0SA 1SIWB 2HBRB 1YJUA 5CABA 2MZ1A 3PR5B 5DZ7A 1P9YA 3HHDA 3OR1A 2A10A 2HQGA 5IT0A 2FLLA 1UW4A 1ZTTA 1T05B 3DHWC 4F4ZA 4P74A 2XGQA 5B0BA 4A47A 2A18A 4QZVB 3S6EA 4GC7A 1XMQF 1J5EJ 1QAIA 5KG2A 4ETZA 4M5KA 4JI4J 3FSIA 5C24A 1PC4A 1HYSA 4LF7J 4DR4F 5JMNA 3AH6A 2Q1LA 4MK7A 3KYLA 2ZH5A 4F26A 5GAGU 3PO5A 4DV2J 2Q6BA 3UWTA 2AEMA 2VG6A 4ICLB 4B3RJ 2JDJA 4I6WA 2F1FA 2K7KA 1CG2A 3CIZA 4MYTA 4LFCF 3K59A 4DX6A 3T1HJ 3PXGa 2AYMA 1VQYA 1HIYA 1NJWA 4URQU 4U95A 1IBLF 3E3XA 1RYSA 1D9FA 3Q2SC 1WUUA 5KFFA 2UUCJ 4OV1A 1S9EA 4DV4J 3UN2A 3HD1A 2XMMA 4DZ6A 3R97A 3QAEA 1CBKA 2VQFJ 3CSKA 1PGZA 4QIGA 1RT5A 4AQYF 3AOAA 3GG0A 4M5DA 2ZJRQ 3R1HA 2DGQA 1DAXA 1GAOA 2ZH3A 2XWXA 4M8LA 3UCGA 2DY1A 2IAJA 3RBEA 5E3QA 3HKWA 5IXUA 3HSJA 4BCAA 3QWUA 3VAIA 1RTIB 2OUGA 1CULB 4NA2A 1K9MT 4PG8A 4D3HA 3CMES 1QD1A 2QL5B 4CO5A 3WX8A 1I94F 4OYPA 2NCKL 2BACA 5B0CA 1U1RA 2R2UA 2JLGA 3PJ9A 2H5IB 3TJAA 5HROB 4X65J 2AU0A 1TK0A 4XDCA 4LF8J 2PI4A 2AJ4A 3MAAA 3O44A 3CMAS 3GG1A 3DOMB 3TX8A 2NXEA 3TQEA 3H5YA 4YQWA 4AFFA 1U48A 1C1BA 5J2PA 3BR9A 2VPWB 3MEDA 2D9PA 5GMKa 3JQKA 4H4KA 4DFPA 1S99A 2OLWA 4Q8EA 5LMUF 1C1CB 1RHJB 3FMBA 1LWXA 1D9DA 2W1BA 3M32B 4OZ0A 3V6KA 3ILIA 3SMZA 2B4VA 3HCXA 4DUZF 4RW9A 3MEGB 2LECA 1KEKA 3KHGA 1HBNA 4ECTA 3B4DA 1HHQA 3HSZA 2V8DA 4B3TF 2ABYA 1VQ8S 4J9PA 5KG4A 2GVZA 1FDNA 2F9JA 2Q79A 3S8SA 4CYUA 2AGQA 2ZOMA 1UZDA 2XWYA 4UOCA 3TA2A 3MD3A 1CJVB 3MECA 2L3MA 3FCHA 2IC3B 3GMGA 3KTQA 5F9LA 1AA1B 2RILA 3LW5C 1XMBA 2YKNB 2APOA 2QT7A 3M8ZA 5M2PA 1D8ZA 4ED2A 5KFJA 2N4CA 2DR8A 3EDQB 3BN7A 4DPOA 3GWCA 3BKTA 5CD4H 4PQAA 4PG4A 1UFWA 3MCSA 3MM5A 1RBOB 4WFXA 4F7VA 3CCLS 4KFBA 1S1VB 2E9TA 3T5LA 4PEOA 3HK2A 1PJ6A 2LEAA 1H7WA 1N36J 1TL5A 2RRBA 4FP9A 2YWGA 1N52B 1TKXB 3QJPA 3HFKA 2MSSA 4DU7A 1Q7YT 3P8BB 4JI0J 4X4QA 4NLTA 4DR5J 3DMJA 1M1KT 4UY8T 4C8KA 3TJ9A 4C48A 3FC9A 2E5IA 4DV6J 5D0GA 4ZPVR 3Q8SB 1BQNB 2PN6A 1JLGA 2ZDOA 4OHWA 3R1LA 4ZVPB 2ROPA 1X4CA 1S1UB 3TRGA 2BUNA 4FF4A 1CLFA 1IBCB 4IOAQ 4CTAA 5A76A 2W9AA 3K17A 1XQIA 2GMJA 2LXIA 3AA9A 4G3IA 1SUQB 2V2VA 1KHWA 3V6JA 2N3OA 4DS5A 1MMNA 4ILRA 4QYZJ 2R7TA 1IKYA 2HMIB 1HNVB 1FEEA 5AJ3F 1FVQA 1YRTA 1M1HA 4ANEA 3J80U 3H20A 1UFLA 1SIZA 2D69A 4I7FB 3LF0A 2MHEA 4YHHF 2R7WA 3T5JA 1EB0A 1RAGB 2J8SA 5K14B 5IM0A 1DQ9A 1U09A 3N6LA 4KH1B 1IKWB 1S0OA 2DGXA 4ZK7M 1MWYA 2BOAA 3FEYB 1U2CA 3JYTB 3D1QA 4MKAA 3G96A 2HHPA 3MMCA 4A8MP 2GIQA 3SSQA 2PMZD 2J5AA 3FZBA 5BYRA 5L46A 1V5VA 2W9BA 4NLGA 2WBRA 3TUIC 3JQJA 1DQAA 3MM6A 2ASLA 3OVBA 1R6VA 2IIHA 2HIQA 2Y1IA 2ZH7A 4I2QB 2J9DE 3R5DA 1O6XA 3DM2A 2W24A 4JP8A 2YWFA 4O0NA 1Q8BA 3IP0A 1NSPA 2FZKB 4USJC 3D6TB 3MPYA 2HYIB 3QZ8A 1TU0B 2HHSA 2HGMA 2ZUGA 4CRJA 3SFGA 5J1NA 3W63A 4ZN1A 4K59A 2VD3A 2UZAA 2BBEA 1ZM9A 3FQKA 4ZPAA 1T11A 2DD8S 4NCGA 1R8CA 3GIIA 3BR8A 3QRPA 1KOHA 3DRPB 4FDFA 4DQQA 1ZAXA 4DL6A 3QLHA 1N5TA 1WC0A 1TVRB 2VZ9A 4Y2AA 2LQ5A 4ES3A 2HVDA 2V8VA 4HHJA 3V2UC 2DB1A 5EWFA 1R0AB 4OI3A 2F3JA 1N5YB 1S79A 3LPYA 3ZZ0A 2XS5A 3PYFA 3IWLA 2JVOA 3CULA 4N76A 1RTDB 3MZIA 4ELVA 2CPHA 3EJMA 1H3DA 1TFYA 2B4UA 1CJUA 1B99A 4C8ZA 1F6TA 3CJ0A 1UP1A 3MF5A 3ADAC 3H2LA 3TYTA 2I38A 5ETPA 1P1TA 1S7IA 2AWZA 2MZQA 1C0UA 1LW0A 3SCLE 4Y65A 4QWAA 2X1AA 2Q66A 3DRRA 3VAHA 5DJBA 5D77A 2CPZA 4TU7A 4CLPA 3TOQA 1RWVB 1UWBA 2CPXA 2BRLA 4OV6A 5KTQA 4C9DA 1FDDA 1TELA 2BYCA 2ZEJA 2KH9A 3LAMA 3D6FB 4A8FA 5AXMA 2ZWOA 1TKTA 3EVWA 1ULRA 3MMAA 4ZVQB 3HPOA 3GILA 1DTQA 3AQOA 1YZ6A 2XI3A 3QFWA 4HKQA 5RUBA 3X1LB 4RX6A 3G6VA 4O3PA 3VGTA 4F02A 2VASA 2MKJA 5E3RA 1RTZA 1SKUB 2B4OA 5I42B 4NZ0A 5H9EJ 1VLOA 5B09A 4LVOP 4F8RA 4IQMA 2K7JA 4DPXA 2PI5A 3MXHP 2MQMA 1Y5LB 1T9YA 4A46A 1U2FA 5KFYA 4DSJA 2VV5A 3TR5A 4QR1A 2CZ9A 5EX3A 1EIYB 4O3QA 1RA7A 1N5VA 5HANA 2YVSA 1H38A 1OMSA 4UUXA 5J2QB 2MKHA 2EK1A 2J9EA 3G9CA 5T7LB 3VAJA 4HHUA 2XM3A 4UZBA 2R7OA 2CRLA 3I0SB 3OXFA 5DLGA 4NLQA 4NPOA 2KDOA 1S6UA 2VC0A 4FS1A 3R7SB 4EYIB 1AYEA 1FWLA 2IVYA 5AE2A 4DR3F 3KJFB 1TMJA 1J27A 2L9NA 1JK9B 2BW7A 2HFOA 3H90A 5C42A 2JSXA 4DEZA 1LXJA 5KT5A 3EXCX 1QAJA 1UVKA 2CZ4A 3DI6A 2QV6A 4N8OA 2GIRA 3SIPB 4LRFA 1OIAA 3OHBA 4IRKA 4PYAA 1PSDA 2VDHA 4DX8H 1BQMA 1LNQA 2K8GA 5C24B 1HYSB 4JV5F 1LW2B 3RG6A 3JTPA 1U47A 1NK6A 2OFGX 1CJKA 2B9XA 2DNHA 2QN6B 2J8AA 4WYWA 3CJ3A 3OTOJ 4P2SA 1EKSA 7AT1B 3KMQA 4ZIWA 4DSIA 1Q78A 3DDIA 4YN3B 2HHQA 4PQUA 2X3DA 2G2YA 4XK8C 1X0FA 2P6TA 1WACA 4OHXA 1HNZJ 2E7VA 5M2RA 2DCLA 1FA0A 2B5JA 2OD4A 4ZJLA 3OTDA 2IM2A 2JJ4D 2OPSA 3VAMA 2GO9A 1H2TZ 3Q8UA 1S9EB 3A3OB 1CQMA 4DCPB 4WP8A 2ZM6J 1VRTA 4YB1P 1GK8A 2MHNA 4ECRA 1WC5A 2HSEB 4DCOB 1H6KX 3ZZRA 4LFAF 3WC2A 1JWWA 2GHPA 3H8YA 3NXZA 4M5DB 1YJRA 3Q2TC 4OI0A 2VFVA 1EQ0A 1Y3JA 4KPCA 1F5BA 4MFBA 4KIAA 1SJRA 2EW9A 4OZNA 2IAJB 5CYJA 2YKMB 3W1YC 1YKWA 5D6GA 2W9CA 1K44A 3T6JA 5KFCA 4PG7A 5E41A 1PC5A 3NNAA 4YB6A 3WC0A 4ELUA 1SQEA 2RU9A 3LUYA 1NO8A 2ZVIA 1H2UX 3B6BA 2KTQA 3THTA 1D3WA 4BHQA 2CAJA 3R6GB 2X1GA 3CJ8A 2XB2D 1BY9A 4I2PA 2KU7A 5DG8A 4KHMA 2JC0A 1Y10A 1RT2A 2V63A 1GX5A 4CT8A 1HWIA 3WIVA 2UP1A 3I32A 4PWDB 1PYOB 1S1TA 5CZXA 1C1BB 1Q5YA 5J2PB 3MEDB 3JQMA 3NCPA 3H4BA 1S12A 4FN5A 3M2UA 3LP0A 2QC3A 1S9FA 2PMHA 2W2MP 4Q43A 3H2VE 1WOSA 2XI2A 5B08A 3BSCA 4ETXA 2FHJA 4RW9B 2HQFA 1HBNB 3VWSA 4O23A 2LCWA 1NK0A 1HHTP 4GO7X 2AEJA 2GVZB 3CJTA 3U1NA 2YX7A 4CYUB 2ZHBA 3D7SB 3ZTOA 5F3ZA 4WWSA 2ZOGA 4GVBA 3RB6A 3VVUA 3MECB 4GKKJ 1V5IB 3G2XA 5LXRA 1N8RT 1FX4A 3OHAA 2VPYB 3MEEB 4YDXA 1B0TA 4DV1F 3MM8B 1MW7A 5IOLA 2B56A 4DOZA 2C3UA 4QIFA 3CW2C 2C2MB 4X62J 1XIQA 1F9FA 3MM5B 2HW3A 1N32F 4WPAA 2M2BA 2A1BA 4IFYA 2AJ0A 1UCNA 2BEFA 2M88A 1T9XA 3PDNA 4DL0C 3AODA 2LVWA 5AXNA 5A0YB 2VBZA 3QBCA 1TUVA 3AY0A 1S1XB 3DC2A 3QT6A 4C0BA 1HARA 2DO0A 3QWPA 3WX4A 3M8PB 1HI1A 4DR2J 2HKEA 4USWA 2QTWA 4DPWA 2MEWA 2DPIA 3A3NB 2HBYB 3BPDA 4C7QA 1ZBTA 4A8SA 2L41A 4TN2A 1JLGB 3VCDA 1FRMA 2CADA 4WE1A 3UCUP 1WC6A 2W8KA 1CJTA 3WZ0A 4CTAB 4KGVB 3M8QA 4CH7A 1FRHA 2AJ1A 3OV7A 5J2MB 1M0SA 3P4UB 4M5NA 1KD1T 1VIOA 5E0OA 4DBQA 2H5JB 4RU2A 2AP6A 5T41A 4RNFA 1IKYB 4OYMA 2KN4A 1UEKA 2CPFA 1F0XA 2GA7A 1XMOF 5E5NA 1XJWB 2CDQA 1T7PA 2Y1LB 4CM2A 2XHCA 2HHWA 4IUFA 3P49B 4QW8A 3S01A 1D8YA 2ZBQA 2KYXA 1G3OA 2IY5B 2HAIA 5ETLA 4F0KA 2KXHA 3LP2A 5MLCV 4LF5J 1WEZA 1H0HB 4QYZK 4ZCKA 5KG5A 3FEZA 4K5RA 1R27B 1WF0A 3RJMB 1QJHA 3PRDA 5KOWA 2XMJA 2WVBA 3R5AA 4U8VA 4MIAA 3HXMA 4OYAA 1EQMA 4B17A 4PZVA 5L39A 3W64A 1YK9A 2C22A 1N88A 1NMEB 3GFZA 2CPIA 1NJYA 1F60B 3K8WA 2J6SA 3W3SA 4PUOA 3DM2B 3N0VA 4XPCA 2M8HA 3LP1B 5J1EB 1BGXT 3LPEA 4C6AA 1WI8A 1UVLA 4GC6A 4CH1A 3F0NA 3SV3A 3PR4A 2O1PA 4EFAC 1UKUA 4CLTA 2UU9J 1FT8A 1Y9OA 1JJHA 2KVIA 3HJFA 4NCGB 3J80Y 2XNQA 3E01B 1HQ2A 4DSLA 2HHHF 1HD0A 3QLHB 3SQGB 3UDVA 4TU8A 1S6PA 4KSEB 1JB0C 2EC2A 3VR1A 5DG7A 4X66F 3ENQA 2MQPA 4B9LA 4USHA 2O67A 5F8LA 4TLQA 4WTOB 1DARA 2CJBA 2GNKA 3C14A 5H9FJ 4IDKA 2XS7A 1L3TA 1S6OA 2YNHA 3ULHA 2GAHC 1HNWJ 4NCAA 2G1HA 4DPUA 3MPDA 2UXCF 3UR0A 3O3LA 2CQ2A 1CJUB 1BUXA 7FDRA 1YBUA 5F0UA 2B43A 2ILZA 4ZP9A 2XMVA 3IMQJ 1SBRA 3JSYA 1WNEA 3H7HB 2QMUB 4USVA 2V34A 3CF5Q 1S7HA 3OXGA 4EZ6A 2RQ4A 2FJAB 3W5XA 4N5SA 4CH0S 3EVOA 1Q86T 4MK9A 5CD4A 4EU0A 5CYQA 3R5JB 3M30B 3K2YA 3N5FA 3TP2A 1TFWA 1ROFA 1S6QA 1JX4A 3D54A 1TKTB 3M2VA 3WQPA 3EZUA 4B9TA 1MN9A 3MMAB 4AL5A 1MROA 5KFHA 5KFSA 1DTQB 1T0TV 4EGLA 4NLSA 1NUEA 4BDPA 1X4AA 3HFVA 1Z1ZA 4HR2A 3TZYA 1KVJA 4F4YA 3BH7B 5E7OB 4MJKA 4M5HA 2QYGA 3KK1A 2NPIA 2C3MA 4HEA9 2AX0A 3CCSS 4IR9A 3KHLA 3QJJA 3TARA 4C8MA 2CQPA 2NYHA 1VDHA 4U9RA 3FSXA 2MKYA 1WJ9A 4LT6A 3I9V9 2GMLA 2GQCA 2P9CA 5DDQC 3LQVA 2FB0A 5KFDA 2HBQB 5LSRA 5GVQA 2K1RB 2R8IA 2W8LA 4MYUA 2MYFA 1TL7A 1VQPS 3A8KA 2ZNYA 5ETNA 2VUGA 4DR4J 2WSFC 4BBYA 3M8SA 3GFHA 1RADB 1R8PA 2DNKA 4R0EA 4K4UA 3PIPQ 1RTJB 5CXTA 4CO3A 3CCES 3LTOA 4J37A 5H9EK 3RW6A 4LBIA 2ZNZA 3MGJA 1RAFB 2IYGA 1AUDA 4F3OA 3B8HA 1RZMA 2HNYA 3TEHB 3U1LA 2FVPA 2EG2A 1ZA1B 4YR0A 2C2EA 5IWAJ 1P8GA 4TY9A 1CPZA 2J6TA 2YQ0A 4KHPF 4KGXB 4ZVHA 1WG4A 3CVKA 1IN0A 4Y00A 4DMZA 2RIJA 4MIWA 3EZ5A 1MSWD 2R2TA 1QUPA 2V94A 4B9SA 2HGLA 3DI6B 4OJHA 1WDTA 1HQUB 4B3SF 1D09B 1VISA 1TL4A 1G4CA 2HWIA 3NGDA 5A8WB 1AW0A 3DYAA 3RRGA 2F5GA 4TU9A 3DOLB 2AZ3A 2DHAA 3RR7A 1HBUB 1OY8A 3H25A 1T03B 2BKOA 2Z2MA 5B0EA 4RZRA 3CD6S 1UVMA 2ZKUA 3PRVA 4X4VA 3BS9A 2E1RA 5DETA 2P8IA 1NK5A 2PD1A 1RT4A 2RDJA 2F7VA 3DGPA 2OTLS 3NWRA 3C6UA 4NX9A 2HLTA 3CDEA 1AZSB 2P6SA 4PAAA 1RAEB 5LOQA 2IBKA 2B5JB 4ID5B 5LSOA 3H40A 1TV6A 3I55S 2OPSB 4JV1A 4Y2MA 1SH2A 2ZBRA 3POTB 4CLZA 3H5XA 4B9VA 2W2QP 3AJ2A 1VRTB 2KT5A 3F73A 3DOKA 2HS3A 1FRLA 1VJQA 1X5PA 3DXBA 2V2KA 3UD3P 3DNCA 2XMAA 2CQIA 2Z2LA 2DHHA 1R0BG 4QQBA 3D6HB 1Y5IB 4F4KA 3TAMA 3BB5A 2N7CA 3GJTB 2BRKA 3NKYA 3PW2A 2KFYA 1DLOA 3LGNA 1DJ0A 3CDUA 2FGCA 3V6DA 2UXDF 4O0IA 4MAKA 4HDGA 1WC4A 1O0PA 2W9CB 3PW4A 1NZAA 3ZFVA 1KNZA 4U67Q 3BKFA 2OTJS 2XNRA 3SYZA 3ITHA 4TLRA 2ERRA 2F8MA 4LRDA 1HBMB 1UVJA 2FY8A 2HZVA 2CJYB 2JEIA 1YTYA 3D0IE 3JAMU 2WHOA 4ECWA 3KJVB 1NKCA 3CUNA 5KG7A 3L7OA 2Z58B 1JXVA 3KLHA 4DV5J 3C8YA 2FVCA 1PIEA 4IO1A 1EETA 2DH9A 1Q1KA 3KKFA 3UO0A 2GX8A 3C6TA 2RVJA 1FXRA 2C2RA 2WCXA 1EARA 3M2UB 4QIEA 1U6ZA 3CCWA 2MB0B 2GHWA 4LF4F 4ZP8A 2E5JA 3MD1A 4DF4A 3BREA 5KFPA 2ZKTA 4QR2A 3E8OA 4F3QA 1JLBA 2CPDA 3ISND 2EXUA 2AKWB 5EHHA 3CD0A 3PVXA 5K8MA 4IH6A 4PXBA 3M9OB 1Q8LA 3N6NA 1S0VA 3OUYA 2WB1D 3V6HA 3HO1A 3DGVA 2CPJA 1YVFA 1OWXA 2Z30B 4F4AA 4WFAQ 3K89A 3KG0A 3J7A1 1QSSA 4CLSA 1IR0A 2OEKA 4KE5A 4GVBB 1X5TA 1AFIA 1F3FA 1UZHA 3CC2S 3AB2B 3HKZD 2D3ZA 3TJ8A 3HVAA 3OFHA 1EKRA 3R9LA 3H42A 2D3OR 2EEYA 1IM6A 1JKHA 5EX0A 5DQGA 1EHWA 2IDLA 1H72C 4Q45A 4NXMJ 2CDRB 2R8GA 1U4BA 4K2XA 3BKUA 3HHKA 3RGIA 1S72S 1OS5A 5AJ3J 1N0UA 2DO4A 2I9SA 1JJCB 2IBOA 1ZTWA 3I4PA 3ONQA 1TAQA 3M2RA 4JI6F 4ZVEA 1SJ3P 4ICLA 4YHHJ 4N8NA 2PEHA 3VVTA 2F9DA 3G82A 4KGKA 2BR0A 2M4MA 4QWEA 2UUWA 1OPIA 1UVIA 1CS4B 3H5SA 2R8HA 3TX0A 1WELA 4DLEA 2WW4A 3S7RA 4Y28C 2H1YA 1DHMA 5FD1A 2V69A 2VDIA 2BKPA 3O5TB 2AX1A 1RWPB 4KPYA 2EWHA 3M6VA 4XIUA 1PILA 5F9NA 2RKIB 2YKPA 1N5SA 4QU7A 3EGWB 3GTYX 2B9EA 5IQQA 1IBMJ 4B3OB 2DGTA 4RPFA 5HK4A 3ILLA 4GKJF 4UOHA 2OEMA 1R89A 4EMDA 3OVAA 1X4DA 3CEDA 4LJMA 2AHOB 1HFEL 5CCLA 1VBXA 3FMWA 3SBMA 5M2UA 2C28A 3J7Z5 2WTFA 3T5KA 2VIHA 5KFQA 2PGCA 3C66A 3T1YJ 4YEAA 5T14A 1NSKL 1NB7A 2DH8A 3TVKA 3HD2A 2I2YA 2HQ3A 3PCOB 4CQ1A 2XMTA 3I96A 3FRYA 2E1PA 3THPA 3ZNJ1 2LQ9A 2CJKA 4QOTA 2LKZA 3LP2B 2NYIA 2MJNA 2BV3A 1A9NB 3KLFB 4IH5A 1WHWA 5HROA 3D0HE 3FKBA 3AOCA 4OHVA 2C42A 3EDRB 1KC8T 4H4OA 1X0PA 2WK4A 3TZZA 3CC4S 1HW8A 4WKRA 4X4SA 2VFRA 4Y0FA 3H2UB 4EYHB 4WK3A 4QWCA 2ZZNA 2MKCA 1T02A 4QPXA 2R9LA 2ZBPA 3ISNC 4WXOA 3ZZYA 4OJ1A 3W61A 1PAEX 1L3SA 4HTJA 2DK2A 4URGA 3EVMA 2RH3A 4F2RA 4PUOB 1MWZA 1Y5NB 4DR6F 4LFBF 3RB0A 3GV7B 2W7OA 4ZIVA 2E9RX 2OH2A 1SVDA 2HHXA 3MEGA 4KO0A 4MKYA 5K9FA 4M94A 1FDAA 3HVWA 1RWNB 2KHDA 2GS8A 2LQJA 2FY1A 1P6TA 1S9GB 3RB4A 3MUMP 4I67A 2WSEC 2FJXA 2HWHA 3PW5A 2ZHOA 4FYDA 3OT9A 2C2ZB 4NXNF 4USTA 5HAOA 1R0CB 3I31A 1KLNA 4FXWA 1WHXA 1S6PB 3OTBA 3DN9A 2YKNA 4ECYA 2R7QA 1V3RA 2E7XA 2OFHX 2XSFA 3W62A 2DNGA 4H4MA 1UETA 4OJGA 5F8JA 4BWJA 4K0KJ 2CQBA 2QMXA 3C14B 2D7SA 5CCMA 1TP7A 4IDKB 1MU2A 2YNHB 1NU4A 4F0HA 1Y0HA 1MNEA 2OSRA 4UOGA 2JNJA 2B6AB 4FBTA 3RBXA 3EZOA 1UWAA 4CM0A 6FDRA 1DURA 2YWKA 3N01A 1DRZA 1YHQS 1BXNA 1X4GA 5L9NA 3W5YA 2EBGA 1H7XA 4EBCA 4DR7F 3C15A 4OIXA 1J5EF 4WCEQ 3FVYA 4YOEA 3T1AA 2W7PA 4JI4F 2WAQD 1RAHB 5H9FK 4UOFA 4LF7F 3DHXA 4KGMA 2VFSA 1CC7A 5ADZA 2HFVA 1REVA 2D3O1 2AGOA 3MR7A 1VI7A 4YB7A 5FLXU 3C19A 4K4YA 3AJDA 5AXKA 3IRXA 1SUQA 2HHVA 2C2OB 4J9OA 2JEGA 5B0DA 4DV2F 4M5GA 9RUBA 1RTHB 1S6QB 1WI6A 3PX4A 2Q43A 1SC1B 8RUCA 3M2VB 4B3RF 1HNVA 2FLOA 4PXCA 2W2PP 2CWXA 2GHVC 2HRUA 4IR1A 2NUUG 3T1HF 2R7VA 3Q8VA 1SC6A 4IOBA 4I7FA 4FS2A 5U47A 1FXDA 4OYXA 1GXTA 2QLBB 3AAWB 4WFNQ 4DR3J 4JOUA 3GR1A 2UUCF 5K14A 2DHGA 1LWCB 5KOXA 4DV4F 2EKYA 2V8PA 4RUCA 3BGLA 2JHEA 4JBCA 4XPEA 5LSLA 1NHVA 4ZVRB 2F65A 3CJRA 1XNQF 4KAIA 3A8IA 3JYTA 4KC5A 2B4PA 3HHLD 2I6WA 4EWTA 1Y11A 4YFUA 4Q5VA 3SSRA 4JV5J 3CXCR 1RSCA 3KLIA 1TL7B 2FUG9 4JI1J 4K4SA 3G8QA 4ANCA 2DXDA 2GAGC 2W4CA 4DX7A 1PJ5A 3NOGA 4I2QA 3IG1A 1RA6A 2KYZA 2DPJA 1E6VB 3EPIA 3VGUA 3NCQA 1PBUA 4P7VA 2R4FA 4TYBA 2XULA 1RYRA 2D9OA 2DGOA 2OAUA 4Q0BA 2QA4G 1IKVA 2HLUA 3HMJG 4ZVSB 1DFDA 4OJ3A 1A7GE 5D4OA 4DCJB 1VGYA 4TYAA 1FRKA 3DYAB 1SC4B 2KJWA 4PWUA 2PFFB 2MZSA 2Y1RI 1HR0J 4DL5A 4DV0J 1R0AA 1O5JA 2WVFA 2B9WA 2AYEA 1VC0A 1N5YA 3R2DJ 2DTJA 1LK5A 2J6UA 3VALA 2HRYA 2H48B 3CT9A 5CYMB 1SQGA 1RTDA 4A48A 3C6UB 4I0WA 4Q8FA 1RJJA 2RMLA 3DLGA 4NLXA 3K58A 4JI7J 2OO4A 2EFVA 5CQGA 2EFOA 4RW6B 1QUVA 1TV6B 1SC3B 2QGFB 3DFEA 5FDLA 2NZ4A 3LGMA 4R5PB 1FEHA 2H54B 2FC8A 1JXLA 2XO7A 1VCTA 2IPOB 3W8PA 1C4AA 5JJBA 3DOKB 2W7AA 2V2ZA 2W25A 2IM0A 1HKAA 3HT3A 3ILJA 4A8XA 3UW1A 4E98A 2QA4S 1NSAA 1NBEB 4FYWB 5GAHU 3B4MA 2DRAA 5F0WA 1DLOB 2WVDA 1WSVA 2W01A 1N36F 3OXLA 4NI2B 4J91A 3KLEA 1QY7A 1NM2A 3G86A 1NK4A 4ES1A 4JI0F 2ALYB 4A8QA 4ZMMA 4DR5F 2R8KA 4E2FB 4DI6A 2LXFA 2OPQA 4DV6F 4YMEA 4OZ2A 5ETMA 3QNWB 4O3NA 2CJAA 3HHLC 1G7CB 3DRYA 3LALA 2RDDA 4FPRA 1WF1A 1F2GA 4YY3F 1Y7PA 4RUHA 3N5BA 5HQMA 4KGZB 2ZJPQ 3SV4A 3OL7A 1X5SA 1SI9A 2HK2A 3M1VB 4RUBA 1EETB 1TK8A 2FZGB 2BE9B 2PA3A 1H98A 3PO4A 2VJVA 2AZ1A 3MPVA 4E8UA 4CCHA 3V81B 3C6TB 4KTQA 1KWMA 2ILYA 5DG9A 3J7YU 3PHEA 2RUSA 4WYLA 4UUWA 4GMKA 4W92B 2MLXA 1VOMA 2OD6A 1WKJA 3KDOA 3HJVA 3CD5A 3I0RA 1JLCA 2PIIA 1B7YB 1PYSB 4G65A 3PFEA 3R5GA 5T7LA 1IM4A 3IXQA 4UZCA 3IR5B 2VQEJ 2KZMA 1GNKA 2GVDB 2HPUA 3OUYB 1LFPA 5D3GA 4YS2A 1V3ZA 3BGFA 2HS0A 4OYWA 1CC8A 1KS2A 4TY8A 1NK9A 1U7LA 2OELA 5KFUA 4TVAB 2RD5C 2UV8A 2F8EX 5A2QU 3VQTA 2VG7B 3D0GE 5C25A 3QZ7A 2WRMA 2K3KA 4WIQA 4KYZA 2RT3A 2B8PA 3HX9A 1UL3A 2XLIA 3BN4A 1MLAA 4DWIA 2QLFB 1JKHB 1LW2A 2AYGA 3IAS9 3OLBA 3D66A 2NZCA 3JAMY 1FX2A 4TKTA 3KHHA 1SV5B 2UVVA 2YKOA 4EK2A 2XLKA 3QT5A 3L95X 3GJSB 4HI2A 1XMOJ 2VJUA 3M2RB 4KT0C 4NLDA 1FTRA 4OYOA 4OL8A 1WD6A 4K4TA 3HP6A 1WEYA 3G82B 2D74B 3U02A 1AT1B 3CMQA 1PYTA 2VC1A 2FHKA 1G1XA 3EMTA 2G0CA 3M9MB 4OX7A 1KQFB 5GAEI 1YJNS 2RS8A 1BMQB 2OJ3A 2RF2B 3MTKA 3ZNUA 2FJDB 1SKRA 1ELOA 3A3PB 2PA8D 4U7CA 3DLBA 2RRAA 1NB2A 5IZHA 4LQ9A 3KNGA 4N47A 4ZPWR 4OQJA 1U49A 4DU8A 4YR2A 4WXWA 3OTCA 3PJWA 2IJNA 4PCQA 4WZQA 1M5VC 1RWOB 1F3VA 3IAM9 2YKMA 2BANB 1UEVA 1YIJS 3PV8A 2E5LF 2HFNA 3HFZB 1RI7A 2PDAA 3RZAA 1ZAWA 1H2VZ 1U6BA 2PT0A 3RAQA 2DEIA 1ZM4A 1ZM2A 2AT1B 1U8SA 4Y6IA 4DQIA 3PYEA 3UQSA 3KDNA 3OFFA 3IGNA 2I5JB 2QRRA 3IBWA 2FHMA 2A2CA 1U02A 1I3OB 4H4OB 5HSPA 1VHFA 2YKAA 2EC0A 1R6YA 3CJSA 5KFLA 4PWDA 3OFGA 1RAIB 4WP3A 2MQLA 3AQPA 3FZ2A 4O44B 4PABA 2XBPA 1VS3A 3MDFA 3A12A 3MOJB 4H54A 3PACA 4CLWA 1AFJA 2LMIA 4A8YA 4K8RA 1N6QB 2R7RA 1AUSL 5D15A 3O6QA 3OTEA 4J9NA 1GMWA 4KO0B 2HNDB 2HFSA 2KVQE 1FD8A 1QAYA 4O3OA 3IWXA 1F2HA 5HVFA 2YKQA 1F1BB 2CVEA 4ECXA 6AT1B 3ZTQA 3OPKA 2ZHAA 4C8LA 1R7IA 1RAOA 2R2SA 2VB6A 4X4UA 3PHTA 1GMVA 5D4LA 2LDYA 4GRSA 2JLEA 3I9ZA 4AL6A 1XTZA 3BGRA 1D1UA 3JSMB 2BW2A 3MEEA 3HF5A 3C3LA 1JJ4A 3PKYA 4KKOA 4H4MB 2VPXB 3MM8A 4LR7A 2KI2A 3WDOA 1NNDA 2HFZA 5ETVA 1XNRF 1DBDA 2FYXA 3TAQA 2DRDA 1XERA 1MU2B 2CQDA 4NCBA 1RCXB 4P6QA 1FFSB 5KT6A 2ROEA 4HACA 3D3CJ 1QE1A 2BM1A 5A0YA 5HJXA 1S1XA 2GW8A 4J9MA 3AD8C 5I3QA 3M8PA 2P2CB 3C15B 1RT3B 3G87A 4X4NA 4DFKA 1KSPA 1RWKB 2GJIA 1RHRB 4ED5A 1DQ8A 1O51A 1E6YA 3P96A 4W4MA 3NMRA 1BWVA 2V8HA 2DH7A 3NBPA 1REVB 5CH7B 4MKVA 4J5OA 5ETRA 5J2MA 3BBBA 2EVZA 1X31C 3IRXB 1FTCA 4MK8A 4DV7F 3OTOF 2ACMA 2POKA 4C0HA 3MR3A 2NSBA 2RDIA 2UUAF 4JUZA 5DGBA 4WFBQ 1HNZF 4IRCA 1S97A 1VQ5S 1LWEB 4NEYA 3FK4A 1TL1A 1SQFA 4ES2A 4HTIA 2ZM6F 2M52A 2JVRA 1RU2A 5KG6A 4ZPTR 3MWBA 1NXIA 1YJTA 4YUDA 3TAPA 4WJBA 5H1SV 4ZCIA 4ZVOB 1Q16B 3VTIA 2YPYA 4J9RA 2C3YA 2RE1A 3L4BC 4OLOA 1ZETA 3UNYA 5IS2A 4KB7A 4ELTA 4LUBA 3NNCA 3KLIB 2VICA 1NKEA 4L72B 2V9KA 1MG7A 4DV3F 5C2CA 4WP9A 4EO6A 1YWXA 2ASJA 3KXDA 2VFUA 2PMWA 3BF4A 4R8UA 5LMNJ 5L1JA 1F5CA 4ZVFA 3IG1B 4MT1A 3QYYA 1RWWB 4ATNA 4USUA 4MMOA 3KUEA 1LV5A 2H51B 1A6LA 3LP1A 3A8EA 5J1EA 3A8JA 2H9ZA 4B9MA 1SH0A 4DN9A 3OJSA 1RB0A 5FLXY 1BE4A 4Q0BB 1T9WA 4LREA 1IKVB 1SCJB 4NASA 1B0VA 1SPBP 3X3UA 3N79A 4NLVA 5F8HA 2XGPA 2KO1A 4JI8J 1DTTA 3E01A 1P27B 3AJ1A 2EFGA 1SB6A 2J7WA 1HPZA 3SQGA 5KFOA 4UY85 2KB2A 4N7TA 2Z56B 3KWMA 1YBAA 2YNIA 4KHRA 1LWFB 1S48A 3LWMA 1RWXB 4UQTA 1SH3A 1EP4B 2QYCA 3OR2A 4HI1A 3NS6A 4LRCA 3PKMA 2O66A 3CJKA 4ED4A 1U24A 2DIUA 3DLGB 1JMTA 4ZVGA 3M6UA 4JI2J 2CYYA 4DG1A 1TL3B 4ECQA 2DR6A 4QYRA 4CO1A 2W4DA 4IG0A 4GKKF 4F4XA 1C0TA 4Z37A 5FDLB 1WWHA 4FKXA 1L3UA 4J9KA 2H3EB 1EJ7L 1KFSA 3MURP 5L38A 2OPPB 3M6WA 3OD2A 3UN5A 2J0SD 2VONA 3M8YA 1U1OA 1Q82T 1KTVA 2NLWA 2HFUA 2BKNA 4CO4A 4UW2A 4NYOA 3M30A 1M1GA 3N9UC 3BDEA 4Z7YA 1S4EA 4IYQA 2N7YA 3EGNA 2EFPA 3KLEB 1PBAA 1U2RA 5KG3A 4OI1A 1FRJA 4LSNA 2OPQB 1RDRA 3SCIE 2BJ8A 5KFVA 4A8OA 1MN7A 3M4XA 2G13A 4CLUA 3FEXB 3CCTA 2MDAA 3ENAA 2DNQA 1ZS6A 3BBFA 1NDLA 2JLFA 1TUWA 2N3LA 2MTLA 1VJWA 3THVA 2A0FB 2OGUA 3FSYA 3HI9A 1X60A 3KK2A 5KFNA 3PW7A 3L7UA 2G0IA 1N33J 2DVIA 3TVZA 3QATA 3Q23A 3NEKA 4EUVA 4RW4B 3LO3A 2PC6A 4X64J 2GMHA 2K1RA 3IR6B 2HWTA 1P9QC 1GX6A 2GJFA 2XMKA 2QLWA 4BS2A 1FESA 4UT4A 2QA1A 4O4RA 3I0RB 1JLCB 2CNNB 3QGPA 4CNYA 1S77D 3GFXA 1RTJA 3HZEA 2HNZA 3F41A 3NGRA 3P3DA 5LJ5Y 4BWMA 2LU2A 3P5BP 3BQ2A 4V19J 2FDNA 2A3JA 3F56A 5KFTA 5D3GB 5HN0A 4LF5F 1S1WA 1IQTA 2IFXA 1KTQA 4B3MF 4TY8B 2QLJB 5CA5A 2XCPA 1H74A 2J9DA 3VF0B 3F44A 1K47A 5ETQA 2KFNA 3HVTA 1NH7A 4F0MA 2Z2YB 4CLKA 2AYBA 3J81U 1IKXB 4NLRA 5C25B 3MUTP 1Q8IA 2R8JA 3NAIA 3O8WA 2Y8YA 4LBPA 3OBIA 1HQUA 2OSQA 5IT9U 3AD9C 2WONA 3BM7A 5A8WA 2FHJD 1C4CA 3ZO7A 2EBEA 5E2QA 3WHIA 1RGVA 3UDLA 3TA1A 1LFWA 3DOLA 3K5PA 3T3FA 3MFHA 2KXNB 2NXCA 4RWWA 1VC6A 1HBUA 1K8AT 1YI2S 1S10A 1T03A 4KV8A 1W7WA 2FLPA 5HATA 3H0PA 2JOQA 2BE7D 3T9ZA 2OKQA 1VLYA 3CCZA 3BQ0A 2P5VA 5J2NB 4EEYA 1AZSA 4P71A 3IRWP 3GV8B 3KMSA 3SDEB 2YTCA 4KRWA 2NUHA 4ID5A 5AT1B 5DS7A 1TUGB 3POTA 2GO8A 4FF1A 1UW9A 4PR6A 4C3MA 2QSFA 2V2QA 2ZH9A 4GVLA 1N34F 1HNXF 3IBFB 3B54A 2JH3A 4DQSA 3K5NA 1UAWA 4IKAA 4C8OA 3RU0A 5G0RA 1EAYC 3TANA 4WFZA 3DCAA 3I5AA 3NCRA 3TUZC 2J0WA 3ISZA 4DUYF 3R6LB 5KFAA 3W5ZA 4ZLNA 4LSLB 4Z7CA 4DR1J 4AD6A 5A2QY 1SJ4P 5D8HB 3RAMA 4M1KA 3QRQA 4DFJA 2CUYA 2MLZA 1FE0A 4LF6J 1HBMA 2ATLA 1VIXA 2KJVA 4MKBA 1OSCA 3ENWA 5D4NA 3GP9A 2QJ3A 2UXBF 3SEOA 2DKOB 4ECZA 1SJ1A 3KJVA 3DLHA 2M3DA 3NL0A 2QEXS 4NXNJ 4CLFA 1FD2A 2Q6CA 3QFHA 3ZXWA 4QBUA 4RJVA 2HVZA 5HBMA 3WIUA 2BE2A 3EUNA 5GMEA 5LXYA 5BYSA 4B9NA 2BABA 2JFDA 3MCOA 2DGSA 4K7QA 3HHNB 2IHR1 4LR9A 2QE5A 3CCVS 2IA6A 5I3PA 3JTNA 1NK7A 3P5TL 3B82A 3D3BJ 3DRSA 5HMWA 4CLYA 1HW9A 4J9QA 3GPAA 2DHXA 4NMLA 2ZWPA 2YPZA 3JSBA 3K8VA 3KK3A 1OJ4A 1LOUA 3I56S 4DR7J 2L9DA 3HZGA 2IDEA 2HQIA 1BC6A 5F8GA 3MUVP 2ZBCA 1ZZFA 2EKNA 4ZPDA 2FVSA 1QVFR 4X4PA 3BGRB 5DDOC 3HT0A 4KKOB 5LT5A 3CO0P 4F25A 1FWKA 4M95A 1BLUA 5IT4A 2CQ1A 4I4BA 1RBLA 3P45B 3KUHA 1NPKA 5GAGI 5IWAF 4HACB 2G1DA 1QE1B 4C8NA 4ID8A 2BVZA 5A6WA 3NGKA 1V6HA 2YY3A 1W25A 4X4RA 4ED1A 1TKZA 3GIMA 1S49A 4KY3A 2HQCA 5K8OA 2V67A 2XCAA 1CS4A 2B51A 2ZUAA 3MM7B 2ZD1A 1OO0B 1E6YB 1HQEA 4ERDA 1XNQJ 3DRXA 2H65B 1GTEA 1X9SA 3NBPB 1HI8A 2UVUA 1RCOB 1ZZNA 5A8RA 1YJ9S 2AMCB 3FRZA 4JI3J 1RQ0A 4U7UK 4NYPA 3FFIA 1DZ5A 4PG6A 5DM6Q 2RKIA 1TK5A 2MKIA 3BGOP 3D9BA 1WF2A 2DNPA 4B3OA 4DSKA 3W8GA 1FKPB 3TVYA 3Q86A 2GIFA 5LM7E 3TZXA 4QJVA 4PPZA 2AGPA 1VBYA 2AF6A 1WEXA 2JWNA 1NDCA 1OYEA 4AE5A 4OI2A 1TL1B 1IBKF 2X51A 3UVJA 2MQ8A 4ECVA 4L74A 1OYDA 5IV3A 4DL3A 3N4WA 3ET6B 2WVCA 2V4JB 4EO8A 4OX6A 2ZH1A 3FUYA 2JL9A 4K4WA 1V9OA 1QTNB 3KLFA 1CQNA 1JQGA 4WBFA 4E0DA 2DR7A 3ZC4A 1XWLA 1YSJA 2LQ8A 1S5ZA 2CJ9A 1X8DA 4AXIA 4IQXA 3HSDA 5ETOA 4MTPA 3FBCA 4I6YA 2LQBA 4QIWD 5K8PA 2ZBIA 4HH1A 1XR7A 5EDWA 2ZH8A 2GV1A 1U1KA 5HP1B 2Z4PA 2V4RA 4CO2A 1DY3A 4CT9A 2VKRA 3FGVA 3E51A 3SQOP 4F04B 2NQPA 1PG5B 1YBTA 4R8UB 3R5BA 3US5A 1RLCL 4YDDB 3BYPA 3T6BA 2HVEA 3DLEB 4DS4A 3GSDA 3FJ2A 4JYAJ 2YWEA 5IV4A 1ICEB 4FF2A 1NEEA 2ZH2A 1JLFA 1FVSA 2OPRB 2CG8A 4DV5F 4L3NA 3R2CJ 1FK9A 4KR0B 5KT3A 2NXNA 4M5JA 1S9GA 3TO8A 1RWUA 4ZJQA 2XQCA 1F9HA 3CJQA 2W2OP 1RLDA 3W2WB 1TMMA 3ZZPA 4RLEA 3RRKA 1DTTB 1FJ7A 3HULA 2XC9A 5KFBA 1FJGJ 1YRXA 2XSJB 3SXLA 1HPZB 3T9NA 1WC1A 3LOUA 1NAQA 4DHVA 2W2NP 1QVGR 3MR6A 4QWDA 1NPRA 3IFEA 1A0OB 4LF9F 5JVHQ 4RNNA 2YNIB 4W98A 3UDEA 4DL7A 4XTTA 1Q53A 2CQ4A 1RACB 4I56A 5JUMA 1L3KA 4FXDA 5BR8J 4DLGA 2DT9A 1MMDA 3OR2B 1X9MA 4NLWA 1YLXA 4OHYA 2DJWA 4CO0A 3CJKB 2YX4A 3KG1A 3OSPA 2B6AA 4G1QB 4DG1B 1JJ2R 1N4LA 4HH0A 3MAQA 1ZOTA 4OX9J 4IG0B 4P2MA 1C0TB 3PX0A 3ZZUA 3EGVA 1KVKA 2DYAA 4YY3J 1GH8A 2I1RA 1FO1A 2WW8A 5LL6d 3Q8PB 2DNRA 1RP5A 1FKOA 3BQ1A 2CNLB 2MZTA 2C3OA 1KQSR 4RNHA
chains in the Genus database with same CATH topology
3KJNB 3D6HB 2Y1LB 1QTNB 3NS7B 3GJRB 1RHKB 1RHUB 4ZVRB 2FQQB 2P2CB 2XYPB 1F9EB 3GJSB 3GJTB 1RHJB 1RWNB 1RE1B 2Y0BB 4ZVUB 1RWKB 1SC4B 2C2KB 2QL7B 4ZVOB 1RHRB 4LSZB 2CNNB 5K20B 3R7NB 5IC4B 2H65B 1I51B 2HBQB 2C2ZB 1RWVB 2XZTB 2DKOB 1RWXB 2QL5B 1RHMB 1QDUB 3EDRB 1I3OB 2C1EB 2HBYB 3R5JB 3GJQB 2H48B 2C2OB 2XYGB 3QNWB 2QLJB 2CJYB 3R6GB 3RJMB 4ZVPB 3D6FB 1BMQB 2H5IB 3IBCB 2QL9B 1RWPB 1SC1B 2CNOB 2HBRB 2CJXB 1IBCB 1RWMB 2HBZB 4ZVQB 3R7SB 5IC6B 1RWWB 2CNKB 3KJQB 3P4UB 2H51B 3R7BB 3IBFB 1ICEB 1SC3B 3P45B 3KJFB 3D6MB 2H5JB 2H4YB 2H4WB 2H54B 1NMEB 4JB8B 1PAUB 1RHQB 4DCPB 1GFWB 3EDQB 2QLBB 1RWOB 3R6LB 2QLFB 1PYOB 2XZDB 4ZVSB 4DCOB 4ZVTB 2C2MB 2CDRB 2XYHB 2CNLB 4DCJB 3SIPB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3KJN B;  3D6H B;  2Y1L B;  1QTN B;  3NS7 B;  3GJR B;  1RHK B;  1RHU B;  4ZVR B;  2FQQ B;  2P2C B;  2XYP B;  1F9E B;  3GJS B;  3GJT B;  1RHJ B;  1RWN B;  1RE1 B;  2Y0B B;  4ZVU B;  1RWK B;  1SC4 B;  2C2K B;  2QL7 B;  4ZVO B;  1RHR B;  4LSZ B;  2CNN B;  5K20 B;  3R7N B;  5IC4 B;  2H65 B;  1I51 B;  2HBQ B;  2C2Z B;  1RWV B;  2XZT B;  2DKO B;  1RWX B;  2QL5 B;  1RHM B;  1QDU B;  3EDR B;  1I3O B;  2C1E B;  2HBY B;  3R5J B;  3GJQ B;  2H48 B;  2C2O B;  2XYG B;  3QNW B;  2QLJ B;  2CJY B;  3R6G B;  3RJM B;  4ZVP B;  3D6F B;  1BMQ B;  2H5I B;  3IBC B;  2QL9 B;  1RWP B;  1SC1 B;  2CNO B;  2HBR B;  2CJX B;  1IBC B;  1RWM B;  2HBZ B;  4ZVQ B;  3R7S B;  5IC6 B;  1RWW B;  2CNK B;  3KJQ B;  3P4U B;  2H51 B;  3R7B B;  3IBF B;  1ICE B;  1SC3 B;  3P45 B;  3KJF B;  3D6M B;  2H5J B;  2H4Y B;  2H4W B;  2H54 B;  1NME B;  4JB8 B;  1PAU B;  1RHQ B;  4DCP B;  1GFW B;  3EDQ B;  2QLB B;  1RWO B;  3R6L B;  2QLF B;  1PYO B;  2XZD B;  4ZVS B;  4DCO B;  4ZVT B;  2C2M B;  2CDR B;  2XYH B;  2CNL B;  4DCJ B;  3SIP B; 
#chains in the Genus database with same CATH topology
 2UUB J;  4O4G B;  1RUS A;  3RUB L;  1B64 A;  4NXM F;  4DSE A;  3MMJ A;  3FNN A;  3RBZ A;  3CJ2 A;  2I0X A;  3D1H A;  1PCA A;  1URN A;  3M9N B;  2XLJ A;  1GEH A;  1SKS A;  2E7W A;  2G4B A;  2HQD A;  1F5A A;  1VRU A;  3QAU A;  2DCU B;  3RTV A;  2FHO B;  1B3T A;  2WBM A;  1RTH A;  5D0R A;  4OI6 A;  4DL4 A;  1SL2 A;  2IM1 A;  1NLK L;  3KNA A;  4R25 A;  4ZLP A;  2Z57 B;  4FPI A;  2IRX A;  3PYD A;  3BPS P;  4LSN B;  4F3M A;  1VQN S;  3DDK A;  4HT7 A;  3QO9 A;  3V4M A;  3PZP A;  2COL A;  3UD5 A;  4LR8 A;  2CQ3 A;  4P9S A;  3RAX A;  5C2G A;  3ZZZ A;  4OZJ A;  2BJE A;  3DLL Q;  5E3P A;  1LWC A;  2NRE A;  3AXM A;  1B70 B;  5DDP C;  3R7B B;  2HRT A;  5B7W A;  1FHT A;  4UQG A;  2RRN A;  2CJQ A;  1FJC A;  2BX6 A;  2CG4 A;  1GFW B;  1XMQ J;  3KK2 B;  3EYZ A;  4DX5 A;  2J7K A;  5L9X A;  3RW7 A;  1IBM F;  4ZIT A;  1YJV A;  3MHY A;  4ZHR A;  5BXI A;  3NS7 B;  1X9W A;  3KLG A;  5F8M A;  1FNX H;  3FQL A;  5B0G A;  2KKH A;  3QIP A;  1ARO P;  1VBZ A;  3T1Y F;  3PM9 A;  2VF3 A;  2DNO A;  2NXJ A;  2YWW A;  1VQ7 S;  2HNZ B;  3MPW A;  2VG5 A;  2IVM A;  2QG9 B;  5B0A A;  3K5L A;  2NSC A;  5AE1 A;  3NRB A;  3EXY A;  1VQ4 S;  1K1Q A;  1S1W B;  4LFC J;  2HVI A;  1E6V A;  1J5O A;  3IGV A;  1YIT S;  3NGS A;  2LFV A;  1Q0N A;  4NL5 A;  2B7C B;  1ZA2 B;  3N6M A;  5GAD U;  1X7V A;  4OFZ A;  3GQC A;  4Y2I A;  3UR3 C;  3HVT B;  3V4I B;  2GGP A;  3IR7 B;  1IBL J;  2G0J A;  3EE3 A;  1Q81 T;  1T9T A;  3MCN A;  3T19 A;  4EBE A;  1SKW A;  5GAD I;  5HLF B;  2KM8 C;  4BC9 A;  2X1B A;  2RHQ B;  4ZPC A;  3PX6 A;  4RUA A;  3G4S S;  1VQO S;  4FXV A;  8ATC B;  2WON B;  1X4F A;  4AQY J;  3Q8R B;  2BM0 A;  4Y2C A;  2LYV A;  3KG4 A;  1YQH A;  3A13 A;  3W9H A;  2FTR A;  3IC1 A;  3M05 A;  1RK8 A;  1XEZ A;  3PFO A;  2I8E A;  1KVI A;  2J9C A;  2DR5 A;  3OL6 A;  1BWE A;  3UI3 A;  4KV8 B;  2IA0 A;  2E1M C;  3LAN A;  1VQK S;  1HA1 A;  3QGH A;  1U0H B;  2E5L J;  2A2D A;  2EG1 A;  4DPY A;  2FVR A;  5CYM A;  2ZE2 B;  3M7V A;  2AW0 A;  2E1A A;  2AJ2 A;  3OVS A;  1I94 J;  5D0E A;  2OI2 A;  2CQC A;  3JXO A;  4RW6 A;  4WKY A;  3GIK A;  2BJ9 A;  3P6Y C;  4R5P A;  4IG3 A;  3IM9 A;  3KLV A;  3OW2 R;  2MZJ A;  2ZJQ Q;  4W90 B;  5EWG A;  3SFU A;  3N28 A;  1HI0 P;  4K0K F;  5G0R B;  5DDR C;  4R0J A;  3HHL B;  4F67 A;  3H5U A;  2WSC C;  4NE9 C;  3NGT A;  3C46 A;  4G1P A;  5F8N A;  5LMU J;  4LVN P;  4NI2 A;  4USM A;  3J81 Y;  2A6M A;  2YH0 A;  1NJZ A;  2IVF B;  4DUZ J;  2ZIT A;  4P2F A;  4USI A;  1O8B A;  5IT9 Y;  4Q7A A;  4QCL A;  1RKI A;  2CXE A;  2M7S A;  4B3T J;  1GMU A;  4BC7 A;  1RT6 B;  2CKW A;  2ROG A;  4K2J A;  2QFJ A;  2DHS A;  2F4V F;  2NXU A;  2FVQ A;  3R3T A;  3CDW A;  4KJI A;  4HT5 A;  4PRF A;  1WKK A;  5DLF A;  3BZQ A;  2VA3 A;  1N48 A;  3M1V A;  1T95 A;  3IBC B;  1U45 A;  5HBM B;  5KG1 A;  3D28 A;  4K4Z A;  1RWM B;  5DGA A;  3V81 A;  2XS2 A;  2BE2 B;  2DR9 A;  4RU9 A;  2H4Y B;  1HWL A;  1XNR J;  1XR6 A;  2V5H G;  3QJL A;  3OLA A;  3DRS B;  3E2E A;  1M5H A;  1VYA A;  3H4D A;  5HMX A;  3NAH A;  4DUT A;  3PW0 A;  2RSQ A;  3OR1 B;  1FF2 A;  2GVD A;  2ADB A;  2IJF A;  3KK3 B;  3FBF A;  4NLY A;  5F41 A;  2XHW A;  3Q24 A;  4ILL A;  5KFR A;  1FWP A;  1Q7L B;  2F63 A;  4KH0 B;  4IRD A;  3U27 A;  1M90 T;  3G6Y A;  2AIR B;  3L09 A;  1Q5V A;  2VG7 A;  2ZFH A;  3TNV A;  3K7R A;  2YNG A;  3Q89 A;  1FRI A;  1RAJ A;  4JI1 F;  1QTM A;  4X4O A;  2JRS A;  3GCX P;  2GFF A;  4EZ9 A;  2WVE A;  4NLP A;  4DV7 J;  3JB9 k;  4O3S A;  4NLO A;  3IO1 A;  3RBD A;  1NDK A;  3CCJ S;  3VAF A;  3NLC A;  2VG6 B;  5ITH A;  2G2O A;  1SV5 A;  4Q44 A;  4ZOS A;  1L3V A;  3RYL A;  4TQR A;  1PO6 A;  5K5M A;  2UUA J;  1U25 A;  3W9I A;  1ACM B;  1U1L A;  3BDP A;  3Q0A A;  2J0Q D;  2ASY A;  2LA6 A;  5HI7 A;  2MPU A;  1JLA A;  2RU3 A;  2IMW P;  4NOH A;  3SSS A;  2FJW A;  4RW7 A;  1VFJ A;  1UA0 A;  1XR5 A;  1TKZ B;  2B0G A;  4XAK A;  3LH2 S;  1R8H A;  4EBD A;  1UPP A;  1RE1 B;  2ZD1 B;  5KFG A;  4K4V A;  4FZV A;  2ZC3 A;  3ETO A;  3HHE A;  3QID A;  2MJU A;  3BYR A;  1RT5 B;  1HWJ A;  1HQE B;  5KFX A;  2CFX A;  2FIU A;  1D9A A;  2CZV C;  3NGU A;  5FII A;  2RF2 A;  4D3G A;  3JSR A;  5A8R B;  2XZT B;  4JI5 F;  1HR0 F;  2LEB A;  2IMO A;  2HEK A;  3FFI B;  4DV0 F;  2EI5 A;  2YX1 A;  4ED7 A;  4ER8 A;  3VHQ A;  3GR0 A;  5I3U A;  3VZH A;  4DV3 J;  2QL9 B;  5KFK A;  3C16 A;  1WTB A;  1U1P A;  3UE2 A;  5BYQ A;  2BAN A;  2MY7 A;  3ILO A;  2VPZ B;  4JI7 F;  1FXL A;  4I68 A;  4CZC A;  2H4W B;  5D78 A;  1Q8K A;  4LF2 A;  2IYI A;  2V6A A;  3UVJ B;  1UPM B;  1JNR B;  1Q95 G;  1WOR A;  3VZI A;  1Z2Z A;  4FVM A;  3MAA B;  1GTH A;  1NHK L;  1M5P C;  2FJV A;  3EX7 B;  4L3K A;  3GIR A;  3Q8Q B;  1T3N A;  2I5J A;  5DO2 A;  3EM1 A;  5KAK A;  4NLU A;  1YGY A;  4Z2X A;  5KG0 A;  3D1O A;  2OMO A;  2X1F A;  2QO3 A;  4LSZ B;  5AE3 A;  5IC4 B;  1NKB A;  2UV8 G;  3U1M A;  4AUK A;  1VMB A;  3ZTP A;  2ZZM A;  2HIY A;  4QU6 A;  5F3T A;  2CPY A;  4HLB A;  3GJQ B;  4O44 A;  2BQU A;  1YJ7 A;  4WK1 A;  3CNQ P;  5LJ3 Y;  2YH1 A;  5THW A;  3I6P A;  4ZPB A;  3VAG A;  4ZCL A;  5B0F A;  2VU5 A;  3BO2 A;  1X4E A;  4S0M A;  1HNI A;  3D4J A;  1N6Q A;  4QW9 A;  2O3D A;  4QWB A;  4CLL A;  3NWG A;  2HND A;  4Y3C A;  1JLF B;  4OHZ A;  2XY6 A;  1R43 A;  2OML A;  1S59 A;  1K73 T;  1FK9 B;  1JLQ A;  5DZ6 A;  4G1I A;  1JIH A;  2J0X A;  4Y34 A;  4FBU A;  1OY6 A;  3D68 A;  3EIC A;  1WKL A;  2XMW A;  3FBB A;  1NCL A;  1OPZ A;  2ZOF A;  3JSM A;  2XG8 A;  1U8W A;  4KFB B;  3DU6 A;  5DM7 Q;  2W4P A;  3GYG A;  3CC7 S;  1KQK A;  2VQE F;  3KUG A;  2HHU A;  1P1L A;  1NPP A;  1IJE B;  1QLN A;  4U6P A;  3DMJ B;  4RBV A;  3L9Z A;  2HAF A;  4TXS A;  4PKD B;  4EI2 A;  2BXJ A;  1HWU A;  4ZP7 A;  1IWA A;  1KR4 A;  5DRK A;  1XK8 A;  3KJQ B;  3DLK A;  2MQO A;  4OX8 A;  3TEG A;  2V50 A;  2DGU A;  1U6F A;  1RT3 A;  4L75 A;  2MST A;  1RKJ A;  1Y3K A;  2X7I A;  1FKO B;  3A1Y G;  1RT7 A;  2KRR A;  4RW8 A;  5HVH A;  4OYI A;  4X2B A;  3CCR S;  2UUT A;  3VGV A;  4CI0 B;  4DXL A;  1S4F A;  1HMV A;  3BEG B;  2B8Q A;  2XY7 A;  2AD9 A;  2V4Q A;  1VRU B;  1Y4Z B;  3HLU A;  3J81 j;  1UJ5 A;  3L7P A;  2ADC A;  2K3I A;  3CTR A;  1N56 A;  2A6O A;  2RAQ A;  2KRB A;  4LF1 A;  2OEJ A;  4J90 A;  3NS5 A;  3GFY A;  2UVR A;  1IXK A;  2J76 E;  4NA1 A;  2LU1 A;  5IM0 B;  2Y0S D;  3QO9 B;  3CE8 A;  3UDC A;  4L73 A;  1LWE A;  2NS1 B;  4A4J A;  1IQZ A;  1GXL A;  3QQC D;  4B3M J;  3UNG C;  1YG0 A;  1IWG A;  5IC6 B;  1FJE B;  3FCW A;  5KFE A;  1KN6 A;  1KBR A;  1WTF A;  1OSD A;  3ZZO A;  2R7S A;  3MMC B;  5ETT A;  2VQF F;  2L08 A;  2DNM A;  4PWW A;  3W9J A;  5K8N A;  4RR5 A;  1JNZ B;  4LQ3 A;  3EGZ A;  2W9B B;  5L1L A;  1EX8 A;  4ZHR B;  5J1P A;  3MM6 B;  4ZLL A;  1LXN A;  1VQ6 S;  3KLG B;  1RHU B;  4YB5 A;  4J9U E;  3Q83 A;  3QIP B;  1AB8 A;  2RHS B;  1J2V A;  4DJB A;  2VG5 B;  1OQ3 A;  1I51 B;  5E33 A;  3FCV A;  3GU0 A;  4YR3 A;  1HLW A;  2DNY A;  4AND A;  4N41 A;  1UEU A;  1J5O B;  3FBE A;  4X65 F;  3BSA A;  3L3C A;  4LF8 F;  1SXL A;  1QM9 A;  3HSG A;  2DIT A;  3CJ4 A;  2CJX B;  5HVG A;  2GGP B;  1NRK A;  1W2I A;  1UJ6 A;  1VBK A;  4V19 X;  3GLJ A;  3S1T A;  1T94 A;  3D2W A;  3AHP A;  2MQN A;  3LAK A;  5CAA A;  1W2B R;  1VQM S;  2Y9H A;  3PEH A;  3PJX A;  4LFA J;  4NZ7 A;  3ZTS A;  4ALZ A;  1TTH B;  4FVC A;  1HNX J;  1N34 J;  4BLG A;  3J7A N;  3DU5 A;  3K5M A;  3FDS A;  1RT1 A;  2ZH4 A;  3PYG A;  2P9E A;  5KFM A;  3JTO A;  3VV2 B;  1L5U A;  3D67 A;  4DUY J;  2XYP B;  3QT8 A;  3B78 A;  2L48 A;  1LWF A;  2ZC4 A;  4FNH A;  1HD1 A;  2ACY A;  1EP4 A;  1R8B A;  2PO4 A;  1UA1 A;  4FYX B;  2N82 B;  1ZM3 A;  1TL3 A;  4M5L A;  2MKK A;  5EUH A;  2D1C A;  1LEO A;  1U0S A;  2AV5 A;  9ATC B;  3M6X A;  2UXB J;  1C0U B;  1LW0 B;  2DXE A;  3TWZ A;  2XTJ P;  3DRR B;  5KT4 A;  4IG3 B;  2M9K A;  1REG X;  1UWB B;  2B9Y A;  3GYX B;  1WOO A;  2U1A A;  2R7X A;  2OPP A;  2OHD A;  3IS9 A;  2ZVS A;  1UVN A;  1IR2 A;  1XBW A;  4K4X A;  5GMD A;  1KQG B;  4HDH A;  1FCA A;  2QSW A;  1B4S A;  2HZA A;  3BBC A;  2KG1 A;  5JVG Q;  4K50 A;  2GZO A;  4NWB A;  2XYH B;  4DZD A;  4X4T A;  2PE8 A;  3EPG A;  5ETS A;  1N0V C;  2EFN A;  1HWK A;  2PEB A;  1FRX A;  3ETM A;  2RQM A;  4MH8 A;  2Y3Y A;  2Y1J A;  1LKZ A;  4RWX A;  1SL0 A;  2YWH A;  3Q22 A;  1N54 B;  1PKU A;  4AXJ A;  2R7U A;  4ZLJ A;  4LIW A;  1VR6 A;  4AT1 B;  1NK8 A;  3UPF A;  2FZC B;  2WB4 A;  1QDU B;  2CVI A;  1IVZ A;  2RS2 A;  3QMQ A;  4L6V 3;  1UFK A;  2GQ2 A;  2N4D A;  5KFW A;  3AOB A;  2K06 A;  4ZDN A;  2XZW A;  4NRU A;  1SJF A;  2QIF A;  4P52 A;  3A4T A;  4XO0 A;  1RU1 A;  1G2E A;  4DV1 J;  4RW4 A;  4F50 A;  1QAX A;  2JC1 A;  3K57 A;  2MGZ A;  4ZS6 A;  4N56 A;  4N77 A;  1N32 J;  4V1A k;  2CPE A;  2HZC A;  3IA0 A;  1QSY A;  5C42 B;  3KOA A;  4QR0 A;  3M8W A;  2BQ3 A;  1KRP A;  2Y0B B;  3PRB A;  2QL7 B;  3CIM A;  2DGW A;  4M5M A;  3PIO Q;  1H73 A;  1S0N A;  3KFW X;  2V0N A;  3BGU A;  1TAU A;  1BQM B;  3BJY A;  4FKY A;  3NG8 A;  4ZA1 A;  1CSJ A;  2CQ0 A;  1IKX A;  1LK7 A;  2YNG B;  2VOD A;  1CJK B;  5CZV A;  4DQP A;  2HVH A;  1KLM A;  4ECS A;  2FGO A;  5IFM A;  1GMW D;  2HBZ B;  3CCU S;  4C11 A;  5LMN F;  3GON A;  3RRH A;  4C98 A;  4UF4 A;  4ZN3 A;  3GYN A;  4PQU B;  3MEK A;  3W60 A;  4MIB A;  1ITP A;  4F36 A;  3CO9 A;  4JB8 B;  1WOP A;  4TNO A;  4C4W A;  5A8K A;  2XZD B;  1GQE A;  1JLA B;  1X4B A;  2P9G A;  5FJ4 A;  1B7F A;  4RW7 B;  2EPI A;  3I82 A;  4OI4 A;  2HG4 A;  1IBK J;  5J2N A;  1G6B A;  2DNN A;  3ENV A;  1HBO A;  2FQQ B;  1BQX A;  3CWJ A;  5GAE U;  4U8Y A;  4ZVU B;  3SDE A;  1NZ8 A;  4JI8 F;  2L9W A;  2WOM A;  1K0T A;  1ZPV A;  5KT7 A;  4Q2L A;  4A8W A;  4MFB B;  1MWQ A;  1VK8 A;  1HHS A;  1AXQ A;  3T41 A;  3MOZ A;  2FJB B;  4C3K A;  2HK3 A;  3TQ1 A;  2C2N A;  5I3U B;  6FD1 A;  4LIR A;  3IN5 A;  2YNF A;  3C16 B;  3TA0 A;  5ETK A;  4C97 A;  4FF3 A;  4NA3 A;  3ZZT A;  2CNK B;  4LSL A;  2R42 A;  1FER A;  4JI2 F;  1VK3 A;  1Y00 A;  2VBX A;  4OYZ A;  1S57 A;  4I69 A;  4DDF A;  2BJD A;  3CCQ S;  2OIH A;  1NJX A;  4I2P B;  2M5Y A;  2XEX A;  4KBI A;  4Q2M A;  1CVJ A;  2RQC A;  3MM9 A;  1RT2 B;  2IJR A;  2Z2Z A;  5G4D A;  4J9V A;  3J7Z T;  2Z8Q A;  4WTY A;  1S1T B;  3GB0 A;  2E5H A;  5HL7 Q;  3W2V A;  1URR A;  4XDD A;  1JLE A;  2CA9 A;  2HHH J;  2QFI A;  3LP0 B;  3GIJ A;  2BA9 A;  2BJ7 A;  1T3O A;  4IH7 A;  2BJ1 A;  4FNI A;  4X66 J;  3R8Y A;  5MAO A;  4LF9 J;  1VRQ C;  5EGY A;  2V68 A;  3PTW A;  1UTA A;  3MMB A;  4HYK A;  1JXE A;  4IFV A;  3O2I A;  5KFZ A;  3PEJ A;  1WC3 A;  1HNI B;  3H98 A;  2DEJ A;  4CP5 A;  4C8Y A;  2UVW A;  4H4K C;  2KHC A;  3CGI A;  1K0V A;  3OL9 A;  3QT7 A;  2UXC J;  4C2M A;  4PG5 A;  1WSR A;  1T05 A;  3CCM S;  3HM9 A;  1JLQ B;  1RAA B;  2YBV A;  1M5S A;  3MTJ A;  4RL1 A;  1APS A;  4AL7 A;  1N33 F;  3GJR B;  2LA4 A;  1YX2 A;  1WHY A;  4X64 F;  3NMA A;  2KL8 A;  4ED0 A;  1K1S A;  2VKZ G;  2JEJ A;  2AQ4 A;  4Y2K A;  3DDN A;  2D41 A;  4IFY B;  4NRT A;  3H59 A;  4PYD A;  2EK6 A;  2DIV A;  4DSF A;  3O1L A;  4M63 A;  2QMW A;  1SJQ A;  3TW0 A;  4J9L A;  4FYV B;  1WHV A;  5IQ6 A;  5L8R C;  5HJY A;  3V5R A;  4NMX A;  1Z4U A;  4RNM A;  2B3T B;  1U26 A;  4J9S A;  1S0M A;  4WU2 A;  3DLK B;  3K5O A;  3QGI A;  4CNZ A;  2K2P A;  1FDB A;  4WE1 B;  1PAU B;  2DBB A;  2Q3P A;  1VQL S;  3BSO A;  4HHH A;  1RHQ B;  3MPU B;  2KG0 A;  3MR2 A;  1CJT B;  3CJ5 A;  3M8Q B;  3MM7 A;  2BOP A;  2MMY A;  1T9U A;  3QGG A;  1RT7 B;  4HVZ A;  4RW8 B;  3IWN C;  1UJ4 A;  5E3A A;  8AT1 B;  4NEZ A;  5C5J A;  2WZ1 A;  3U7J A;  1HMV B;  1QSL A;  3NNH A;  5AXL A;  4DN0 A;  3GE9 A;  4F2S A;  4A8K A;  2VHG A;  1RIS A;  2GC8 A;  1RTI A;  1CUL A;  1FI4 A;  1FKP A;  4YP3 A;  2LDI A;  2YQ1 A;  1TZ0 A;  2GCF A;  3CDA A;  2U2F A;  1N5Q A;  4NYZ A;  2IRY A;  2PSZ A;  4WF9 Q;  5DQH A;  3SCJ E;  3DKD A;  3TUJ C;  3VQS A;  4URS A;  3G8S A;  4I6A A;  4KHP J;  3ET6 A;  1U1M A;  2V4J A;  2ZDP A;  2ALZ A;  2JEF A;  3R27 A;  1R8A A;  3D6M B;  1BHN A;  5EWE A;  2FD2 A;  4K5S A;  3DOM A;  4LMZ A;  1IR1 A;  3CD7 A;  2XO6 A;  5BJR A;  4M5I A;  3I4H X;  4OLP A;  4B3S J;  3OFE A;  1KON A;  2V9W A;  4PXE A;  3KJN B;  1TQL A;  4RBT A;  3K0J A;  2J7U A;  1RHK B;  5CHC B;  4DR1 F;  1C1C A;  4ED6 A;  3M32 A;  5HP1 A;  2E29 A;  2E9Z A;  4JV0 A;  1EZZ B;  4O3R A;  1YZ7 A;  2IM3 A;  2NR0 A;  2R2R A;  4ENO A;  3DLJ A;  4LF6 F;  1XN9 A;  4HL9 A;  2MZR A;  2M0G B;  2BZ2 A;  2ZZT A;  2VOO A;  3DLE A;  2C2D A;  4ECU A;  1KHV A;  2LEP A;  4ZCM A;  1X5O A;  1SL1 A;  4OZ5 A;  1YJW S;  1U1Q A;  2OPR A;  1UMJ A;  5HO4 A;  1CJV A;  4P75 A;  3PY8 A;  2IC3 A;  4CDI A;  1RXO B;  3WBZ A;  1VHI A;  4QIV A;  2X3G A;  4PPD A;  3W2W A;  4WFY A;  3UFC X;  1YRU A;  2DXF A;  4ED3 A;  2DIS A;  4FYY B;  2FLN A;  3QSY B;  2XSJ A;  2KXF A;  4ZKA A;  4ZVT B;  1NDP A;  3Q8Y A;  4NZ6 A;  1RAB B;  1RT1 B;  3VGS A;  1BD6 A;  3BH6 B;  2G9O A;  1OQ6 A;  4UTG A;  1S1V A;  1VQ9 S;  2LLZ A;  2KT2 A;  2CWK A;  5DQI A;  2LXU A;  2UXD J;  1MML A;  1ZYQ A;  4DF8 A;  5KFI A;  2C2K B;  2O5D A;  1TKX A;  2MY8 A;  1LQ9 A;  3DXS X;  2LP4 A;  4CIO A;  2KFZ A;  3C2P A;  5I4M A;  4G1Q A;  2FPH X;  2KZZ A;  4DPT A;  3PG9 A;  5SZT A;  4L76 A;  3BO4 A;  1Q79 A;  2O01 C;  2ATC B;  2EFQ A;  3ZTR A;  1BQN A;  2F40 A;  4C0O C;  3KHR A;  1X4H A;  2GQQ A;  1ZPW X;  2F4V J;  1S1U A;  4U96 A;  4U7U D;  5L1I A;  1FE4 A;  5CYQ B;  3SCK E;  4CWB A;  1TR0 A;  3T5H A;  2RUG A;  4OMF G;  5D4P A;  2DRB A;  3IS9 B;  2CQH A;  5HMZ A;  3OSN A;  3BSN A;  4O4G A;  4G6V B;  4X62 F;  1FNO A;  4C3L A;  3W7B A;  2M8D B;  5KT2 A;  3I5B A;  2HMI A;  2RQK A;  5EN1 A;  1MRO B;  3M8R A;  1NSQ A;  2JZ5 A;  4LF4 J;  3RR8 A;  3UCZ P;  1WDD A;  4I1T A;  5HMY A;  2JX2 A;  3UN3 A;  4AYB D;  5E3C A;  2BJ3 A;  3SI8 A;  5A6P A;  2HS4 A;  4DR2 F;  1D0E A;  3AFG A;  3KK1 B;  1B0P A;  5K20 B;  2GJ2 A;  3MR5 A;  2HGN A;  3MFI A;  2OP5 A;  3GSI A;  1ZH5 A;  4OYB A;  1PJ7 A;  1IKW A;  3HVR A;  2M70 A;  2MLY A;  4IOC Q;  2BMB A;  4GO5 X;  4LBH A;  4X84 A;  3AD7 C;  1RHM B;  1KP6 A;  1KDN A;  2VBW A;  2XY5 A;  4JI3 F;  3EWG A;  1I1G A;  3HDS A;  2ZH6 A;  4P2X A;  1T9V A;  4OZL A;  1HL6 A;  1FFG B;  3I5C A;  4ED8 A;  4WZM A;  2QX0 A;  1Z2L A;  1GT8 A;  2AEF A;  2QZ8 A;  3I87 A;  2MGZ B;  4P72 A;  2HNY B;  1IUJ A;  2YXL A;  2KM8 B;  1KKH A;  4DL2 A;  4JI6 J;  3QSI A;  2VA2 A;  4WU3 A;  1F9E B;  5C7P A;  5SUH A;  2BDP A;  1ZAV A;  3ICL A;  1VC5 A;  2CIM A;  4WII A;  1R31 A;  3G71 S;  2B7B B;  2SXL A;  1Q4R A;  2F4F A;  3AT1 B;  2DNZ A;  3GCW P;  2BQR A;  1VQS A;  3V4I A;  3SZ2 A;  1NHU A;  3DRP A;  2G2Z A;  2C1E B;  3MCM A;  3AB4 B;  1TVR A;  5HLF A;  1V3S A;  1S76 D;  1TKD A;  4IO9 Q;  3OQ2 A;  2HHT A;  4RKU C;  2XYG B;  4JI5 J;  4QPT A;  1KOO A;  2NPF A;  1KLM B;  3G6X A;  4I64 A;  2C3P A;  2CNO B;  2F8H A;  3JS9 A;  2E1C A;  1YDL A;  3LGH A;  1FNM A;  1WG5 A;  4C11 B;  2RNE A;  3D5M A;  4LRA A;  1FFW B;  2FC9 A;  4B9U A;  1CEZ A;  1RT4 B;  4GKJ J;  5F8I A;  2XMU A;  4P73 A;  3DGP B;  2DY9 A;  4JYA F;  2Z0G A;  3BO3 A;  4OZ3 A;  3RB3 A;  1I5O B;  1U0H A;  2FJE B;  5A8K B;  4ILM A;  2VL1 A;  4F4W A;  3QRR A;  1M5O C;  1WG1 A;  2RJZ A;  2E44 A;  2IRU A;  2ZE2 A;  2QA2 A;  3TZW A;  2MXY A;  5HQL A;  2UU9 F;  1U1N A;  1HBO B;  4J7C A;  3NP5 A;  4P7T A;  4ZJO A;  3CPW R;  4RO0 A;  3MI7 X;  2WOM B;  3W65 A;  1IJF B;  3LA0 A;  3R7N B;  1FJG F;  1T8E A;  2DGV A;  3VAK A;  1M5K C;  1C2P A;  4B02 A;  3G6E S;  3CDB A;  4PXD A;  3TAM B;  2R3V A;  2DNL A;  1XC9 A;  1I6J A;  3V6D B;  2YQ3 A;  5GAH I;  5BR8 F;  4KQZ A;  1RBA A;  3ELH A;  3GV5 B;  3TI0 A;  3HHL A;  3GZ7 A;  2E5G A;  3MAH A;  3QPI A;  2V8G A;  4DQR A;  2E66 A;  2YNF B;  3LWL A;  4RBU A;  2AJQ A;  2VBY A;  1HNW F;  2KT3 A;  3ITH B;  2Y8W A;  3OJU A;  2VFT A;  2MKS A;  4LRB A;  2MQQ A;  4OX9 F;  4DR6 J;  4LFB J;  3G8T A;  3UD4 P;  2CQG A;  3IM8 A;  1KFD A;  5I42 A;  5L1K A;  1R3N A;  3CB4 A;  3KLH B;  3BV8 A;  3MM9 B;  4OZ1 A;  2RB7 A;  4P10 A;  1RT6 A;  5HQ8 A;  2JFK A;  5D0H A;  3W66 A;  1GXU A;  2UUB F;  2QLX A;  2VOP A;  1W26 A;  2H5E A;  1NJI T;  7FD1 A;  3NOC A;  4JV2 A;  1NH8 A;  3AXK A;  3W2V B;  2PFD A;  1JLE B;  4USK A;  4ITS A;  3OL8 A;  2HUR A;  2ASD A;  3NY0 A;  3TUP A;  4DFM A;  3AA8 A;  3J7Y I;  2AJF E;  3PNI A;  4RNO A;  1FKA F;  4B08 A;  3R5C A;  5J2Q A;  1OY9 A;  2D3U A;  3MMB B;  2VH7 A;  5JXS A;  1JLB B;  4TQS A;  4IFV B;  4ZP6 A;  3I0S A;  1SIW B;  2HBR B;  1YJU A;  5CAB A;  2MZ1 A;  3PR5 B;  5DZ7 A;  1P9Y A;  3HHD A;  3OR1 A;  2A10 A;  2HQG A;  5IT0 A;  2FLL A;  1UW4 A;  1ZTT A;  1T05 B;  3DHW C;  4F4Z A;  4P74 A;  2XGQ A;  5B0B A;  4A47 A;  2A18 A;  4QZV B;  3S6E A;  4GC7 A;  1XMQ F;  1J5E J;  1QAI A;  5KG2 A;  4ETZ A;  4M5K A;  4JI4 J;  3FSI A;  5C24 A;  1PC4 A;  1HYS A;  4LF7 J;  4DR4 F;  5JMN A;  3AH6 A;  2Q1L A;  4MK7 A;  3KYL A;  2ZH5 A;  4F26 A;  5GAG U;  3PO5 A;  4DV2 J;  2Q6B A;  3UWT A;  2AEM A;  2VG6 A;  4ICL B;  4B3R J;  2JDJ A;  4I6W A;  2F1F A;  2K7K A;  1CG2 A;  3CIZ A;  4MYT A;  4LFC F;  3K59 A;  4DX6 A;  3T1H J;  3PXG a;  2AYM A;  1VQY A;  1HIY A;  1NJW A;  4URQ U;  4U95 A;  1IBL F;  3E3X A;  1RYS A;  1D9F A;  3Q2S C;  1WUU A;  5KFF A;  2UUC J;  4OV1 A;  1S9E A;  4DV4 J;  3UN2 A;  3HD1 A;  2XMM A;  4DZ6 A;  3R97 A;  3QAE A;  1CBK A;  2VQF J;  3CSK A;  1PGZ A;  4QIG A;  1RT5 A;  4AQY F;  3AOA A;  3GG0 A;  4M5D A;  2ZJR Q;  3R1H A;  2DGQ A;  1DAX A;  1GAO A;  2ZH3 A;  2XWX A;  4M8L A;  3UCG A;  2DY1 A;  2IAJ A;  3RBE A;  5E3Q A;  3HKW A;  5IXU A;  3HSJ A;  4BCA A;  3QWU A;  3VAI A;  1RTI B;  2OUG A;  1CUL B;  4NA2 A;  1K9M T;  4PG8 A;  4D3H A;  3CME S;  1QD1 A;  2QL5 B;  4CO5 A;  3WX8 A;  1I94 F;  4OYP A;  2NCK L;  2BAC A;  5B0C A;  1U1R A;  2R2U A;  2JLG A;  3PJ9 A;  2H5I B;  3TJA A;  5HRO B;  4X65 J;  2AU0 A;  1TK0 A;  4XDC A;  4LF8 J;  2PI4 A;  2AJ4 A;  3MAA A;  3O44 A;  3CMA S;  3GG1 A;  3DOM B;  3TX8 A;  2NXE A;  3TQE A;  3H5Y A;  4YQW A;  4AFF A;  1U48 A;  1C1B A;  5J2P A;  3BR9 A;  2VPW B;  3MED A;  2D9P A;  5GMK a;  3JQK A;  4H4K A;  4DFP A;  1S99 A;  2OLW A;  4Q8E A;  5LMU F;  1C1C B;  1RHJ B;  3FMB A;  1LWX A;  1D9D A;  2W1B A;  3M32 B;  4OZ0 A;  3V6K A;  3ILI A;  3SMZ A;  2B4V A;  3HCX A;  4DUZ F;  4RW9 A;  3MEG B;  2LEC A;  1KEK A;  3KHG A;  1HBN A;  4ECT A;  3B4D A;  1HHQ A;  3HSZ A;  2V8D A;  4B3T F;  2ABY A;  1VQ8 S;  4J9P A;  5KG4 A;  2GVZ A;  1FDN A;  2F9J A;  2Q79 A;  3S8S A;  4CYU A;  2AGQ A;  2ZOM A;  1UZD A;  2XWY A;  4UOC A;  3TA2 A;  3MD3 A;  1CJV B;  3MEC A;  2L3M A;  3FCH A;  2IC3 B;  3GMG A;  3KTQ A;  5F9L A;  1AA1 B;  2RIL A;  3LW5 C;  1XMB A;  2YKN B;  2APO A;  2QT7 A;  3M8Z A;  5M2P A;  1D8Z A;  4ED2 A;  5KFJ A;  2N4C A;  2DR8 A;  3EDQ B;  3BN7 A;  4DPO A;  3GWC A;  3BKT A;  5CD4 H;  4PQA A;  4PG4 A;  1UFW A;  3MCS A;  3MM5 A;  1RBO B;  4WFX A;  4F7V A;  3CCL S;  4KFB A;  1S1V B;  2E9T A;  3T5L A;  4PEO A;  3HK2 A;  1PJ6 A;  2LEA A;  1H7W A;  1N36 J;  1TL5 A;  2RRB A;  4FP9 A;  2YWG A;  1N52 B;  1TKX B;  3QJP A;  3HFK A;  2MSS A;  4DU7 A;  1Q7Y T;  3P8B B;  4JI0 J;  4X4Q A;  4NLT A;  4DR5 J;  3DMJ A;  1M1K T;  4UY8 T;  4C8K A;  3TJ9 A;  4C48 A;  3FC9 A;  2E5I A;  4DV6 J;  5D0G A;  4ZPV R;  3Q8S B;  1BQN B;  2PN6 A;  1JLG A;  2ZDO A;  4OHW A;  3R1L A;  4ZVP B;  2ROP A;  1X4C A;  1S1U B;  3TRG A;  2BUN A;  4FF4 A;  1CLF A;  1IBC B;  4IOA Q;  4CTA A;  5A76 A;  2W9A A;  3K17 A;  1XQI A;  2GMJ A;  2LXI A;  3AA9 A;  4G3I A;  1SUQ B;  2V2V A;  1KHW A;  3V6J A;  2N3O A;  4DS5 A;  1MMN A;  4ILR A;  4QYZ J;  2R7T A;  1IKY A;  2HMI B;  1HNV B;  1FEE A;  5AJ3 F;  1FVQ A;  1YRT A;  1M1H A;  4ANE A;  3J80 U;  3H20 A;  1UFL A;  1SIZ A;  2D69 A;  4I7F B;  3LF0 A;  2MHE A;  4YHH F;  2R7W A;  3T5J A;  1EB0 A;  1RAG B;  2J8S A;  5K14 B;  5IM0 A;  1DQ9 A;  1U09 A;  3N6L A;  4KH1 B;  1IKW B;  1S0O A;  2DGX A;  4ZK7 M;  1MWY A;  2BOA A;  3FEY B;  1U2C A;  3JYT B;  3D1Q A;  4MKA A;  3G96 A;  2HHP A;  3MMC A;  4A8M P;  2GIQ A;  3SSQ A;  2PMZ D;  2J5A A;  3FZB A;  5BYR A;  5L46 A;  1V5V A;  2W9B A;  4NLG A;  2WBR A;  3TUI C;  3JQJ A;  1DQA A;  3MM6 A;  2ASL A;  3OVB A;  1R6V A;  2IIH A;  2HIQ A;  2Y1I A;  2ZH7 A;  4I2Q B;  2J9D E;  3R5D A;  1O6X A;  3DM2 A;  2W24 A;  4JP8 A;  2YWF A;  4O0N A;  1Q8B A;  3IP0 A;  1NSP A;  2FZK B;  4USJ C;  3D6T B;  3MPY A;  2HYI B;  3QZ8 A;  1TU0 B;  2HHS A;  2HGM A;  2ZUG A;  4CRJ A;  3SFG A;  5J1N A;  3W63 A;  4ZN1 A;  4K59 A;  2VD3 A;  2UZA A;  2BBE A;  1ZM9 A;  3FQK A;  4ZPA A;  1T11 A;  2DD8 S;  4NCG A;  1R8C A;  3GII A;  3BR8 A;  3QRP A;  1KOH A;  3DRP B;  4FDF A;  4DQQ A;  1ZAX A;  4DL6 A;  3QLH A;  1N5T A;  1WC0 A;  1TVR B;  2VZ9 A;  4Y2A A;  2LQ5 A;  4ES3 A;  2HVD A;  2V8V A;  4HHJ A;  3V2U C;  2DB1 A;  5EWF A;  1R0A B;  4OI3 A;  2F3J A;  1N5Y B;  1S79 A;  3LPY A;  3ZZ0 A;  2XS5 A;  3PYF A;  3IWL A;  2JVO A;  3CUL A;  4N76 A;  1RTD B;  3MZI A;  4ELV A;  2CPH A;  3EJM A;  1H3D A;  1TFY A;  2B4U A;  1CJU A;  1B99 A;  4C8Z A;  1F6T A;  3CJ0 A;  1UP1 A;  3MF5 A;  3ADA C;  3H2L A;  3TYT A;  2I38 A;  5ETP A;  1P1T A;  1S7I A;  2AWZ A;  2MZQ A;  1C0U A;  1LW0 A;  3SCL E;  4Y65 A;  4QWA A;  2X1A A;  2Q66 A;  3DRR A;  3VAH A;  5DJB A;  5D77 A;  2CPZ A;  4TU7 A;  4CLP A;  3TOQ A;  1RWV B;  1UWB A;  2CPX A;  2BRL A;  4OV6 A;  5KTQ A;  4C9D A;  1FDD A;  1TEL A;  2BYC A;  2ZEJ A;  2KH9 A;  3LAM A;  3D6F B;  4A8F A;  5AXM A;  2ZWO A;  1TKT A;  3EVW A;  1ULR A;  3MMA A;  4ZVQ B;  3HPO A;  3GIL A;  1DTQ A;  3AQO A;  1YZ6 A;  2XI3 A;  3QFW A;  4HKQ A;  5RUB A;  3X1L B;  4RX6 A;  3G6V A;  4O3P A;  3VGT A;  4F02 A;  2VAS A;  2MKJ A;  5E3R A;  1RTZ A;  1SKU B;  2B4O A;  5I42 B;  4NZ0 A;  5H9E J;  1VLO A;  5B09 A;  4LVO P;  4F8R A;  4IQM A;  2K7J A;  4DPX A;  2PI5 A;  3MXH P;  2MQM A;  1Y5L B;  1T9Y A;  4A46 A;  1U2F A;  5KFY A;  4DSJ A;  2VV5 A;  3TR5 A;  4QR1 A;  2CZ9 A;  5EX3 A;  1EIY B;  4O3Q A;  1RA7 A;  1N5V A;  5HAN A;  2YVS A;  1H38 A;  1OMS A;  4UUX A;  5J2Q B;  2MKH A;  2EK1 A;  2J9E A;  3G9C A;  5T7L B;  3VAJ A;  4HHU A;  2XM3 A;  4UZB A;  2R7O A;  2CRL A;  3I0S B;  3OXF A;  5DLG A;  4NLQ A;  4NPO A;  2KDO A;  1S6U A;  2VC0 A;  4FS1 A;  3R7S B;  4EYI B;  1AYE A;  1FWL A;  2IVY A;  5AE2 A;  4DR3 F;  3KJF B;  1TMJ A;  1J27 A;  2L9N A;  1JK9 B;  2BW7 A;  2HFO A;  3H90 A;  5C42 A;  2JSX A;  4DEZ A;  1LXJ A;  5KT5 A;  3EXC X;  1QAJ A;  1UVK A;  2CZ4 A;  3DI6 A;  2QV6 A;  4N8O A;  2GIR A;  3SIP B;  4LRF A;  1OIA A;  3OHB A;  4IRK A;  4PYA A;  1PSD A;  2VDH A;  4DX8 H;  1BQM A;  1LNQ A;  2K8G A;  5C24 B;  1HYS B;  4JV5 F;  1LW2 B;  3RG6 A;  3JTP A;  1U47 A;  1NK6 A;  2OFG X;  1CJK A;  2B9X A;  2DNH A;  2QN6 B;  2J8A A;  4WYW A;  3CJ3 A;  3OTO J;  4P2S A;  1EKS A;  7AT1 B;  3KMQ A;  4ZIW A;  4DSI A;  1Q78 A;  3DDI A;  4YN3 B;  2HHQ A;  4PQU A;  2X3D A;  2G2Y A;  4XK8 C;  1X0F A;  2P6T A;  1WAC A;  4OHX A;  1HNZ J;  2E7V A;  5M2R A;  2DCL A;  1FA0 A;  2B5J A;  2OD4 A;  4ZJL A;  3OTD A;  2IM2 A;  2JJ4 D;  2OPS A;  3VAM A;  2GO9 A;  1H2T Z;  3Q8U A;  1S9E B;  3A3O B;  1CQM A;  4DCP B;  4WP8 A;  2ZM6 J;  1VRT A;  4YB1 P;  1GK8 A;  2MHN A;  4ECR A;  1WC5 A;  2HSE B;  4DCO B;  1H6K X;  3ZZR A;  4LFA F;  3WC2 A;  1JWW A;  2GHP A;  3H8Y A;  3NXZ A;  4M5D B;  1YJR A;  3Q2T C;  4OI0 A;  2VFV A;  1EQ0 A;  1Y3J A;  4KPC A;  1F5B A;  4MFB A;  4KIA A;  1SJR A;  2EW9 A;  4OZN A;  2IAJ B;  5CYJ A;  2YKM B;  3W1Y C;  1YKW A;  5D6G A;  2W9C A;  1K44 A;  3T6J A;  5KFC A;  4PG7 A;  5E41 A;  1PC5 A;  3NNA A;  4YB6 A;  3WC0 A;  4ELU A;  1SQE A;  2RU9 A;  3LUY A;  1NO8 A;  2ZVI A;  1H2U X;  3B6B A;  2KTQ A;  3THT A;  1D3W A;  4BHQ A;  2CAJ A;  3R6G B;  2X1G A;  3CJ8 A;  2XB2 D;  1BY9 A;  4I2P A;  2KU7 A;  5DG8 A;  4KHM A;  2JC0 A;  1Y10 A;  1RT2 A;  2V63 A;  1GX5 A;  4CT8 A;  1HWI A;  3WIV A;  2UP1 A;  3I32 A;  4PWD B;  1PYO B;  1S1T A;  5CZX A;  1C1B B;  1Q5Y A;  5J2P B;  3MED B;  3JQM A;  3NCP A;  3H4B A;  1S12 A;  4FN5 A;  3M2U A;  3LP0 A;  2QC3 A;  1S9F A;  2PMH A;  2W2M P;  4Q43 A;  3H2V E;  1WOS A;  2XI2 A;  5B08 A;  3BSC A;  4ETX A;  2FHJ A;  4RW9 B;  2HQF A;  1HBN B;  3VWS A;  4O23 A;  2LCW A;  1NK0 A;  1HHT P;  4GO7 X;  2AEJ A;  2GVZ B;  3CJT A;  3U1N A;  2YX7 A;  4CYU B;  2ZHB A;  3D7S B;  3ZTO A;  5F3Z A;  4WWS A;  2ZOG A;  4GVB A;  3RB6 A;  3VVU A;  3MEC B;  4GKK J;  1V5I B;  3G2X A;  5LXR A;  1N8R T;  1FX4 A;  3OHA A;  2VPY B;  3MEE B;  4YDX A;  1B0T A;  4DV1 F;  3MM8 B;  1MW7 A;  5IOL A;  2B56 A;  4DOZ A;  2C3U A;  4QIF A;  3CW2 C;  2C2M B;  4X62 J;  1XIQ A;  1F9F A;  3MM5 B;  2HW3 A;  1N32 F;  4WPA A;  2M2B A;  2A1B A;  4IFY A;  2AJ0 A;  1UCN A;  2BEF A;  2M88 A;  1T9X A;  3PDN A;  4DL0 C;  3AOD A;  2LVW A;  5AXN A;  5A0Y B;  2VBZ A;  3QBC A;  1TUV A;  3AY0 A;  1S1X B;  3DC2 A;  3QT6 A;  4C0B A;  1HAR A;  2DO0 A;  3QWP A;  3WX4 A;  3M8P B;  1HI1 A;  4DR2 J;  2HKE A;  4USW A;  2QTW A;  4DPW A;  2MEW A;  2DPI A;  3A3N B;  2HBY B;  3BPD A;  4C7Q A;  1ZBT A;  4A8S A;  2L41 A;  4TN2 A;  1JLG B;  3VCD A;  1FRM A;  2CAD A;  4WE1 A;  3UCU P;  1WC6 A;  2W8K A;  1CJT A;  3WZ0 A;  4CTA B;  4KGV B;  3M8Q A;  4CH7 A;  1FRH A;  2AJ1 A;  3OV7 A;  5J2M B;  1M0S A;  3P4U B;  4M5N A;  1KD1 T;  1VIO A;  5E0O A;  4DBQ A;  2H5J B;  4RU2 A;  2AP6 A;  5T41 A;  4RNF A;  1IKY B;  4OYM A;  2KN4 A;  1UEK A;  2CPF A;  1F0X A;  2GA7 A;  1XMO F;  5E5N A;  1XJW B;  2CDQ A;  1T7P A;  2Y1L B;  4CM2 A;  2XHC A;  2HHW A;  4IUF A;  3P49 B;  4QW8 A;  3S01 A;  1D8Y A;  2ZBQ A;  2KYX A;  1G3O A;  2IY5 B;  2HAI A;  5ETL A;  4F0K A;  2KXH A;  3LP2 A;  5MLC V;  4LF5 J;  1WEZ A;  1H0H B;  4QYZ K;  4ZCK A;  5KG5 A;  3FEZ A;  4K5R A;  1R27 B;  1WF0 A;  3RJM B;  1QJH A;  3PRD A;  5KOW A;  2XMJ A;  2WVB A;  3R5A A;  4U8V A;  4MIA A;  3HXM A;  4OYA A;  1EQM A;  4B17 A;  4PZV A;  5L39 A;  3W64 A;  1YK9 A;  2C22 A;  1N88 A;  1NME B;  3GFZ A;  2CPI A;  1NJY A;  1F60 B;  3K8W A;  2J6S A;  3W3S A;  4PUO A;  3DM2 B;  3N0V A;  4XPC A;  2M8H A;  3LP1 B;  5J1E B;  1BGX T;  3LPE A;  4C6A A;  1WI8 A;  1UVL A;  4GC6 A;  4CH1 A;  3F0N A;  3SV3 A;  3PR4 A;  2O1P A;  4EFA C;  1UKU A;  4CLT A;  2UU9 J;  1FT8 A;  1Y9O A;  1JJH A;  2KVI A;  3HJF A;  4NCG B;  3J80 Y;  2XNQ A;  3E01 B;  1HQ2 A;  4DSL A;  2HHH F;  1HD0 A;  3QLH B;  3SQG B;  3UDV A;  4TU8 A;  1S6P A;  4KSE B;  1JB0 C;  2EC2 A;  3VR1 A;  5DG7 A;  4X66 F;  3ENQ A;  2MQP A;  4B9L A;  4USH A;  2O67 A;  5F8L A;  4TLQ A;  4WTO B;  1DAR A;  2CJB A;  2GNK A;  3C14 A;  5H9F J;  4IDK A;  2XS7 A;  1L3T A;  1S6O A;  2YNH A;  3ULH A;  2GAH C;  1HNW J;  4NCA A;  2G1H A;  4DPU A;  3MPD A;  2UXC F;  3UR0 A;  3O3L A;  2CQ2 A;  1CJU B;  1BUX A;  7FDR A;  1YBU A;  5F0U A;  2B43 A;  2ILZ A;  4ZP9 A;  2XMV A;  3IMQ J;  1SBR A;  3JSY A;  1WNE A;  3H7H B;  2QMU B;  4USV A;  2V34 A;  3CF5 Q;  1S7H A;  3OXG A;  4EZ6 A;  2RQ4 A;  2FJA B;  3W5X A;  4N5S A;  4CH0 S;  3EVO A;  1Q86 T;  4MK9 A;  5CD4 A;  4EU0 A;  5CYQ A;  3R5J B;  3M30 B;  3K2Y A;  3N5F A;  3TP2 A;  1TFW A;  1ROF A;  1S6Q A;  1JX4 A;  3D54 A;  1TKT B;  3M2V A;  3WQP A;  3EZU A;  4B9T A;  1MN9 A;  3MMA B;  4AL5 A;  1MRO A;  5KFH A;  5KFS A;  1DTQ B;  1T0T V;  4EGL A;  4NLS A;  1NUE A;  4BDP A;  1X4A A;  3HFV A;  1Z1Z A;  4HR2 A;  3TZY A;  1KVJ A;  4F4Y A;  3BH7 B;  5E7O B;  4MJK A;  4M5H A;  2QYG A;  3KK1 A;  2NPI A;  2C3M A;  4HEA 9;  2AX0 A;  3CCS S;  4IR9 A;  3KHL A;  3QJJ A;  3TAR A;  4C8M A;  2CQP A;  2NYH A;  1VDH A;  4U9R A;  3FSX A;  2MKY A;  1WJ9 A;  4LT6 A;  3I9V 9;  2GML A;  2GQC A;  2P9C A;  5DDQ C;  3LQV A;  2FB0 A;  5KFD A;  2HBQ B;  5LSR A;  5GVQ A;  2K1R B;  2R8I A;  2W8L A;  4MYU A;  2MYF A;  1TL7 A;  1VQP S;  3A8K A;  2ZNY A;  5ETN A;  2VUG A;  4DR4 J;  2WSF C;  4BBY A;  3M8S A;  3GFH A;  1RAD B;  1R8P A;  2DNK A;  4R0E A;  4K4U A;  3PIP Q;  1RTJ B;  5CXT A;  4CO3 A;  3CCE S;  3LTO A;  4J37 A;  5H9E K;  3RW6 A;  4LBI A;  2ZNZ A;  3MGJ A;  1RAF B;  2IYG A;  1AUD A;  4F3O A;  3B8H A;  1RZM A;  2HNY A;  3TEH B;  3U1L A;  2FVP A;  2EG2 A;  1ZA1 B;  4YR0 A;  2C2E A;  5IWA J;  1P8G A;  4TY9 A;  1CPZ A;  2J6T A;  2YQ0 A;  4KHP F;  4KGX B;  4ZVH A;  1WG4 A;  3CVK A;  1IN0 A;  4Y00 A;  4DMZ A;  2RIJ A;  4MIW A;  3EZ5 A;  1MSW D;  2R2T A;  1QUP A;  2V94 A;  4B9S A;  2HGL A;  3DI6 B;  4OJH A;  1WDT A;  1HQU B;  4B3S F;  1D09 B;  1VIS A;  1TL4 A;  1G4C A;  2HWI A;  3NGD A;  5A8W B;  1AW0 A;  3DYA A;  3RRG A;  2F5G A;  4TU9 A;  3DOL B;  2AZ3 A;  2DHA A;  3RR7 A;  1HBU B;  1OY8 A;  3H25 A;  1T03 B;  2BKO A;  2Z2M A;  5B0E A;  4RZR A;  3CD6 S;  1UVM A;  2ZKU A;  3PRV A;  4X4V A;  3BS9 A;  2E1R A;  5DET A;  2P8I A;  1NK5 A;  2PD1 A;  1RT4 A;  2RDJ A;  2F7V A;  3DGP A;  2OTL S;  3NWR A;  3C6U A;  4NX9 A;  2HLT A;  3CDE A;  1AZS B;  2P6S A;  4PAA A;  1RAE B;  5LOQ A;  2IBK A;  2B5J B;  4ID5 B;  5LSO A;  3H40 A;  1TV6 A;  3I55 S;  2OPS B;  4JV1 A;  4Y2M A;  1SH2 A;  2ZBR A;  3POT B;  4CLZ A;  3H5X A;  4B9V A;  2W2Q P;  3AJ2 A;  1VRT B;  2KT5 A;  3F73 A;  3DOK A;  2HS3 A;  1FRL A;  1VJQ A;  1X5P A;  3DXB A;  2V2K A;  3UD3 P;  3DNC A;  2XMA A;  2CQI A;  2Z2L A;  2DHH A;  1R0B G;  4QQB A;  3D6H B;  1Y5I B;  4F4K A;  3TAM A;  3BB5 A;  2N7C A;  3GJT B;  2BRK A;  3NKY A;  3PW2 A;  2KFY A;  1DLO A;  3LGN A;  1DJ0 A;  3CDU A;  2FGC A;  3V6D A;  2UXD F;  4O0I A;  4MAK A;  4HDG A;  1WC4 A;  1O0P A;  2W9C B;  3PW4 A;  1NZA A;  3ZFV A;  1KNZ A;  4U67 Q;  3BKF A;  2OTJ S;  2XNR A;  3SYZ A;  3ITH A;  4TLR A;  2ERR A;  2F8M A;  4LRD A;  1HBM B;  1UVJ A;  2FY8 A;  2HZV A;  2CJY B;  2JEI A;  1YTY A;  3D0I E;  3JAM U;  2WHO A;  4ECW A;  3KJV B;  1NKC A;  3CUN A;  5KG7 A;  3L7O A;  2Z58 B;  1JXV A;  3KLH A;  4DV5 J;  3C8Y A;  2FVC A;  1PIE A;  4IO1 A;  1EET A;  2DH9 A;  1Q1K A;  3KKF A;  3UO0 A;  2GX8 A;  3C6T A;  2RVJ A;  1FXR A;  2C2R A;  2WCX A;  1EAR A;  3M2U B;  4QIE A;  1U6Z A;  3CCW A;  2MB0 B;  2GHW A;  4LF4 F;  4ZP8 A;  2E5J A;  3MD1 A;  4DF4 A;  3BRE A;  5KFP A;  2ZKT A;  4QR2 A;  3E8O A;  4F3Q A;  1JLB A;  2CPD A;  3ISN D;  2EXU A;  2AKW B;  5EHH A;  3CD0 A;  3PVX A;  5K8M A;  4IH6 A;  4PXB A;  3M9O B;  1Q8L A;  3N6N A;  1S0V A;  3OUY A;  2WB1 D;  3V6H A;  3HO1 A;  3DGV A;  2CPJ A;  1YVF A;  1OWX A;  2Z30 B;  4F4A A;  4WFA Q;  3K89 A;  3KG0 A;  3J7A 1;  1QSS A;  4CLS A;  1IR0 A;  2OEK A;  4KE5 A;  4GVB B;  1X5T A;  1AFI A;  1F3F A;  1UZH A;  3CC2 S;  3AB2 B;  3HKZ D;  2D3Z A;  3TJ8 A;  3HVA A;  3OFH A;  1EKR A;  3R9L A;  3H42 A;  2D3O R;  2EEY A;  1IM6 A;  1JKH A;  5EX0 A;  5DQG A;  1EHW A;  2IDL A;  1H72 C;  4Q45 A;  4NXM J;  2CDR B;  2R8G A;  1U4B A;  4K2X A;  3BKU A;  3HHK A;  3RGI A;  1S72 S;  1OS5 A;  5AJ3 J;  1N0U A;  2DO4 A;  2I9S A;  1JJC B;  2IBO A;  1ZTW A;  3I4P A;  3ONQ A;  1TAQ A;  3M2R A;  4JI6 F;  4ZVE A;  1SJ3 P;  4ICL A;  4YHH J;  4N8N A;  2PEH A;  3VVT A;  2F9D A;  3G82 A;  4KGK A;  2BR0 A;  2M4M A;  4QWE A;  2UUW A;  1OPI A;  1UVI A;  1CS4 B;  3H5S A;  2R8H A;  3TX0 A;  1WEL A;  4DLE A;  2WW4 A;  3S7R A;  4Y28 C;  2H1Y A;  1DHM A;  5FD1 A;  2V69 A;  2VDI A;  2BKP A;  3O5T B;  2AX1 A;  1RWP B;  4KPY A;  2EWH A;  3M6V A;  4XIU A;  1PIL A;  5F9N A;  2RKI B;  2YKP A;  1N5S A;  4QU7 A;  3EGW B;  3GTY X;  2B9E A;  5IQQ A;  1IBM J;  4B3O B;  2DGT A;  4RPF A;  5HK4 A;  3ILL A;  4GKJ F;  4UOH A;  2OEM A;  1R89 A;  4EMD A;  3OVA A;  1X4D A;  3CED A;  4LJM A;  2AHO B;  1HFE L;  5CCL A;  1VBX A;  3FMW A;  3SBM A;  5M2U A;  2C28 A;  3J7Z 5;  2WTF A;  3T5K A;  2VIH A;  5KFQ A;  2PGC A;  3C66 A;  3T1Y J;  4YEA A;  5T14 A;  1NSK L;  1NB7 A;  2DH8 A;  3TVK A;  3HD2 A;  2I2Y A;  2HQ3 A;  3PCO B;  4CQ1 A;  2XMT A;  3I96 A;  3FRY A;  2E1P A;  3THP A;  3ZNJ 1;  2LQ9 A;  2CJK A;  4QOT A;  2LKZ A;  3LP2 B;  2NYI A;  2MJN A;  2BV3 A;  1A9N B;  3KLF B;  4IH5 A;  1WHW A;  5HRO A;  3D0H E;  3FKB A;  3AOC A;  4OHV A;  2C42 A;  3EDR B;  1KC8 T;  4H4O A;  1X0P A;  2WK4 A;  3TZZ A;  3CC4 S;  1HW8 A;  4WKR A;  4X4S A;  2VFR A;  4Y0F A;  3H2U B;  4EYH B;  4WK3 A;  4QWC A;  2ZZN A;  2MKC A;  1T02 A;  4QPX A;  2R9L A;  2ZBP A;  3ISN C;  4WXO A;  3ZZY A;  4OJ1 A;  3W61 A;  1PAE X;  1L3S A;  4HTJ A;  2DK2 A;  4URG A;  3EVM A;  2RH3 A;  4F2R A;  4PUO B;  1MWZ A;  1Y5N B;  4DR6 F;  4LFB F;  3RB0 A;  3GV7 B;  2W7O A;  4ZIV A;  2E9R X;  2OH2 A;  1SVD A;  2HHX A;  3MEG A;  4KO0 A;  4MKY A;  5K9F A;  4M94 A;  1FDA A;  3HVW A;  1RWN B;  2KHD A;  2GS8 A;  2LQJ A;  2FY1 A;  1P6T A;  1S9G B;  3RB4 A;  3MUM P;  4I67 A;  2WSE C;  2FJX A;  2HWH A;  3PW5 A;  2ZHO A;  4FYD A;  3OT9 A;  2C2Z B;  4NXN F;  4UST A;  5HAO A;  1R0C B;  3I31 A;  1KLN A;  4FXW A;  1WHX A;  1S6P B;  3OTB A;  3DN9 A;  2YKN A;  4ECY A;  2R7Q A;  1V3R A;  2E7X A;  2OFH X;  2XSF A;  3W62 A;  2DNG A;  4H4M A;  1UET A;  4OJG A;  5F8J A;  4BWJ A;  4K0K J;  2CQB A;  2QMX A;  3C14 B;  2D7S A;  5CCM A;  1TP7 A;  4IDK B;  1MU2 A;  2YNH B;  1NU4 A;  4F0H A;  1Y0H A;  1MNE A;  2OSR A;  4UOG A;  2JNJ A;  2B6A B;  4FBT A;  3RBX A;  3EZO A;  1UWA A;  4CM0 A;  6FDR A;  1DUR A;  2YWK A;  3N01 A;  1DRZ A;  1YHQ S;  1BXN A;  1X4G A;  5L9N A;  3W5Y A;  2EBG A;  1H7X A;  4EBC A;  4DR7 F;  3C15 A;  4OIX A;  1J5E F;  4WCE Q;  3FVY A;  4YOE A;  3T1A A;  2W7P A;  4JI4 F;  2WAQ D;  1RAH B;  5H9F K;  4UOF A;  4LF7 F;  3DHX A;  4KGM A;  2VFS A;  1CC7 A;  5ADZ A;  2HFV A;  1REV A;  2D3O 1;  2AGO A;  3MR7 A;  1VI7 A;  4YB7 A;  5FLX U;  3C19 A;  4K4Y A;  3AJD A;  5AXK A;  3IRX A;  1SUQ A;  2HHV A;  2C2O B;  4J9O A;  2JEG A;  5B0D A;  4DV2 F;  4M5G A;  9RUB A;  1RTH B;  1S6Q B;  1WI6 A;  3PX4 A;  2Q43 A;  1SC1 B;  8RUC A;  3M2V B;  4B3R F;  1HNV A;  2FLO A;  4PXC A;  2W2P P;  2CWX A;  2GHV C;  2HRU A;  4IR1 A;  2NUU G;  3T1H F;  2R7V A;  3Q8V A;  1SC6 A;  4IOB A;  4I7F A;  4FS2 A;  5U47 A;  1FXD A;  4OYX A;  1GXT A;  2QLB B;  3AAW B;  4WFN Q;  4DR3 J;  4JOU A;  3GR1 A;  2UUC F;  5K14 A;  2DHG A;  1LWC B;  5KOX A;  4DV4 F;  2EKY A;  2V8P A;  4RUC A;  3BGL A;  2JHE A;  4JBC A;  4XPE A;  5LSL A;  1NHV A;  4ZVR B;  2F65 A;  3CJR A;  1XNQ F;  4KAI A;  3A8I A;  3JYT A;  4KC5 A;  2B4P A;  3HHL D;  2I6W A;  4EWT A;  1Y11 A;  4YFU A;  4Q5V A;  3SSR A;  4JV5 J;  3CXC R;  1RSC A;  3KLI A;  1TL7 B;  2FUG 9;  4JI1 J;  4K4S A;  3G8Q A;  4ANC A;  2DXD A;  2GAG C;  2W4C A;  4DX7 A;  1PJ5 A;  3NOG A;  4I2Q A;  3IG1 A;  1RA6 A;  2KYZ A;  2DPJ A;  1E6V B;  3EPI A;  3VGU A;  3NCQ A;  1PBU A;  4P7V A;  2R4F A;  4TYB A;  2XUL A;  1RYR A;  2D9O A;  2DGO A;  2OAU A;  4Q0B A;  2QA4 G;  1IKV A;  2HLU A;  3HMJ G;  4ZVS B;  1DFD A;  4OJ3 A;  1A7G E;  5D4O A;  4DCJ B;  1VGY A;  4TYA A;  1FRK A;  3DYA B;  1SC4 B;  2KJW A;  4PWU A;  2PFF B;  2MZS A;  2Y1R I;  1HR0 J;  4DL5 A;  4DV0 J;  1R0A A;  1O5J A;  2WVF A;  2B9W A;  2AYE A;  1VC0 A;  1N5Y A;  3R2D J;  2DTJ A;  1LK5 A;  2J6U A;  3VAL A;  2HRY A;  2H48 B;  3CT9 A;  5CYM B;  1SQG A;  1RTD A;  4A48 A;  3C6U B;  4I0W A;  4Q8F A;  1RJJ A;  2RML A;  3DLG A;  4NLX A;  3K58 A;  4JI7 J;  2OO4 A;  2EFV A;  5CQG A;  2EFO A;  4RW6 B;  1QUV A;  1TV6 B;  1SC3 B;  2QGF B;  3DFE A;  5FDL A;  2NZ4 A;  3LGM A;  4R5P B;  1FEH A;  2H54 B;  2FC8 A;  1JXL A;  2XO7 A;  1VCT A;  2IPO B;  3W8P A;  1C4A A;  5JJB A;  3DOK B;  2W7A A;  2V2Z A;  2W25 A;  2IM0 A;  1HKA A;  3HT3 A;  3ILJ A;  4A8X A;  3UW1 A;  4E98 A;  2QA4 S;  1NSA A;  1NBE B;  4FYW B;  5GAH U;  3B4M A;  2DRA A;  5F0W A;  1DLO B;  2WVD A;  1WSV A;  2W01 A;  1N36 F;  3OXL A;  4NI2 B;  4J91 A;  3KLE A;  1QY7 A;  1NM2 A;  3G86 A;  1NK4 A;  4ES1 A;  4JI0 F;  2ALY B;  4A8Q A;  4ZMM A;  4DR5 F;  2R8K A;  4E2F B;  4DI6 A;  2LXF A;  2OPQ A;  4DV6 F;  4YME A;  4OZ2 A;  5ETM A;  3QNW B;  4O3N A;  2CJA A;  3HHL C;  1G7C B;  3DRY A;  3LAL A;  2RDD A;  4FPR A;  1WF1 A;  1F2G A;  4YY3 F;  1Y7P A;  4RUH A;  3N5B A;  5HQM A;  4KGZ B;  2ZJP Q;  3SV4 A;  3OL7 A;  1X5S A;  1SI9 A;  2HK2 A;  3M1V B;  4RUB A;  1EET B;  1TK8 A;  2FZG B;  2BE9 B;  2PA3 A;  1H98 A;  3PO4 A;  2VJV A;  2AZ1 A;  3MPV A;  4E8U A;  4CCH A;  3V81 B;  3C6T B;  4KTQ A;  1KWM A;  2ILY A;  5DG9 A;  3J7Y U;  3PHE A;  2RUS A;  4WYL A;  4UUW A;  4GMK A;  4W92 B;  2MLX A;  1VOM A;  2OD6 A;  1WKJ A;  3KDO A;  3HJV A;  3CD5 A;  3I0R A;  1JLC A;  2PII A;  1B7Y B;  1PYS B;  4G65 A;  3PFE A;  3R5G A;  5T7L A;  1IM4 A;  3IXQ A;  4UZC A;  3IR5 B;  2VQE J;  2KZM A;  1GNK A;  2GVD B;  2HPU A;  3OUY B;  1LFP A;  5D3G A;  4YS2 A;  1V3Z A;  3BGF A;  2HS0 A;  4OYW A;  1CC8 A;  1KS2 A;  4TY8 A;  1NK9 A;  1U7L A;  2OEL A;  5KFU A;  4TVA B;  2RD5 C;  2UV8 A;  2F8E X;  5A2Q U;  3VQT A;  2VG7 B;  3D0G E;  5C25 A;  3QZ7 A;  2WRM A;  2K3K A;  4WIQ A;  4KYZ A;  2RT3 A;  2B8P A;  3HX9 A;  1UL3 A;  2XLI A;  3BN4 A;  1MLA A;  4DWI A;  2QLF B;  1JKH B;  1LW2 A;  2AYG A;  3IAS 9;  3OLB A;  3D66 A;  2NZC A;  3JAM Y;  1FX2 A;  4TKT A;  3KHH A;  1SV5 B;  2UVV A;  2YKO A;  4EK2 A;  2XLK A;  3QT5 A;  3L95 X;  3GJS B;  4HI2 A;  1XMO J;  2VJU A;  3M2R B;  4KT0 C;  4NLD A;  1FTR A;  4OYO A;  4OL8 A;  1WD6 A;  4K4T A;  3HP6 A;  1WEY A;  3G82 B;  2D74 B;  3U02 A;  1AT1 B;  3CMQ A;  1PYT A;  2VC1 A;  2FHK A;  1G1X A;  3EMT A;  2G0C A;  3M9M B;  4OX7 A;  1KQF B;  5GAE I;  1YJN S;  2RS8 A;  1BMQ B;  2OJ3 A;  2RF2 B;  3MTK A;  3ZNU A;  2FJD B;  1SKR A;  1ELO A;  3A3P B;  2PA8 D;  4U7C A;  3DLB A;  2RRA A;  1NB2 A;  5IZH A;  4LQ9 A;  3KNG A;  4N47 A;  4ZPW R;  4OQJ A;  1U49 A;  4DU8 A;  4YR2 A;  4WXW A;  3OTC A;  3PJW A;  2IJN A;  4PCQ A;  4WZQ A;  1M5V C;  1RWO B;  1F3V A;  3IAM 9;  2YKM A;  2BAN B;  1UEV A;  1YIJ S;  3PV8 A;  2E5L F;  2HFN A;  3HFZ B;  1RI7 A;  2PDA A;  3RZA A;  1ZAW A;  1H2V Z;  1U6B A;  2PT0 A;  3RAQ A;  2DEI A;  1ZM4 A;  1ZM2 A;  2AT1 B;  1U8S A;  4Y6I A;  4DQI A;  3PYE A;  3UQS A;  3KDN A;  3OFF A;  3IGN A;  2I5J B;  2QRR A;  3IBW A;  2FHM A;  2A2C A;  1U02 A;  1I3O B;  4H4O B;  5HSP A;  1VHF A;  2YKA A;  2EC0 A;  1R6Y A;  3CJS A;  5KFL A;  4PWD A;  3OFG A;  1RAI B;  4WP3 A;  2MQL A;  3AQP A;  3FZ2 A;  4O44 B;  4PAB A;  2XBP A;  1VS3 A;  3MDF A;  3A12 A;  3MOJ B;  4H54 A;  3PAC A;  4CLW A;  1AFJ A;  2LMI A;  4A8Y A;  4K8R A;  1N6Q B;  2R7R A;  1AUS L;  5D15 A;  3O6Q A;  3OTE A;  4J9N A;  1GMW A;  4KO0 B;  2HND B;  2HFS A;  2KVQ E;  1FD8 A;  1QAY A;  4O3O A;  3IWX A;  1F2H A;  5HVF A;  2YKQ A;  1F1B B;  2CVE A;  4ECX A;  6AT1 B;  3ZTQ A;  3OPK A;  2ZHA A;  4C8L A;  1R7I A;  1RAO A;  2R2S A;  2VB6 A;  4X4U A;  3PHT A;  1GMV A;  5D4L A;  2LDY A;  4GRS A;  2JLE A;  3I9Z A;  4AL6 A;  1XTZ A;  3BGR A;  1D1U A;  3JSM B;  2BW2 A;  3MEE A;  3HF5 A;  3C3L A;  1JJ4 A;  3PKY A;  4KKO A;  4H4M B;  2VPX B;  3MM8 A;  4LR7 A;  2KI2 A;  3WDO A;  1NND A;  2HFZ A;  5ETV A;  1XNR F;  1DBD A;  2FYX A;  3TAQ A;  2DRD A;  1XER A;  1MU2 B;  2CQD A;  4NCB A;  1RCX B;  4P6Q A;  1FFS B;  5KT6 A;  2ROE A;  4HAC A;  3D3C J;  1QE1 A;  2BM1 A;  5A0Y A;  5HJX A;  1S1X A;  2GW8 A;  4J9M A;  3AD8 C;  5I3Q A;  3M8P A;  2P2C B;  3C15 B;  1RT3 B;  3G87 A;  4X4N A;  4DFK A;  1KSP A;  1RWK B;  2GJI A;  1RHR B;  4ED5 A;  1DQ8 A;  1O51 A;  1E6Y A;  3P96 A;  4W4M A;  3NMR A;  1BWV A;  2V8H A;  2DH7 A;  3NBP A;  1REV B;  5CH7 B;  4MKV A;  4J5O A;  5ETR A;  5J2M A;  3BBB A;  2EVZ A;  1X31 C;  3IRX B;  1FTC A;  4MK8 A;  4DV7 F;  3OTO F;  2ACM A;  2POK A;  4C0H A;  3MR3 A;  2NSB A;  2RDI A;  2UUA F;  4JUZ A;  5DGB A;  4WFB Q;  1HNZ F;  4IRC A;  1S97 A;  1VQ5 S;  1LWE B;  4NEY A;  3FK4 A;  1TL1 A;  1SQF A;  4ES2 A;  4HTI A;  2ZM6 F;  2M52 A;  2JVR A;  1RU2 A;  5KG6 A;  4ZPT R;  3MWB A;  1NXI A;  1YJT A;  4YUD A;  3TAP A;  4WJB A;  5H1S V;  4ZCI A;  4ZVO B;  1Q16 B;  3VTI A;  2YPY A;  4J9R A;  2C3Y A;  2RE1 A;  3L4B C;  4OLO A;  1ZET A;  3UNY A;  5IS2 A;  4KB7 A;  4ELT A;  4LUB A;  3NNC A;  3KLI B;  2VIC A;  1NKE A;  4L72 B;  2V9K A;  1MG7 A;  4DV3 F;  5C2C A;  4WP9 A;  4EO6 A;  1YWX A;  2ASJ A;  3KXD A;  2VFU A;  2PMW A;  3BF4 A;  4R8U A;  5LMN J;  5L1J A;  1F5C A;  4ZVF A;  3IG1 B;  4MT1 A;  3QYY A;  1RWW B;  4ATN A;  4USU A;  4MMO A;  3KUE A;  1LV5 A;  2H51 B;  1A6L A;  3LP1 A;  3A8E A;  5J1E A;  3A8J A;  2H9Z A;  4B9M A;  1SH0 A;  4DN9 A;  3OJS A;  1RB0 A;  5FLX Y;  1BE4 A;  4Q0B B;  1T9W A;  4LRE A;  1IKV B;  1SCJ B;  4NAS A;  1B0V A;  1SPB P;  3X3U A;  3N79 A;  4NLV A;  5F8H A;  2XGP A;  2KO1 A;  4JI8 J;  1DTT A;  3E01 A;  1P27 B;  3AJ1 A;  2EFG A;  1SB6 A;  2J7W A;  1HPZ A;  3SQG A;  5KFO A;  4UY8 5;  2KB2 A;  4N7T A;  2Z56 B;  3KWM A;  1YBA A;  2YNI A;  4KHR A;  1LWF B;  1S48 A;  3LWM A;  1RWX B;  4UQT A;  1SH3 A;  1EP4 B;  2QYC A;  3OR2 A;  4HI1 A;  3NS6 A;  4LRC A;  3PKM A;  2O66 A;  3CJK A;  4ED4 A;  1U24 A;  2DIU A;  3DLG B;  1JMT A;  4ZVG A;  3M6U A;  4JI2 J;  2CYY A;  4DG1 A;  1TL3 B;  4ECQ A;  2DR6 A;  4QYR A;  4CO1 A;  2W4D A;  4IG0 A;  4GKK F;  4F4X A;  1C0T A;  4Z37 A;  5FDL B;  1WWH A;  4FKX A;  1L3U A;  4J9K A;  2H3E B;  1EJ7 L;  1KFS A;  3MUR P;  5L38 A;  2OPP B;  3M6W A;  3OD2 A;  3UN5 A;  2J0S D;  2VON A;  3M8Y A;  1U1O A;  1Q82 T;  1KTV A;  2NLW A;  2HFU A;  2BKN A;  4CO4 A;  4UW2 A;  4NYO A;  3M30 A;  1M1G A;  3N9U C;  3BDE A;  4Z7Y A;  1S4E A;  4IYQ A;  2N7Y A;  3EGN A;  2EFP A;  3KLE B;  1PBA A;  1U2R A;  5KG3 A;  4OI1 A;  1FRJ A;  4LSN A;  2OPQ B;  1RDR A;  3SCI E;  2BJ8 A;  5KFV A;  4A8O A;  1MN7 A;  3M4X A;  2G13 A;  4CLU A;  3FEX B;  3CCT A;  2MDA A;  3ENA A;  2DNQ A;  1ZS6 A;  3BBF A;  1NDL A;  2JLF A;  1TUW A;  2N3L A;  2MTL A;  1VJW A;  3THV A;  2A0F B;  2OGU A;  3FSY A;  3HI9 A;  1X60 A;  3KK2 A;  5KFN A;  3PW7 A;  3L7U A;  2G0I A;  1N33 J;  2DVI A;  3TVZ A;  3QAT A;  3Q23 A;  3NEK A;  4EUV A;  4RW4 B;  3LO3 A;  2PC6 A;  4X64 J;  2GMH A;  2K1R A;  3IR6 B;  2HWT A;  1P9Q C;  1GX6 A;  2GJF A;  2XMK A;  2QLW A;  4BS2 A;  1FES A;  4UT4 A;  2QA1 A;  4O4R A;  3I0R B;  1JLC B;  2CNN B;  3QGP A;  4CNY A;  1S77 D;  3GFX A;  1RTJ A;  3HZE A;  2HNZ A;  3F41 A;  3NGR A;  3P3D A;  5LJ5 Y;  4BWM A;  2LU2 A;  3P5B P;  3BQ2 A;  4V19 J;  2FDN A;  2A3J A;  3F56 A;  5KFT A;  5D3G B;  5HN0 A;  4LF5 F;  1S1W A;  1IQT A;  2IFX A;  1KTQ A;  4B3M F;  4TY8 B;  2QLJ B;  5CA5 A;  2XCP A;  1H74 A;  2J9D A;  3VF0 B;  3F44 A;  1K47 A;  5ETQ A;  2KFN A;  3HVT A;  1NH7 A;  4F0M A;  2Z2Y B;  4CLK A;  2AYB A;  3J81 U;  1IKX B;  4NLR A;  5C25 B;  3MUT P;  1Q8I A;  2R8J A;  3NAI A;  3O8W A;  2Y8Y A;  4LBP A;  3OBI A;  1HQU A;  2OSQ A;  5IT9 U;  3AD9 C;  2WON A;  3BM7 A;  5A8W A;  2FHJ D;  1C4C A;  3ZO7 A;  2EBE A;  5E2Q A;  3WHI A;  1RGV A;  3UDL A;  3TA1 A;  1LFW A;  3DOL A;  3K5P A;  3T3F A;  3MFH A;  2KXN B;  2NXC A;  4RWW A;  1VC6 A;  1HBU A;  1K8A T;  1YI2 S;  1S10 A;  1T03 A;  4KV8 A;  1W7W A;  2FLP A;  5HAT A;  3H0P A;  2JOQ A;  2BE7 D;  3T9Z A;  2OKQ A;  1VLY A;  3CCZ A;  3BQ0 A;  2P5V A;  5J2N B;  4EEY A;  1AZS A;  4P71 A;  3IRW P;  3GV8 B;  3KMS A;  3SDE B;  2YTC A;  4KRW A;  2NUH A;  4ID5 A;  5AT1 B;  5DS7 A;  1TUG B;  3POT A;  2GO8 A;  4FF1 A;  1UW9 A;  4PR6 A;  4C3M A;  2QSF A;  2V2Q A;  2ZH9 A;  4GVL A;  1N34 F;  1HNX F;  3IBF B;  3B54 A;  2JH3 A;  4DQS A;  3K5N A;  1UAW A;  4IKA A;  4C8O A;  3RU0 A;  5G0R A;  1EAY C;  3TAN A;  4WFZ A;  3DCA A;  3I5A A;  3NCR A;  3TUZ C;  2J0W A;  3ISZ A;  4DUY F;  3R6L B;  5KFA A;  3W5Z A;  4ZLN A;  4LSL B;  4Z7C A;  4DR1 J;  4AD6 A;  5A2Q Y;  1SJ4 P;  5D8H B;  3RAM A;  4M1K A;  3QRQ A;  4DFJ A;  2CUY A;  2MLZ A;  1FE0 A;  4LF6 J;  1HBM A;  2ATL A;  1VIX A;  2KJV A;  4MKB A;  1OSC A;  3ENW A;  5D4N A;  3GP9 A;  2QJ3 A;  2UXB F;  3SEO A;  2DKO B;  4ECZ A;  1SJ1 A;  3KJV A;  3DLH A;  2M3D A;  3NL0 A;  2QEX S;  4NXN J;  4CLF A;  1FD2 A;  2Q6C A;  3QFH A;  3ZXW A;  4QBU A;  4RJV A;  2HVZ A;  5HBM A;  3WIU A;  2BE2 A;  3EUN A;  5GME A;  5LXY A;  5BYS A;  4B9N A;  2BAB A;  2JFD A;  3MCO A;  2DGS A;  4K7Q A;  3HHN B;  2IHR 1;  4LR9 A;  2QE5 A;  3CCV S;  2IA6 A;  5I3P A;  3JTN A;  1NK7 A;  3P5T L;  3B82 A;  3D3B J;  3DRS A;  5HMW A;  4CLY A;  1HW9 A;  4J9Q A;  3GPA A;  2DHX A;  4NML A;  2ZWP A;  2YPZ A;  3JSB A;  3K8V A;  3KK3 A;  1OJ4 A;  1LOU A;  3I56 S;  4DR7 J;  2L9D A;  3HZG A;  2IDE A;  2HQI A;  1BC6 A;  5F8G A;  3MUV P;  2ZBC A;  1ZZF A;  2EKN A;  4ZPD A;  2FVS A;  1QVF R;  4X4P A;  3BGR B;  5DDO C;  3HT0 A;  4KKO B;  5LT5 A;  3CO0 P;  4F25 A;  1FWK A;  4M95 A;  1BLU A;  5IT4 A;  2CQ1 A;  4I4B A;  1RBL A;  3P45 B;  3KUH A;  1NPK A;  5GAG I;  5IWA F;  4HAC B;  2G1D A;  1QE1 B;  4C8N A;  4ID8 A;  2BVZ A;  5A6W A;  3NGK A;  1V6H A;  2YY3 A;  1W25 A;  4X4R A;  4ED1 A;  1TKZ A;  3GIM A;  1S49 A;  4KY3 A;  2HQC A;  5K8O A;  2V67 A;  2XCA A;  1CS4 A;  2B51 A;  2ZUA A;  3MM7 B;  2ZD1 A;  1OO0 B;  1E6Y B;  1HQE A;  4ERD A;  1XNQ J;  3DRX A;  2H65 B;  1GTE A;  1X9S A;  3NBP B;  1HI8 A;  2UVU A;  1RCO B;  1ZZN A;  5A8R A;  1YJ9 S;  2AMC B;  3FRZ A;  4JI3 J;  1RQ0 A;  4U7U K;  4NYP A;  3FFI A;  1DZ5 A;  4PG6 A;  5DM6 Q;  2RKI A;  1TK5 A;  2MKI A;  3BGO P;  3D9B A;  1WF2 A;  2DNP A;  4B3O A;  4DSK A;  3W8G A;  1FKP B;  3TVY A;  3Q86 A;  2GIF A;  5LM7 E;  3TZX A;  4QJV A;  4PPZ A;  2AGP A;  1VBY A;  2AF6 A;  1WEX A;  2JWN A;  1NDC A;  1OYE A;  4AE5 A;  4OI2 A;  1TL1 B;  1IBK F;  2X51 A;  3UVJ A;  2MQ8 A;  4ECV A;  4L74 A;  1OYD A;  5IV3 A;  4DL3 A;  3N4W A;  3ET6 B;  2WVC A;  2V4J B;  4EO8 A;  4OX6 A;  2ZH1 A;  3FUY A;  2JL9 A;  4K4W A;  1V9O A;  1QTN B;  3KLF A;  1CQN A;  1JQG A;  4WBF A;  4E0D A;  2DR7 A;  3ZC4 A;  1XWL A;  1YSJ A;  2LQ8 A;  1S5Z A;  2CJ9 A;  1X8D A;  4AXI A;  4IQX A;  3HSD A;  5ETO A;  4MTP A;  3FBC A;  4I6Y A;  2LQB A;  4QIW D;  5K8P A;  2ZBI A;  4HH1 A;  1XR7 A;  5EDW A;  2ZH8 A;  2GV1 A;  1U1K A;  5HP1 B;  2Z4P A;  2V4R A;  4CO2 A;  1DY3 A;  4CT9 A;  2VKR A;  3FGV A;  3E51 A;  3SQO P;  4F04 B;  2NQP A;  1PG5 B;  1YBT A;  4R8U B;  3R5B A;  3US5 A;  1RLC L;  4YDD B;  3BYP A;  3T6B A;  2HVE A;  3DLE B;  4DS4 A;  3GSD A;  3FJ2 A;  4JYA J;  2YWE A;  5IV4 A;  1ICE B;  4FF2 A;  1NEE A;  2ZH2 A;  1JLF A;  1FVS A;  2OPR B;  2CG8 A;  4DV5 F;  4L3N A;  3R2C J;  1FK9 A;  4KR0 B;  5KT3 A;  2NXN A;  4M5J A;  1S9G A;  3TO8 A;  1RWU A;  4ZJQ A;  2XQC A;  1F9H A;  3CJQ A;  2W2O P;  1RLD A;  3W2W B;  1TMM A;  3ZZP A;  4RLE A;  3RRK A;  1DTT B;  1FJ7 A;  3HUL A;  2XC9 A;  5KFB A;  1FJG J;  1YRX A;  2XSJ B;  3SXL A;  1HPZ B;  3T9N A;  1WC1 A;  3LOU A;  1NAQ A;  4DHV A;  2W2N P;  1QVG R;  3MR6 A;  4QWD A;  1NPR A;  3IFE A;  1A0O B;  4LF9 F;  5JVH Q;  4RNN A;  2YNI B;  4W98 A;  3UDE A;  4DL7 A;  4XTT A;  1Q53 A;  2CQ4 A;  1RAC B;  4I56 A;  5JUM A;  1L3K A;  4FXD A;  5BR8 J;  4DLG A;  2DT9 A;  1MMD A;  3OR2 B;  1X9M A;  4NLW A;  1YLX A;  4OHY A;  2DJW A;  4CO0 A;  3CJK B;  2YX4 A;  3KG1 A;  3OSP A;  2B6A A;  4G1Q B;  4DG1 B;  1JJ2 R;  1N4L A;  4HH0 A;  3MAQ A;  1ZOT A;  4OX9 J;  4IG0 B;  4P2M A;  1C0T B;  3PX0 A;  3ZZU A;  3EGV A;  1KVK A;  2DYA A;  4YY3 J;  1GH8 A;  2I1R A;  1FO1 A;  2WW8 A;  5LL6 d;  3Q8P B;  2DNR A;  1RP5 A;  1FKO A;  3BQ1 A;  2CNL B;  2MZT A;  2C3O A;  1KQS R;  4RNH A; 
#chains in the Genus database with same CATH homology
 3KJN B;  3D6H B;  2Y1L B;  1QTN B;  3NS7 B;  3GJR B;  1RHK B;  1RHU B;  4ZVR B;  2FQQ B;  2P2C B;  2XYP B;  1F9E B;  3GJS B;  3GJT B;  1RHJ B;  1RWN B;  1RE1 B;  2Y0B B;  4ZVU B;  1RWK B;  1SC4 B;  2C2K B;  2QL7 B;  4ZVO B;  1RHR B;  4LSZ B;  2CNN B;  5K20 B;  3R7N B;  5IC4 B;  2H65 B;  1I51 B;  2HBQ B;  2C2Z B;  1RWV B;  2XZT B;  2DKO B;  1RWX B;  2QL5 B;  1RHM B;  1QDU B;  3EDR B;  1I3O B;  2C1E B;  2HBY B;  3R5J B;  3GJQ B;  2H48 B;  2C2O B;  2XYG B;  3QNW B;  2QLJ B;  2CJY B;  3R6G B;  3RJM B;  4ZVP B;  3D6F B;  1BMQ B;  2H5I B;  3IBC B;  2QL9 B;  1RWP B;  1SC1 B;  2CNO B;  2HBR B;  2CJX B;  1IBC B;  1RWM B;  2HBZ B;  4ZVQ B;  3R7S B;  5IC6 B;  1RWW B;  2CNK B;  3KJQ B;  3P4U B;  2H51 B;  3R7B B;  3IBF B;  1ICE B;  1SC3 B;  3P45 B;  3KJF B;  3D6M B;  2H5J B;  2H4Y B;  2H4W B;  2H54 B;  1NME B;  4JB8 B;  1PAU B;  1RHQ B;  4DCP B;  1GFW B;  3EDQ B;  2QLB B;  1RWO B;  3R6L B;  2QLF B;  1PYO B;  2XZD B;  4ZVS B;  4DCO B;  4ZVT B;  2C2M B;  2CDR B;  2XYH B;  2CNL B;  4DCJ B;  3SIP B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...