2H4WB

Crystal structure of human caspase-1 (glu390->asp) in complex with 3-[2-(2-benzyloxycarbonylamino-3-methyl-butyrylamino)-propionylamino]-4-oxo-pentanoic acid (z-vad-fmk)
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
88
structure length
88
Chain Sequence
AIKKAHIEKDFIAFCSSTPDNVSWRHPTMGSVFIGRLIEHMQEYACSCDVEEIFRKVRFSFEQPDGRAQMPTTDRVTLTRCFYLFPGH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Caspase-1
publication title An allosteric circuit in caspase-1.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/hydrolase inhibitor
total genus 15
structure length 88
sequence length 88
ec nomenclature ec 3.4.22.36: Caspase-1.
pdb deposition date 2006-05-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1470 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Caspase-like 2h4wB00
1RWXB 2CJXB 2DKOB 1SC4B 4DCOB 3D6FB 1RWWB 1RHQB 4ZVRB 2CNOB 1F9EB 1PYOB 3RJMB 1RE1B 3R6LB 2QL7B 1RHMB 3IBCB 4LSZB 4DCPB 1RHKB 1RWVB 2HBRB 2P2CB 3R6GB 1RWNB 2C2MB 4ZVQB 2XYPB 3KJQB 1RHRB 2QLJB 5K20B 1RWOB 1PAUB 2XYHB 1IBCB 2C2KB 3KJFB 3EDQB 2Y1LB 3IBFB 2H5IB 3R7BB 3R7SB 3KJNB 4ZVSB 2QLFB 3GJRB 2H54B 4ZVUB 4ZVTB 2Y0BB 4ZVPB 3QNWB 2C2OB 2XYGB 3NS7B 2QL5B 2CNKB 2HBQB 2QL9B 2CNLB 1ICEB 3D6MB 2FQQB 2CJYB 1RHUB 3D6HB 2XZTB 2H5JB 2C1EB 3R7NB 2H65B 5IC4B 2H4WB 2HBYB 2HBZB 2XZDB 3SIPB 1RWMB 2H51B 1I3OB 2QLBB 2H4YB 2CNNB 1RWKB 2C2ZB 4ZVOB 2H48B 4JB8B 1RHJB 3P45B 1QDUB 1RWPB 5IC6B 3R5JB 3EDRB 4DCJB 1I51B 1BMQB 1QTNB 3GJQB 2CDRB 1GFWB 1NMEB 1SC3B 3GJSB 3GJTB 1SC1B 3P4UB
chains in the Genus database with same CATH superfamily
2OPQB 4RJVA 5DM6Q 2VKRA 5HI7A 4DBQA 5I3PA 3BO3A 3D54A 4JV0A 4WE1B 2AGQA 3W63A 3N5FA 4DR5J 3IAS9 3C3LA 1NB2A 4H4MA 2G1HA 1XERA 2LVWA 3MPDA 4Q0BB 2MQ8A 3ZZTA 2VFVA 4YEAA 3CJRA 1G4CA 1V5VA 2XY5A 1R0AA 2BJDA 3CDBA 2MXYA 2X1GA 5GAGU 3GWCA 1LW0B 2GVDA 4JI1J 2C2RA 1T9YA 1S0NA 2NXNA 3KLHA 2HPUA 2W8KA 4DV2F 3MM6A 2EFGA 2CG4A 3NLCA 2FLNA 4M5GA 1DAXA 2EVZA 1WF0A 2ZKTA 2ZZNA 4NEYA 2DNYA 4PAAA 2WRMA 3CCRS 1KQGB 2DR7A 3OJSA 3N6LA 1S9FA 3VGVA 3DOMA 4P74A 4EYIB 5C2GA 1CG2A 1Y5NB 2HNYA 1X5SA 2COLA 1RBLA 2OJ3A 1FVSA 2ASLA 2LCWA 1XN9A 3DLKB 4FPIA 4LFAJ 3K8VA 2MKIA 4KFBB 3M30B 2ZJPQ 3C46A 3ITHB 4P72A 3SFUA 1KNZA 3SZ2A 4LF9F 4LR7A 2HQFA 2H54B 3A3NB 5JVGQ 4WYWA 2ASYA 3MD3A 1VQSA 4LBHA 3GYGA 3GG0A 1FFGB 3DFEA 1WOPA 1I5OB 2D74B 4HHUA 5LM7E 1RT2A 4F2RA 2W2PP 4F3OA 5HVHA 1P1TA 4ZPAA 3G71S 2UV8A 1J5OB 4ZDNA 2BJ7A 2D3O1 2CJKA 5E3PA 2X3DA 1S9GA 4Y2CA 2POKA 2DGXA 5BR8F 2ZC4A 1NUEA 4WFBQ 5BYQA 3V4IA 4RUHA 1H74A 1Q1KA 2CQBA 1REVA 4EUVA 1FI4A 3NY0A 2KDOA 2ZJRQ 1O5JA 3CCLS 5EDWA 4K5RA 3GR1A 2KJVA 2GCFA 4HTIA 1U1NA 3K57A 2UU9J 1EHWA 3TVZA 3H7HB 2EFVA 1FERA 1RHMB 4CH1A 2ZOMA 5I3UA 4M63A 2KT3A 4R8UA 3L7OA 3CMAS 2XO7A 1U1OA 1UA1A 2X7IA 3OT9A 2LFVA 3ZZRA 2OSRA 3CJQA 1B7FA 2UV8G 4A8FA 5L9XA 2BJ9A 3W64A 1GMWA 3FBBA 1NK8A 1QY7A 5RUBA 2CNLB 3TR5A 2D1CA 3R7NB 2GC8A 3GFYA 4B3MF 4CRJA 3MHYA 3H2VE 2BV3A 2BW2A 1O51A 2DXDA 2OSQA 1Y0HA 4QYZK 2UUWA 3RBDA 4OYOA 1R31A 2P6SA 3PVXA 4C8OA 1GXTA 5F8MA 3VGTA 4NI2B 4WCEQ 4ZCLA 4UTGA 1NK0A 3MEEA 2MMYA 1M5SA 4QWAA 3MECA 1N54B 2ASJA 1JNZB 1UEKA 1YJTA 2E7VA 4QR1A 4B3TJ 2OD6A 2CJXB 3W9JA 3MOZA 2RKIB 3PJWA 1Q7YT 1RKJA 4XK8C 3KMSA 3D28A 1NXIA 1NJWA 1T3OA 2V5HG 1IKWA 4FKYA 3DXBA 2XYPB 3HHLD 3UN3A 2XB2D 4ZHRB 2DEJA 1FRMA 4YOEA 2YQ1A 3M2RA 3DLEA 1NK6A 4XIUA 3R7BB 1WEXA 3CT9A 3HM9A 4FVMA 4G65A 2RE1A 1WDTA 3I55S 3ILOA 1OYEA 4WXOA 2PI5A 1FKOB 3AHPA 3RYLA 3MR6A 5L39A 2QRRA 1ZBTA 2AU0A 4JI1F 2VJUA 2YWWA 1VQYA 2HBZB 3PYGA 2ZHOA 2E9RX 3CJKB 1NSPA 1FTRA 1GXUA 4YR3A 2HRYA 2R8IA 1B0PA 2P6TA 3N01A 1IWGA 3G87A 2CZ4A 1VC0A 4LF5J 1Q8LA 5IT9U 5J1NA 4O3QA 4B3OA 4USUA 3CC2S 2AKWB 3GJSB 2BE9B 1U1MA 1QE1B 1SKRA 3EX7B 4U96A 4ECWA 3MMAA 2C28A 2H3EB 3OSPA 2HRUA 1LXNA 1S0OA 4LFAF 5KFCA 1YJ9S 2M7SA 4RUBA 1YLXA 4YB6A 9ATCB 5MLCV 4YHHJ 1JLGA 1UW4A 3M2UA 1DBDA 3GIKA 4KHPJ 4Q8EA 3LW5C 2VA3A 4ZVTB 3M05A 4XPEA 1S6UA 1F1BB 1RT6B 4MKVA 3SV3A 2QL9B 1JJHA 3H4BA 2AJFE 4OQJA 1B4SA 3MF5A 1AUDA 1Q16B 3DI6B 1U0SA 1S1TA 2CPDA 4QYZJ 1GX5A 3MPUB 3OR1A 5KG6A 1UVNA 4DV4J 3EYZA 2MGZB 2YKNA 3CULA 1RBAA 2XSJA 2XS7A 5GVQA 1QAXA 4IR9A 2BM1A 2NXJA 5EN1A 4NLRA 1GT8A 1S77D 5J2NA 1OS5A 1TVRB 3HP6A 3DOKB 2OFGX 2UU9F 1RGVA 4GC6A 2BX6A 1Q5YA 1AFJA 3U27A 4CLZA 2XMMA 5MAOA 1JLEB 4OYMA 1P6TA 2ASDA 1PC4A 4ZLJA 1U48A 4KGKA 2DB1A 2HURA 3QMQA 3W5YA 3QGHA 3HKWA 3Q0AA 4YB7A 2V63A 3PNIA 4Y6IA 1KRPA 2GFFA 1RAJA 2OEMA 3EZ5A 3J7AN 1D8YA 3M8QB 1VCTA 2QJ3A 1SBRA 3R5GA 2EK6A 2ROGA 1R89A 4RBUA 4PG6A 4KO0A 4C98A 4H4KC 2AYEA 2F65A 4DG1A 2OEJA 1IM6A 5KFKA 1KQSR 1QDUB 1BD6A 2DT9A 4U67Q 5A2QY 5L1LA 2XQCA 1BMQB 4N41A 5EUHA 2FZKB 2MQPA 2AX0A 3HHKA 4K4WA 1VBZA 3AA8A 3EXCX 2PI4A 2BJ3A 4DZ6A 3JSYA 4LF6F 1UJ4A 4GVLA 5M2PA 4LFCF 2CQHA 3DRRB 2XI3A 4YR2A 5HMWA 3ISND 2ALZA 4IG0A 1RA7A 1W7WA 1MWYA 4HEA9 2KHDA 3C19A 4JI5J 1LKZA 2KN4A 3THTA 5HMYA 5B0GA 2PSZA 2AQ4A 3QSIA 1UWBB 1HBOB 3MAQA 2KO1A 3BSCA 3DLHA 1VBKA 5DJBA 4ZVUB 5C42A 3S8SA 3K5MA 4O23A 4V19J 3QT5A 1EP4B 5D0RA 4OYZA 1IKYA 1DFDA 2I2YA 2VICA 4DX5A 5SZTA 2QA2A 4G1QA 2XHCA 1CJVB 2JEFA 1RTZA 2H65B 2RRBA 2XULA 2HHTA 2V2VA 4ZLNA 1Y5IB 1V3SA 5JMNA 2EK1A 2EG1A 2ZH7A 3O1LA 4UQGA 4TQSA 2B4OA 3KLIB 1RU1A 2MJUA 1NJZA 1HMVA 4LF5F 2IBOA 3QWPA 4C8LA 1TELA 2ZM6F 1LXJA 1DTTB 2ZUGA 1UZHA 3T1HJ 3RJMB 4UZCA 4Y2KA 3M1VA 5GAGI 4F02A 1PIEA 5JJBA 3ILJA 3V81B 3KJQB 4YHHF 5F41A 3DU5A 4A8XA 3G8TA 5ETMA 4DR3J 2KU7A 3QGPA 1E6VB 1X31C 4KHPF 2VBZA 6AT1B 1NEEA 1WEZA 3RRKA 4IOAQ 4ED7A 2FC8A 2M9KA 3JTOA 3TQ1A 3L09A 2OP5A 2HMIB 2CJYB 1LFPA 3MCMA 4JI2J 2AP6A 3HXMA 4LSLA 2ZJQQ 1K0VA 1VK3A 4C9DA 4ZS6A 3KHRA 1KC8T 3G82B 4ELTA 1NKBA 1LK7A 3MUVP 3CJ0A 4ZVGA 2H4YB 5CAAA 5D6GA 4LF7J 2PO4A 4K2XA 3T1YJ 5L1KA 3EJMA 1HPZB 3FGVA 2ZUAA 3SXLA 4C3KA 1T02A 4DR2J 1SXLA 1Q53A 2WSFC 3W8GA 5HP1B 3RB3A 3GTYX 1B0TA 3VQTA 4C7QA 1D9FA 2ZZTA 4EBDA 4OJ3A 1E6YB 1G1XA 2WAQD 5FJ4A 3LPEA 4LIRA 1FJEB 4K4YA 4BBYA 4AQYF 2DITA 3KJNB 3JSMB 2N7CA 4LRCA 1F2GA 3GV8B 1T9XA 4ZVPB 2YNFA 2CQ1A 2ZZMA 3OL6A 2DO4A 1N6QA 1OWXA 4LR8A 4KR0B 4DXLA 4QPXA 2EKNA 3HJVA 2IDLA 1XMOF 1B7YB 4C3MA 4YB1P 2YH1A 2LEAA 3MR3A 2Y9HA 4USWA 3LP0A 1LWCB 4ECRA 2K7KA 4IFVB 3W9HA 4A8KA 2LQBA 2YNIA 3LTOA 3CCVS 1VMBA 3I9ZA 2Z0GA 1RT1A 1EX8A 3ET6B 4C0OC 2DIUA 1HLWA 2CJQA 3EGVA 4WFXA 4NCBA 3TX8A 4JI5F 2QLXA 2GA7A 2QYCA 2E5GA 2K2PA 4OLOA 3PG9A 2I6WA 2AZ1A 2KVIA 2O1PA 5FDLB 2C2NA 1SC6A 5D8HB 2DNLA 4KH0B 3PY8A 4AFFA 5F3TA 4B3SJ 4L72B 1G6BA 1HQ2A 4J9KA 2AEMA 2DJWA 1J5OA 5HLFA 3CC4S 3HDSA 4F4YA 4JYAJ 1YJUA 3TEHB 5FLXY 3NCPA 1R7IA 4IQMA 3ZTQA 4OYIA 5C24A 4EYHB 2HFSA 4KYZA 2FVSA 3AXKA 1S1XA 2I5JB 4M8LA 4DFKA 2OELA 1KVKA 3VZIA 3OTDA 3NGKA 4Y34A 2R9LA 3CO9A 3RUBL 2IMWP 3TYTA 2RF2B 3AAWB 2L9NA 5T41A 4Y0FA 2OMOA 5KFLA 3IAM9 1WF2A 2UXCJ 3GJTB 3OFEA 2BJ1A 2VPYB 3T1HF 3NAIA 1OPIA 4RBVA 4W98A 4PWWA 4BWJA 4JI4J 2VONA 1DY3A 4N76A 2HK3A 2RAQA 4F50A 4Q2MA 4MKBA 3OJUA 4IDKA 3T5KA 3BF4A 3NMAA 5E3AA 1UAWA 4DR3F 1VC5A 4MYUA 5IS2A 2C3YA 1XR7A 5DRKA 2Y1RI 4PUOB 1R8AA 4R5PB 1XK8A 4FDFA 2HWTA 2KTQA 3FEZA 5CQGA 3DGPB 4XTTA 2HGNA 4QBUA 5DG9A 3K5LA 2R2TA 1S48A 3MFIA 2ZDPA 3MAAA 1R8HA 4XDDA 4ES1A 1AW0A 1XJWB 2XMVA 4LF7F 2IAJA 3KK2B 1WG4A 3D3CJ 2L41A 3T5JA 2XC9A 1IKVB 3D68A 3Q2SC 1SUQB 3HHDA 4YY3J 2PDAA 2HSEB 5IWAJ 4ZHRA 2IM0A 1ZETA 3H2UB 4H54A 5BYRA 3LAMA 2W8LA 2BA9A 4FYXB 4IRCA 5JUMA 3W62A 3BPSP 5J2MB 2B9YA 1PBUA 2VHGA 4OJGA 1OJ4A 5A8KA 4Y2MA 1RT7B 1L3TA 3T5LA 2GAHC 4B9MA 3MUMP 3U1MA 5JXSA 1ZPWX 2YWEA 4FS2A 3I87A 5IZHA 2YXLA 1TR0A 4KHRA 3QZ7A 2MQMA 2OPSA 5F8JA 3CJ8A 2V2KA 2YX1A 4C11B 4RUAA 3UD5A 3RB0A 4B9TA 2OI2A 3PW5A 3IA0A 2HHSA 4DX8H 3NGRA 2NPIA 3PRDA 1S9EA 2FGOA 3HULA 2GIFA 4DCJB 2F40A 5HVGA 1NJXA 4JUZA 3UFCX 2ZVSA 4UY8T 2XM3A 2VBYA 3JAMU 4HACB 2F1FA 3I5CA 2G1DA 3LP2B 3VAFA 1RCOB 5KFUA 1GTHA 3L95X 3JQJA 2CDQA 3D7SB 1IR2A 4P2MA 1RWWB 2RD5C 1WI6A 3ZZUA 4C8NA 2BKNA 3Q83A 1AZSA 4X65J 3N6NA 4NLPA 2IVFB 1WNEA 2XHWA 1UTAA 4MK7A 3KOAA 4OX6A 2B5JB 5KFIA 1RTHA 3EDQB 3HHLA 4USMA 2HVZA 2M88A 3QGIA 3GFXA 5A2QU 1IN0A 5J1EB 2AIRB 3UN2A 4OV1A 3E3XA 2UUTA 3D9BA 4I0WA 3DI6A 3MMBA 4JYAF 2ZH1A 1G7CB 1RLDA 2W2NP 5CD4A 1C1BA 2XZDB 3ENVA 4DZDA 5B0AA 1N52B 1NRKA 3TZYA 5KFAA 4U7UD 3R9LA 3RW6A 1VQOS 2OPRB 2BEFA 3E01B 1FVQA 4DL2A 2FLPA 4R0EA 2DYAA 2F9DA 3NOCA 3ENWA 2JOQA 3KMQA 2DNHA 2UXCF 1H72C 1JJ2R 4J9PA 4L75A 4ZK7M 2GHWA 1XNRJ 2HAFA 1C0TA 4OZNA 4WTYA 2NXEA 1X8DA 2UUAF 2MZTA 1JKHA 4PPDA 5DM7Q 4PEOA 4YQWA 1YHQS 4DMZA 3KHHA 3UQSA 3QO9A 2PD1A 1S99A 5FD1A 3IBFB 3R7SB 2QG9B 5HL7Q 4HL9A 2W2MP 4NYOA 2N3LA 4TU7A 2JHEA 1WOOA 2JEJA 3B4DA 4I2QA 1RAFB 1C1CB 4IG3A 1QM9A 2ATCB 4LRDA 5DQHA 1NO8A 1SJFA 3R5CA 2KM8B 3GLJA 3IRXA 1RK8A 5A0YA 4BLGA 1VQ4S 5CYQB 3HX9A 3Q8UA 2NXCA 1S97A 1VDHA 5D15A 2R7QA 5KFOA 1RUSA 4DS4A 3JYTA 1U0HB 3N5BA 2BQRA 4YY3F 5IWAF 3DHWC 1UWBA 1HBOA 1N5QA 4OZLA 2DGSA 1XR5A 1S6OA 4RUCA 3M6WA 4YDXA 1WEYA 4QCLA 2HVEA 3QIPA 2XO6A 1EP4A 3C15A 3GILA 3SDEB 1P9YA 3MEKA 2JFDA 1C0UA 4DU7A 3Q24A 2XCPA 3GYNA 3MMJA 1XR6A 1RTDB 2IC3A 4ETZA 1SJ1A 1WC3A 3NWRA 4TN2A 2C42A 4UUXA 4JB8B 1U1QA 3D1QA 2AEFA 3HHNB 1TL1A 1S6PA 4EGLA 1UVIA 1MWQA 1R0CB 4PXEA 3NNAA 1HNVB 2VPZB 3CCJS 1K9MT 2BDPA 3KKFA 4ECVA 4GVBA 5I42A 4KHMA 3LPYA 2V50A 1QAIA 1X0PA 2YKOA 4OZJA 1T8EA 3ZZYA 4WP8A 2DVIA 3R6LB 2KFZA 3AB2B 2IJNA 4X65F 2AW0A 2E1AA 2AX1A 1NDPA 3VCDA 4ZVFA 2B4UA 2HMIA 4OHZA 1RAOA 3BM7A 3C6UA 3CDAA 1KSPA 1V3RA 3KK1A 4KY3A 3RZAA 1RI7A 5KG0A 3G82A 5AXKA 2C2OB 4B08A 3H98A 4O3RA 2RILA 4OJ1A 3T19A 4I67A 3NXZA 3TZXA 2IM1A 2YKMA 4ZIWA 2RMLA 2ZH9A 3ILLA 3GONA 2LU2A 3UDVA 4DWIA 2DR9A 4DR6F 2JRSA 2LA4A 7FD1A 1B3TA 4JI8J 2H1YA 2AGPA 1J27A 2RH3A 2AYBA 4I7FA 3K17A 4LQ3A 5EHHA 5J2PB 2ZH2A 3ETMA 3BR9A 3BSNA 5FLXU 4JI3J 1XNRF 1M5OC 4UW2A 2CADA 3F56A 3F0NA 5DQIA 4DCPB 4N77A 4MKYA 2QA4G 1UPMB 3NP5A 3MCSA 4LR9A 2O5DA 4I68A 3TRGA 2YNGA 3HJFA 3JB9k 4QR0A 3BBCA 3AT1B 1HBNB 1L3VA 2DRDA 2DH7A 1YJ7A 2ACMA 2HW3A 4PQUB 3HSGA 5E41A 1ZOTA 4IFVA 1U1KA 1SH3A 3CCES 3SMZA 2R8HA 3CC7S 3BR8A 1Q82T 5KFMA 4B9SA 1DLOA 3EUNA 1HHSA 1KS2A 4FBUA 2XMUA 2IVYA 3C66A 4KV8B 4DQPA 1X4DA 2OUGA 8AT1B 3CNQP 3G8QA 4ICLA 5M2UA 2K8GA 1RAEB 5J1PA 2XWYA 1NMEB 4OHXA 2HZVA 2BOAA 3IXQA 2C22A 4ZOSA 2QSWA 2ZBRA 3MDFA 1JLCB 2NSCA 4YMEA 3CEDA 3TEGA 5E33A 1F9EB 4DQSA 4KKOA 2AT1B 1LWXA 1HWJA 3EVMA 5KT4A 1YI2S 1NK9A 2RS8A 2GMHA 3BH7B 2CA9A 3T1AA 5HMXA 2XI2A 2U2FA 3PW2A 2B7BB 3FDSA 1I1GA 3QIDA 3VVUA 1IUJA 1S7IA 2ABYA 4NPOA 4DQQA 5J2QA 2I5JA 1KHWA 2VKZG 3W1YC 2E7WA 3D1OA 2PFDA 1VRTB 1ZYQA 1FD2A 4ER8A 4WTOB 2E5IA 1N0UA 2YKAA 4DOZA 1VGYA 4F4ZA 1X4CA 4HDHA 2QTWA 4KH1B 1RWPB 2DEIA 1CJUB 4O3OA 2HIQA 4PKDB 2MKCA 3E2EA 1KOHA 4CP5A 4PCQA 2J0XA 2KHCA 3G9CA 1JK9B 3PXGa 3MM5B 3PR5B 1BQMB 2CZ9A 3MZIA 1RWXB 2V4JA 2X1AA 3H0PA 4NLSA 4CLFA 4K4TA 1JLAB 1FKPB 4M5DB 2LQ8A 2M8HA 2XMJA 2VQEJ 1GH8A 2R7WA 2AJQA 3AQOA 4Z2XA 5E5NA 1H6KX 1BGXT 5KT5A 2V9WA 1RWOB 2IA0A 2IDEA 1PAUB 5D78A 1TUGB 3UN5A 4H4OA 2YKQA 3UVJB 1RTJB 1M5HA 1M0SA 5HBMB 2HHUA 4WP9A 3KHGA 2M52A 2K3IA 1TFWA 2PC6A 3VAHA 2WTFA 2WVFA 4CLPA 1NDCA 1OY8A 2YWFA 4USTA 3H5XA 1XEZA 1KKHA 3JSBA 4NZ7A 4USJC 5C25A 3FZ2A 3P5BP 1JJCB 1TK5A 1RT5B 3TUJC 1YQHA 3MEDB 4N5SA 1UKUA 1N56A 3MFHA 2FVPA 4I64A 4QIFA 3V5RA 1U8SA 3Q8VA 2Q1LA 2Z57B 4JI8F 1KTVA 4F04B 3NMRA 3LQVA 5G0RA 4DL6A 3PX4A 4RZRA 4CLTA 3NEKA 4I6AA 1VIXA 5F3ZA 1RYRA 2G0JA 1FJCA 2AWZA 2Q3PA 2W7PA 3K5NA 2HWHA 2JX2A 1FXLA 1ULRA 4BC9A 4M1KA 4PXCA 1X9WA 4H4MB 2CQ3A 5L1JA 2HZAA 4TY8B 2JLGA 1FNXH 1D9DA 3ENAA 4OI4A 2AV5A 1YJWS 3HPOA 1L5UA 1R0AB 1TQLA 3SBMA 4C11A 4X4QA 2GVDB 2DIVA 5E3QA 5EWGA 4DL5A 3K7RA 2G9OA 3KLHB 3PW7A 3MM6B 1N8RT 4TVAB 1UW9A 2F8MA 2ADBA 2GIQA 3RTVA 1UVLA 1WC1A 2B9WA 4OHWA 5CHCB 2QSFA 5IM0A 1WOSA 2CPHA 1HARA 4FXVA 2FJEB 1ZZNA 3HFZB 2DR8A 3CMQA 3A13A 3UNYA 3DOMB 4YN3B 3W2WA 1YK9A 1QSSA 2DHXA 2CQ0A 2DPJA 4J9MA 2KZZA 1QLNA 4B02A 2HNYB 1V5IB 2BKOA 3KG1A 5K8PA 6FDRA 5LSOA 5GADU 2DGVA 2VG7A 4ATNA 2CQDA 4A47A 4RNOA 2MDAA 4PYAA 2ZH3A 4XAKA 2L9WA 3GJRB 1WHVA 4V1Ak 2HHHJ 3FBCA 3MEGB 3ZZOA 2HBQB 3M9MB 1RT2B 1QJHA 3EICA 5CA5A 3GP9A 3ENQA 5IV3A 2UUBJ 3TVKA 3ZNJ1 1T05A 3PYEA 3RAQA 4Q8FA 3QPIA 2J5AA 4MK9A 3TNVA 3OUYA 3QLHB 4J37A 2Y8WA 1RHJB 4M5NA 4U6PA 2HVIA 3V4IB 4BHQA 1U4BA 1GEHA 5L46A 3ETOA 2HS3A 3W8PA 1M1GA 1YJVA 5KTQA 1DQ9A 4JI6J 2HQDA 3KUGA 4EZ9A 4LUBA 3LGMA 3RW7A 2NUHA 4ZP7A 3IP0A 2KFNA 3DM2A 2WOMA 4ZVHA 5I3UB 2VQEF 1P9QC 4F2SA 1YZ7A 4R8UB 2EFOA 2MKHA 5DG7A 2BUNA 1SKSA 2I9SA 1WDDA 3FNNA 3O44A 2YNHA 4F26A 3TW0A 2B4VA 4CQ1A 2EFQA 5HJXA 1NAQA 3QATA 2AF6A 2KB2A 1VQKS 4TU9A 2WONA 2K3KA 1WD6A 2PMHA 4UOHA 3LWMA 4N8NA 4RKUC 2IM3A 4OFZA 2E7XA 2GW8A 4ERDA 3LWLA 1FJGJ 1EKSA 3HVAA 1RWKB 4YDDB 5KFDA 3VVTA 3I4PA 1VQ6S 3UD3P 1NSKL 3R5JB 3MEEB 1X4BA 3MECB 3R5BA 2GVZA 2ZKUA 3R97A 2ZD1A 2MTLA 1GK8A 3M32A 5LSLA 5KT2A 2HIYA 5IT0A 1FTCA 1U7LA 3ZXWA 4DV0J 5CCLA 2VZ9A 1IKWB 4U9RA 5KG1A 4NCGA 1NZ8A 1F0XA 1QTMA 4NA3A 5KFBA 3OR2B 3IR5B 3M2RB 3CDEA 3DLEB 1LEOA 4CT9A 1FWKA 2G13A 4QWCA 2HFVA 1U1LA 2HLTA 3QT7A 2X1BA 1CC8A 1OO0B 2ROEA 4WFAQ 1HR0F 5L9NA 2JJ4D 3D6MB 4ED1A 4WU2A 4NL5A 1TK8A 5GAHU 5GMEA 4GKJF 4DN0A 2EXUA 4JBCA 2MKJA 4HH1A 2OTLS 1R6YA 3IG1A 3V2UC 5LJ3Y 4RW4A 1RBOB 2DK2A 1OSCA 3LGNA 2FJBB 4B3OB 1OMSA 3ZZ0A 4S0MA 4NRTA 4HKQA 3MMAB 1XWLA 1TL4A 4LT6A 3BYRA 4J9QA 3NNHA 3B54A 3QGGA 1VHIA 2JL9A 2O01C 3KLFA 1IQZA 2I0XA 2HQIA 3CJTA 2E44A 2V67A 5D0EA 1JLGB 2B4PA 3M2UB 2JEGA 3SI8A 2Y8YA 2HKEA 4I6YA 2HQ3A 2IRXA 4YB5A 2R7SA 1TL5A 1YZ6A 1HQEA 2R7OA 2VOPA 5KFPA 3V4MA 2YKPA 4I6WA 2HHHF 2XY6A 4JI0J 3IGNA 3NGTA 4NXNJ 1AA1B 3UR0A 2R3VA 4RW7A 4X4OA 2C1EB 3FFIA 3J7ZT 4ZN1A 1KLMA 4NRUA 4C8KA 1S1TB 2UUBF 2B7CB 2F3JA 4CI0B 3GSDA 1I3OB 4DX7A 4RNNA 1CPZA 5LMUJ 3CCMS 3A8JA 1FA0A 2BE2A 1S59A 2XSJB 2KRRA 1LQ9A 2D9PA 5BJRA 3R27A 2LEBA 3HVWA 4JI6F 1FJ7A 5J2NB 3QZ8A 3IWLA 1AFIA 3M9NB 2XTJP 2J7UA 4ZVRB 4QPTA 3FEXB 3N0VA 4LRFA 1HBMA 2R42A 5D0GA 1U47A 2PT0A 2CPXA 1HBNA 4X2BA 2KFYA 1Q78A 1RT3B 2L9DA 3OBIA 1RISA 2LYVA 4DV2J 3POTA 4L3NA 5DDRC 3D3BJ 2LMIA 2APOA 3M6VA 1X7VA 4J91A 2PEHA 1U49A 4WXWA 5AJ3J 1KFSA 4KO0B 1FO1A 4O3NA 2XGQA 4FF1A 4IRKA 1IQTA 1NHKL 1MLAA 1FJGF 4ZPCA 4DSFA 3P45B 4CDIA 4ZCKA 1IKXA 3AD9C 2R7XA 5HQ8A 1RA6A 3BGOP 4FYWB 4IG0B 1HFEL 2MHNA 4DLEA 1S4FA 4FPRA 2GV1A 1EKRA 4DV0F 5I4MA 3OTCA 1WKLA 3NS6A 5A6WA 4AE5A 2BMBA 2X51A 5E3RA 4B9NA 1OY6A 4H4KA 4NE9C 4Q43A 4OI6A 3MM9A 4Y3CA 2HHVA 5C42B 4X4SA 4AUKA 3N79A 5DQGA 1XBWA 1RT4A 2VQFF 3OL9A 1IKYB 1BUXA 5CYMA 2HQCA 1X9SA 5H1SV 4G1QB 3H5UA 2IRYA 2MY7A 4GO7X 1FNMA 1CJUA 2H5EA 2EPIA 3CTRA 3WC0A 3J80Y 1ZA1B 5LXRA 3LUYA 2H51B 1TL7A 1URNA 1TKDA 1ZS6A 4KIAA 2E66A 3PO4A 1NK7A 3MM5A 3VGUA 4O4GB 4URSA 1PJ7A 1HMVB 1QTNB 2K7JA 3JQKA 1JLAA 3EZUA 5CZXA 2GHPA 4K4SA 1XMBA 3A8EA 2J0SD 3F73A 4EEYA 1Q4RA 1GX6A 2DCLA 1T9WA 3KHLA 2RT3A 4FXDA 1F3FA 2MKYA 4Q2LA 3RBEA 4FS1A 2D69A 3CIZA 2E1MC 4IO9Q 3VAJA 4LSZB 1RTJA 1GMVA 3B6BA 1IBMJ 5B0BA 3DOLA 3T3FA 3FMWA 1R27B 4PG4A 1FXDA 4UY85 3GFHA 4ZVSB 2J6TA 5LMNJ 4PG5A 2B8QA 2C3OA 3ICLA 3FSXA 4JI0F 2MKKA 4LSLB 2W2OP 4NXNF 4QW8A 1MW7A 4PG8A 1U25A 3SSRA 4J9VA 2ACYA 2MZSA 2R7VA 1YIJS 4CO5A 3J81Y 3Q86A 3A1YG 1MWZA 3NCQA 2R2UA 5LMUF 3GZ7A 2E5JA 2NYHA 4E98A 2IYGA 2ZBQA 4IO1A 4NZ6A 2HRTA 1YVFA 1UEUA 3MM8A 1VIOA 2F63A 4X4UA 4YR0A 2V68A 2HQGA 2VJVA 2HYIB 3D6FB 4F0HA 3T6BA 1SJQA 4TY8A 4RWWA 3MXHP 2AYMA 4DHVA 3PR4A 2LDIA 4NLTA 2HBRB 4P7VA 1HA1A 3GPAA 2J6SA 2C3UA 3UCUP 4KPYA 2HHWA 1CJTA 2RVJA 1NB7A 1N5YA 1BQNA 1IJEB 4CO4A 2YNFB 5JVHQ 2XS2A 1N6QB 5EWEA 5AE3A 2C3MA 4KE5A 4FF3A 3PW0A 5HQLA 2Y1JA 4O4RA 3KDNA 2DNKA 5KFEA 5AJ3F 3LP0B 3KLVA 3ULHA 2LKZA 3NGUA 1SQEA 4F36A 1HNXJ 1O8BA 1HNZJ 2F4VJ 1Y5LB 4WFNQ 5ETKA 3RGIA 3AD8C 2YNIB 3TO8A 4RW6B 3GSIA 2N7YA 3MOJB 4CYUA 4HR2A 5EX0A 1RT1B 4YS2A 5K8NA 4DLGA 4ED0A 2YQ0A 1S49A 2J6UA 1I94J 3CE8A 1TFYA 3AOAA 1RYSA 2RJZA 3TJAA 1YRTA 3C16A 1X4GA 2YPYA 4PXDA 4PWUA 5CCMA 2AJ0A 3LH2S 3CCZA 3RR7A 3R5AA 3NBPA 3MEGA 2XYHB 3KJFB 3LOUA 3BKUA 4QU7A 4ELUA 4CM2A 4DSEA 4FNIA 1R8CA 2Z8QA 5HLFB 1J5EJ 2FHMA 1MG7A 3X3UA 3CCTA 2PGCA 3O8WA 1S1UA 1S76D 3HT0A 5ETOA 4KJIA 4QWDA 5C24B 2FLLA 3QLHA 3VAGA 2QC3A 2XNQA 1S1XB 3NS5A 5KFJA 1HNIA 1NU4A 2RDJA 3PO5A 3TARA 3ZTSA 1NH8A 3CDUA 2W4CA 3BQ2A 3CCWA 4UT4A 2VF3A 2HS4A 1HW9A 3EXYA 5KAKA 2HNDA 5KG2A 5K14A 1C4AA 4DSKA 2ATLA 1Z2LA 4C48A 3TUZC 2JDJA 3P4UB 3CXCR 3GV5B 5E2QA 2M8DB 2OGUA 1NDKA 1X5PA 2MEWA 4OZ2A 1NPPA 2WVEA 2DR6A 1R0BG 4IDKB 3OL7A 2NREA 1T11A 4MTPA 4I56A 1IBMF 3WX8A 3H25A 2YTCA 4K7QA 3R1HA 4KT0C 5GAHI 2OIHA 3DRPA 2MPUA 4NMXA 4O0NA 2WK4A 4HT5A 3VALA 2V4RA 5LMNF 5F8NA 3DYAA 4PWDA 2ZBIA 4A8QA 4FYDA 2V4QA 2B8PA 1ROFA 1SKWA 2KT5A 1UETA 2FHJA 3NL0A 3MAAB 3QFHA 3WIUA 1MNEA 4TQRA 2UZAA 3CSKA 1Q8KA 3PHEA 4LF6J 2MHEA 2IAJB 4LFCJ 2VODA 3X1LB 2LLZA 2N4DA 3DGVA 2OAUA 2BBEA 2RRNA 4NEZA 2NSBA 2G2OA 2FJAB 4DPUA 1RAAB 1KN6A 4EK2A 1HL6A 3UW1A 4E8UA 1V3ZA 1QUPA 4K50A 3OR2A 1FF2A 2KG0A 1QSYA 4U95A 4ZP9A 3HHLC 4NA2A 1GTEA 2MQNA 4LBIA 2GX8A 1T9UA 2B56A 3BDPA 3KLGA 5A8KB 1YJRA 2QLJB 3HSJA 2E1CA 2NYIA 2BZ2A 4CLUA 2RDDA 1FE0A 3O3LA 3TAPA 4EBCA 1HWIA 4DPYA 4W4MA 1BLUA 4NLWA 3ZC4A 2OPSB 3R3TA 3S1TA 4GMKA 3MTKA 3S01A 3G86A 1HD0A 3SIPB 2ZM6J 4IH5A 1HNXF 1HNZF 2F4VF 1HHTP 1S9EB 3KJVA 1PJ6A 4QU6A 1N48A 1RACB 4A8WA 3EM1A 3K0JA 4DUYJ 4LREA 3I32A 2CPFA 1PG5B 1FFWB 1H0HB 1TKZA 3CGIA 4ID5A 1I94F 1CQMA 1DQ8A 5ETNA 4K4UA 3W7BA 4HVZA 1VC6A 2GJ2A 1NKEA 3PKMA 1OYDA 3HT3A 1AZSB 2VPXB 1S1VA 1IBLJ 2E1RA 3BYPA 2I1RA 4ECSA 3J7A1 4EZ6A 4WK3A 3O2IA 1EETA 3W65A 2V6AA 1RTHB 1RP5A 4CTAA 3HHLB 3PACA 2C2KB 3RBXA 1UVMA 3KLEA 3NNCA 3IGVA 1NJYA 3VAMA 2LU1A 5HO4A 3MMBB 1J5EF 3R2DJ 1YRUA 2KXHA 3PYDA 4TXSA 4P52A 2NLWA 2XZTB 1C1BB 3GG1A 4A8OA 3I5BA 3BQ1A 3DLGA 3PW4A 4KTQA 3CWJA 2GNKA 2VV5A 2CXEA 3IBWA 1RXOB 5IC6B 1SI9A 2MLYA 4CLLA 3NWGA 4FKXA 1VJQA 4C0HA 1HWKA 4WU3A 3WBZA 4RNMA 3BGLA 4QYRA 5CXTA 2R8JA 3H20A 3LAKA 2DKOB 4EFAC 5KT6A 1C0TB 4AQYJ 3A8IA 1RHQB 3H90A 4ZLPA 1RT3A 1RE1B 2CQCA 2LECA 1JKHB 1RLCL 3B78A 3J80U 3EZOA 2NZ4A 3QO9B 2XBPA 3Q23A 1IBCB 1XMOJ 2K1RA 2HFZA 1S0VA 2MLZA 2JLEA 1W26A 1VBYA 1CLFA 2E5HA 4F3MA 1LOUA 3R5DA 4PZVA 3FCWA 1XC9A 3FBFA 4I2QB 3KK3B 4ZCIA 1S72S 1VQ9S 3H4DA 4IG3B 4FYYB 4OIXA 3IRXB 1K47A 5A0YB 3OLAA 4L74A 4NLOA 4OV6A 1YKWA 2W7OA 4DEZA 1ELOA 5HROA 4OJHA 3T41A 3M8ZA 3JXOA 4NWBA 4PQAA 3ISNC 3JYTB 2QEXS 4NYPA 4K5SA 4P2XA 4DDFA 1KDNA 3ILIA 2NZCA 5KT7A 3FVYA 1TL3B 5DDOC 1SVDA 4KGMA 3QIPB 5IV4A 2DGTA 4ELVA 3C15B 2OKQA 2WVDA 3US5A 3CIMA 1QVFR 4C4WA 1C0UB 3DMJA 3OTOJ 2D41A 2ADCA 4C2MA 2QIFA 3DC2A 5KFHA 2P9EA 2CWXA 2AYGA 4U7CA 4NCAA 2IC3B 1TKTA 3MUTP 3AQPA 4O4GA 5C7PA 2HBYB 4HDGA 4FF4A 3TA2A 3N6MA 3CMES 2QLBB 1XNQJ 2CYYA 4M5LA 1TL1B 1YG0A 1S6PB 3EVOA 1KVIA 2FTRA 4J9RA 2VBXA 2CJ9A 2P8IA 1AB8A 2HLUA 2CRLA 4DUYF 3G96A 2FVRA 1QUVA 1MN7A 4GVBB 5I42B 1GXLA 1K44A 1S4EA 3L9ZA 4OX8A 1Y4ZB 3MD1A 1IBLF 2VDHA 3K8WA 1CC7A 2FUG9 2DBBA 1W2BR 1YBTA 5C5JA 3C6UB 2MZQA 3D5MA 3G6XA 3QT6A 3KK1B 1JMTA 3LF0A 5B0CA 4X64J 2RDIA 4DFMA 1FRKA 1NK5A 3BREA 1PKUA 4DFJA 4QR2A 2FQQB 4QQBA 2YKMB 3MR2A 3TAQA 4LF8J 3SV4A 4BCAA 4DV7J 5IT9Y 4OHYA 3DXSX 5EWFA 2GQCA 2GJFA 2AJ2A 1JLFA 2CNNB 2EFNA 3DRSA 2Z2YB 2PA3A 3UNGC 4LSNB 4M5JA 1ACMB 3EMTA 4YUDA 4I7FB 2BJEA 3GIMA 4C8YA 1UCNA 5F8IA 2Z2MA 2HK2A 1JB0C 2WSCC 1H2VZ 4LQ9A 1PAEX 4C0BA 4QW9A 5FIIA 3UDEA 1IBKJ 4OX9J 2XMAA 2OEKA 3BKFA 2MSSA 1RWVB 1N33J 3OXLA 1VFJA 1M1KT 2YNGB 1K1QA 1N5SA 3L3CA 1JX4A 1NSAA 4DV3J 3W9IA 1SH2A 2DPIA 2FJVA 2QE5A 4NOHA 2BKPA 4PG7A 4RW6A 3RRHA 1O6XA 1FRLA 1XMQJ 1RWUA 1SV5A 1DLOB 2UXBF 1MROA 3V6DA 1ZZFA 5EX3A 4ICLB 4LJMA 4OZ3A 3Q8YA 4OI2A 3D66A 1ZH5A 4G3IA 1KEKA 2XSFA 3DKDA 2MLXA 3QJJA 1U1PA 1VQ7S 2QO3A 4DCOB 2CPEA 3H2LA 2DHGA 4KKOB 2CQ2A 5KFTA 3MURP 4Y2AA 2Q43A 2ALYB 2LEPA 4BS2A 3UDLA 2KYXA 2WBMA 1KQFB 2P9GA 2ZE2A 1VR6A 5J2QB 3MGJA 3OTOF 2OO4A 3MM7B 2WW4A 3TUIC 1T03B 1FE4A 3RB4A 3IC1A 1M1HA 1CULA 4K0KJ 1PSDA 5CZVA 2CWKA 3L7UA 4N56A 2XMKA 2B9XA 3KNAA 3I6PA 1VJWA 3UR3C 1AUSL 1DRZA 3FSYA 1KHVA 2W24A 1TTHB 3TI0A 1XNQF 5HQMA 2FLOA 4DPTA 2J7WA 1TUVA 2RQCA 4Y28C 3HVTB 3NCRA 3D0GE 2V8PA 1FRHA 3UE2A 3IR6B 2BJ8A 5DDPC 4F0KA 4IYQA 1H73A 2UUAJ 1WTBA 2V4JB 5KFZA 4LVOP 3I5AA 3K5PA 5T7LB 5F8LA 4XO0A 4UOGA 3DDKA 1FCAA 3HHEA 1YRXA 2J9DA 3OVSA 3G6VA 2B6AB 1BE4A 2MQOA 4NASA 2ZH5A 4C3LA 4LF4J 5HJYA 2ZEJA 4HLBA 1YBAA 4E0DA 4DQRA 2QMXA 4H4OB 5D77A 2MYFA 3IS9A 5B7WA 4DN9A 3A12A 2BE7D 2DRBA 5B09A 3I82A 4X64F 5L38A 4OLPA 2JH3A 1N0VC 2DCUB 5C25B 2A1BA 3MCOA 3IRWP 1S10A 4NLUA 4LF8F 3WX4A 2GGPA 2HHQA 2VFSA 4DV7F 2F4FA 3EPIA 2O67A 2FJXA 2FHKA 1P1LA 1FK9B 2DNPA 4EI2A 2IJRA 1TAQA 1H3DA 2HEKA 3DDIA 1B70B 4P9SA 5G0RB 5A8WA 4DSJA 4DX6A 3DU6A 2O66A 1LWFB 3PM9A 2XG8A 2CUYA 5D3GB 2Y1IA 3M2VB 3LP1A 2VFTA 3QFWA 3CD7A 1YDLA 2BRLA 3UDCA 3J7Z5 3OSNA 1B0VA 1IBKF 4OX9F 2HGLA 3K5OA 3NG8A 1CVJA 4URGA 2BACA 3C8YA 4DSLA 1FNOA 2I38A 2JZ5A 5LJ5Y 1UJ5A 4CH0S 1Q5VA 1N33F 1U26A 4TNOA 2C2EA 2M3DA 4OL8A 1HNWJ 4DV3F 3MPYA 3UI3A 1UA0A 4ED6A 4BC7A 1K1SA 3BN4A 4B9LA 2V0NA 4O44A 2DGWA 4P2FA 3VGSA 1S1WA 1UL3A 4I2PB 1Y10A 3BDEA 4IOBA 1XMQF 1Y7PA 4WK1A 2H4WB 4M5IA 2JEIA 2MB0B 1RSCA 2J0WA 2YQ3A 5IM0B 2GAGC 2OPPB 2QGFB 3MMCA 1WSVA 1X5TA 2ZOFA 4QIEA 3QYYA 4CZCA 3W2WB 1TZ0A 2BR0A 4ILLA 2CDRB 3G6YA 1QAYA 1L3SA 1CSJA 2A6OA 1SC1B 2VG7B 3BN7A 5AXMA 3TOQA 4Z7CA 2FPHX 2QMWA 5D0HA 5AT1B 4B9UA 4F7VA 5ETTA 4PPZA 3SFGA 1HYSA 3PEHA 1NDLA 5K5MA 1TU0B 2KM8C 3W5ZA 1RHRB 2VG6A 1UWAA 2J9CA 1URRA 7AT1B 1SL2A 1FDBA 4RW8A 4AL7A 1CS4A 1SL0A 4RPFA 2IVMA 4ECXA 4OYAA 2EFPA 4DR6J 2CNKB 4A46A 4K0KF 2UVWA 1H7XA 3NGSA 3BGUA 5I3QA 1T05B 2YPZA 3S7RA 1F5CA 5HANA 3GV7B 1VISA 4ALZA 3OUYB 3CJ3A 1JLQB 3U1NA 4NXMF 2WB1D 1JJ4A 1EJ7L 3OV7A 2AD9A 3AJDA 5IFMA 4O3PA 4LRAA 3HI9A 4OI3A 3KUEA 1VRQC 4Q44A 5KFFA 2VFRA 3DM2B 2WOMB 3CW2C 3ZTRA 2DY1A 2DISA 1F5BA 4CIOA 4MK8A 5K9FA 3HFVA 2IY5B 1S6QB 2LXUA 5AXLA 1VRUA 3Q8SB 4UZBA 1Q8BA 4LF4F 2J8SA 3ZTOA 5AE1A 4ECYA 2C2MB 2WBRA 2YNHB 2KYZA 4E2FB 3KK3A 2SXLA 2CG8A 2YBVA 3VAIA 1X60A 1DTQA 3CF5Q 1LWEA 3M6XA 2FVQA 4DR5F 4ANDA 4QJVA 2WONB 3TZZA 1U02A 2DH9A 3ZO7A 3W61A 2AGOA 3U1LA 3OTEA 3KG0A 2MZ1A 3C6TA 2V34A 3TA0A 4UOCA 1S79A 4IFYA 2H48B 2Q6BA 2HHPA 4RW9A 1EAYC 4CLSA 3BBBA 4FZVA 4HTJA 1YGYA 1RU2A 2GVZB 2K06A 2ZD1B 2A18A 4P2SA 3M32B 2IYIA 2F9JA 3TQEA 2DO0A 3HD1A 1TL3A 4DUZJ 4NX9A 4ILRA 2BRKA 3I0SA 3C14A 1TAUA 1XQIA 1LW2A 4G1IA 4BDPA 4NCGB 3LANA 2ROPA 1S12A 2X1FA 4U8YA 4X4NA 3D6TB 2B3TB 3CCSS 5BYSA 3EE3A 2HAIA 3OHAA 3FK4A 4O0IA 3VAKA 4ANCA 4CNZA 1ZTTA 4PYDA 5KFSA 1HNWF 1N5TA 4KBIA 2LXFA 1MU2A 1RQ0A 3D0HE 1UMJA 2VG5A 4F25A 2W01A 1QD1A 1UVKA 2DNNA 4ZPBA 1RDRA 2VU5A 5H9EK 1VBXA 4TYBA 3M8RA 3IG1B 5IQQA 4RW4B 4ZPVR 3RRGA 1EQMA 3BSAA 4HI1A 4EO8A 1YJNS 2XCAA 4ZVOB 1DQAA 1WTFA 3OL8A 1RADB 2R7TA 2OFHX 3EWGA 1T9TA 2MY8A 4ED3A 3HZGA 3HD2A 1FESA 1RTIA 2GJIA 3DHXA 4HYKA 1TMJA 2J0QD 3UD4P 2DGUA 3CPWR 3KLFB 4AL6A 5THWA 5A76A 3DLBA 2V2ZA 1TKXA 3PJ9A 4RU9A 2MQLA 3I0RB 1A6LA 2QV6A 1APSA 4K4VA 1MMDA 4JV1A 2ERRA 3PJXA 2LDYA 2A6MA 4N8OA 3JSRA 5DS7A 1HQEB 1C2PA 4Y65A 3JTNA 2FHOB 2UP1A 4M5KA 2MQQA 2V2QA 4W92B 3SEOA 4BWMA 5L8RC 4RW7B 3FFIB 1PO6A 2HGMA 1KLMB 4MT1A 4LSNA 3JAMY 4OYWA 2BQUA 4A48A 1CJKA 1BY9A 1NM2A 3I9V9 1JLBA 2E5LJ 1PGZA 1K0TA 1HQUA 4F8RA 2BE2B 2IJFA 1OPZA 3A3PB 4WIIA 1S57A 3W2VA 1LNQA 3ISZA 1SJ4P 3PCOB 1X4EA 3SQGB 4FP9A 4GO5X 4K8RA 1GMUA 1R8BA 4N7TA 1OQ6A 3UCZP 1OIAA 4ZIVA 4WWSA 1FXRA 2NR0A 1HBMB 3BSOA 2QL7B 2X3GA 3GU0A 2CZVC 3HVRA 5AXNA 1KTQA 4B3TF 3QBCA 1K73T 1VI7A 2RU9A 4L76A 3HMJG 3POTB 2BANA 2AHOB 5DZ7A 3TZWA 4IOCQ 3E51A 4X84A 4OI1A 2FC9A 3M8YA 4F4XA 1NNDA 2E1PA 5ETSA 5H9EJ 3A3OB 2WCXA 3U7JA 5D4LA 1BC6A 4RBTA 1IKXB 1U2CA 3OFGA 3MWBA 3BGFA 3TVYA 2RHSB 4A8SA 1GFWB 1FEEA 5G4DA 4DUZF 2HNZB 1R6VA 2CVEA 1RABB 2JVRA 2MZJA 1RB0A 1H2UX 2XGPA 2KT2A 1SPBP 2CIMA 3MM9B 3MM7A 1T03A 3TJ8A 3EGNA 1UJ6A 3M8PA 4N47A 4WJBA 3OXGA 8ATCB 1N32J 4F3QA 2W9BA 3SCLE 5CH7B 4MIBA 1RT4B 5CYMB 4DV6J 1WHYA 2DXEA 2Z30B 3PHTA 2W9AA 1S0MA 2QT7A 1IM4A 4RWXA 4L3KA 2N82B 3KFWX 3HVTA 1TL7B 1ZTWA 2N3OA 3NRBA 4HT7A 3RU0A 2E29A 2GS8A 2P9CA 4P73A 4U8VA 4KSEB 2GO9A 1TV6A 3SQOP 3EDRB 5T7LA 5HSPA 4ZJLA 3KUHA 4MAKA 3VTIA 3BKTA 2G0CA 4M5MA 2B6AA 2BXJA 5GAEU 2B43A 2QYGA 2IRUA 4WP3A 2I8EA 4DV4F 3SCJE 1V9OA 4ECTA 2OPQA 1EARA 3CJ5A 3L7PA 4IKAA 3BO2A 3DOLB 1NCLA 4WE1A 1NZAA 3IR7B 1LK5A 2D3UA 2Q66A 2W9CB 3JTPA 4Q0BA 1F9FA 2M2BA 3FJ2A 3GIJA 3PV8A 3H5SA 3W66A 3MPWA 1FK9A 1ICEB 2ZFHA 4QZVB 3I96A 2A2CA 4ZP8A 3CCUS 3N28A 2V9KA 1LW0A 3WQPA 1NK4A 4QIWD 5EGYA 1LWFA 2E5LF 3WC2A 5D3GA 3M2VA 3HSDA 1UP1A 3QQCD 1FRXA 4ECQA 1N4LA 1FWPA 2JLFA 2LA6A 4R0JA 3W3SA 2A0FB 3MM8B 4P75A 4DV1J 2Z2ZA 4CLKA 2M70A 2HVDA 2QFJA 5F9NA 2DRAA 5KT3A 4M95A 4ETXA 2ZHBA 1VQNS 2KG1A 1WC5A 3BJYA 4ZPDA 5LXYA 3DLKA 3CJ4A 1TMMA 1QVGR 1HR0J 4AD6A 4CO1A 4KFBA 1CJTB 3M30A 2NPFA 1N5YB 1BQNB 3ITHA 4GKKJ 3V6HA 4GKJJ 4I2PA 2UUCJ 3M9OB 4IQXA 3GE9A 2RU3A 2FJWA 4KQZA 5T14A 4OI0A 2RIJA 2BQ3A 3IWNC 2B9EA 1WKKA 2M0GB 2W4PA 4QOTA 2QL5B 2BVZA 1SJ3P 2QA1A 2V69A 5GMDA 4MFBB 2OPPA 3BEGB 4TYAA 1Z2ZA 4FNHA 1IR0A 3KTQA 4DPOA 5ETVA 1NH7A 5IC4B 1WACA 1KR4A 5CD4H 3W60A 5ETPA 1JQGA 3CUNA 3EVWA 4P6QA 1T95A 2PA8D 4CYUB 3Q2TC 1TUWA 2RQMA 4J9LA 3ZNUA 3K59A 3QRQA 2LXIA 1UEVA 2CPIA 1VYAA 5A8RB 3C16B 4AT1B 3HF5A 5HAOA 3PFEA 4OZ1A 5F8GA 3IBCB 2MJNA 3RR8A 4X4VA 3NBPB 1D09B 3QSYB 8RUCA 4HH0A 3UO0A 2FHJD 3EGZA 4B3RJ 4DR7J 1N32F 2DGQA 4CO0A 3TJ9A 4NLGA 4F4WA 3QJPA 4TKTA 2HS0A 1S1UB 5KFVA 3H59A 4DV6F 4ZJOA 4USIA 2L48A 1JLQA 1S7HA 1QAJA 5KFNA 2FGCA 2EBGA 4PR6A 3TUPA 4R25A 1W2IA 1HNIB 2KVQE 4FBTA 1VQPS 3BZQA 3CO0P 1VOMA 3DRXA 4RO0A 2HNDB 4JI2F 5K14B 2HVHA 2AJ4A 4P7TA 4NI2A 3FC9A 1S6QA 3D2WA 5ETRA 1FDNA 4JI7J 4A8MP 3FZBA 1JIHA 4DL3A 4B17A 3Q8RB 4DF4A 2JSXA 3IM8A 1Q7LB 2RKIA 3T1YF 1SJRA 1EQ0A 1PCAA 2PEBA 3GIIA 3VWSA 4CO2A 2P2CB 3K58A 3DRPB 3QAEA 2CPZA 3D0IE 4DR2F 2Z2LA 1M5VC 3J7YU 4CM0A 5D4OA 2XMWA 6FD1A 3FBEA 3DYAB 4PWDB 4WFZA 1IJFB 2OD4A 1RAGB 1L3KA 4FYVB 4MH8A 4C8ZA 2V94A 2WW8A 3OPKA 1FKAF 1WI8A 4J9UE 2NS1B 1RHUB 5LSRA 4ZCMA 1FKOA 3OVAA 1GNKA 2CPYA 3K2YA 2UVVA 4JV5J 2DGOA 2ZVIA 2CKWA 2L08A 1NSQA 2C2ZB 2XWXA 3CJKA 4CLYA 2UXDJ 4ES3A 2GQ2A 1CQNA 4DV1F 4DU8A 1KONA 2IMOA 2ZOGA 4NA1A 1QE1A 1FFSB 4DPWA 3HFKA 1KBRA 4C97A 3VHQA 1NHVA 5F0WA 3KLGB 1RCXB 2VQFJ 2U1AA 3J81j 2FZCB 1BQXA 2F8EX 1JXEA 3KWMA 4GKKF 1H7WA 5KOXA 4EMDA 2UUCF 1HD1A 1ZM3A 5IQ6A 4P10A 1WHXA 3NS7B 1NPRA 3AD7C 3N9UC 4GRSA 1HBUB 1RT6A 4EO6A 2W7AA 3D4JA 4B3SF 2LQ5A 3BQ0A 3G6ES 4CWBA 1X9MA 2ILYA 3P8BB 4LIWA 4ED5A 2CFXA 1DZ5A 3KJVB 3AB4B 4NLYA 2YWKA 1PYTA 3QWUA 2OH2A 3ONQA 5C2CA 2Q79A 4L73A 1TKZB 2MGZA 1WWHA 4ID5B 2QMUB 3FKBA 3I0RA 3VQSA 5KG7A 1R8PA 1PILA 3PFOA 4DR4J 1S1VB 4F0MA 2HZCA 1EETB 1TVRA 2ZBCA 3RB6A 2C3PA 3DOKA 3R6GB 4CTAB 3HO1A 1BHNA 3AH6A 2ZH4A 2R8GA 1JLEA 3LALA 3KLEB 3FMBA 1UPPA 4B3RF 4DR7F 2BYCA 3FRZA 2RUSA 2UVUA 5HK4A 4JI4F 1U2FA 1MSWD 1LFWA 1VS3A 5B0FA 4J9SA 2WB4A 3P49B 2W1BA 2XS5A 3JS9A 1VQ8S 1MN9A 3M8QA 5HMZA 2YX4A 4DR1J 2V8GA 1A7GE 2CQIA 3DLGB 1PJ5A 2EC2A 2W25A 3SQGA 3DRYA 3DLLQ 3BBFA 2W4DA 5DZ6A 2ZNYA 3SYZA 2J8AA 4C8MA 4KGVB 3FEYB 7FDRA 4NLDA 5K8OA 3WIVA 1BWEA 4JI7F 3BH6B 3PIOQ 2WVCA 4NZ0A 4OZ0A 2OHDA 4OHVA 4A4JA 3DRRA 2J9EA 2CJBA 4KGZB 2FY8A 3NAHA 5DG8A 5DGAA 1SH0A 3DLJA 5DO2A 4J5OA 2IFXA 4HI2A 4LF2A 1IXKA 2K1RB 1D3WA 1PYSB 3PIPQ 5K20B 3A4TA 3PZPA 3AOCA 1WUUA 5IT4A 3JQMA 1VLOA 3VF0B 3OXFA 1F3VA 1UFLA 4OYBA 1DHMA 1FDAA 2J7KA 4Z7YA 2EBEA 4EU0A 4HHJA 3OVBA 2VOOA 3KDOA 4UF4A 2DR5A 2HFUA 5GAEI 1U6BA 4JV5F 1CJVA 2G2ZA 3IN5A 1WJ9A 4RNHA 3EPGA 2HNZA 2DD8S 5HROB 3P96A 1RKIA 5GMKa 2XEXA 2UXDF 2A10A 3B82A 4L6V3 3PX0A 2ILZA 1A0OB 3KLIA 1N34J 1FDDA 1VK8A 2CQGA 1DTTA 4TLRA 1HW8A 3M4XA 1KFDA 4DPXA 2BOPA 3PDNA 1FX4A 1PYOB 1X4AA 3M6UA 4WZMA 2OLWA 1CBKA 1R3NA 3T9ZA 4KGXB 4RNFA 4I1TA 3P6YC 3V81A 1T94A 5D4NA 4TU8A 1Y00A 3DMJB 3OFHA 2VH7A 4CO3A 4X66J 1E6VA 1SKUB 3RBZA 1TKTB 4ED2A 2FVCA 2WZ1A 4KRWA 3P3DA 3PRVA 2XNRA 2RRAA 2EI5A 2L3MA 1SQFA 4DQIA 3T9NA 3PRBA 3TA1A 1FD8A 1ZA2B 1HWLA 4ENOA 2VBWA 1I6JA 3RG6A 1O0PA 3PTWA 1Z1ZA 3AA9A 4NYZA 4WPAA 3B8HA 1S5ZA 3BV8A 4FN5A 3MR7A 3F41A 4ZITA 1M5KC 1HPZA 3CJ2A 3NKYA 4DR4F 3WZ0A 3GCWP 5HP1A 5SUHA 2W9CA 4IH6A 3V6JA 2GIRA 4IRDA 3G8SA 1Q79A 4USKA 2EW9A 2JC1A 3ADAC 2HFOA 4X4RA 5HATA 5F8HA 1E6YA 4Q45A 1RZMA 3MCNA 4USHA 4PABA 2Z56B 1JXVA 3THPA 4IR1A 1GAOA 3JSMA 4ZPWR 4MIAA 3TAMB 5KG4A 4NLXA 2FJDB 5GADI 5U47A 3D6HB 2DH8A 3BS9A 2E9ZA 3DNCA 4MYTA 4DR1F 1JLFB 3DRSB 3HSZA 1WHWA 2AEJA 2EKYA 4X4TA 3CDWA 1KVJA 4M94A 3VR1A 1LWCA 4DSIA 4Y00A 1IR1A 3R1LA 5DLGA 3AJ1A 2M4MA 2OTJS 2CQ4A 1ZPVA 1JXLA 1MMNA 2XY7A 3ET6A 3FSIA 2ZITA 2MZRA 2EC0A 3UPFA 5ETLA 3GR0A 3SSSA 2AZ3A 2JFKA 3S6EA 2JNJA 4ZVQB 2NUUG 4KAIA 3M8SA 3OTBA 4MFBA 1KP6A 1G3OA 5FDLA 2V8VA 3B4MA 3R8YA 4G1PA 2VDIA 2R7RA 1X0FA 4ZJQA 1TP7A 1NKCA 5E3CA 4KB7A 1YTYA 2CJAA 4QIGA 3O5TB 1WORA 2Y3YA 1SV5B 1H2TZ 2KL8A 1UFWA 4ZPTR 1MROB 1T9VA 2ZWPA 3V6DB 1X4FA 2PFFB 1AROP 1XTZA 4PRFA 5IXUA 1YSJA 2JWNA 5LOQA 1IVZA 1YWXA 2Z58B 5A8RA 1FRJA 4ZA1A 3IWXA 4RL1A 3GJQB 2RF2A 3HKZD 4FXWA 1N34F 1SC3B 1AXQA 3U02A 3J7YI 3QT8A 2YH0A 2MSTA 4WFYA 3VZHA 3BGRB 2RHQB 2LP4A 3LA0A 1F9HA 3QRRA 4XPCA 2LQ9A 2Q6CA 5CYJA 3EGWB 2ZE2B 3PKYA 1FRIA 1EZZB 4X66F 2G0IA 1REGX 1CULB 4OYXA 2ZWOA 1L3UA 4PUOA 4R5PA 1N5VA 2D3ZA 3HZEA 1AT1B 3BO4A 1B99A 3QAUA 2QLWA 1RWMB 3DGPA 4ECZA 2OMLA 5H9FK 4C6AA 3PYFA 4ZP6A 1HHQA 4MJKA 1J2VA 3OQ2A 4YFUA 4TLQA 4NLVA 2W2QP 2YX7A 3KK2A 4Q7AA 2DY9A 1WG5A 1IKVA 1U09A 2DTJA 2JC0A 1KOOA 2CVIA 2C2DA 1HKAA 1SUQA 2ZNZA 1NJIT 1JNRB 2PIIA 3G4SS 2GMJA 2YVSA 2VC0A 3PEJA 4ANEA 4J9OA 4WKRA 3IS9B 4J9NA 3M8WA 3GYXB 4A8YA 3T5HA 1D0EA 1OY9A 5J2MA 2RNEA 3C2PA 4JI3F 3FCHA 1RT7A 4O3SA 4U7UK 4K59A 3RAMA 1QSLA 2G2YA 1H98A 2UVRA 2AJ1A 2N4CA 2IM2A 3DDNA 4Z37A 2V8DA 3OD2A 4F4AA 2GGPB 2H5JB 1HWUA 4QWEA 2GQQA 1FT8A 4JOUA 1SCJB 3CVKA 4NMLA 2VC1A 3E8OA 3K89A 2MKSA 3KG4A 2YWGA 4ITSA 4Y2IA 5A8WB 1M5PC 1D1UA 9RUBA 5IOLA 5DGBA 3O6QA 3W5XA 3CB4A 5DDQC 1RAIB 3LP1B 3IFEA 4YP3A 4DL0C 2B0GA 1YBUA 4HACA 4ED8A 2P5VA 5F9LA 2XLIA 3LP2A 2YY3A 4IUFA 1ZM9A 1JWWA 4USVA 4ZLLA 2IHR1 2GMLA 3QJLA 4WBFA 5ITHA 3MTJA 2IPOB 2RSQA 3L4BC 2PE8A 1DJ0A 3TP2A 2H5IB 1HBUA 2B5JA 1SQGA 1GMWD 4ILMA 4F4KA 1ITPA 1WC6A 3HK2A 4O44B 2Y0SD 5J1EA 1S1WB 2VIHA 2CPJA 2VFUA 3GQCA 2XLJA 1UZDA 3AODA 4I4BA 4LBPA 1WF1A 1PC5A 3SSQA 1ZM4A 3MMCB 4K4XA 3VV2B 5H9FJ 1Q0NA 5L1IA 2DXFA 1OQ3A 2A3JA 2Z4PA 3RAXA 1FX2A 5DLFA 2OPRA 3DCAA 3E01A 1RAHB 1IWAA 2B51A 1R43A 1WSRA 1S9GB 1RJJA 2VD3A 1U6ZA 2RB7A 4X62J 1KLNA 4AL5A 1Q86T 2BM0A 3KXDA 3TWZA 4ID8A 4CNYA 1HYSB 2D7SA 3LGHA 3ZZZA 1Y9OA 3PX6A 1Q8IA 1REVB 2DHSA 4RU2A 4ZMMA 4K2JA 2VG6B 2KI2A 2R8KA 2VPWB 2F7VA 1A9NB 4RW8B 1CS4B 2DNGA 2Y1LB 4XDCA 3TX0A 3MAHA 2VUGA 2IA6A 2VASA 3QNWB 4WIQA 3AOBA 3KYLA 3GCXP 4JV2A 2XZWA 2EEYA 3NGDA 1U8WA 1BXNA 3CJSA 5DETA 5B0DA 1C1CA 3MR5A 3IM9A 5KOWA 4JP8A 3I56S 2HG4A 4PXBA 5CYQA 4DFPA 1NLKL 5E0OA 3MPVA 1NHUA 1ZAVA 2DHAA 3THVA 4DL7A 2KH9A 4URQU 3GFZA 2DNOA 4X4PA 1PBAA 3AFGA 1Z4UA 1EIYB 1U0HA 2DNQA 1MMLA 1VQLS 1VRUB 2ZC3A 4OYPA 2F8HA 3KNGA 2XMTA 1HI1A 2NQPA 1WC0A 1LV5A 2HWIA 5HN0A 1RWNB 4AYBD 4FF2A 4OZ5A 2EWHA 1SL1A 1G2EA 3AXMA 4LF1A 1DTQB 2R4FA 1LWEB 3AJ2A 1P27B 2UXBJ 1UFKA 1ZM2A 1N36J 3P5TL 4TY9A 1D9AA 3SDEA 2QZ8A 4QWBA 2DNRA 1CEZA 2RS2A 1VQMS 2R2SA 2LQJA 5ADZA 2JVOA 2WHOA 5B0EA 3C6TB 1WELA 1RTDA 1EB0A 4UUWA 1HI8A 1WC4A 4IFYB 4D3HA 4RW9B 2FD2A 4RX6A 1W25A 2BW7A 2J76E 2KRBA 5F0UA 4DS5A 1NPKA 4DV5J 4DJBA 5ETQA 4MKAA 4FVCA 5B08A 4DUTA 1F5AA 3OW2R 3I0SB 3C14B 3J81U 2QA4S 4M5HA 1LW2B 1HNVA 2J9DE 3ZFVA 2BABA 2YWHA 2D9OA 3BPDA 3Q8PB 3SCIE 2PN6A 3G2XA 4LFBJ 1HI0P 3OFFA 5HVFA 4QIVA 3FRYA 1ZAWA 1YX2A 2KXNB 3FUYA 2GZOA 3Q89A 2M5YA 2QX0A 1MU2B 2CAJA 3R2CJ 3DN9A 2XYGB 2DHHA 4ZN3A 2VG5B 3FQKA 5KFXA 3CD5A 3NOGA 4RR5A 2IIHA 1U45A 4ZKAA 5KFWA 3ZTPA 2FY1A 1FWLA 4D3GA 2NCKL 2WSEC 1Q81T 1U1RA 3N4WA 3GMGA 2WVBA 2FDNA 3QRPA 2FZGB 1RTIB 2ZH8A 2HHXA 3SCKE 3D1HA 1FHTA 1X5OA 3OR1B 2O3DA 3CD0A 2IBKA 2ZDOA 1TKXB 2QFIA 4X62F 2YKNB 1SC4B 4KC5A 5J2PA 3CCQS 1FEHA 4LRBA 2FIUA 4GC7A 1U6FA 2ZHAA 1K8AT 2DNZA 4OX7A 3AY0A 1RHKB 3WDOA 2F5GA 3TAMA 2RQKA 1T0TV 1BWVA 5K8MA 1GQEA 1Y3KA 1HIYA 1TK0A 4CCHA 4I69A 4LVNP 2VL1A 2Y0BB 3LO3A 4CLWA 1KWMA 4AXJA 5KFYA 2FYXA 1CJKB 4PQUA 1M90T 1V6HA 1JLBB 3OLBA 2HFNA 1HQUB 4K4ZA 3M7VA 5CABA 4LMZA 2ZH6A 4EBEA 3W2VB 4ED4A 2V8HA 2GHVC 4CT8A 1I51B 5BXIA 4WKYA 3FQLA 4KV8A 2R2RA 2DNMA 4DG1B 4OMFG 4DI6A 1DARA 4P71A 2CQPA 4AXIA 1N88A 5LT5A 1VLYA 3ZZPA 4DF8A 4WYLA 3ELHA 4B9VA 3H8YA 2E9TA 3OHBA 1JLCA 2EG2A 2CNOB 1H38A 4WZQA 3UCGA 2FB0A 4V19X 4MMOA 4LF9J 1T7PA 5D4PA 2BANB 4ECUA 3I31A 2QLFB 1AYEA 1N36F 1Q95G 1SIZA 2D3OR 3D67A 4W90B 1Y11A 1F60B 1NBEB 2QN6B 4KPCA 3T6JA 1KQKA 1P8GA 3BB5A 1OSDA 5E7OB 4ZVEA 1VRTA 3MI7X 1D8ZA 4MIWA 3GIRA 4IH7A 4Q5VA 3F44A 1VHFA 4J7CA 1WKJA 5BR8J 3IMQJ 3IO1A 3HCXA 5KG5A 3V6KA 3UWTA 4DV5F 1SB6A 2VB6A 5KFGA 2NXUA 2ZBPA 3A8KA 3BGRA 5M2RA 1UVJA 4CH7A 3TANA 1YITS 1DURA 2KZMA 3GB0A 2KJWA 1X4HA 4G6VB 1ZAXA 1BQMA 4WF9Q 1FKPA 4M5DA 2RQ4A 3WHIA 1U24A 5KFQA 3CD6S 4ES2A 3M8PB 1Y3JA 2XLKA 4LFBF 2VA2A 1C4CA 1F2HA 2W9BB 1VQ5S 3H42A 5KFRA 1XIQA 2PMZD 2KXFA 2GO8A 3UVJA 2RUGA 3M1VB 2A2DA 4F67A 3H40A 2PMWA 2AMCB 4NXMJ 5HBMA 5AE2A 4UQTA 3HLUA 4EWTA 2R7UA 3FCVA 1SIWB 1WG1A 1T3NA 4B3MJ 4RLEA 5A6PA 1RT5A 5LL6d 4UOFA 5KG3A 3I4HX 4J90A 3MEDA 1TV6B 1F6TA 2G4BA 2KKHA 1U2RA 4HHHA 1B64A 1KD1T 3H5YA 3Q22A 3Q8QB 4DL4A 2H9ZA 4NLQA
chains in the Genus database with same CATH topology
1RWXB 2CJXB 2DKOB 1SC4B 4DCOB 3D6FB 1RWWB 1RHQB 4ZVRB 2CNOB 1F9EB 1PYOB 3RJMB 1RE1B 3R6LB 2QL7B 1RHMB 3IBCB 4LSZB 4DCPB 1RHKB 1RWVB 2HBRB 2P2CB 3R6GB 1RWNB 2C2MB 4ZVQB 2XYPB 3KJQB 1RHRB 2QLJB 5K20B 1RWOB 1PAUB 2XYHB 1IBCB 2C2KB 3KJFB 3EDQB 2Y1LB 3IBFB 2H5IB 3R7BB 3R7SB 3KJNB 4ZVSB 2QLFB 3GJRB 2H54B 4ZVUB 4ZVTB 2Y0BB 4ZVPB 3QNWB 2C2OB 2XYGB 3NS7B 2QL5B 2CNKB 2HBQB 2QL9B 2CNLB 1ICEB 3D6MB 2FQQB 2CJYB 1RHUB 3D6HB 2XZTB 2H5JB 2C1EB 3R7NB 2H65B 5IC4B 2H4WB 2HBYB 2HBZB 2XZDB 3SIPB 1RWMB 2H51B 1I3OB 2QLBB 2H4YB 2CNNB 1RWKB 2C2ZB 4ZVOB 2H48B 4JB8B 1RHJB 3P45B 1QDUB 1RWPB 5IC6B 3R5JB 3EDRB 4DCJB 1I51B 1BMQB 1QTNB 3GJQB 2CDRB 1GFWB 1NMEB 1SC3B 3GJSB 3GJTB 1SC1B 3P4UB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1RWX B;  2CJX B;  2DKO B;  1SC4 B;  4DCO B;  3D6F B;  1RWW B;  1RHQ B;  4ZVR B;  2CNO B;  1F9E B;  1PYO B;  3RJM B;  1RE1 B;  3R6L B;  2QL7 B;  1RHM B;  3IBC B;  4LSZ B;  4DCP B;  1RHK B;  1RWV B;  2HBR B;  2P2C B;  3R6G B;  1RWN B;  2C2M B;  4ZVQ B;  2XYP B;  3KJQ B;  1RHR B;  2QLJ B;  5K20 B;  1RWO B;  1PAU B;  2XYH B;  1IBC B;  2C2K B;  3KJF B;  3EDQ B;  2Y1L B;  3IBF B;  2H5I B;  3R7B B;  3R7S B;  3KJN B;  4ZVS B;  2QLF B;  3GJR B;  2H54 B;  4ZVU B;  4ZVT B;  2Y0B B;  4ZVP B;  3QNW B;  2C2O B;  2XYG B;  3NS7 B;  2QL5 B;  2CNK B;  2HBQ B;  2QL9 B;  2CNL B;  1ICE B;  3D6M B;  2FQQ B;  2CJY B;  1RHU B;  3D6H B;  2XZT B;  2H5J B;  2C1E B;  3R7N B;  2H65 B;  5IC4 B;  2H4W B;  2HBY B;  2HBZ B;  2XZD B;  3SIP B;  1RWM B;  2H51 B;  1I3O B;  2QLB B;  2H4Y B;  2CNN B;  1RWK B;  2C2Z B;  4ZVO B;  2H48 B;  4JB8 B;  1RHJ B;  3P45 B;  1QDU B;  1RWP B;  5IC6 B;  3R5J B;  3EDR B;  4DCJ B;  1I51 B;  1BMQ B;  1QTN B;  3GJQ B;  2CDR B;  1GFW B;  1NME B;  1SC3 B;  3GJS B;  3GJT B;  1SC1 B;  3P4U B; 
#chains in the Genus database with same CATH topology
 2OPQ B;  4RJV A;  5DM6 Q;  2VKR A;  5HI7 A;  4DBQ A;  5I3P A;  3BO3 A;  3D54 A;  4JV0 A;  4WE1 B;  2AGQ A;  3W63 A;  3N5F A;  4DR5 J;  3IAS 9;  3C3L A;  1NB2 A;  4H4M A;  2G1H A;  1XER A;  2LVW A;  3MPD A;  4Q0B B;  2MQ8 A;  3ZZT A;  2VFV A;  4YEA A;  3CJR A;  1G4C A;  1V5V A;  2XY5 A;  1R0A A;  2BJD A;  3CDB A;  2MXY A;  2X1G A;  5GAG U;  3GWC A;  1LW0 B;  2GVD A;  4JI1 J;  2C2R A;  1T9Y A;  1S0N A;  2NXN A;  3KLH A;  2HPU A;  2W8K A;  4DV2 F;  3MM6 A;  2EFG A;  2CG4 A;  3NLC A;  2FLN A;  4M5G A;  1DAX A;  2EVZ A;  1WF0 A;  2ZKT A;  2ZZN A;  4NEY A;  2DNY A;  4PAA A;  2WRM A;  3CCR S;  1KQG B;  2DR7 A;  3OJS A;  3N6L A;  1S9F A;  3VGV A;  3DOM A;  4P74 A;  4EYI B;  5C2G A;  1CG2 A;  1Y5N B;  2HNY A;  1X5S A;  2COL A;  1RBL A;  2OJ3 A;  1FVS A;  2ASL A;  2LCW A;  1XN9 A;  3DLK B;  4FPI A;  4LFA J;  3K8V A;  2MKI A;  4KFB B;  3M30 B;  2ZJP Q;  3C46 A;  3ITH B;  4P72 A;  3SFU A;  1KNZ A;  3SZ2 A;  4LF9 F;  4LR7 A;  2HQF A;  2H54 B;  3A3N B;  5JVG Q;  4WYW A;  2ASY A;  3MD3 A;  1VQS A;  4LBH A;  3GYG A;  3GG0 A;  1FFG B;  3DFE A;  1WOP A;  1I5O B;  2D74 B;  4HHU A;  5LM7 E;  1RT2 A;  4F2R A;  2W2P P;  4F3O A;  5HVH A;  1P1T A;  4ZPA A;  3G71 S;  2UV8 A;  1J5O B;  4ZDN A;  2BJ7 A;  2D3O 1;  2CJK A;  5E3P A;  2X3D A;  1S9G A;  4Y2C A;  2POK A;  2DGX A;  5BR8 F;  2ZC4 A;  1NUE A;  4WFB Q;  5BYQ A;  3V4I A;  4RUH A;  1H74 A;  1Q1K A;  2CQB A;  1REV A;  4EUV A;  1FI4 A;  3NY0 A;  2KDO A;  2ZJR Q;  1O5J A;  3CCL S;  5EDW A;  4K5R A;  3GR1 A;  2KJV A;  2GCF A;  4HTI A;  1U1N A;  3K57 A;  2UU9 J;  1EHW A;  3TVZ A;  3H7H B;  2EFV A;  1FER A;  1RHM B;  4CH1 A;  2ZOM A;  5I3U A;  4M63 A;  2KT3 A;  4R8U A;  3L7O A;  3CMA S;  2XO7 A;  1U1O A;  1UA1 A;  2X7I A;  3OT9 A;  2LFV A;  3ZZR A;  2OSR A;  3CJQ A;  1B7F A;  2UV8 G;  4A8F A;  5L9X A;  2BJ9 A;  3W64 A;  1GMW A;  3FBB A;  1NK8 A;  1QY7 A;  5RUB A;  2CNL B;  3TR5 A;  2D1C A;  3R7N B;  2GC8 A;  3GFY A;  4B3M F;  4CRJ A;  3MHY A;  3H2V E;  2BV3 A;  2BW2 A;  1O51 A;  2DXD A;  2OSQ A;  1Y0H A;  4QYZ K;  2UUW A;  3RBD A;  4OYO A;  1R31 A;  2P6S A;  3PVX A;  4C8O A;  1GXT A;  5F8M A;  3VGT A;  4NI2 B;  4WCE Q;  4ZCL A;  4UTG A;  1NK0 A;  3MEE A;  2MMY A;  1M5S A;  4QWA A;  3MEC A;  1N54 B;  2ASJ A;  1JNZ B;  1UEK A;  1YJT A;  2E7V A;  4QR1 A;  4B3T J;  2OD6 A;  2CJX B;  3W9J A;  3MOZ A;  2RKI B;  3PJW A;  1Q7Y T;  1RKJ A;  4XK8 C;  3KMS A;  3D28 A;  1NXI A;  1NJW A;  1T3O A;  2V5H G;  1IKW A;  4FKY A;  3DXB A;  2XYP B;  3HHL D;  3UN3 A;  2XB2 D;  4ZHR B;  2DEJ A;  1FRM A;  4YOE A;  2YQ1 A;  3M2R A;  3DLE A;  1NK6 A;  4XIU A;  3R7B B;  1WEX A;  3CT9 A;  3HM9 A;  4FVM A;  4G65 A;  2RE1 A;  1WDT A;  3I55 S;  3ILO A;  1OYE A;  4WXO A;  2PI5 A;  1FKO B;  3AHP A;  3RYL A;  3MR6 A;  5L39 A;  2QRR A;  1ZBT A;  2AU0 A;  4JI1 F;  2VJU A;  2YWW A;  1VQY A;  2HBZ B;  3PYG A;  2ZHO A;  2E9R X;  3CJK B;  1NSP A;  1FTR A;  1GXU A;  4YR3 A;  2HRY A;  2R8I A;  1B0P A;  2P6T A;  3N01 A;  1IWG A;  3G87 A;  2CZ4 A;  1VC0 A;  4LF5 J;  1Q8L A;  5IT9 U;  5J1N A;  4O3Q A;  4B3O A;  4USU A;  3CC2 S;  2AKW B;  3GJS B;  2BE9 B;  1U1M A;  1QE1 B;  1SKR A;  3EX7 B;  4U96 A;  4ECW A;  3MMA A;  2C28 A;  2H3E B;  3OSP A;  2HRU A;  1LXN A;  1S0O A;  4LFA F;  5KFC A;  1YJ9 S;  2M7S A;  4RUB A;  1YLX A;  4YB6 A;  9ATC B;  5MLC V;  4YHH J;  1JLG A;  1UW4 A;  3M2U A;  1DBD A;  3GIK A;  4KHP J;  4Q8E A;  3LW5 C;  2VA3 A;  4ZVT B;  3M05 A;  4XPE A;  1S6U A;  1F1B B;  1RT6 B;  4MKV A;  3SV3 A;  2QL9 B;  1JJH A;  3H4B A;  2AJF E;  4OQJ A;  1B4S A;  3MF5 A;  1AUD A;  1Q16 B;  3DI6 B;  1U0S A;  1S1T A;  2CPD A;  4QYZ J;  1GX5 A;  3MPU B;  3OR1 A;  5KG6 A;  1UVN A;  4DV4 J;  3EYZ A;  2MGZ B;  2YKN A;  3CUL A;  1RBA A;  2XSJ A;  2XS7 A;  5GVQ A;  1QAX A;  4IR9 A;  2BM1 A;  2NXJ A;  5EN1 A;  4NLR A;  1GT8 A;  1S77 D;  5J2N A;  1OS5 A;  1TVR B;  3HP6 A;  3DOK B;  2OFG X;  2UU9 F;  1RGV A;  4GC6 A;  2BX6 A;  1Q5Y A;  1AFJ A;  3U27 A;  4CLZ A;  2XMM A;  5MAO A;  1JLE B;  4OYM A;  1P6T A;  2ASD A;  1PC4 A;  4ZLJ A;  1U48 A;  4KGK A;  2DB1 A;  2HUR A;  3QMQ A;  3W5Y A;  3QGH A;  3HKW A;  3Q0A A;  4YB7 A;  2V63 A;  3PNI A;  4Y6I A;  1KRP A;  2GFF A;  1RAJ A;  2OEM A;  3EZ5 A;  3J7A N;  1D8Y A;  3M8Q B;  1VCT A;  2QJ3 A;  1SBR A;  3R5G A;  2EK6 A;  2ROG A;  1R89 A;  4RBU A;  4PG6 A;  4KO0 A;  4C98 A;  4H4K C;  2AYE A;  2F65 A;  4DG1 A;  2OEJ A;  1IM6 A;  5KFK A;  1KQS R;  1QDU B;  1BD6 A;  2DT9 A;  4U67 Q;  5A2Q Y;  5L1L A;  2XQC A;  1BMQ B;  4N41 A;  5EUH A;  2FZK B;  2MQP A;  2AX0 A;  3HHK A;  4K4W A;  1VBZ A;  3AA8 A;  3EXC X;  2PI4 A;  2BJ3 A;  4DZ6 A;  3JSY A;  4LF6 F;  1UJ4 A;  4GVL A;  5M2P A;  4LFC F;  2CQH A;  3DRR B;  2XI3 A;  4YR2 A;  5HMW A;  3ISN D;  2ALZ A;  4IG0 A;  1RA7 A;  1W7W A;  1MWY A;  4HEA 9;  2KHD A;  3C19 A;  4JI5 J;  1LKZ A;  2KN4 A;  3THT A;  5HMY A;  5B0G A;  2PSZ A;  2AQ4 A;  3QSI A;  1UWB B;  1HBO B;  3MAQ A;  2KO1 A;  3BSC A;  3DLH A;  1VBK A;  5DJB A;  4ZVU B;  5C42 A;  3S8S A;  3K5M A;  4O23 A;  4V19 J;  3QT5 A;  1EP4 B;  5D0R A;  4OYZ A;  1IKY A;  1DFD A;  2I2Y A;  2VIC A;  4DX5 A;  5SZT A;  2QA2 A;  4G1Q A;  2XHC A;  1CJV B;  2JEF A;  1RTZ A;  2H65 B;  2RRB A;  2XUL A;  2HHT A;  2V2V A;  4ZLN A;  1Y5I B;  1V3S A;  5JMN A;  2EK1 A;  2EG1 A;  2ZH7 A;  3O1L A;  4UQG A;  4TQS A;  2B4O A;  3KLI B;  1RU1 A;  2MJU A;  1NJZ A;  1HMV A;  4LF5 F;  2IBO A;  3QWP A;  4C8L A;  1TEL A;  2ZM6 F;  1LXJ A;  1DTT B;  2ZUG A;  1UZH A;  3T1H J;  3RJM B;  4UZC A;  4Y2K A;  3M1V A;  5GAG I;  4F02 A;  1PIE A;  5JJB A;  3ILJ A;  3V81 B;  3KJQ B;  4YHH F;  5F41 A;  3DU5 A;  4A8X A;  3G8T A;  5ETM A;  4DR3 J;  2KU7 A;  3QGP A;  1E6V B;  1X31 C;  4KHP F;  2VBZ A;  6AT1 B;  1NEE A;  1WEZ A;  3RRK A;  4IOA Q;  4ED7 A;  2FC8 A;  2M9K A;  3JTO A;  3TQ1 A;  3L09 A;  2OP5 A;  2HMI B;  2CJY B;  1LFP A;  3MCM A;  4JI2 J;  2AP6 A;  3HXM A;  4LSL A;  2ZJQ Q;  1K0V A;  1VK3 A;  4C9D A;  4ZS6 A;  3KHR A;  1KC8 T;  3G82 B;  4ELT A;  1NKB A;  1LK7 A;  3MUV P;  3CJ0 A;  4ZVG A;  2H4Y B;  5CAA A;  5D6G A;  4LF7 J;  2PO4 A;  4K2X A;  3T1Y J;  5L1K A;  3EJM A;  1HPZ B;  3FGV A;  2ZUA A;  3SXL A;  4C3K A;  1T02 A;  4DR2 J;  1SXL A;  1Q53 A;  2WSF C;  3W8G A;  5HP1 B;  3RB3 A;  3GTY X;  1B0T A;  3VQT A;  4C7Q A;  1D9F A;  2ZZT A;  4EBD A;  4OJ3 A;  1E6Y B;  1G1X A;  2WAQ D;  5FJ4 A;  3LPE A;  4LIR A;  1FJE B;  4K4Y A;  4BBY A;  4AQY F;  2DIT A;  3KJN B;  3JSM B;  2N7C A;  4LRC A;  1F2G A;  3GV8 B;  1T9X A;  4ZVP B;  2YNF A;  2CQ1 A;  2ZZM A;  3OL6 A;  2DO4 A;  1N6Q A;  1OWX A;  4LR8 A;  4KR0 B;  4DXL A;  4QPX A;  2EKN A;  3HJV A;  2IDL A;  1XMO F;  1B7Y B;  4C3M A;  4YB1 P;  2YH1 A;  2LEA A;  3MR3 A;  2Y9H A;  4USW A;  3LP0 A;  1LWC B;  4ECR A;  2K7K A;  4IFV B;  3W9H A;  4A8K A;  2LQB A;  2YNI A;  3LTO A;  3CCV S;  1VMB A;  3I9Z A;  2Z0G A;  1RT1 A;  1EX8 A;  3ET6 B;  4C0O C;  2DIU A;  1HLW A;  2CJQ A;  3EGV A;  4WFX A;  4NCB A;  3TX8 A;  4JI5 F;  2QLX A;  2GA7 A;  2QYC A;  2E5G A;  2K2P A;  4OLO A;  3PG9 A;  2I6W A;  2AZ1 A;  2KVI A;  2O1P A;  5FDL B;  2C2N A;  1SC6 A;  5D8H B;  2DNL A;  4KH0 B;  3PY8 A;  4AFF A;  5F3T A;  4B3S J;  4L72 B;  1G6B A;  1HQ2 A;  4J9K A;  2AEM A;  2DJW A;  1J5O A;  5HLF A;  3CC4 S;  3HDS A;  4F4Y A;  4JYA J;  1YJU A;  3TEH B;  5FLX Y;  3NCP A;  1R7I A;  4IQM A;  3ZTQ A;  4OYI A;  5C24 A;  4EYH B;  2HFS A;  4KYZ A;  2FVS A;  3AXK A;  1S1X A;  2I5J B;  4M8L A;  4DFK A;  2OEL A;  1KVK A;  3VZI A;  3OTD A;  3NGK A;  4Y34 A;  2R9L A;  3CO9 A;  3RUB L;  2IMW P;  3TYT A;  2RF2 B;  3AAW B;  2L9N A;  5T41 A;  4Y0F A;  2OMO A;  5KFL A;  3IAM 9;  1WF2 A;  2UXC J;  3GJT B;  3OFE A;  2BJ1 A;  2VPY B;  3T1H F;  3NAI A;  1OPI A;  4RBV A;  4W98 A;  4PWW A;  4BWJ A;  4JI4 J;  2VON A;  1DY3 A;  4N76 A;  2HK3 A;  2RAQ A;  4F50 A;  4Q2M A;  4MKB A;  3OJU A;  4IDK A;  3T5K A;  3BF4 A;  3NMA A;  5E3A A;  1UAW A;  4DR3 F;  1VC5 A;  4MYU A;  5IS2 A;  2C3Y A;  1XR7 A;  5DRK A;  2Y1R I;  4PUO B;  1R8A A;  4R5P B;  1XK8 A;  4FDF A;  2HWT A;  2KTQ A;  3FEZ A;  5CQG A;  3DGP B;  4XTT A;  2HGN A;  4QBU A;  5DG9 A;  3K5L A;  2R2T A;  1S48 A;  3MFI A;  2ZDP A;  3MAA A;  1R8H A;  4XDD A;  4ES1 A;  1AW0 A;  1XJW B;  2XMV A;  4LF7 F;  2IAJ A;  3KK2 B;  1WG4 A;  3D3C J;  2L41 A;  3T5J A;  2XC9 A;  1IKV B;  3D68 A;  3Q2S C;  1SUQ B;  3HHD A;  4YY3 J;  2PDA A;  2HSE B;  5IWA J;  4ZHR A;  2IM0 A;  1ZET A;  3H2U B;  4H54 A;  5BYR A;  3LAM A;  2W8L A;  2BA9 A;  4FYX B;  4IRC A;  5JUM A;  3W62 A;  3BPS P;  5J2M B;  2B9Y A;  1PBU A;  2VHG A;  4OJG A;  1OJ4 A;  5A8K A;  4Y2M A;  1RT7 B;  1L3T A;  3T5L A;  2GAH C;  4B9M A;  3MUM P;  3U1M A;  5JXS A;  1ZPW X;  2YWE A;  4FS2 A;  3I87 A;  5IZH A;  2YXL A;  1TR0 A;  4KHR A;  3QZ7 A;  2MQM A;  2OPS A;  5F8J A;  3CJ8 A;  2V2K A;  2YX1 A;  4C11 B;  4RUA A;  3UD5 A;  3RB0 A;  4B9T A;  2OI2 A;  3PW5 A;  3IA0 A;  2HHS A;  4DX8 H;  3NGR A;  2NPI A;  3PRD A;  1S9E A;  2FGO A;  3HUL A;  2GIF A;  4DCJ B;  2F40 A;  5HVG A;  1NJX A;  4JUZ A;  3UFC X;  2ZVS A;  4UY8 T;  2XM3 A;  2VBY A;  3JAM U;  4HAC B;  2F1F A;  3I5C A;  2G1D A;  3LP2 B;  3VAF A;  1RCO B;  5KFU A;  1GTH A;  3L95 X;  3JQJ A;  2CDQ A;  3D7S B;  1IR2 A;  4P2M A;  1RWW B;  2RD5 C;  1WI6 A;  3ZZU A;  4C8N A;  2BKN A;  3Q83 A;  1AZS A;  4X65 J;  3N6N A;  4NLP A;  2IVF B;  1WNE A;  2XHW A;  1UTA A;  4MK7 A;  3KOA A;  4OX6 A;  2B5J B;  5KFI A;  1RTH A;  3EDQ B;  3HHL A;  4USM A;  2HVZ A;  2M88 A;  3QGI A;  3GFX A;  5A2Q U;  1IN0 A;  5J1E B;  2AIR B;  3UN2 A;  4OV1 A;  3E3X A;  2UUT A;  3D9B A;  4I0W A;  3DI6 A;  3MMB A;  4JYA F;  2ZH1 A;  1G7C B;  1RLD A;  2W2N P;  5CD4 A;  1C1B A;  2XZD B;  3ENV A;  4DZD A;  5B0A A;  1N52 B;  1NRK A;  3TZY A;  5KFA A;  4U7U D;  3R9L A;  3RW6 A;  1VQO S;  2OPR B;  2BEF A;  3E01 B;  1FVQ A;  4DL2 A;  2FLP A;  4R0E A;  2DYA A;  2F9D A;  3NOC A;  3ENW A;  2JOQ A;  3KMQ A;  2DNH A;  2UXC F;  1H72 C;  1JJ2 R;  4J9P A;  4L75 A;  4ZK7 M;  2GHW A;  1XNR J;  2HAF A;  1C0T A;  4OZN A;  4WTY A;  2NXE A;  1X8D A;  2UUA F;  2MZT A;  1JKH A;  4PPD A;  5DM7 Q;  4PEO A;  4YQW A;  1YHQ S;  4DMZ A;  3KHH A;  3UQS A;  3QO9 A;  2PD1 A;  1S99 A;  5FD1 A;  3IBF B;  3R7S B;  2QG9 B;  5HL7 Q;  4HL9 A;  2W2M P;  4NYO A;  2N3L A;  4TU7 A;  2JHE A;  1WOO A;  2JEJ A;  3B4D A;  4I2Q A;  1RAF B;  1C1C B;  4IG3 A;  1QM9 A;  2ATC B;  4LRD A;  5DQH A;  1NO8 A;  1SJF A;  3R5C A;  2KM8 B;  3GLJ A;  3IRX A;  1RK8 A;  5A0Y A;  4BLG A;  1VQ4 S;  5CYQ B;  3HX9 A;  3Q8U A;  2NXC A;  1S97 A;  1VDH A;  5D15 A;  2R7Q A;  5KFO A;  1RUS A;  4DS4 A;  3JYT A;  1U0H B;  3N5B A;  2BQR A;  4YY3 F;  5IWA F;  3DHW C;  1UWB A;  1HBO A;  1N5Q A;  4OZL A;  2DGS A;  1XR5 A;  1S6O A;  4RUC A;  3M6W A;  4YDX A;  1WEY A;  4QCL A;  2HVE A;  3QIP A;  2XO6 A;  1EP4 A;  3C15 A;  3GIL A;  3SDE B;  1P9Y A;  3MEK A;  2JFD A;  1C0U A;  4DU7 A;  3Q24 A;  2XCP A;  3GYN A;  3MMJ A;  1XR6 A;  1RTD B;  2IC3 A;  4ETZ A;  1SJ1 A;  1WC3 A;  3NWR A;  4TN2 A;  2C42 A;  4UUX A;  4JB8 B;  1U1Q A;  3D1Q A;  2AEF A;  3HHN B;  1TL1 A;  1S6P A;  4EGL A;  1UVI A;  1MWQ A;  1R0C B;  4PXE A;  3NNA A;  1HNV B;  2VPZ B;  3CCJ S;  1K9M T;  2BDP A;  3KKF A;  4ECV A;  4GVB A;  5I42 A;  4KHM A;  3LPY A;  2V50 A;  1QAI A;  1X0P A;  2YKO A;  4OZJ A;  1T8E A;  3ZZY A;  4WP8 A;  2DVI A;  3R6L B;  2KFZ A;  3AB2 B;  2IJN A;  4X65 F;  2AW0 A;  2E1A A;  2AX1 A;  1NDP A;  3VCD A;  4ZVF A;  2B4U A;  2HMI A;  4OHZ A;  1RAO A;  3BM7 A;  3C6U A;  3CDA A;  1KSP A;  1V3R A;  3KK1 A;  4KY3 A;  3RZA A;  1RI7 A;  5KG0 A;  3G82 A;  5AXK A;  2C2O B;  4B08 A;  3H98 A;  4O3R A;  2RIL A;  4OJ1 A;  3T19 A;  4I67 A;  3NXZ A;  3TZX A;  2IM1 A;  2YKM A;  4ZIW A;  2RML A;  2ZH9 A;  3ILL A;  3GON A;  2LU2 A;  3UDV A;  4DWI A;  2DR9 A;  4DR6 F;  2JRS A;  2LA4 A;  7FD1 A;  1B3T A;  4JI8 J;  2H1Y A;  2AGP A;  1J27 A;  2RH3 A;  2AYB A;  4I7F A;  3K17 A;  4LQ3 A;  5EHH A;  5J2P B;  2ZH2 A;  3ETM A;  3BR9 A;  3BSN A;  5FLX U;  4JI3 J;  1XNR F;  1M5O C;  4UW2 A;  2CAD A;  3F56 A;  3F0N A;  5DQI A;  4DCP B;  4N77 A;  4MKY A;  2QA4 G;  1UPM B;  3NP5 A;  3MCS A;  4LR9 A;  2O5D A;  4I68 A;  3TRG A;  2YNG A;  3HJF A;  3JB9 k;  4QR0 A;  3BBC A;  3AT1 B;  1HBN B;  1L3V A;  2DRD A;  2DH7 A;  1YJ7 A;  2ACM A;  2HW3 A;  4PQU B;  3HSG A;  5E41 A;  1ZOT A;  4IFV A;  1U1K A;  1SH3 A;  3CCE S;  3SMZ A;  2R8H A;  3CC7 S;  3BR8 A;  1Q82 T;  5KFM A;  4B9S A;  1DLO A;  3EUN A;  1HHS A;  1KS2 A;  4FBU A;  2XMU A;  2IVY A;  3C66 A;  4KV8 B;  4DQP A;  1X4D A;  2OUG A;  8AT1 B;  3CNQ P;  3G8Q A;  4ICL A;  5M2U A;  2K8G A;  1RAE B;  5J1P A;  2XWY A;  1NME B;  4OHX A;  2HZV A;  2BOA A;  3IXQ A;  2C22 A;  4ZOS A;  2QSW A;  2ZBR A;  3MDF A;  1JLC B;  2NSC A;  4YME A;  3CED A;  3TEG A;  5E33 A;  1F9E B;  4DQS A;  4KKO A;  2AT1 B;  1LWX A;  1HWJ A;  3EVM A;  5KT4 A;  1YI2 S;  1NK9 A;  2RS8 A;  2GMH A;  3BH7 B;  2CA9 A;  3T1A A;  5HMX A;  2XI2 A;  2U2F A;  3PW2 A;  2B7B B;  3FDS A;  1I1G A;  3QID A;  3VVU A;  1IUJ A;  1S7I A;  2ABY A;  4NPO A;  4DQQ A;  5J2Q A;  2I5J A;  1KHW A;  2VKZ G;  3W1Y C;  2E7W A;  3D1O A;  2PFD A;  1VRT B;  1ZYQ A;  1FD2 A;  4ER8 A;  4WTO B;  2E5I A;  1N0U A;  2YKA A;  4DOZ A;  1VGY A;  4F4Z A;  1X4C A;  4HDH A;  2QTW A;  4KH1 B;  1RWP B;  2DEI A;  1CJU B;  4O3O A;  2HIQ A;  4PKD B;  2MKC A;  3E2E A;  1KOH A;  4CP5 A;  4PCQ A;  2J0X A;  2KHC A;  3G9C A;  1JK9 B;  3PXG a;  3MM5 B;  3PR5 B;  1BQM B;  2CZ9 A;  3MZI A;  1RWX B;  2V4J A;  2X1A A;  3H0P A;  4NLS A;  4CLF A;  4K4T A;  1JLA B;  1FKP B;  4M5D B;  2LQ8 A;  2M8H A;  2XMJ A;  2VQE J;  1GH8 A;  2R7W A;  2AJQ A;  3AQO A;  4Z2X A;  5E5N A;  1H6K X;  1BGX T;  5KT5 A;  2V9W A;  1RWO B;  2IA0 A;  2IDE A;  1PAU B;  5D78 A;  1TUG B;  3UN5 A;  4H4O A;  2YKQ A;  3UVJ B;  1RTJ B;  1M5H A;  1M0S A;  5HBM B;  2HHU A;  4WP9 A;  3KHG A;  2M52 A;  2K3I A;  1TFW A;  2PC6 A;  3VAH A;  2WTF A;  2WVF A;  4CLP A;  1NDC A;  1OY8 A;  2YWF A;  4UST A;  3H5X A;  1XEZ A;  1KKH A;  3JSB A;  4NZ7 A;  4USJ C;  5C25 A;  3FZ2 A;  3P5B P;  1JJC B;  1TK5 A;  1RT5 B;  3TUJ C;  1YQH A;  3MED B;  4N5S A;  1UKU A;  1N56 A;  3MFH A;  2FVP A;  4I64 A;  4QIF A;  3V5R A;  1U8S A;  3Q8V A;  2Q1L A;  2Z57 B;  4JI8 F;  1KTV A;  4F04 B;  3NMR A;  3LQV A;  5G0R A;  4DL6 A;  3PX4 A;  4RZR A;  4CLT A;  3NEK A;  4I6A A;  1VIX A;  5F3Z A;  1RYR A;  2G0J A;  1FJC A;  2AWZ A;  2Q3P A;  2W7P A;  3K5N A;  2HWH A;  2JX2 A;  1FXL A;  1ULR A;  4BC9 A;  4M1K A;  4PXC A;  1X9W A;  4H4M B;  2CQ3 A;  5L1J A;  2HZA A;  4TY8 B;  2JLG A;  1FNX H;  1D9D A;  3ENA A;  4OI4 A;  2AV5 A;  1YJW S;  3HPO A;  1L5U A;  1R0A B;  1TQL A;  3SBM A;  4C11 A;  4X4Q A;  2GVD B;  2DIV A;  5E3Q A;  5EWG A;  4DL5 A;  3K7R A;  2G9O A;  3KLH B;  3PW7 A;  3MM6 B;  1N8R T;  4TVA B;  1UW9 A;  2F8M A;  2ADB A;  2GIQ A;  3RTV A;  1UVL A;  1WC1 A;  2B9W A;  4OHW A;  5CHC B;  2QSF A;  5IM0 A;  1WOS A;  2CPH A;  1HAR A;  4FXV A;  2FJE B;  1ZZN A;  3HFZ B;  2DR8 A;  3CMQ A;  3A13 A;  3UNY A;  3DOM B;  4YN3 B;  3W2W A;  1YK9 A;  1QSS A;  2DHX A;  2CQ0 A;  2DPJ A;  4J9M A;  2KZZ A;  1QLN A;  4B02 A;  2HNY B;  1V5I B;  2BKO A;  3KG1 A;  5K8P A;  6FDR A;  5LSO A;  5GAD U;  2DGV A;  2VG7 A;  4ATN A;  2CQD A;  4A47 A;  4RNO A;  2MDA A;  4PYA A;  2ZH3 A;  4XAK A;  2L9W A;  3GJR B;  1WHV A;  4V1A k;  2HHH J;  3FBC A;  3MEG B;  3ZZO A;  2HBQ B;  3M9M B;  1RT2 B;  1QJH A;  3EIC A;  5CA5 A;  3GP9 A;  3ENQ A;  5IV3 A;  2UUB J;  3TVK A;  3ZNJ 1;  1T05 A;  3PYE A;  3RAQ A;  4Q8F A;  3QPI A;  2J5A A;  4MK9 A;  3TNV A;  3OUY A;  3QLH B;  4J37 A;  2Y8W A;  1RHJ B;  4M5N A;  4U6P A;  2HVI A;  3V4I B;  4BHQ A;  1U4B A;  1GEH A;  5L46 A;  3ETO A;  2HS3 A;  3W8P A;  1M1G A;  1YJV A;  5KTQ A;  1DQ9 A;  4JI6 J;  2HQD A;  3KUG A;  4EZ9 A;  4LUB A;  3LGM A;  3RW7 A;  2NUH A;  4ZP7 A;  3IP0 A;  2KFN A;  3DM2 A;  2WOM A;  4ZVH A;  5I3U B;  2VQE F;  1P9Q C;  4F2S A;  1YZ7 A;  4R8U B;  2EFO A;  2MKH A;  5DG7 A;  2BUN A;  1SKS A;  2I9S A;  1WDD A;  3FNN A;  3O44 A;  2YNH A;  4F26 A;  3TW0 A;  2B4V A;  4CQ1 A;  2EFQ A;  5HJX A;  1NAQ A;  3QAT A;  2AF6 A;  2KB2 A;  1VQK S;  4TU9 A;  2WON A;  2K3K A;  1WD6 A;  2PMH A;  4UOH A;  3LWM A;  4N8N A;  4RKU C;  2IM3 A;  4OFZ A;  2E7X A;  2GW8 A;  4ERD A;  3LWL A;  1FJG J;  1EKS A;  3HVA A;  1RWK B;  4YDD B;  5KFD A;  3VVT A;  3I4P A;  1VQ6 S;  3UD3 P;  1NSK L;  3R5J B;  3MEE B;  1X4B A;  3MEC B;  3R5B A;  2GVZ A;  2ZKU A;  3R97 A;  2ZD1 A;  2MTL A;  1GK8 A;  3M32 A;  5LSL A;  5KT2 A;  2HIY A;  5IT0 A;  1FTC A;  1U7L A;  3ZXW A;  4DV0 J;  5CCL A;  2VZ9 A;  1IKW B;  4U9R A;  5KG1 A;  4NCG A;  1NZ8 A;  1F0X A;  1QTM A;  4NA3 A;  5KFB A;  3OR2 B;  3IR5 B;  3M2R B;  3CDE A;  3DLE B;  1LEO A;  4CT9 A;  1FWK A;  2G13 A;  4QWC A;  2HFV A;  1U1L A;  2HLT A;  3QT7 A;  2X1B A;  1CC8 A;  1OO0 B;  2ROE A;  4WFA Q;  1HR0 F;  5L9N A;  2JJ4 D;  3D6M B;  4ED1 A;  4WU2 A;  4NL5 A;  1TK8 A;  5GAH U;  5GME A;  4GKJ F;  4DN0 A;  2EXU A;  4JBC A;  2MKJ A;  4HH1 A;  2OTL S;  1R6Y A;  3IG1 A;  3V2U C;  5LJ3 Y;  4RW4 A;  1RBO B;  2DK2 A;  1OSC A;  3LGN A;  2FJB B;  4B3O B;  1OMS A;  3ZZ0 A;  4S0M A;  4NRT A;  4HKQ A;  3MMA B;  1XWL A;  1TL4 A;  4LT6 A;  3BYR A;  4J9Q A;  3NNH A;  3B54 A;  3QGG A;  1VHI A;  2JL9 A;  2O01 C;  3KLF A;  1IQZ A;  2I0X A;  2HQI A;  3CJT A;  2E44 A;  2V67 A;  5D0E A;  1JLG B;  2B4P A;  3M2U B;  2JEG A;  3SI8 A;  2Y8Y A;  2HKE A;  4I6Y A;  2HQ3 A;  2IRX A;  4YB5 A;  2R7S A;  1TL5 A;  1YZ6 A;  1HQE A;  2R7O A;  2VOP A;  5KFP A;  3V4M A;  2YKP A;  4I6W A;  2HHH F;  2XY6 A;  4JI0 J;  3IGN A;  3NGT A;  4NXN J;  1AA1 B;  3UR0 A;  2R3V A;  4RW7 A;  4X4O A;  2C1E B;  3FFI A;  3J7Z T;  4ZN1 A;  1KLM A;  4NRU A;  4C8K A;  1S1T B;  2UUB F;  2B7C B;  2F3J A;  4CI0 B;  3GSD A;  1I3O B;  4DX7 A;  4RNN A;  1CPZ A;  5LMU J;  3CCM S;  3A8J A;  1FA0 A;  2BE2 A;  1S59 A;  2XSJ B;  2KRR A;  1LQ9 A;  2D9P A;  5BJR A;  3R27 A;  2LEB A;  3HVW A;  4JI6 F;  1FJ7 A;  5J2N B;  3QZ8 A;  3IWL A;  1AFI A;  3M9N B;  2XTJ P;  2J7U A;  4ZVR B;  4QPT A;  3FEX B;  3N0V A;  4LRF A;  1HBM A;  2R42 A;  5D0G A;  1U47 A;  2PT0 A;  2CPX A;  1HBN A;  4X2B A;  2KFY A;  1Q78 A;  1RT3 B;  2L9D A;  3OBI A;  1RIS A;  2LYV A;  4DV2 J;  3POT A;  4L3N A;  5DDR C;  3D3B J;  2LMI A;  2APO A;  3M6V A;  1X7V A;  4J91 A;  2PEH A;  1U49 A;  4WXW A;  5AJ3 J;  1KFS A;  4KO0 B;  1FO1 A;  4O3N A;  2XGQ A;  4FF1 A;  4IRK A;  1IQT A;  1NHK L;  1MLA A;  1FJG F;  4ZPC A;  4DSF A;  3P45 B;  4CDI A;  4ZCK A;  1IKX A;  3AD9 C;  2R7X A;  5HQ8 A;  1RA6 A;  3BGO P;  4FYW B;  4IG0 B;  1HFE L;  2MHN A;  4DLE A;  1S4F A;  4FPR A;  2GV1 A;  1EKR A;  4DV0 F;  5I4M A;  3OTC A;  1WKL A;  3NS6 A;  5A6W A;  4AE5 A;  2BMB A;  2X51 A;  5E3R A;  4B9N A;  1OY6 A;  4H4K A;  4NE9 C;  4Q43 A;  4OI6 A;  3MM9 A;  4Y3C A;  2HHV A;  5C42 B;  4X4S A;  4AUK A;  3N79 A;  5DQG A;  1XBW A;  1RT4 A;  2VQF F;  3OL9 A;  1IKY B;  1BUX A;  5CYM A;  2HQC A;  1X9S A;  5H1S V;  4G1Q B;  3H5U A;  2IRY A;  2MY7 A;  4GO7 X;  1FNM A;  1CJU A;  2H5E A;  2EPI A;  3CTR A;  3WC0 A;  3J80 Y;  1ZA1 B;  5LXR A;  3LUY A;  2H51 B;  1TL7 A;  1URN A;  1TKD A;  1ZS6 A;  4KIA A;  2E66 A;  3PO4 A;  1NK7 A;  3MM5 A;  3VGU A;  4O4G B;  4URS A;  1PJ7 A;  1HMV B;  1QTN B;  2K7J A;  3JQK A;  1JLA A;  3EZU A;  5CZX A;  2GHP A;  4K4S A;  1XMB A;  3A8E A;  2J0S D;  3F73 A;  4EEY A;  1Q4R A;  1GX6 A;  2DCL A;  1T9W A;  3KHL A;  2RT3 A;  4FXD A;  1F3F A;  2MKY A;  4Q2L A;  3RBE A;  4FS1 A;  2D69 A;  3CIZ A;  2E1M C;  4IO9 Q;  3VAJ A;  4LSZ B;  1RTJ A;  1GMV A;  3B6B A;  1IBM J;  5B0B A;  3DOL A;  3T3F A;  3FMW A;  1R27 B;  4PG4 A;  1FXD A;  4UY8 5;  3GFH A;  4ZVS B;  2J6T A;  5LMN J;  4PG5 A;  2B8Q A;  2C3O A;  3ICL A;  3FSX A;  4JI0 F;  2MKK A;  4LSL B;  2W2O P;  4NXN F;  4QW8 A;  1MW7 A;  4PG8 A;  1U25 A;  3SSR A;  4J9V A;  2ACY A;  2MZS A;  2R7V A;  1YIJ S;  4CO5 A;  3J81 Y;  3Q86 A;  3A1Y G;  1MWZ A;  3NCQ A;  2R2U A;  5LMU F;  3GZ7 A;  2E5J A;  2NYH A;  4E98 A;  2IYG A;  2ZBQ A;  4IO1 A;  4NZ6 A;  2HRT A;  1YVF A;  1UEU A;  3MM8 A;  1VIO A;  2F63 A;  4X4U A;  4YR0 A;  2V68 A;  2HQG A;  2VJV A;  2HYI B;  3D6F B;  4F0H A;  3T6B A;  1SJQ A;  4TY8 A;  4RWW A;  3MXH P;  2AYM A;  4DHV A;  3PR4 A;  2LDI A;  4NLT A;  2HBR B;  4P7V A;  1HA1 A;  3GPA A;  2J6S A;  2C3U A;  3UCU P;  4KPY A;  2HHW A;  1CJT A;  2RVJ A;  1NB7 A;  1N5Y A;  1BQN A;  1IJE B;  4CO4 A;  2YNF B;  5JVH Q;  2XS2 A;  1N6Q B;  5EWE A;  5AE3 A;  2C3M A;  4KE5 A;  4FF3 A;  3PW0 A;  5HQL A;  2Y1J A;  4O4R A;  3KDN A;  2DNK A;  5KFE A;  5AJ3 F;  3LP0 B;  3KLV A;  3ULH A;  2LKZ A;  3NGU A;  1SQE A;  4F36 A;  1HNX J;  1O8B A;  1HNZ J;  2F4V J;  1Y5L B;  4WFN Q;  5ETK A;  3RGI A;  3AD8 C;  2YNI B;  3TO8 A;  4RW6 B;  3GSI A;  2N7Y A;  3MOJ B;  4CYU A;  4HR2 A;  5EX0 A;  1RT1 B;  4YS2 A;  5K8N A;  4DLG A;  4ED0 A;  2YQ0 A;  1S49 A;  2J6U A;  1I94 J;  3CE8 A;  1TFY A;  3AOA A;  1RYS A;  2RJZ A;  3TJA A;  1YRT A;  3C16 A;  1X4G A;  2YPY A;  4PXD A;  4PWU A;  5CCM A;  2AJ0 A;  3LH2 S;  3CCZ A;  3RR7 A;  3R5A A;  3NBP A;  3MEG A;  2XYH B;  3KJF B;  3LOU A;  3BKU A;  4QU7 A;  4ELU A;  4CM2 A;  4DSE A;  4FNI A;  1R8C A;  2Z8Q A;  5HLF B;  1J5E J;  2FHM A;  1MG7 A;  3X3U A;  3CCT A;  2PGC A;  3O8W A;  1S1U A;  1S76 D;  3HT0 A;  5ETO A;  4KJI A;  4QWD A;  5C24 B;  2FLL A;  3QLH A;  3VAG A;  2QC3 A;  2XNQ A;  1S1X B;  3NS5 A;  5KFJ A;  1HNI A;  1NU4 A;  2RDJ A;  3PO5 A;  3TAR A;  3ZTS A;  1NH8 A;  3CDU A;  2W4C A;  3BQ2 A;  3CCW A;  4UT4 A;  2VF3 A;  2HS4 A;  1HW9 A;  3EXY A;  5KAK A;  2HND A;  5KG2 A;  5K14 A;  1C4A A;  4DSK A;  2ATL A;  1Z2L A;  4C48 A;  3TUZ C;  2JDJ A;  3P4U B;  3CXC R;  3GV5 B;  5E2Q A;  2M8D B;  2OGU A;  1NDK A;  1X5P A;  2MEW A;  4OZ2 A;  1NPP A;  2WVE A;  2DR6 A;  1R0B G;  4IDK B;  3OL7 A;  2NRE A;  1T11 A;  4MTP A;  4I56 A;  1IBM F;  3WX8 A;  3H25 A;  2YTC A;  4K7Q A;  3R1H A;  4KT0 C;  5GAH I;  2OIH A;  3DRP A;  2MPU A;  4NMX A;  4O0N A;  2WK4 A;  4HT5 A;  3VAL A;  2V4R A;  5LMN F;  5F8N A;  3DYA A;  4PWD A;  2ZBI A;  4A8Q A;  4FYD A;  2V4Q A;  2B8P A;  1ROF A;  1SKW A;  2KT5 A;  1UET A;  2FHJ A;  3NL0 A;  3MAA B;  3QFH A;  3WIU A;  1MNE A;  4TQR A;  2UZA A;  3CSK A;  1Q8K A;  3PHE A;  4LF6 J;  2MHE A;  2IAJ B;  4LFC J;  2VOD A;  3X1L B;  2LLZ A;  2N4D A;  3DGV A;  2OAU A;  2BBE A;  2RRN A;  4NEZ A;  2NSB A;  2G2O A;  2FJA B;  4DPU A;  1RAA B;  1KN6 A;  4EK2 A;  1HL6 A;  3UW1 A;  4E8U A;  1V3Z A;  1QUP A;  4K50 A;  3OR2 A;  1FF2 A;  2KG0 A;  1QSY A;  4U95 A;  4ZP9 A;  3HHL C;  4NA2 A;  1GTE A;  2MQN A;  4LBI A;  2GX8 A;  1T9U A;  2B56 A;  3BDP A;  3KLG A;  5A8K B;  1YJR A;  2QLJ B;  3HSJ A;  2E1C A;  2NYI A;  2BZ2 A;  4CLU A;  2RDD A;  1FE0 A;  3O3L A;  3TAP A;  4EBC A;  1HWI A;  4DPY A;  4W4M A;  1BLU A;  4NLW A;  3ZC4 A;  2OPS B;  3R3T A;  3S1T A;  4GMK A;  3MTK A;  3S01 A;  3G86 A;  1HD0 A;  3SIP B;  2ZM6 J;  4IH5 A;  1HNX F;  1HNZ F;  2F4V F;  1HHT P;  1S9E B;  3KJV A;  1PJ6 A;  4QU6 A;  1N48 A;  1RAC B;  4A8W A;  3EM1 A;  3K0J A;  4DUY J;  4LRE A;  3I32 A;  2CPF A;  1PG5 B;  1FFW B;  1H0H B;  1TKZ A;  3CGI A;  4ID5 A;  1I94 F;  1CQM A;  1DQ8 A;  5ETN A;  4K4U A;  3W7B A;  4HVZ A;  1VC6 A;  2GJ2 A;  1NKE A;  3PKM A;  1OYD A;  3HT3 A;  1AZS B;  2VPX B;  1S1V A;  1IBL J;  2E1R A;  3BYP A;  2I1R A;  4ECS A;  3J7A 1;  4EZ6 A;  4WK3 A;  3O2I A;  1EET A;  3W65 A;  2V6A A;  1RTH B;  1RP5 A;  4CTA A;  3HHL B;  3PAC A;  2C2K B;  3RBX A;  1UVM A;  3KLE A;  3NNC A;  3IGV A;  1NJY A;  3VAM A;  2LU1 A;  5HO4 A;  3MMB B;  1J5E F;  3R2D J;  1YRU A;  2KXH A;  3PYD A;  4TXS A;  4P52 A;  2NLW A;  2XZT B;  1C1B B;  3GG1 A;  4A8O A;  3I5B A;  3BQ1 A;  3DLG A;  3PW4 A;  4KTQ A;  3CWJ A;  2GNK A;  2VV5 A;  2CXE A;  3IBW A;  1RXO B;  5IC6 B;  1SI9 A;  2MLY A;  4CLL A;  3NWG A;  4FKX A;  1VJQ A;  4C0H A;  1HWK A;  4WU3 A;  3WBZ A;  4RNM A;  3BGL A;  4QYR A;  5CXT A;  2R8J A;  3H20 A;  3LAK A;  2DKO B;  4EFA C;  5KT6 A;  1C0T B;  4AQY J;  3A8I A;  1RHQ B;  3H90 A;  4ZLP A;  1RT3 A;  1RE1 B;  2CQC A;  2LEC A;  1JKH B;  1RLC L;  3B78 A;  3J80 U;  3EZO A;  2NZ4 A;  3QO9 B;  2XBP A;  3Q23 A;  1IBC B;  1XMO J;  2K1R A;  2HFZ A;  1S0V A;  2MLZ A;  2JLE A;  1W26 A;  1VBY A;  1CLF A;  2E5H A;  4F3M A;  1LOU A;  3R5D A;  4PZV A;  3FCW A;  1XC9 A;  3FBF A;  4I2Q B;  3KK3 B;  4ZCI A;  1S72 S;  1VQ9 S;  3H4D A;  4IG3 B;  4FYY B;  4OIX A;  3IRX B;  1K47 A;  5A0Y B;  3OLA A;  4L74 A;  4NLO A;  4OV6 A;  1YKW A;  2W7O A;  4DEZ A;  1ELO A;  5HRO A;  4OJH A;  3T41 A;  3M8Z A;  3JXO A;  4NWB A;  4PQA A;  3ISN C;  3JYT B;  2QEX S;  4NYP A;  4K5S A;  4P2X A;  4DDF A;  1KDN A;  3ILI A;  2NZC A;  5KT7 A;  3FVY A;  1TL3 B;  5DDO C;  1SVD A;  4KGM A;  3QIP B;  5IV4 A;  2DGT A;  4ELV A;  3C15 B;  2OKQ A;  2WVD A;  3US5 A;  3CIM A;  1QVF R;  4C4W A;  1C0U B;  3DMJ A;  3OTO J;  2D41 A;  2ADC A;  4C2M A;  2QIF A;  3DC2 A;  5KFH A;  2P9E A;  2CWX A;  2AYG A;  4U7C A;  4NCA A;  2IC3 B;  1TKT A;  3MUT P;  3AQP A;  4O4G A;  5C7P A;  2HBY B;  4HDG A;  4FF4 A;  3TA2 A;  3N6M A;  3CME S;  2QLB B;  1XNQ J;  2CYY A;  4M5L A;  1TL1 B;  1YG0 A;  1S6P B;  3EVO A;  1KVI A;  2FTR A;  4J9R A;  2VBX A;  2CJ9 A;  2P8I A;  1AB8 A;  2HLU A;  2CRL A;  4DUY F;  3G96 A;  2FVR A;  1QUV A;  1MN7 A;  4GVB B;  5I42 B;  1GXL A;  1K44 A;  1S4E A;  3L9Z A;  4OX8 A;  1Y4Z B;  3MD1 A;  1IBL F;  2VDH A;  3K8W A;  1CC7 A;  2FUG 9;  2DBB A;  1W2B R;  1YBT A;  5C5J A;  3C6U B;  2MZQ A;  3D5M A;  3G6X A;  3QT6 A;  3KK1 B;  1JMT A;  3LF0 A;  5B0C A;  4X64 J;  2RDI A;  4DFM A;  1FRK A;  1NK5 A;  3BRE A;  1PKU A;  4DFJ A;  4QR2 A;  2FQQ B;  4QQB A;  2YKM B;  3MR2 A;  3TAQ A;  4LF8 J;  3SV4 A;  4BCA A;  4DV7 J;  5IT9 Y;  4OHY A;  3DXS X;  5EWF A;  2GQC A;  2GJF A;  2AJ2 A;  1JLF A;  2CNN B;  2EFN A;  3DRS A;  2Z2Y B;  2PA3 A;  3UNG C;  4LSN B;  4M5J A;  1ACM B;  3EMT A;  4YUD A;  4I7F B;  2BJE A;  3GIM A;  4C8Y A;  1UCN A;  5F8I A;  2Z2M A;  2HK2 A;  1JB0 C;  2WSC C;  1H2V Z;  4LQ9 A;  1PAE X;  4C0B A;  4QW9 A;  5FII A;  3UDE A;  1IBK J;  4OX9 J;  2XMA A;  2OEK A;  3BKF A;  2MSS A;  1RWV B;  1N33 J;  3OXL A;  1VFJ A;  1M1K T;  2YNG B;  1K1Q A;  1N5S A;  3L3C A;  1JX4 A;  1NSA A;  4DV3 J;  3W9I A;  1SH2 A;  2DPI A;  2FJV A;  2QE5 A;  4NOH A;  2BKP A;  4PG7 A;  4RW6 A;  3RRH A;  1O6X A;  1FRL A;  1XMQ J;  1RWU A;  1SV5 A;  1DLO B;  2UXB F;  1MRO A;  3V6D A;  1ZZF A;  5EX3 A;  4ICL B;  4LJM A;  4OZ3 A;  3Q8Y A;  4OI2 A;  3D66 A;  1ZH5 A;  4G3I A;  1KEK A;  2XSF A;  3DKD A;  2MLX A;  3QJJ A;  1U1P A;  1VQ7 S;  2QO3 A;  4DCO B;  2CPE A;  3H2L A;  2DHG A;  4KKO B;  2CQ2 A;  5KFT A;  3MUR P;  4Y2A A;  2Q43 A;  2ALY B;  2LEP A;  4BS2 A;  3UDL A;  2KYX A;  2WBM A;  1KQF B;  2P9G A;  2ZE2 A;  1VR6 A;  5J2Q B;  3MGJ A;  3OTO F;  2OO4 A;  3MM7 B;  2WW4 A;  3TUI C;  1T03 B;  1FE4 A;  3RB4 A;  3IC1 A;  1M1H A;  1CUL A;  4K0K J;  1PSD A;  5CZV A;  2CWK A;  3L7U A;  4N56 A;  2XMK A;  2B9X A;  3KNA A;  3I6P A;  1VJW A;  3UR3 C;  1AUS L;  1DRZ A;  3FSY A;  1KHV A;  2W24 A;  1TTH B;  3TI0 A;  1XNQ F;  5HQM A;  2FLO A;  4DPT A;  2J7W A;  1TUV A;  2RQC A;  4Y28 C;  3HVT B;  3NCR A;  3D0G E;  2V8P A;  1FRH A;  3UE2 A;  3IR6 B;  2BJ8 A;  5DDP C;  4F0K A;  4IYQ A;  1H73 A;  2UUA J;  1WTB A;  2V4J B;  5KFZ A;  4LVO P;  3I5A A;  3K5P A;  5T7L B;  5F8L A;  4XO0 A;  4UOG A;  3DDK A;  1FCA A;  3HHE A;  1YRX A;  2J9D A;  3OVS A;  3G6V A;  2B6A B;  1BE4 A;  2MQO A;  4NAS A;  2ZH5 A;  4C3L A;  4LF4 J;  5HJY A;  2ZEJ A;  4HLB A;  1YBA A;  4E0D A;  4DQR A;  2QMX A;  4H4O B;  5D77 A;  2MYF A;  3IS9 A;  5B7W A;  4DN9 A;  3A12 A;  2BE7 D;  2DRB A;  5B09 A;  3I82 A;  4X64 F;  5L38 A;  4OLP A;  2JH3 A;  1N0V C;  2DCU B;  5C25 B;  2A1B A;  3MCO A;  3IRW P;  1S10 A;  4NLU A;  4LF8 F;  3WX4 A;  2GGP A;  2HHQ A;  2VFS A;  4DV7 F;  2F4F A;  3EPI A;  2O67 A;  2FJX A;  2FHK A;  1P1L A;  1FK9 B;  2DNP A;  4EI2 A;  2IJR A;  1TAQ A;  1H3D A;  2HEK A;  3DDI A;  1B70 B;  4P9S A;  5G0R B;  5A8W A;  4DSJ A;  4DX6 A;  3DU6 A;  2O66 A;  1LWF B;  3PM9 A;  2XG8 A;  2CUY A;  5D3G B;  2Y1I A;  3M2V B;  3LP1 A;  2VFT A;  3QFW A;  3CD7 A;  1YDL A;  2BRL A;  3UDC A;  3J7Z 5;  3OSN A;  1B0V A;  1IBK F;  4OX9 F;  2HGL A;  3K5O A;  3NG8 A;  1CVJ A;  4URG A;  2BAC A;  3C8Y A;  4DSL A;  1FNO A;  2I38 A;  2JZ5 A;  5LJ5 Y;  1UJ5 A;  4CH0 S;  1Q5V A;  1N33 F;  1U26 A;  4TNO A;  2C2E A;  2M3D A;  4OL8 A;  1HNW J;  4DV3 F;  3MPY A;  3UI3 A;  1UA0 A;  4ED6 A;  4BC7 A;  1K1S A;  3BN4 A;  4B9L A;  2V0N A;  4O44 A;  2DGW A;  4P2F A;  3VGS A;  1S1W A;  1UL3 A;  4I2P B;  1Y10 A;  3BDE A;  4IOB A;  1XMQ F;  1Y7P A;  4WK1 A;  2H4W B;  4M5I A;  2JEI A;  2MB0 B;  1RSC A;  2J0W A;  2YQ3 A;  5IM0 B;  2GAG C;  2OPP B;  2QGF B;  3MMC A;  1WSV A;  1X5T A;  2ZOF A;  4QIE A;  3QYY A;  4CZC A;  3W2W B;  1TZ0 A;  2BR0 A;  4ILL A;  2CDR B;  3G6Y A;  1QAY A;  1L3S A;  1CSJ A;  2A6O A;  1SC1 B;  2VG7 B;  3BN7 A;  5AXM A;  3TOQ A;  4Z7C A;  2FPH X;  2QMW A;  5D0H A;  5AT1 B;  4B9U A;  4F7V A;  5ETT A;  4PPZ A;  3SFG A;  1HYS A;  3PEH A;  1NDL A;  5K5M A;  1TU0 B;  2KM8 C;  3W5Z A;  1RHR B;  2VG6 A;  1UWA A;  2J9C A;  1URR A;  7AT1 B;  1SL2 A;  1FDB A;  4RW8 A;  4AL7 A;  1CS4 A;  1SL0 A;  4RPF A;  2IVM A;  4ECX A;  4OYA A;  2EFP A;  4DR6 J;  2CNK B;  4A46 A;  4K0K F;  2UVW A;  1H7X A;  3NGS A;  3BGU A;  5I3Q A;  1T05 B;  2YPZ A;  3S7R A;  1F5C A;  5HAN A;  3GV7 B;  1VIS A;  4ALZ A;  3OUY B;  3CJ3 A;  1JLQ B;  3U1N A;  4NXM F;  2WB1 D;  1JJ4 A;  1EJ7 L;  3OV7 A;  2AD9 A;  3AJD A;  5IFM A;  4O3P A;  4LRA A;  3HI9 A;  4OI3 A;  3KUE A;  1VRQ C;  4Q44 A;  5KFF A;  2VFR A;  3DM2 B;  2WOM B;  3CW2 C;  3ZTR A;  2DY1 A;  2DIS A;  1F5B A;  4CIO A;  4MK8 A;  5K9F A;  3HFV A;  2IY5 B;  1S6Q B;  2LXU A;  5AXL A;  1VRU A;  3Q8S B;  4UZB A;  1Q8B A;  4LF4 F;  2J8S A;  3ZTO A;  5AE1 A;  4ECY A;  2C2M B;  2WBR A;  2YNH B;  2KYZ A;  4E2F B;  3KK3 A;  2SXL A;  2CG8 A;  2YBV A;  3VAI A;  1X60 A;  1DTQ A;  3CF5 Q;  1LWE A;  3M6X A;  2FVQ A;  4DR5 F;  4AND A;  4QJV A;  2WON B;  3TZZ A;  1U02 A;  2DH9 A;  3ZO7 A;  3W61 A;  2AGO A;  3U1L A;  3OTE A;  3KG0 A;  2MZ1 A;  3C6T A;  2V34 A;  3TA0 A;  4UOC A;  1S79 A;  4IFY A;  2H48 B;  2Q6B A;  2HHP A;  4RW9 A;  1EAY C;  4CLS A;  3BBB A;  4FZV A;  4HTJ A;  1YGY A;  1RU2 A;  2GVZ B;  2K06 A;  2ZD1 B;  2A18 A;  4P2S A;  3M32 B;  2IYI A;  2F9J A;  3TQE A;  2DO0 A;  3HD1 A;  1TL3 A;  4DUZ J;  4NX9 A;  4ILR A;  2BRK A;  3I0S A;  3C14 A;  1TAU A;  1XQI A;  1LW2 A;  4G1I A;  4BDP A;  4NCG B;  3LAN A;  2ROP A;  1S12 A;  2X1F A;  4U8Y A;  4X4N A;  3D6T B;  2B3T B;  3CCS S;  5BYS A;  3EE3 A;  2HAI A;  3OHA A;  3FK4 A;  4O0I A;  3VAK A;  4ANC A;  4CNZ A;  1ZTT A;  4PYD A;  5KFS A;  1HNW F;  1N5T A;  4KBI A;  2LXF A;  1MU2 A;  1RQ0 A;  3D0H E;  1UMJ A;  2VG5 A;  4F25 A;  2W01 A;  1QD1 A;  1UVK A;  2DNN A;  4ZPB A;  1RDR A;  2VU5 A;  5H9E K;  1VBX A;  4TYB A;  3M8R A;  3IG1 B;  5IQQ A;  4RW4 B;  4ZPV R;  3RRG A;  1EQM A;  3BSA A;  4HI1 A;  4EO8 A;  1YJN S;  2XCA A;  4ZVO B;  1DQA A;  1WTF A;  3OL8 A;  1RAD B;  2R7T A;  2OFH X;  3EWG A;  1T9T A;  2MY8 A;  4ED3 A;  3HZG A;  3HD2 A;  1FES A;  1RTI A;  2GJI A;  3DHX A;  4HYK A;  1TMJ A;  2J0Q D;  3UD4 P;  2DGU A;  3CPW R;  3KLF B;  4AL6 A;  5THW A;  5A76 A;  3DLB A;  2V2Z A;  1TKX A;  3PJ9 A;  4RU9 A;  2MQL A;  3I0R B;  1A6L A;  2QV6 A;  1APS A;  4K4V A;  1MMD A;  4JV1 A;  2ERR A;  3PJX A;  2LDY A;  2A6M A;  4N8O A;  3JSR A;  5DS7 A;  1HQE B;  1C2P A;  4Y65 A;  3JTN A;  2FHO B;  2UP1 A;  4M5K A;  2MQQ A;  2V2Q A;  4W92 B;  3SEO A;  4BWM A;  5L8R C;  4RW7 B;  3FFI B;  1PO6 A;  2HGM A;  1KLM B;  4MT1 A;  4LSN A;  3JAM Y;  4OYW A;  2BQU A;  4A48 A;  1CJK A;  1BY9 A;  1NM2 A;  3I9V 9;  1JLB A;  2E5L J;  1PGZ A;  1K0T A;  1HQU A;  4F8R A;  2BE2 B;  2IJF A;  1OPZ A;  3A3P B;  4WII A;  1S57 A;  3W2V A;  1LNQ A;  3ISZ A;  1SJ4 P;  3PCO B;  1X4E A;  3SQG B;  4FP9 A;  4GO5 X;  4K8R A;  1GMU A;  1R8B A;  4N7T A;  1OQ6 A;  3UCZ P;  1OIA A;  4ZIV A;  4WWS A;  1FXR A;  2NR0 A;  1HBM B;  3BSO A;  2QL7 B;  2X3G A;  3GU0 A;  2CZV C;  3HVR A;  5AXN A;  1KTQ A;  4B3T F;  3QBC A;  1K73 T;  1VI7 A;  2RU9 A;  4L76 A;  3HMJ G;  3POT B;  2BAN A;  2AHO B;  5DZ7 A;  3TZW A;  4IOC Q;  3E51 A;  4X84 A;  4OI1 A;  2FC9 A;  3M8Y A;  4F4X A;  1NND A;  2E1P A;  5ETS A;  5H9E J;  3A3O B;  2WCX A;  3U7J A;  5D4L A;  1BC6 A;  4RBT A;  1IKX B;  1U2C A;  3OFG A;  3MWB A;  3BGF A;  3TVY A;  2RHS B;  4A8S A;  1GFW B;  1FEE A;  5G4D A;  4DUZ F;  2HNZ B;  1R6V A;  2CVE A;  1RAB B;  2JVR A;  2MZJ A;  1RB0 A;  1H2U X;  2XGP A;  2KT2 A;  1SPB P;  2CIM A;  3MM9 B;  3MM7 A;  1T03 A;  3TJ8 A;  3EGN A;  1UJ6 A;  3M8P A;  4N47 A;  4WJB A;  3OXG A;  8ATC B;  1N32 J;  4F3Q A;  2W9B A;  3SCL E;  5CH7 B;  4MIB A;  1RT4 B;  5CYM B;  4DV6 J;  1WHY A;  2DXE A;  2Z30 B;  3PHT A;  2W9A A;  1S0M A;  2QT7 A;  1IM4 A;  4RWX A;  4L3K A;  2N82 B;  3KFW X;  3HVT A;  1TL7 B;  1ZTW A;  2N3O A;  3NRB A;  4HT7 A;  3RU0 A;  2E29 A;  2GS8 A;  2P9C A;  4P73 A;  4U8V A;  4KSE B;  2GO9 A;  1TV6 A;  3SQO P;  3EDR B;  5T7L A;  5HSP A;  4ZJL A;  3KUH A;  4MAK A;  3VTI A;  3BKT A;  2G0C A;  4M5M A;  2B6A A;  2BXJ A;  5GAE U;  2B43 A;  2QYG A;  2IRU A;  4WP3 A;  2I8E A;  4DV4 F;  3SCJ E;  1V9O A;  4ECT A;  2OPQ A;  1EAR A;  3CJ5 A;  3L7P A;  4IKA A;  3BO2 A;  3DOL B;  1NCL A;  4WE1 A;  1NZA A;  3IR7 B;  1LK5 A;  2D3U A;  2Q66 A;  2W9C B;  3JTP A;  4Q0B A;  1F9F A;  2M2B A;  3FJ2 A;  3GIJ A;  3PV8 A;  3H5S A;  3W66 A;  3MPW A;  1FK9 A;  1ICE B;  2ZFH A;  4QZV B;  3I96 A;  2A2C A;  4ZP8 A;  3CCU S;  3N28 A;  2V9K A;  1LW0 A;  3WQP A;  1NK4 A;  4QIW D;  5EGY A;  1LWF A;  2E5L F;  3WC2 A;  5D3G A;  3M2V A;  3HSD A;  1UP1 A;  3QQC D;  1FRX A;  4ECQ A;  1N4L A;  1FWP A;  2JLF A;  2LA6 A;  4R0J A;  3W3S A;  2A0F B;  3MM8 B;  4P75 A;  4DV1 J;  2Z2Z A;  4CLK A;  2M70 A;  2HVD A;  2QFJ A;  5F9N A;  2DRA A;  5KT3 A;  4M95 A;  4ETX A;  2ZHB A;  1VQN S;  2KG1 A;  1WC5 A;  3BJY A;  4ZPD A;  5LXY A;  3DLK A;  3CJ4 A;  1TMM A;  1QVG R;  1HR0 J;  4AD6 A;  4CO1 A;  4KFB A;  1CJT B;  3M30 A;  2NPF A;  1N5Y B;  1BQN B;  3ITH A;  4GKK J;  3V6H A;  4GKJ J;  4I2P A;  2UUC J;  3M9O B;  4IQX A;  3GE9 A;  2RU3 A;  2FJW A;  4KQZ A;  5T14 A;  4OI0 A;  2RIJ A;  2BQ3 A;  3IWN C;  2B9E A;  1WKK A;  2M0G B;  2W4P A;  4QOT A;  2QL5 B;  2BVZ A;  1SJ3 P;  2QA1 A;  2V69 A;  5GMD A;  4MFB B;  2OPP A;  3BEG B;  4TYA A;  1Z2Z A;  4FNH A;  1IR0 A;  3KTQ A;  4DPO A;  5ETV A;  1NH7 A;  5IC4 B;  1WAC A;  1KR4 A;  5CD4 H;  3W60 A;  5ETP A;  1JQG A;  3CUN A;  3EVW A;  4P6Q A;  1T95 A;  2PA8 D;  4CYU B;  3Q2T C;  1TUW A;  2RQM A;  4J9L A;  3ZNU A;  3K59 A;  3QRQ A;  2LXI A;  1UEV A;  2CPI A;  1VYA A;  5A8R B;  3C16 B;  4AT1 B;  3HF5 A;  5HAO A;  3PFE A;  4OZ1 A;  5F8G A;  3IBC B;  2MJN A;  3RR8 A;  4X4V A;  3NBP B;  1D09 B;  3QSY B;  8RUC A;  4HH0 A;  3UO0 A;  2FHJ D;  3EGZ A;  4B3R J;  4DR7 J;  1N32 F;  2DGQ A;  4CO0 A;  3TJ9 A;  4NLG A;  4F4W A;  3QJP A;  4TKT A;  2HS0 A;  1S1U B;  5KFV A;  3H59 A;  4DV6 F;  4ZJO A;  4USI A;  2L48 A;  1JLQ A;  1S7H A;  1QAJ A;  5KFN A;  2FGC A;  2EBG A;  4PR6 A;  3TUP A;  4R25 A;  1W2I A;  1HNI B;  2KVQ E;  4FBT A;  1VQP S;  3BZQ A;  3CO0 P;  1VOM A;  3DRX A;  4RO0 A;  2HND B;  4JI2 F;  5K14 B;  2HVH A;  2AJ4 A;  4P7T A;  4NI2 A;  3FC9 A;  1S6Q A;  3D2W A;  5ETR A;  1FDN A;  4JI7 J;  4A8M P;  3FZB A;  1JIH A;  4DL3 A;  4B17 A;  3Q8R B;  4DF4 A;  2JSX A;  3IM8 A;  1Q7L B;  2RKI A;  3T1Y F;  1SJR A;  1EQ0 A;  1PCA A;  2PEB A;  3GII A;  3VWS A;  4CO2 A;  2P2C B;  3K58 A;  3DRP B;  3QAE A;  2CPZ A;  3D0I E;  4DR2 F;  2Z2L A;  1M5V C;  3J7Y U;  4CM0 A;  5D4O A;  2XMW A;  6FD1 A;  3FBE A;  3DYA B;  4PWD B;  4WFZ A;  1IJF B;  2OD4 A;  1RAG B;  1L3K A;  4FYV B;  4MH8 A;  4C8Z A;  2V94 A;  2WW8 A;  3OPK A;  1FKA F;  1WI8 A;  4J9U E;  2NS1 B;  1RHU B;  5LSR A;  4ZCM A;  1FKO A;  3OVA A;  1GNK A;  2CPY A;  3K2Y A;  2UVV A;  4JV5 J;  2DGO A;  2ZVI A;  2CKW A;  2L08 A;  1NSQ A;  2C2Z B;  2XWX A;  3CJK A;  4CLY A;  2UXD J;  4ES3 A;  2GQ2 A;  1CQN A;  4DV1 F;  4DU8 A;  1KON A;  2IMO A;  2ZOG A;  4NA1 A;  1QE1 A;  1FFS B;  4DPW A;  3HFK A;  1KBR A;  4C97 A;  3VHQ A;  1NHV A;  5F0W A;  3KLG B;  1RCX B;  2VQF J;  2U1A A;  3J81 j;  2FZC B;  1BQX A;  2F8E X;  1JXE A;  3KWM A;  4GKK F;  1H7W A;  5KOX A;  4EMD A;  2UUC F;  1HD1 A;  1ZM3 A;  5IQ6 A;  4P10 A;  1WHX A;  3NS7 B;  1NPR A;  3AD7 C;  3N9U C;  4GRS A;  1HBU B;  1RT6 A;  4EO6 A;  2W7A A;  3D4J A;  4B3S F;  2LQ5 A;  3BQ0 A;  3G6E S;  4CWB A;  1X9M A;  2ILY A;  3P8B B;  4LIW A;  4ED5 A;  2CFX A;  1DZ5 A;  3KJV B;  3AB4 B;  4NLY A;  2YWK A;  1PYT A;  3QWU A;  2OH2 A;  3ONQ A;  5C2C A;  2Q79 A;  4L73 A;  1TKZ B;  2MGZ A;  1WWH A;  4ID5 B;  2QMU B;  3FKB A;  3I0R A;  3VQS A;  5KG7 A;  1R8P A;  1PIL A;  3PFO A;  4DR4 J;  1S1V B;  4F0M A;  2HZC A;  1EET B;  1TVR A;  2ZBC A;  3RB6 A;  2C3P A;  3DOK A;  3R6G B;  4CTA B;  3HO1 A;  1BHN A;  3AH6 A;  2ZH4 A;  2R8G A;  1JLE A;  3LAL A;  3KLE B;  3FMB A;  1UPP A;  4B3R F;  4DR7 F;  2BYC A;  3FRZ A;  2RUS A;  2UVU A;  5HK4 A;  4JI4 F;  1U2F A;  1MSW D;  1LFW A;  1VS3 A;  5B0F A;  4J9S A;  2WB4 A;  3P49 B;  2W1B A;  2XS5 A;  3JS9 A;  1VQ8 S;  1MN9 A;  3M8Q A;  5HMZ A;  2YX4 A;  4DR1 J;  2V8G A;  1A7G E;  2CQI A;  3DLG B;  1PJ5 A;  2EC2 A;  2W25 A;  3SQG A;  3DRY A;  3DLL Q;  3BBF A;  2W4D A;  5DZ6 A;  2ZNY A;  3SYZ A;  2J8A A;  4C8M A;  4KGV B;  3FEY B;  7FDR A;  4NLD A;  5K8O A;  3WIV A;  1BWE A;  4JI7 F;  3BH6 B;  3PIO Q;  2WVC A;  4NZ0 A;  4OZ0 A;  2OHD A;  4OHV A;  4A4J A;  3DRR A;  2J9E A;  2CJB A;  4KGZ B;  2FY8 A;  3NAH A;  5DG8 A;  5DGA A;  1SH0 A;  3DLJ A;  5DO2 A;  4J5O A;  2IFX A;  4HI2 A;  4LF2 A;  1IXK A;  2K1R B;  1D3W A;  1PYS B;  3PIP Q;  5K20 B;  3A4T A;  3PZP A;  3AOC A;  1WUU A;  5IT4 A;  3JQM A;  1VLO A;  3VF0 B;  3OXF A;  1F3V A;  1UFL A;  4OYB A;  1DHM A;  1FDA A;  2J7K A;  4Z7Y A;  2EBE A;  4EU0 A;  4HHJ A;  3OVB A;  2VOO A;  3KDO A;  4UF4 A;  2DR5 A;  2HFU A;  5GAE I;  1U6B A;  4JV5 F;  1CJV A;  2G2Z A;  3IN5 A;  1WJ9 A;  4RNH A;  3EPG A;  2HNZ A;  2DD8 S;  5HRO B;  3P96 A;  1RKI A;  5GMK a;  2XEX A;  2UXD F;  2A10 A;  3B82 A;  4L6V 3;  3PX0 A;  2ILZ A;  1A0O B;  3KLI A;  1N34 J;  1FDD A;  1VK8 A;  2CQG A;  1DTT A;  4TLR A;  1HW8 A;  3M4X A;  1KFD A;  4DPX A;  2BOP A;  3PDN A;  1FX4 A;  1PYO B;  1X4A A;  3M6U A;  4WZM A;  2OLW A;  1CBK A;  1R3N A;  3T9Z A;  4KGX B;  4RNF A;  4I1T A;  3P6Y C;  3V81 A;  1T94 A;  5D4N A;  4TU8 A;  1Y00 A;  3DMJ B;  3OFH A;  2VH7 A;  4CO3 A;  4X66 J;  1E6V A;  1SKU B;  3RBZ A;  1TKT B;  4ED2 A;  2FVC A;  2WZ1 A;  4KRW A;  3P3D A;  3PRV A;  2XNR A;  2RRA A;  2EI5 A;  2L3M A;  1SQF A;  4DQI A;  3T9N A;  3PRB A;  3TA1 A;  1FD8 A;  1ZA2 B;  1HWL A;  4ENO A;  2VBW A;  1I6J A;  3RG6 A;  1O0P A;  3PTW A;  1Z1Z A;  3AA9 A;  4NYZ A;  4WPA A;  3B8H A;  1S5Z A;  3BV8 A;  4FN5 A;  3MR7 A;  3F41 A;  4ZIT A;  1M5K C;  1HPZ A;  3CJ2 A;  3NKY A;  4DR4 F;  3WZ0 A;  3GCW P;  5HP1 A;  5SUH A;  2W9C A;  4IH6 A;  3V6J A;  2GIR A;  4IRD A;  3G8S A;  1Q79 A;  4USK A;  2EW9 A;  2JC1 A;  3ADA C;  2HFO A;  4X4R A;  5HAT A;  5F8H A;  1E6Y A;  4Q45 A;  1RZM A;  3MCN A;  4USH A;  4PAB A;  2Z56 B;  1JXV A;  3THP A;  4IR1 A;  1GAO A;  3JSM A;  4ZPW R;  4MIA A;  3TAM B;  5KG4 A;  4NLX A;  2FJD B;  5GAD I;  5U47 A;  3D6H B;  2DH8 A;  3BS9 A;  2E9Z A;  3DNC A;  4MYT A;  4DR1 F;  1JLF B;  3DRS B;  3HSZ A;  1WHW A;  2AEJ A;  2EKY A;  4X4T A;  3CDW A;  1KVJ A;  4M94 A;  3VR1 A;  1LWC A;  4DSI A;  4Y00 A;  1IR1 A;  3R1L A;  5DLG A;  3AJ1 A;  2M4M A;  2OTJ S;  2CQ4 A;  1ZPV A;  1JXL A;  1MMN A;  2XY7 A;  3ET6 A;  3FSI A;  2ZIT A;  2MZR A;  2EC0 A;  3UPF A;  5ETL A;  3GR0 A;  3SSS A;  2AZ3 A;  2JFK A;  3S6E A;  2JNJ A;  4ZVQ B;  2NUU G;  4KAI A;  3M8S A;  3OTB A;  4MFB A;  1KP6 A;  1G3O A;  5FDL A;  2V8V A;  3B4M A;  3R8Y A;  4G1P A;  2VDI A;  2R7R A;  1X0F A;  4ZJQ A;  1TP7 A;  1NKC A;  5E3C A;  4KB7 A;  1YTY A;  2CJA A;  4QIG A;  3O5T B;  1WOR A;  2Y3Y A;  1SV5 B;  1H2T Z;  2KL8 A;  1UFW A;  4ZPT R;  1MRO B;  1T9V A;  2ZWP A;  3V6D B;  1X4F A;  2PFF B;  1ARO P;  1XTZ A;  4PRF A;  5IXU A;  1YSJ A;  2JWN A;  5LOQ A;  1IVZ A;  1YWX A;  2Z58 B;  5A8R A;  1FRJ A;  4ZA1 A;  3IWX A;  4RL1 A;  3GJQ B;  2RF2 A;  3HKZ D;  4FXW A;  1N34 F;  1SC3 B;  1AXQ A;  3U02 A;  3J7Y I;  3QT8 A;  2YH0 A;  2MST A;  4WFY A;  3VZH A;  3BGR B;  2RHQ B;  2LP4 A;  3LA0 A;  1F9H A;  3QRR A;  4XPC A;  2LQ9 A;  2Q6C A;  5CYJ A;  3EGW B;  2ZE2 B;  3PKY A;  1FRI A;  1EZZ B;  4X66 F;  2G0I A;  1REG X;  1CUL B;  4OYX A;  2ZWO A;  1L3U A;  4PUO A;  4R5P A;  1N5V A;  2D3Z A;  3HZE A;  1AT1 B;  3BO4 A;  1B99 A;  3QAU A;  2QLW A;  1RWM B;  3DGP A;  4ECZ A;  2OML A;  5H9F K;  4C6A A;  3PYF A;  4ZP6 A;  1HHQ A;  4MJK A;  1J2V A;  3OQ2 A;  4YFU A;  4TLQ A;  4NLV A;  2W2Q P;  2YX7 A;  3KK2 A;  4Q7A A;  2DY9 A;  1WG5 A;  1IKV A;  1U09 A;  2DTJ A;  2JC0 A;  1KOO A;  2CVI A;  2C2D A;  1HKA A;  1SUQ A;  2ZNZ A;  1NJI T;  1JNR B;  2PII A;  3G4S S;  2GMJ A;  2YVS A;  2VC0 A;  3PEJ A;  4ANE A;  4J9O A;  4WKR A;  3IS9 B;  4J9N A;  3M8W A;  3GYX B;  4A8Y A;  3T5H A;  1D0E A;  1OY9 A;  5J2M A;  2RNE A;  3C2P A;  4JI3 F;  3FCH A;  1RT7 A;  4O3S A;  4U7U K;  4K59 A;  3RAM A;  1QSL A;  2G2Y A;  1H98 A;  2UVR A;  2AJ1 A;  2N4C A;  2IM2 A;  3DDN A;  4Z37 A;  2V8D A;  3OD2 A;  4F4A A;  2GGP B;  2H5J B;  1HWU A;  4QWE A;  2GQQ A;  1FT8 A;  4JOU A;  1SCJ B;  3CVK A;  4NML A;  2VC1 A;  3E8O A;  3K89 A;  2MKS A;  3KG4 A;  2YWG A;  4ITS A;  4Y2I A;  5A8W B;  1M5P C;  1D1U A;  9RUB A;  5IOL A;  5DGB A;  3O6Q A;  3W5X A;  3CB4 A;  5DDQ C;  1RAI B;  3LP1 B;  3IFE A;  4YP3 A;  4DL0 C;  2B0G A;  1YBU A;  4HAC A;  4ED8 A;  2P5V A;  5F9L A;  2XLI A;  3LP2 A;  2YY3 A;  4IUF A;  1ZM9 A;  1JWW A;  4USV A;  4ZLL A;  2IHR 1;  2GML A;  3QJL A;  4WBF A;  5ITH A;  3MTJ A;  2IPO B;  2RSQ A;  3L4B C;  2PE8 A;  1DJ0 A;  3TP2 A;  2H5I B;  1HBU A;  2B5J A;  1SQG A;  1GMW D;  4ILM A;  4F4K A;  1ITP A;  1WC6 A;  3HK2 A;  4O44 B;  2Y0S D;  5J1E A;  1S1W B;  2VIH A;  2CPJ A;  2VFU A;  3GQC A;  2XLJ A;  1UZD A;  3AOD A;  4I4B A;  4LBP A;  1WF1 A;  1PC5 A;  3SSQ A;  1ZM4 A;  3MMC B;  4K4X A;  3VV2 B;  5H9F J;  1Q0N A;  5L1I A;  2DXF A;  1OQ3 A;  2A3J A;  2Z4P A;  3RAX A;  1FX2 A;  5DLF A;  2OPR A;  3DCA A;  3E01 A;  1RAH B;  1IWA A;  2B51 A;  1R43 A;  1WSR A;  1S9G B;  1RJJ A;  2VD3 A;  1U6Z A;  2RB7 A;  4X62 J;  1KLN A;  4AL5 A;  1Q86 T;  2BM0 A;  3KXD A;  3TWZ A;  4ID8 A;  4CNY A;  1HYS B;  2D7S A;  3LGH A;  3ZZZ A;  1Y9O A;  3PX6 A;  1Q8I A;  1REV B;  2DHS A;  4RU2 A;  4ZMM A;  4K2J A;  2VG6 B;  2KI2 A;  2R8K A;  2VPW B;  2F7V A;  1A9N B;  4RW8 B;  1CS4 B;  2DNG A;  2Y1L B;  4XDC A;  3TX0 A;  3MAH A;  2VUG A;  2IA6 A;  2VAS A;  3QNW B;  4WIQ A;  3AOB A;  3KYL A;  3GCX P;  4JV2 A;  2XZW A;  2EEY A;  3NGD A;  1U8W A;  1BXN A;  3CJS A;  5DET A;  5B0D A;  1C1C A;  3MR5 A;  3IM9 A;  5KOW A;  4JP8 A;  3I56 S;  2HG4 A;  4PXB A;  5CYQ A;  4DFP A;  1NLK L;  5E0O A;  3MPV A;  1NHU A;  1ZAV A;  2DHA A;  3THV A;  4DL7 A;  2KH9 A;  4URQ U;  3GFZ A;  2DNO A;  4X4P A;  1PBA A;  3AFG A;  1Z4U A;  1EIY B;  1U0H A;  2DNQ A;  1MML A;  1VQL S;  1VRU B;  2ZC3 A;  4OYP A;  2F8H A;  3KNG A;  2XMT A;  1HI1 A;  2NQP A;  1WC0 A;  1LV5 A;  2HWI A;  5HN0 A;  1RWN B;  4AYB D;  4FF2 A;  4OZ5 A;  2EWH A;  1SL1 A;  1G2E A;  3AXM A;  4LF1 A;  1DTQ B;  2R4F A;  1LWE B;  3AJ2 A;  1P27 B;  2UXB J;  1UFK A;  1ZM2 A;  1N36 J;  3P5T L;  4TY9 A;  1D9A A;  3SDE A;  2QZ8 A;  4QWB A;  2DNR A;  1CEZ A;  2RS2 A;  1VQM S;  2R2S A;  2LQJ A;  5ADZ A;  2JVO A;  2WHO A;  5B0E A;  3C6T B;  1WEL A;  1RTD A;  1EB0 A;  4UUW A;  1HI8 A;  1WC4 A;  4IFY B;  4D3H A;  4RW9 B;  2FD2 A;  4RX6 A;  1W25 A;  2BW7 A;  2J76 E;  2KRB A;  5F0U A;  4DS5 A;  1NPK A;  4DV5 J;  4DJB A;  5ETQ A;  4MKA A;  4FVC A;  5B08 A;  4DUT A;  1F5A A;  3OW2 R;  3I0S B;  3C14 B;  3J81 U;  2QA4 S;  4M5H A;  1LW2 B;  1HNV A;  2J9D E;  3ZFV A;  2BAB A;  2YWH A;  2D9O A;  3BPD A;  3Q8P B;  3SCI E;  2PN6 A;  3G2X A;  4LFB J;  1HI0 P;  3OFF A;  5HVF A;  4QIV A;  3FRY A;  1ZAW A;  1YX2 A;  2KXN B;  3FUY A;  2GZO A;  3Q89 A;  2M5Y A;  2QX0 A;  1MU2 B;  2CAJ A;  3R2C J;  3DN9 A;  2XYG B;  2DHH A;  4ZN3 A;  2VG5 B;  3FQK A;  5KFX A;  3CD5 A;  3NOG A;  4RR5 A;  2IIH A;  1U45 A;  4ZKA A;  5KFW A;  3ZTP A;  2FY1 A;  1FWL A;  4D3G A;  2NCK L;  2WSE C;  1Q81 T;  1U1R A;  3N4W A;  3GMG A;  2WVB A;  2FDN A;  3QRP A;  2FZG B;  1RTI B;  2ZH8 A;  2HHX A;  3SCK E;  3D1H A;  1FHT A;  1X5O A;  3OR1 B;  2O3D A;  3CD0 A;  2IBK A;  2ZDO A;  1TKX B;  2QFI A;  4X62 F;  2YKN B;  1SC4 B;  4KC5 A;  5J2P A;  3CCQ S;  1FEH A;  4LRB A;  2FIU A;  4GC7 A;  1U6F A;  2ZHA A;  1K8A T;  2DNZ A;  4OX7 A;  3AY0 A;  1RHK B;  3WDO A;  2F5G A;  3TAM A;  2RQK A;  1T0T V;  1BWV A;  5K8M A;  1GQE A;  1Y3K A;  1HIY A;  1TK0 A;  4CCH A;  4I69 A;  4LVN P;  2VL1 A;  2Y0B B;  3LO3 A;  4CLW A;  1KWM A;  4AXJ A;  5KFY A;  2FYX A;  1CJK B;  4PQU A;  1M90 T;  1V6H A;  1JLB B;  3OLB A;  2HFN A;  1HQU B;  4K4Z A;  3M7V A;  5CAB A;  4LMZ A;  2ZH6 A;  4EBE A;  3W2V B;  4ED4 A;  2V8H A;  2GHV C;  4CT8 A;  1I51 B;  5BXI A;  4WKY A;  3FQL A;  4KV8 A;  2R2R A;  2DNM A;  4DG1 B;  4OMF G;  4DI6 A;  1DAR A;  4P71 A;  2CQP A;  4AXI A;  1N88 A;  5LT5 A;  1VLY A;  3ZZP A;  4DF8 A;  4WYL A;  3ELH A;  4B9V A;  3H8Y A;  2E9T A;  3OHB A;  1JLC A;  2EG2 A;  2CNO B;  1H38 A;  4WZQ A;  3UCG A;  2FB0 A;  4V19 X;  4MMO A;  4LF9 J;  1T7P A;  5D4P A;  2BAN B;  4ECU A;  3I31 A;  2QLF B;  1AYE A;  1N36 F;  1Q95 G;  1SIZ A;  2D3O R;  3D67 A;  4W90 B;  1Y11 A;  1F60 B;  1NBE B;  2QN6 B;  4KPC A;  3T6J A;  1KQK A;  1P8G A;  3BB5 A;  1OSD A;  5E7O B;  4ZVE A;  1VRT A;  3MI7 X;  1D8Z A;  4MIW A;  3GIR A;  4IH7 A;  4Q5V A;  3F44 A;  1VHF A;  4J7C A;  1WKJ A;  5BR8 J;  3IMQ J;  3IO1 A;  3HCX A;  5KG5 A;  3V6K A;  3UWT A;  4DV5 F;  1SB6 A;  2VB6 A;  5KFG A;  2NXU A;  2ZBP A;  3A8K A;  3BGR A;  5M2R A;  1UVJ A;  4CH7 A;  3TAN A;  1YIT S;  1DUR A;  2KZM A;  3GB0 A;  2KJW A;  1X4H A;  4G6V B;  1ZAX A;  1BQM A;  4WF9 Q;  1FKP A;  4M5D A;  2RQ4 A;  3WHI A;  1U24 A;  5KFQ A;  3CD6 S;  4ES2 A;  3M8P B;  1Y3J A;  2XLK A;  4LFB F;  2VA2 A;  1C4C A;  1F2H A;  2W9B B;  1VQ5 S;  3H42 A;  5KFR A;  1XIQ A;  2PMZ D;  2KXF A;  2GO8 A;  3UVJ A;  2RUG A;  3M1V B;  2A2D A;  4F67 A;  3H40 A;  2PMW A;  2AMC B;  4NXM J;  5HBM A;  5AE2 A;  4UQT A;  3HLU A;  4EWT A;  2R7U A;  3FCV A;  1SIW B;  1WG1 A;  1T3N A;  4B3M J;  4RLE A;  5A6P A;  1RT5 A;  5LL6 d;  4UOF A;  5KG3 A;  3I4H X;  4J90 A;  3MED A;  1TV6 B;  1F6T A;  2G4B A;  2KKH A;  1U2R A;  4HHH A;  1B64 A;  1KD1 T;  3H5Y A;  3Q22 A;  3Q8Q B;  4DL4 A;  2H9Z A;  4NLQ A; 
#chains in the Genus database with same CATH homology
 1RWX B;  2CJX B;  2DKO B;  1SC4 B;  4DCO B;  3D6F B;  1RWW B;  1RHQ B;  4ZVR B;  2CNO B;  1F9E B;  1PYO B;  3RJM B;  1RE1 B;  3R6L B;  2QL7 B;  1RHM B;  3IBC B;  4LSZ B;  4DCP B;  1RHK B;  1RWV B;  2HBR B;  2P2C B;  3R6G B;  1RWN B;  2C2M B;  4ZVQ B;  2XYP B;  3KJQ B;  1RHR B;  2QLJ B;  5K20 B;  1RWO B;  1PAU B;  2XYH B;  1IBC B;  2C2K B;  3KJF B;  3EDQ B;  2Y1L B;  3IBF B;  2H5I B;  3R7B B;  3R7S B;  3KJN B;  4ZVS B;  2QLF B;  3GJR B;  2H54 B;  4ZVU B;  4ZVT B;  2Y0B B;  4ZVP B;  3QNW B;  2C2O B;  2XYG B;  3NS7 B;  2QL5 B;  2CNK B;  2HBQ B;  2QL9 B;  2CNL B;  1ICE B;  3D6M B;  2FQQ B;  2CJY B;  1RHU B;  3D6H B;  2XZT B;  2H5J B;  2C1E B;  3R7N B;  2H65 B;  5IC4 B;  2H4W B;  2HBY B;  2HBZ B;  2XZD B;  3SIP B;  1RWM B;  2H51 B;  1I3O B;  2QLB B;  2H4Y B;  2CNN B;  1RWK B;  2C2Z B;  4ZVO B;  2H48 B;  4JB8 B;  1RHJ B;  3P45 B;  1QDU B;  1RWP B;  5IC6 B;  3R5J B;  3EDR B;  4DCJ B;  1I51 B;  1BMQ B;  1QTN B;  3GJQ B;  2CDR B;  1GFW B;  1NME B;  1SC3 B;  3GJS B;  3GJT B;  1SC1 B;  3P4U B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...