2H4YA

Crystal structure of human caspase-1 (arg286->lys) in complex with 3-[2-(2-benzyloxycarbonylamino-3-methyl-butyrylamino)-propionylamino]-4-oxo-pentanoic acid (z-vad-fmk)
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
166
structure length
163
Chain Sequence
NVKLCSLEEAQRIWSAEIYPIMDKSSRTRLALIICNEEFDSIPRRTGAEVDITGMTMLLQNLGYSVDVKKNLTASDMTTELEAFAHRPEHKTSDSTFLVFMSHGIREGICGKKHSEQVPDILQLNAIFNMLNTKNCPSLKDKPKVIIIQACKGDSPGVVWFKD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title An allosteric circuit in caspase-1.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords Caspase-1
total genus 49
structure length 163
sequence length 166
ec nomenclature ec 3.4.22.36: Caspase-1.
pdb deposition date 2006-05-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1460 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2h4yA00
5JFTA 4N7MA 2C2KA 2FP3A 3ITNA 4PRYA 4FGUA 5I9BA 3V3KA 2H65A 3D6FA 2XYGA 1IBCA 4I1RA 4IYRA 4DCPA 4EJFA 4M9RA 3R7BA 3V55A 4EHFA 3PCXA 1RE1A 2H4WA 1JXQA 4DCOA 2HBZA 2QL7A 5IABA 1RHJA 2H48A 5IAGA 1NW9B 3P45A 4QUDA 4ZVUA 2H5JA 2K7ZA 4QUJA 4D3XA 1BMQA 3OD5A 1K88A 1PAUA 3NS7A 3H11A 4EHLA 2C1EA 3NKFA 5IARA 5IBCA 1F1JA 4EHKA 2FUNB 4N6OA 3RJMA 2QL5A 1I4EB 2H54A 4QUEA 4HQRA 2XYPA 3NR2A 4FDLA 5IASA 3DEJA 4QU0A 4QUHA 4AW9A 3H1PA 3KJFA 5IC6A 2QL9A 2H4YA 3QNWA 2CDRA 1RWWA 2WDPA 3EDRA 2XYHA 1I4OA 4QUIA 3V4LA 3KJNA 1NMEA 3GJRA 2P2CA 3IBFA 1RHUA 5LUAA 4NBLA 4FXOA 1RWOA 2J30A 1RHKA 2CNKA 2J31A 1CVRA 1SC3A 5I9TA 1RWVA 5LU9A 3H11B 3E4CA 3R6GA 4JQZA 3V6LA 1NMSA 3D6HA 3R7SA 1CP3A 2NN3C 3BIJA 2AR9A 4PS1A 1SHLA 4NBKA 1QX3A 4HVAA 3SIPA 1SC4A 1RWMA 1QDUA 3R5JA 4JJ7A 2QLFA 1RWXA 4NOMA 4QULA 4QU9A 3V4OA 1ICEA 2HBQA 3UO8B 2QLBA 4ZVOA 5K20A 2QLJA 4I1PA 3V6MA 1SC1A 3R6LA 4HQ0A 2CNNA 2C2ZA 1M72A 2HBRA 1F9EA 4QTYA 1GFWA 2H5IA 3H13A 1KMCA 5IBRA 5IAKA 4QUAA 2CNOA 3PD1A 3UOAB 4N5DA 1I3OA 3P4UA 1RHRA 3GJTA 3K7EA 1PYOA 4NOLA 3DEKA 4DCJA 4EHDA 2J32A 3R5KA 4N6GA 3R7NA 4D3ZA 4EHNA 5IANA 4QTXA 2HBYA 4NOKA 4JJEA 3EDQA 5IAJA 1RHMA 4ZVQA 3D6MA 5IC4A 4AWAA 2XZTA 4NBNA 1GQFA 3H0EA 2DKOA 4QU8A 5LU8A 4JJ8A 5IBPA 2CJYA 4JQYA 4JR2A 4QUBA 4JR1A 3DEHA 3KJQA 4LSZA 5H0IA 4FEAA 2C2MA 4QU5A 3IBCA 4PS0A 4ZVSA 3GJSA 1I51A 1K86A 2C2OA 2CNLA 4PRZA 2Y1LA 1RHQA 4ZVPA 4ZVTA 4AWBA 3S8EA 2FQQA 3PD0A 4ZVRA 4EHHA 3GJQA 1QTNA 2CJXA 2J33A 4D3YA 4QUGA 2H51A 3S70A 3DEIA 4JB8A 4N6NA 4NOJA 1SHJA 2Y0BA 5LUBA 1NMQA 2XZDA 3SIRA 4EHAA 1RWKA 4IEFB 1RWPA 4JR0A 4N7JA 5IAEA 1RWNA
chains in the Genus database with same CATH superfamily
3G5TA 4P4LA 4FGUA 4P22A 4Y6OA 2B5VA 3RU7A 3QWBA 4E21A 2P79A 1OC2A 2OD7A 4IZIA 2X7JA 2GYYA 4NZ9A 3RARA 1N6KA 2OV3A 3K0AB 1JG2A 1G98A 2VTBB 2X0JA 4YUAA 1Y8AA 4PX9A 3TW4A 1OMOA 2JATA 2ZBEA 3NM4A 1WHTB 4HD8A 4BN0A 1WV1A 2VRBA 1QRUA 1GPLA 1UFOA 4Q37A 1MVOA 1WUHS 1DLIA 3I0ZA 2PT7A 1NUUA 3KOOA 4LXIA 4MB0A 2V98A 4Y2UA 3ZBTA 3GA0A 3TLEA 1R0SA 3VZRA 3AVVA 4QOHA 4EHKA 4HVCA 4J7CA 2W8BB 3LY7A 5GZ6A 3UZUA 4OUDB 2QB5A 4EMUA 4FZVA 4S1NA 4BJ3A 4TPKA 2X2EA 1HI9A 4FC6A 3UC5A 3HVKA 4URZR 1XSEA 3KJFA 3L7YA 2XHEA 3DDUA 1U9IC 3EC7A 1RQLA 2XECA 1L8XA 3EHDA 2PH5A 4UNSA 4DWVA 2E3JA 3F96A 4MR7A 1FP2A 1DAIA 1E94E 3ZEAA 2J30A 2PHZA 4XWKA 1UMDB 2FMHA 1VHWA 1QHHB 3O03A 4RIIA 3R20A 3VZBA 3U80A 2E1RA 4B75A 5LB2A 3R0XA 4DCNA 1JJFA 4UJ5A 4YRFA 2CB9A 1Z8NA 1XDDA 1J06A 4DT1B 4O25A 4BU0A 1RJ9B 1D3AA 2Z2YA 4C1BA 3VH2A 5KOHB 1FBTA 3VMMA 1FS6A 1YRYE 1LPBB 2FMFA 2ZRAA 3G2QA 3ICVA 4LKRA 4PSKA 3AKYA 5G0UA 3UXYA 4EA6A 5BSRA 4M9ZA 1DAOA 2ZSJA 2O2CA 3ONFA 1RKQA 3TTSA 4DWOA 1HTWA 2CXOA 1FTNA 2Q9AA 3AY6A 5LWQA 4O2BA 3FPAA 4ZEOA 1U98A 3GRCA 4RWZA 1Z0IA 2QR2A 4IIVA 4QUAA 2ZYSA 1X3SA 1AXEA 3OFKA 2A59A 5TC4A 3U6BA 2B8WA 3KHTA 1SBQA 2HDOA 3QVMA 1SUSA 3FDJA 1P9RA 2GTPA 1ZRSA 3K0BA 5H3HA 5DFAA 3KUDA 3CT6A 3I9NA 3K72B 4XIYA 5TPZA 5HW0A 1G8FA 1EBFA 1Z7BA 3KKKA 5AM5A 5C0OE 3U7FB 2J4DA 2Q0HA 1QH1B 3CH4B 3ESAA 1N2CE 3DVQX 3PX2A 4RMHA 3DAHA 4UXJA 1I6MA 3BDAA 1QFJA 3A3YA 1M1YE 3VR6H 3ZJVA 1GA6A 1X7WB 3DFIA 3AG5A 4WMLA 5LB4A 4CRWB 4RVGA 5KVCA 2WWYA 3VHRA 2CNLA 1TXGA 4X6YA 5HIIA 3TEFA 3S40A 2IYZA 4UUAA 4FLEA 4HI0E 3CRQA 2CT8A 2EF0A 1KNQA 3I09A 3L43A 5DXJA 3DBLA 3UN1A 3BGSA 7ADHA 5I7HA 3FPEA 1HFKA 1H23A 4PC3A 3I5UA 4C4PA 2PVPA 1WVIA 4M8NE 2H2GA 3RANA 3GLIE 5KTSA 1CEXA 3HZOA 4JOBA 3SI7A 1YDWA 2H7VA 1E4EA 2V7GA 4XFKA 4AURA 5HUJA 3OF3A 1XJCA 3K15A 1DKRA 1MCZA 3IC5A 3PLAE 3IRVA 1XA3A 3JARA 1NHGA 4NHEA 1N1MA 5DNAA 5A6SA 5NULA 2GARA 1FLNA 3OQ6A 4TMKA 1GPMA 4BCCA 1GSHA 2Q2QA 1RYYA 1DTWA 2R47A 1W19A 3JSAA 4C0HA 3QF4A 4C87A 2Q1WA 3AFGA 5FWNA 3EGDB 4K2HA 5A03A 3RC8A 1F48A 2O2ZA 2ZDGA 2HHCA 2IPOA 2G04A 1JXAA 4HY3A 4QDTA 4QUDA 5EP2A 1O94C 1ZGBA 4BNZA 3P9PA 4YPVA 2RARA 4YCNA 1JAXA 1SVMA 3GEBA 4IDBA 3H6KA 4IHJA 3KVYA 1KAGA 2ID7A 2IUSA 4R6XA 3MOGA 3QVVA 5SZJA 3FRIA 3TMAA 5IBCA 1F1JA 1BX1A 3GPCA 4IO1A 4L5YA 3KZMA 4BFSA 4EQZA 1I4EB 3AEKB 3MJRA 4EPYA 1PTKA 1O4WA 3I6IA 3R9WA 4DQUA 1H6BA 2ZM5A 2AR7A 1VSVA 2H2IA 1NPYA 2IOHA 3BQMB 3HI6A 4KQXA 5AKHA 5B53A 3SC2B 3NNDA 4WBNF 4RHUA 1U3CA 1IAVA 2OO7A 2Z9CA 1GWNA 3A1EA 3TKYA 2QD1A 1W96A 1C1YA 3GUCA 1HQYE 3OJCA 1YR9A 1ID8A 1A5AB 1JVBA 1NXSA 3ZTTA 5F7OA 5HP4A 2ZYRA 2C4MA 4ZVVA 1RP7A 2MMGA 3SR3A 2BZ1A 3PJFA 2FFRA 4NPCA 3C87A 3PITA 2AG6A 4ML3A 4WESA 3C6QA 1A82A 3SBDA 5U4QA 3B78A 1C1HA 3EZGA 5A5VA 1JR4A 2I65A 4L4UA 4YFVA 1KTIA 1WY7A 5C80A 1AKRA 1PTJA 3EJ6A 4LQDA 4UZSA 3ZKAA 1DS6A 3R7WA 1ULBA 4RKYA 4J4BA 4EI9A 4ZV4A 8ABPA 3GN1A 3KSDO 5AQ1A 2YTZA 4D9IA 1T3GA 2C5HA 2WV9A 3BSYA 4N40A 1GCUA 2I6GA 4AC9A 1INLA 4PZZA 1CS4C 1DJOA 3B1WA 4PQGA 4WE3A 5K20A 1PZMA 4AIRA 3PB3A 5EJ6A 2M98A 2IXGA 3PVSA 3AHCA 3LXRA 1GFWA 4TV8F 1Y3HA 2OGTA 5JRDS 1NBIA 1P6XA 1Y34E 5HF5A 3USES 4A1OA 1N77A 2C9YA 4P54A 3ZVRA 3IP7A 1I2CA 1PS9A 2G1KA 2XQJA 3PUHA 4J3NA 5IANA 4RNCA 3CR3C 3WYFA 3THXA 1ZUNA 2IPMA 3PI6A 4MOWA 3RYTC 1XZEA 3FSRA 3T1TA 5IC4A 3DWFA 1DIHA 5JZ9A 1V7CA 2W2KB 1P2BA 3GARA 4BLQA 2IITA 1UBKS 1C0KA 2FWNA 3IPXA 1U9JA 4DLWA 1F4VA 4QPNA 3RV4A 3OQNA 1YCGA 2JNWA 3H1GA 2GUGA 4GGOA 4QQKA 3TSCA 4TSKA 3KOUA 1OA0A 1Y8CA 4URYR 3KYIB 3PTZA 3FSGD 4IO0A 4RBNA 4TKMA 1DXOA 1YQTA 4TT3D 4E08A 4R2IA 1WQ1R 1G3IA 4MVXA 2JFHA 5BQXA 1QHYA 1G7RA 5JNVA 1LBQA 3K8QA 5CB6A 3PYMA 5TIIA 1OV6A 4HQFA 4BY9E 4JLKA 4B8WA 2AMJA 4YCLA 5IVHA 3OTHA 3ZKWB 2DPLA 2MDTA 4FCVA 4DV5B 4CFSA 1EH5A 1NSYA 2E5WA 4N3CA 5CW2A 1ZITA 1Y8RB 1XRSB 2FFBA 3EZXA 1P81A 4N7MA 3R7LA 5J2TB 5BURA 5EHZA 2X7HA 5D84A 4BB0A 5M04A 3ZNPA 1XDUA 1YXMA 1W1UA 4KQJA 4RELA 2P4HX 3TTUA 1C29B 1HETA 1KK2A 1CLUA 1SKUA 1T5OA 1T8WA 1TD1A 1UMKA 2CFSA 1N9GA 1NXXA 1PKXA 2AN9A 2W4IA 3HNRA 3N76A 3R5TA 5A71A 5E9QA 3DJYA 5AUQA 1UWVA 3FFXA 4QDUA 4WY2A 4B85A 3O8DA 4I14A 4KFRA 2P78A 2F1HA 3MTDA 4MQFB 5AHRA 1OLOA 3M5PA 5BWNA 1P0IA 1PQ4A 1UBUS 4J0KA 3PC4A 1XU7A 1SKBA 4WADA 4DJAA 5CLJA 1WCYA 4W7HA 2GILA 3GMDA 3IE0A 1F0KA 5TNXA 1XMPA 4X1OA 4C0BA 1PE0A 4QICA 2BFDB 3MWEA 1Z4IA 1MB9A 3UFBA 4FYPA 3FCUB 4AXXA 2QM0A 4OXRA 3E9QA 3SXUB 3OSZA 3L84A 2BMJA 2WU1A 2ZSUA 3L4BA 3ZWVA 4CKEB 2PRSA 1WEHA 3SG0A 4X8OA 3H4TA 3A1CA 1SVWA 1H94A 2PMBA 4X66B 1VCIA 3GP3A 3TYXA 2CDRA 1PKEA 4FKZA 2IX3A 5D3ZA 2VP3A 2Z6AA 4KO1S 3KSZO 3T15A 1II0A 1RHUA 5DV9A 1USUA 4LOHA 2P3SA 5CMLA 2X58A 2PGLA 4FFPA 2A9OA 5E4JA 5AQEA 1ZK1A 2ZIXB 4UBNA 1BJRE 4M83A 5FYDA 1K4YA 1W5SA 2QR5A 2YFKA 3LH5A 1SULA 3T1HB 2F64A 3PDJA 4LY0A 1YZKA 3TNJA 4DSTA 1UMCA 2XSZD 4NQZA 1LV7A 4B2LA 3R8FA 4ZAYA 3W5UA 3HJBA 1HE2A 4RAQA 4HAXA 2VWGA 4R68A 3ZHRA 3FN4A 3GT4A 1GVHA 2XRMA 3BWYA 4WFIA 2E1PA 4OYYA 1FRNA 1ZJ4A 3B5EA 1JG3A 3EK2A 3JQ6A 5FI3A 2ID8A 2NUPB 5DK4A 3QQPA 4N8DA 1K5GA 2I3DA 3FYDA 4G9EA 4X62B 3X2SA 3HFJA 5GWXA 5J2UF 3WLRA 3JZFA 5C32A 2Z6QA 3W4KA 2IBSA 2RH4A 3I53A 5A1JA 4JLJA 1U0NA 2ACWA 4M0FA 4C6HA 2ST1A 1Y9DA 1WB9A 3OA2A 2F7SA 4OK5A 3T06B 4FHCA 2P0AA 3WFIA 2ZEJA 3R6TA 2A9PA 5YASA 1P0PA 2FW1A 3TZQA 3FNEA 3M6VA 1QOZA 4I3FA 1ECCA 1SCUA 2YIDA 3L6EA 4NBRA 5SZKB 2QXTA 4EX6A 1AKVA 2VH2A 1BFUA 4XXHA 4QZVA 2VTKA 1O5IA 3REFA 3A32A 4GPAA 9ABPA 1U7UA 1FBNA 1YE5A 3N59A 4XOIA 5DX8A 3RKSA 3TD2A 1W34A 3BXOA 2E2WA 4YN3A 3IBGA 5HGXA 1K5DA 3I61A 1C30A 1MAVA 4IL5A 2HIMA 3M1IA 2P0YA 1C80A 4RGBA 1OR8A 1G17A 2NZUG 3ZZUA 1PLLA 1CVIA 2OP1A 2PSFA 2FSSA 3GFPA 1VIAA 3P4YA 1G291 1UJMA 3ROFA 4BKRA 2OBMA 4WXYB 5JE8A 4C6TA 5LQUA 1SBIA 3CGWA 1V1RA 2ECQA 3KTOA 4N54A 4YQFA 1RAHA 1NF8A 5A04A 3FI9A 1XZNA 1Z4QA 2ORIA 2QN1A 1XCGB 4C0KA 1JKMA 3IJRA 1ZI9A 2B92A 1G5FA 2I66A 2Q1TA 3E9DA 3LW8A 3IEMA 2H8KA 1MENA 1HKHA 1SB8A 2ZBGA 3QLJA 5BSEA 2EQBA 1GSOA 1L5HA 3TE7A 1KJYA 2E4YA 1AC5A 3DOCA 1UZNA 4BFTA 5ALFA 4CKZA 2IDZA 3FB1A 1V5EA 3R76A 3NGXA 4IDFA 5T4EA 4EO4A 2J85A 4RMGA 1P6QA 3UCXA 4EPRA 2HCJB 3R5FA 4WOJA 1PI3A 4ALJA 4PIMA 1PJLA 3D3KA 5CRIA 3TW8B 4RGYA 4C43A 3FPBA 2SICE 1EVQA 1HV8A 2VAXA 1WE2A 1UODA 3TCXB 1GAWA 5AUNB 1UOEA 3L0SA 4EEKA 3IPCA 5CDUA 4G6ZA 2O0JA 1RPZA 2PZFA 5CFQA 4G0NA 3PA8A 1MIOB 2RAVA 2YIVX 1OXSC 5I6DA 4PN3A 1CFJA 2XY4A 4DMGA 1MFZA 4RTRA 1YZQA 3QF7A 1NNLA 4ER5A 2H3HA 1X74A 5JADA 2FPMA 3GPBA 4J03A 1P7YA 4H6PA 5KQGA 5F3DA 2X19A 1A96A 4L5JA 3ZHCA 4QG7A 4QBGB 5CD9A 1TJ3A 3RS2A 4TTQA 3CM0A 3V97A 2QLFA 4PGHA 4L4XA 3WMEA 2BD0A 2BEWB 4A23A 2JPDA 1JFRA 2ZJBA 4AJIA 5JR3A 4D0RA 2HJVA 4FYMA 3GLRA 1JYFA 1CY1A 2FOLA 2I2DA 2ZSBA 2NT4A 2ZBFA 3BYZA 4RVOA 2ZR7A 1JLRA 4DV4B 3AESA 4UEJA 3K4HA 5AUPB 5IFLA 2F9FA 2Z4SA 5K03A 3FF1A 4HNQA 4XKJA 3ZKWA 1WD7A 4KG7A 1SVUA 2Q1SA 4Q00A 3C3DA 1P1RA 3ZGZA 3A10A 4P32A 2PS0A 3JR3A 3G2MA 4G4IA 4B40A 4WJKB 5DTJA 5A4JA 2JFFA 4NOKA 1KI8A 1L5OA 2HU2A 4DUPA 5MFPA 4OM7A 1ZCZA 4LSMA 4R84A 4HP8A 3H83A 2B82A 3UIEA 3L0IB 2UXBB 1XVAA 1AKYA 3F3KA 3JQ8A 3KKOA 2Q6TA 1F0YA 1XMIA 4PHGA 5JD3A 3KOZA 1ACMA 1RI3A 1WG8A 4UC0A 2PSHA 4QU5A 4J43A 4F3TA 1NX9A 3CSDA 4EPTA 1L6IA 5JIBA 2OPHA 4RSMA 3D2AA 3PL1A 3GLKA 5FOQA 2PJRA 4MUHA 4K0RA 1ZESA 4RQBA 3KNZA 3GLSA 2HLDA 2Y6VA 5FBKA 1S89A 1SQFA 4RA9A 1HKUA 1KMMA 1AUVA 3HYTA 5F33A 3WB9A 5DBOA 3ZZNA 3PJEA 4LGVA 1KI3A 3KD2A 4LZAA 5ANRB 2C7VA 3HXPA 4QPJC 4I2VA 3AFHA 1XA0A 2BEUA 3THYB 3NH9A 2YHIB 2R60A 3ET5A 4M98A 1M7BA 2MYNA 1IY8A 2R00C 3WQHA 4C05A 1R4NB 4X24A 4X1KB 1LBEA 5EE3A 1S0UA 3CYFA 1PEYA 2P62A 2XQGA 1XTPA 2C42A 1KI9A 3HCPA 4FJ2A 4MYDA 3WO1A 1X1QA 2WTXA 2XWPA 1I30A 2C5FA 2C7PA 5SZIA 2GEFA 1BDIA 5IN5A 5FUQA 5HF8A 1X7ZB 1N0WA 2Q41A 4BPBA 3OY7A 5SZHB 2J5XA 1TD9A 3QI2A 4FYIA 2TS1A 2CE2X 1AM4D 3JVVA 3R5HA 4LC0A 4Q39A 4RDXA 3LUKA 1E9DA 3I37X 4HKTA 4MZDA 1NNUA 4ASUD 2J3MA 2Y71A 4NFSA 4KIUA 4L0DA 4WBNB 2LGJA 1EFVA 1EP1B 2D2FA 5EJ5A 1XD2A 4HAVA 2O8BB 3IQEA 4LUCA 3WE7A 4YAUA 3SIWA 3GGPA 2QR3A 1U5CA 3VHXB 1I7DA 2A5JA 5AI5A 4KR3A 2HPHA 3VDMA 4JT8A 4YECA 3QG5A 1XZFA 3P0IA 4GP6A 2HA2A 3ZDQA 2O3SA 2VUUA 1CVRA 3FKQA 2Y1CA 2YW9A 4PXAA 3HDGA 5LU9A 1YL6A 2A0KA 2OZKA 4MRNA 3KKZA 4WKOA 4TYYA 1FA9A 3NH6A 4BFUA 3TQHA 1Z88A 5ECGC 3V6LA 5LQMA 3FOCA 1QV9A 3GRAA 3ORHA 3TZHA 3UNXA 2GJAA 3HJHA 4DBLC 4CM3A 1EDZA 1CP2A 5KSPA 1QKKA 3E84A 4AVYA 5A5DA 4XYLA 4M9UA 1MQAA 2NLOA 3UJ6A 5KYGA 4RHEA 1YRAA 1M6YA 5TEVA 2Q9CA 2YZKA 3UTDA 5CM2Z 2RHTA 4BAGA 3M6FA 3C6BA 3TKLA 2VYNA 1CDZA 4KMRA 2ZSFA 3AI3A 4B6QA 4DNXA 4BQNA 1W93A 3RVKA 3HXOA 5DMHA 1FUIA 5G4KA 3QVGA 2G6TA 3AL0C 3KG2A 3R8CA 1IVSA 2BLNA 1GFZA 2R1ZA 1IMOA 3R74A 3T5PA 2EFYA 1GRNA 2BOVA 2FCRA 1DIAA 3HYSA 4TT3A 5H4GA 3R5KA 4P7GA 2GVZC 1L9KA 1ECBA 1UFKA 1W4ZA 1VI6A 3ZIAA 1Z22A 4L1KA 2ONZA 4PLGA 3GJ8A 3MUFA 4QPPA 1SXPA 1RXEA 5KZMB 2QHXA 2C5GA 9GPBA 1OUMA 4OGFA 2H3EA 4JVLA 1J8FA 1CQJB 1E7YA 2VK8A 3OURA 2GETA 3P9RA 4DEYA 2E85A 1PR1A 4K8RB 5CB4B 5JTUA 1K66A 5KTRA 4F6RB 3JW8A 1VXRA 2QVLA 4QEDA 4B3XA 1Q44A 1T26A 2YVUA 4QWMA 3WGLA 4C29A 4CF3A 4CMIB 4DAOA 2I33A 4BNLA 2BFDA 3GFBA 3MWEB 2Q29A 1YV9A 2GAFA 3OOEA 4IDEA 2H4XA 4UAJA 4CM9A 2IODA 5T3UA 4E03A 4P34A 1PDWA 5LQJA 3SBXA 1BE1A 3IQHX 3X1ZA 4O4HA 4ZV9A 4II3A 2R44A 1D4OA 5ALMA 3CTPA 4JBXA 4UARA 4ENSA 2W2KA 4DTIA 2NXNA 1E3IA 4LJ7A 4WZAB 4B6EA 3IKTA 1FFEA 2PBLA 4LS3A 3SPXA 2P65A 3ZDZB 3Q6NA 1YRWA 1P4RA 1VHLA 3P2MA 4ZOLF 3VKWA 3S2EA 1IN5A 3T99A 2GBIA 1AK9A 2RJNA 1ABBA 3SMVA 3T1QA 4POOA 1HC7A 3N2KA 5ALDA 4KO8A 5BN3B 1A9XB 2AF4C 4KQ6A 1U0HC 3GT3A 1O6FA 3DR5A 1YB6A 5IMBA 3UENA 5IM4A 4QJBA 5ALSA 3RJZA 4LJ5A 4AKIA 2HDNB 2A30A 3O38A 5DMXA 3GIDA 1IY0A 3AUFA 1Z45A 3CUSA 1FYXA 1GG2A 3UHJA 4DYDA 1AIPA 4YJGA 3BB1A 1K5PA 1RBZA 2IYEA 3GVCA 3FYUB 2MSEB 1N2ZA 3TQTA 3ZQ4A 4G0MA 3WGUA 5JFGA 4JI4B 1Y80A 2FV8A 2JC3A 4UNIA 5H02A 3D0RA 5D8DA 4W5QA 6REQB 2OSBA 5F5NA 5M5BA 1Z0FA 3NGMA 4NH4A 2AW5A 3LK6A 2WG0A 4NU0A 1N5KA 2XMCA 3RVSA 1N3BA 5T4FA 3L1IA 4A5OA 4IZOA 3A9VA 4IUDS 4TUYB 1MIHA 1Z7EA 4OD0A 3UV7A 3DONA 3SP1A 4Q3EA 4HAYA 3V4LA 3WADA 1U63A 1AQ6A 4CN8A 2J3HA 4TOIA 3W7AA 4I8IA 2A9JA 2I99A 4UU8A 3RT9A 3JAMA 1W29A 4QYTA 3E35A 4UM7A 5CVVA 4KXNA 2Q7DA 3FTFA 5FTKA 2NOAA 4WWHA 1GADO 4RJTA 3EARA 4Y2SA 1KPIA 3PUIA 1V3VA 3Q6IA 4C0JA 2EDAA 3EHEA 1JFSA 2HYDA 5HCUA 4BVFA 3GNQA 4HNVA 2XF8A 3ZNQA 2YQ4A 1NU6A 2M32A 2ATEA 4M46A 2PU5A 3GEIA 2OOKA 3IMGA 5JXWA 5GADl 5AJZA 3ESQA 1IOWA 3OPVA 1ZPDA 2J3IA 3EVTA 2WF5A 3W4IA 3KUKA 4B6PA 4BO1A 4C88A 3WY9A 5JS6A 4IUCS 4QNRA 4DL9A 2NT3A 3J81A 2UYGA 4Z0TA 3LO5A 2GHRA 3G9ZA 4FGLA 4QYMA 3P2EA 3ITKA 2VVTA 3KV3O 4KCGA 2XCLA 3OZFA 4P58A 1Y4UA 4WXEA 1OZ0A 2OSVA 3WX0A 1SCUB 3SQOA 2AOTA 2ZCVA 4U7TB 5AJTA 3RVRA 5B58T 2PWYA 3BQNB 3MNFA 4PM4A 5K1ZA 3S5UA 2HPVA 3KJXA 4Q7MB 4HTFB 1H1LA 3SDSA 3TI9A 1KIMA 1AF7A 3GMIA 5JYBA 1ZN9A 3BJRA 3OJOA 2YY5A 4WAUA 4Y7DA 3EPJA 1UAYA 3SHWA 4MAMA 2Q3JA 4MVJD 2P9JA 2QX7A 3GA5A 1F38A 1EXDA 1OX5A 2OPBA 3RT1A 4CFZA 4ZC8A 1MJGM 1I51A 3INGA 4KB5A 4AM8A 1Q3TA 3GVPA 4AG6A 2XZOA 3NUZA 2E6UX 2NUPA 1CX9B 2VH1A 3DMTC 3Q7SA 2NVUB 5JNRA 3RVBA 3EEFA 3EGDA 3WGVA 2QYHA 3BMNA 4UFPA 1S4MA 4YUWA 2W5UA 3EGIA 4G5HA 3U4QA 2GCNA 3CIFA 1W5AA 2F3PA 4H6VA 4CL2A 4FKBA 3RAFC 1MTZA 2IOFK 1B0PA 1IBMB 3L8ZA 5DW0A 1FMJA 1HL7A 2JIOA 2YY6A 4IV8A 2AMYA 3FVVA 3EC2A 4XD2A 1EP2B 2W2QA 4CR8A 2C5LA 4NZYA 1IBRA 1WWKA 4YK7A 2APJA 3TM5A 5FPTA 2HJHA 4IIJF 5B58C 2RGRA 1QPZA 1SFRA 4EKIA 2YWHA 1JHQA 2BMDA 2VQ3A 3MJ4A 2X5NA 4RHFA 3CRNA 4Q4HB 2KW5A 5JJKA 2YZGA 2NV0A 3NWBA 1VZ2A 3KQTA 4X3OA 3O31A 2JDIA 4OYLA 4GSKA 5DP1A 2VNAA 5JATA 4JJIA 2DR3A 2OVBA 4R3UC 4GKJB 5F1OA 2XGMA 2BM0A 4P3OA 1L5GB 1T2CA 4DR5B 4LHSA 1H0KA 3RVJA 2HNAA 2NO7A 4HDSB 3CLRC 3GB9A 4RSHA 1XHLA 1ZZGA 2FHSA 3ORFA 4K6OA 1XA4A 1K92A 5KB3A 1LK7A 4CM1A 1IMJA 1JS1X 2AFVA 3BBLA 4Y9UA 3NHLA 3P4XA 2OHXA 3ZUPA 1YBAA 2TECE 4HC4A 1U3VA 1N8NA 4DV6B 2YWCA 2YVAA 1F1BA 4FDLA 3TUZC 3WLPA 1OWOA 4KLCA 1C7FA 1YDGA 1FNCA 1SZDA 1XZLA 2QN2A 3I9OA 2YYZA 3QEAZ 5IC6A 2FK8A 1VG9B 3L0DA 4DN6A 2MYUA 3HDHA 2ATIA 3FGNA 2VEOA 1OZHA 1BHJA 3T7SA 4AY6A 5D00A 2PO5A 3EEIA 3OZXA 5DCLA 2J08A 4H7JA 4NPHA 5DCYA 4UTOA 5ICEA 3PUVA 2A9RA 4COKA 2QTBA 1M34A 3KL4A 2GRAA 4W5HA 4LYJA 5ED0A 2CL7X 4JBGA 5CBKA 1PT9A 3NDBB 2CYAA 1X7GA 3A4MA 1G38A 1QXSA 3GJZA 1J1IA 4FR0A 1JN0A 3SYMA 5FLKA 1Y0BA 2IOQA 2O7RA 1TGVA 5JSZB 1OB5A 1AH2A 1G3RA 3BCHA 3EB9A 4XEHA 5LJLA 4M37A 2Q5QA 3AM1A 3L8HA 3FY4A 4K9PA 1CR1A 3S2YA 1K9SA 3UO8B 2B69A 1IOLA 3D1VA 1JHYA 2BMEA 2RBKA 3EMKA 3NIFB 5F1KA 1EQ2A 4GKBA 3FFAA 2Y8EA 5JOQA 5I3CA 1M72A 5E6RB 5K8UA 2F3RA 3TL3A 4MWCA 2KJQA 2R8RA 1SCAA 2V97A 3ND6A 4UMFA 2PWZA 2QY9A 2XNCA 1E1QD 3OY2A 4CM6A 5HZGA 4A91A 5CB0A 1M76A 1ZA1A 3TTYA 2FW8A 1U7WA 5AK3A 5KNCH 1QAMA 4KE9A 1A71A 3M6UA 1XOIA 4BQIA 4MV5A 1A2OA 1RAGA 3KYCB 3BVPA 3BFVA 3IBSA 1UEIA 3I05A 4ZT6A 3AETB 4EDHA 1UOQA 1A1VA 2C5AA 3CNBA 1U5BB 4BMNA 3MT0A 2QUAA 4QDXA 2VSNA 4FEAA 1CQJA 3NJ8A 4CKXA 4R7TA 4PS0A 1W46A 3T8YA 1NVUQ 1UDRA 5K3FB 1M9NA 1U0SY 2HRBA 3WL8A 4QPCA 2OK7A 2X1MA 3ITEA 4TZ0A 2BH9A 2FG7C 5ALXA 5JVDF 4BE9A 4QJ3A 4TKLA 4JQSA 3C70A 3M81A 5FBZA 1CUCA 1NXPA 3AP3A 4Q7KA 3RM3A 3X1YA 4BKMA 3VJRA 3DSRA 4BNKA 3D7LA 4BASA 1L0BA 1H0SA 1S7GA 2PN1A 1P1BA 1BX3A 1XFAA 3JD4A 2OHJA 1JEEA 1MB3A 3PP8A 4TQAA 4UFOA 1PSDA 4LPKA 4IINA 5TQ0A 5JT1A 4HDQB 1JL3A 4ID9A 4D25A 1T5HX 1W85B 2ACKA 4S0XA 4DR2B 1I4LD 2AKYA 2GS9A 3COZA 1CY0A 2VHTA 2FKNA 2GR9A 3GLQA 1YQ9A 3IESA 4P7BA 4E5DA 1FX0B 5ITSA 2RHRA 1R88A 1A8PA 1Q84A 2DHDA 2W6CX 1PP4A 3HJGA 3P9CA 4IVQA 2BH2A 1EEXB 3ECCA 2Q6KA 3WIDA 3BM5A 4LOIA 3RS8A 1USKA 3DTVA 1KEUA 4EA7A 5KMGA 3OHPA 1R6BX 3EXG2 3F3MA 3IB6A 3LE8A 1KZ6A 4HYTA 3R75A 8ADHA 4JWKA 5LNK6 1UZLA 3MRVA 3QFHA 1I32A 5I7EA 1P0QA 3J81k 1AGYA 3MBIA 1L7NA 4YDHB 4Z86A 4ZCTA 2JIZD 1TPZA 4MS3B 4QJ4A 3RO7A 5GVSA 2XCOA 3NC1C 3ZE2B 4FSHA 2GUWA 5IH3A 5C51B 3QUCA 2BCJQ 3RFUA 2YXDA 3WZMA 2IYAA 3QV2A 3LPLA 4ZYWA 1BZYA 3E7DA 3FCEA 3KALA 4YYZA 5KX5A 2BUCA 1GZHB 4GU5A 4GO1A 4HSEA 4XJTA 2PMEA 2E4AA 2Z83A 1Z25A 4R9SA 1L1FA 2ODQA 4L7VA 3HB5X 4HEA1 2B3DA 3A36A 3OT1A 5K2MA 4BV3A 1F2UA 4CL3A 1H1TA 2C4TA 3GLHE 3MAJA 1KE2A 1UDCA 4ND1A 1SO8A 4ZYTA 2D5CA 4KBYA 1OLXA 2PX3A 3LWDA 3QFRA 4DJ5X 1R0BA 4IMIB 4LTNA 4KMSA 3X1JA 3M3DA 4WXMA 5CVDA 3KPYA 3FHLA 4YAEA 2JD0A 3TFWA 5C9ZA 2IUYA 1EX7A 2HSWA 3PVCA 5K0SA 3OQ1A 4ESVA 1OX4A 4FHFA 4LBZA 5DTEA 1VIYA 4UAVA 3WKBA 2CV1A 8ATCA 1S6YA 4GBJA 5K0FA 2ZITA 2DWQA 2UUCB 3M3PA 4G0QA 4LMAA 4GG1A 4WIAA 1U9ZA 4M3NA 2GDJA 3C0KA 4YRMA 4EI7A 3EZNA 2KYRA 4XGNA 4HRAA 4F2PA 5BT9A 3R7FA 4B76A 1RM4A 1ZD9A 2D7DA 4EF4A 4JHLA 3ZYZA 2G4CA 2HT6A 2X2PA 3IQZA 1NMYA 4MLZA 5BWLA 4URXR 1YD7A 3V8VA 2V6MA 2XKJE 2BTQA 4LRXA 3RBVA 2BDEA 2PZMA 4KGZA 3DDCA 1CSEE 4DTCA 3TZLA 4PHTA 4RCVA 5HQJA 1JDTA 2N75A 2DTEA 1KGSA 1N1DA 4Z2AA 2R5WA 2QTMA 1GAJA 3M4YA 1WXHA 3HO6A 1E59A 1U7PA 4EG3A 1W4BA 5E9AA 4RCYA 7MDHA 1NSFA 4NC9A 3OZUA 3PUJA 3O9VA 1OPRA 4BVKA 2Q27A 4XLZA 3IE1A 2VBFA 4N18A 5AWFC 2FH5B 1AKQA 4CF4A 4F0JA 1ZA2A 3IPLA 2AK3A 2JB9A 3JTMA 4J1TA 1K8ZB 5BYJA 2C58A 4GECA 1O7JA 2FZEA 1NUTA 1M7GA 4U7HA 4ZOLB 3UJAA 5JFTA 3JVIA 1Z2PX 2Z98A 5G1PA 1R6UA 2CBZA 2OB1A 4RAOA 1CJMA 3ZV5A 1JDBB 3L8YA 4YRLA 4F56A 4FONA 1W88A 1KE1A 1RMTA 3H2HA 2IXAA 1RHJA 4OCZA 4Z4EA 1QM5A 2AFIA 3MS4A 1Z6QA 4HNSA 3SR4A 1CHNA 1U2PA 2I8LA 2Q50A 3HVJA 1XTSA 4IDPA 4AXBA 2AX3A 4C4AA 4OXYA 3AY7A 4Z6KA 2JBHA 4ZTBA 3B89A 3UV3A 4P0QB 3PHCA 1YIDA 1NOIA 4CF5A 3C6KA 3VKFA 1V6SA 2AEEA 1T6ZA 1B00A 1I4DD 1MB2A 2O7VA 3GUZA 1Y48E 1SZJG 4IWNA 3LO8A 4J1TC 4Q12A 4W5WA 1GO2A 3VV2A 1D04A 4FZ5A 3B2QA 5KJ6A 2R8BA 5AHOA 4E5NA 1K7FB 1RYZA 2OGZA 1QFZA 1JAIA 2NPOA 4BECA 1UJ4A 4QTUB 3RU2A 5B4TA 3TUJC 3RAGA 1UP7A 4LYHA 2VO1A 1T91A 3HDQA 4FDMA 5ALHA 1OZGA 2E7ZA 4J8PA 3NONA 4C9BA 4TMZA 1NRXA 4G5QA 3PXCX 3IAUA 4IGEA 1K68A 4EKEA 1N1EA 2AD5A 2E4UA 4AUNA 1KR5A 4RK4A 1XZ8A 2ANCA 5IULC 3COPA 3B7GA 1DBQA 1T6XA 3IE2A 2ZW9A 1M5UA 1RHKA 3RBZA 3S99A 4CMJA 3ZZTA 2PJUA 3A4TA 2AN5A 3ZQUA 3GJ0A 5HBGA 3SQLA 3W5BA 3A9RA 3JWGA 1D7OA 3OJLA 2VRCD 3F8TA 3LHDA 1U8XX 1ZM3A 2G7MC 1U4OA 5AD1A 3MRTA 1EFVB 1XDGA 2F00A 3PQ4A 5HR5A 2EVWX 2FR0A 3MINB 4CGYA 1EKXA 4XPZA 4DW8A 3S8MA 1RWXA 2A0WA 2UZ1A 1DUIA 4OSPA 4BV2A 3VU9A 1VA5A 4FCCA 3M5CA 3T41A 1THGA 2BWJA 3OQIB 5E7QA 3MBKA 2QM7A 1M1UA 2IDKA 4YCDA 2IPXA 4QBFA 3UAVA 3KELA 4PF1A 3RC1A 4V1CA 1ETHA 4ZT7A 1YKFA 1SXQA 3UUFA 4KNVA 1IOVA 5ALNA 5C8XA 4ILEA 1HNXB 4L85A 3DTVB 3UW1A 1PW5A 3OFVA 3UT6A 5JH7A 5BXQC 2XXAB 1OVMA 1ZMBA 2N47A 1GU0A 1ULAA 3FRHA 2W0MA 3GROA 3ZZ0A 4DS3A 2BYTA 2BFAA 2EWVA 2NXJA 4KQKA 1WPXA 4GMFA 4MZXA 5KOJA 2NADA 1UBMS 3IV7A 4PSDA 1BH2A 5FL7A 4HMOA 5DK6A 2IYFA 2R62A 3WNZA 1E64A 2VS1A 5AUOB 2O7SA 4MCAA 4P4TA 1QC5B 4DY6A 3UV6A 1Z26A 3DE0X 1DBPA 1U7TA 3HKBA 1JYEA 3M70A 4Y9TA 3DTVD 4PRZA 2WAXA 3FPKA 1MQSA 2DCMA 1OLSA 3BAFA 3ELYA 1OILA 4QGBA 3I9MA 3PQ2A 4V38A 1P2VA 2ARKA 3LUHA 1EXNA 3BEDA 3QKSA 3F2IA 4G5OA 3RG8A 3ZY4A 2PLFA 2PBRA 3BGVA 1I3KA 1H5QA 2YZ2A 3QEOA 5CDGA 2DB3A 3WOHA 1U94A 1M2VA 2XUPA 4DNOA 3WWOA 2PKCA 4LNUA 3S1AA 4J16A 4BFCA 5CTAA 1II8B 2D0PB 2V54A 4RVNA 4AULA 4BTLA 2XRYA 1KJJA 4D81A 3L0BA 5B5SA 2NIPA 1MC8A 1SA0B 4XYEA 4UPEA 4UQLA 3CJQA 5IK2D 1A50B 3Q87B 2J5RA 2QQFA 4EVQA 5AVWA 1Q1BA 1P1CA 4HJRA 4KPFC 1DJQA 1M10A 3IPYA 5IDVA 1P33A 1WB4A 3ZBUA 1YVEI 4WOCA 3A6KA 3E22B 4M36A 5JG7A 3VBCA 3A1WA 4WNYA 1VKHA 4MVCA 2FLKA 1DJLA 1ZC3A 1OROA 1NW9B 1P60A 1X42A 2XMDA 2YS7A 4LRUA 4S1PA 4X1YA 3WBBA 4MQFA 1TZMA 4BQEA 1ZOPA 4NCAA 2RSLA 2VTEA 1WZEA 1NM5C 1CJTC 1YRHA 3UMJA 3KBOA 4NMHA 1S3GA 1HDYA 1W88B 1STOA 1XMSA 2BCEA 1Z4LA 2KMLA 3PNMA 5EIAA 5KU1A 4PCAA 1X9IA 4ZQFA 1IN6A 4H7DA 4EJ2A 3P20A 3M6WA 4K46A 5BW8A 4LMRA 2HYIC 1ZNZA 1OI4A 3I3SR 2VEDA 3OQBA 4TWIA 1F8FA 3ANMA 1NWCA 4ARBA 4FFNA 1TAGA 2JEZA 4YJ2B 3GA7A 4E22A 2YZMA 3A4YA 4GI5A 2B20A 2CJPA 1A5BB 1OAOC 2I8AA 1U5AA 2WWIA 4UDYX 3WLMA 4A9AA 2Y1OA 5B12A 4ERNA 3HQ4O 3ILVA 3B9PA 3QI7A 3W5HA 2ZUEA 3VV3A 4TMTA 3WMRA 3B1FA 2O2XA 1XZIA 5KYXA 1CULC 3JQAA 3Q1KA 1A9TA 1ZRNA 1YS7A 1DZ3A 3STYA 1NBME 4CU5A 2IQ5A 3EMVA 2OR3A 3LK7A 2AJLI 2IP2A 2QJOA 2RJ3A 3RRBA 1ZIOA 1T4CB 3D3WB 3WA6A 2VWQA 1VRVA 3WGYA 4A0QA 3H7AA 3AM3A 5LYYA 4LF4B 1R12A 3HJUA 3NHBA 2DETA 3CRVA 4FYJA 5BPHA 5AW2A 3AEQA 1TVKA 2PGJA 4KRYA 3T52A 5KS2A 3BWXA 3TG8A 1YFLA 3ANSA 2JFVA 3N7TA 1TUEA 4Y2XA 4GLLA 1CUFA 1Z2NX 3TTTA 3DMRA 3WMXA 1RNLA 3ZTWA 3HA5A 2C3YA 1CJKC 4OJTA 1NJGA 4X7RA 3MS2A 3WK8A 2R86A 3RG2A 1YE8A 2PIDA 3HBLA 3AR3A 5JAOA 3JQEA 1GL6A 3KD3A 3MRXA 4LZLA 3ZWWA 1ZI6A 5FI0B 2RG7A 1QTRA 3UWKA 5KYYA 4RV5A 4CV0A 4EB8A 2ZJ6A 3M6LA 3AHEA 1GILA 4MGEA 4DMLA 4W5OA 4EYOA 1QVZA 1OLXB 3KQSA 2HHAA 1ODSA 4JC8A 5JBNA 4GQIA 3CSSA 3JAKA 3ML1A 4DSUA 5H9VA 1M2GA 1IAQA 1DL5A 2J0UB 3IBCA 4UUNA 4H0FA 1Z62A 4BMYA 4BZXA 2YWXA 1FJ2A 2PLRA 2V1UA 3KZXA 3WLAA 4WKPA 4OBXA 1PNOA 1N1GA 1HA3A 3HWRA 1J07A 4KRXA 1FW6A 2I3BA 4MV6A 1CWUA 1I0IA 1QGOA 2C03A 2P2YA 3LBYA 4NZNA 4KDFA 4WASA 3WL5A 2EP8A 3RRXA 3TTVA 4DHEA 1MUUA 4DXAA 4Z0HO 4RTLA 1NBOA 3H16A 4M0LA 2C84A 1U80A 4FUQA 3W8RA 4ACAA 1Z29A 3G23A 4ZJYA 4IM7A 5B3JC 4Q24A 3PQ6A 4EJFA 3V55A 3OOHA 9ATCA 3M83A 4JI5B 2OCDA 3DPUA 2BMAA 4EUFA 3BRCA 3NXKA 4OHRA 2H48A 4YA6A 5DEOA 2EWWA 3B38A 1QJCA 4K6GA 2IXTA 4LHZA 3OM9A 1BMTA 4HUJA 4JP1A 1DFHA 5ED4A 3SQDA 4MEAA 1HLGA 3CN9A 4XWYA 2OD9A 4A26A 1IPEA 2CCKA 1V95A 1ZN8A 3BRSA 3EGOA 3EWIA 2W2OA 2WJJA 1VGVA 3AM5A 4MKXA 4MR9A 2DQZA 1KK0A 4JC0A 1E5TA 2G40A 3LKDA 1O2DA 5J2UB 1LD3A 1NV8A 3C3JA 3DO6A 3G2HA 3I6BA 2LBPA 4TRJA 4X6UA 5IU6A 2EL9A 3DAFA 2WAYA 1JKJA 1WV0A 2CXQA 1CDOA 4IHAA 1EJBA 2I7XA 1V4NA 2PQ0A 5JJCA 4LX0A 2W6JD 3IERA 5DBGA 4AROA 5LZ9A 2CXHA 1YBHA 2JK0A 3RWMB 3AFIA 1SQGA 3QWFA 1OFVA 2Z0MA 4UHKA 1ZGAA 2OMKA 1IFXA 2EF1A 2D1FA 5L3SA 4G89A 3RFVA 4OFZA 2CWWA 4JDUA 1RWVA 1T8PA 3CONA 4AI6A 1MOZA 2PRIA 5TXGA 1N0UA 4BFZA 1QKIA 1HTTA 4QBIA 1ZWKA 3K1TA 3PHJA 4R7ZA 4ALNA 4KNYA 4AN1A 1I1OA 1DV1A 2R1VB 4QECA 5FF9A 3HXMA 1N8KA 2Q6IA 3A4NA 2OAQ1 2Q5JA 4FVTA 1EGQA 3WAGA 1W2HA 2VHUA 4P4UA 2HMVA 4RPJA 2IYNA 3JD0A 3ZGYA 2OESA 1J1ZA 2V5UA 3ADOA 5KYTA 1DC5A 2AB0A 2OLJA 1XQXA 2I2AA 2WVHA 3UKDA 2FWAA 3PL5A 1VPVA 4Z0NA 5J40A 4AKTA 2QAJA 1X15A 2C00A 3LLUA 4IQ0A 2QLMA 4I1SA 1QQBA 2OBYA 1NG1A 3I76A 5E1MA 4AJHA 3D64A 1TAUA 3BILA 1QVVA 1YI1A 4ABTA 1VLQA 2ZDQA 2JDID 1OD6A 1HNNA 1NYTA 4Z7OB 3BF7A 1TMGE 2WI8A 3L6UA 5D6OA 3VOTA 3W2EA 3G2KA 5KWEA 1G20A 1WKVA 1JLMA 3ICQB 2GX6A 2WIGA 2VQDA 3CUKA 1FRFS 2XVZA 2X14A 3RIXA 1CUHA 3TB6A 3DYIA 3RE1A 5FIUA 4MV8A 4GICA 6ADHA 1TJ4A 2MSWA 4WECA 2X0DA 3O94A 2AS0A 2P6PA 3GRFA 4QQ8A 3AJ9A 4WNCA 3BXHA 3E53A 4AZ3A 5SY9A 3LXUX 5CPFA 1QFXA 3WQBA 1QFMA 2ZUBA 4NBVA 2XV1A 4XIJA 4PQEA 1RLTA 4PYKA 5AKJA 1E1NA 4LJ8A 1CVLA 3LWNA 3P9SA 3TPFA 2LIVA 2HK9A 3ENNA 3W2TA 3QBVA 4YGYA 4A1FA 4F91B 4FDTA 4I50A 2P4SA 3KYDA 3BXZA 5L40A 2MTBA 3F5SA 2EIXA 4M49A 1EFRD 4FD2A 4DV1B 1E2KA 2R5FA 1GUDA 1SQ6A 1U31A 2ZUUA 4ZYUA 1DXYA 4ED9A 3WFJA 2HMUA 2WJVA 3P26A 1AQUA 4OQEA 4RLQA 4D4MA 1QZZA 2WJYA 4GMGA 1VKRA 3O4VA 3AFNA 1IWOA 1MX1A 1XLUA 5AM1A 4KWEA 4V2UA 2EKDA 1XLWA 4G0YA 4JS0A 4D0NA 4KITB 1APBA 1MR3F 1O8CA 3OTOB 4QDZA 3QVWA 4DREA 4O2RA 2FZ4A 3VUEA 2DR2A 1ZUWA 2QPAA 1Q0ZA 4CM9D 4WLUA 2W70A 5KNDH 5JZMA 4PU0A 3X44A 2G0AA 1NWHA 1QR2A 1EWVA 2QRJA 4EF5A 1J56A 3AF1A 4MQMA 5EKXA 4ARAA 1VPTA 4Y6LA 1DFGA 3OIGA 5G4KB 1SUFA 2FVXA 4MR7B 1T36A 4K9OA 3B82A 1A9ZA 4D80A 1C7IA 5KNDD 1ZSYA 4CKCB 2WJ4A 2HV9A 3IXMA 4FYKA 3CRW1 4HH4A 4BMCA 5AOVA 2IYSA 2JEYA 4GE3A 3T1VA 2O2HA 2ZETA 3O3NB 3KXDA 4HN9A 1YA8A 2FSPA 4UTXA 2LIPA 5DCWA 4ALIA 4DV0B 3GV0A 3V42A 1LQUA 4F45A 2O1WA 1OI2A 4KR6A 1JDNA 4O4IA 3NHFA 1C4OA 4Z9BA 5CA1A 1YUMA 1JH8A 2PLWA 4JOQA 2MJLA 4HGZA 4L5IA 1SR8A 1MPTA 2CL5A 4JB0A 4WKCA 3J7AC 3L0CA 3DTYA 1ENZA 4TLMB 4QO8A 4Y2RA 1CETA 1V16B 1DLJA 1KYVA 3CW8X 3T9BA 3UK6A 3PU6A 2FOXA 3WWEA 2PUJA 3HY3A 4B3MB 3IDQA 4GS5A 1ZK2A 3VMFA 3INRA 5TQVA 1JQBA 1I2MA 1Y82A 421PA 4OBEA 2J0QA 1Z6PA 2YUTA 3BG5A 2VC2B 4TN5A 1OZAA 1P80A 1ES9A 4EUSA 3HPRA 2RB4A 1TF2A 4EFLA 4B0PA 2V65A 1IUKA 4N0DA 5JMPA 5KTKA 4MR9B 4ZHQB 2C98A 1JPNA 4UU1A 1ZRMA 4QL3A 1JWAB 2IXDA 2BI7A 1YOVA 2QW8A 3ZGNA 2ZCJA 1K8YB 2ZT6A 3LJKA 1GLGA 4PYLA 5A6SB 3RLIA 2R7MA 3C97A 4NZPA 4YCJA 1YZFA 1EFPA 5FFFA 1WW8A 1RHMA 1IC6A 2WINI 3A3NA 3JASA 4MA0A 4QXOA 3C3EA 3ISVA 2QRLA 4WLVA 4ZPJA 3TSZA 5FUMA 2F1JA 4NYJQ 1FVOA 4V0QA 1IY2A 3RSZA 2BMWA 4R51A 2H1FA 4MWOA 3AUJB 2UUPA 1XF1A 4HCJA 4WLEA 1PCXA 3Q7QA 3EEYA 5LFAA 8GPBA 4ZALA 1XMXA 4MMYB 4RH1A 4M1WA 1YQEA 2ZPTX 3V00A 2YXLA 1BIFA 2DCUA 4UXHA 1CV2A 2D13A 2GNAA 4HEHA 5F7ZA 4GL2A 1IK6A 3H97A 3SNKA 3W05A 3TIGA 4G1BA 1FLVA 2NAPA 3DMNA 3RYHA 5AVXA 1WR8A 4CLOB 2R66A 1UT6A 1VJCA 4NFHA 1QCCA 3ZEIA 3BD8A 4RZHA 1XHEA 4FWBA 3NFYA 5LQNA 4X44A 1E2BA 1G5PA 5KYVA 5ADUS 3WSWA 4P9NA 3BMOB 1QRAA 2V4MA 1P1FA 1H2EA 3HY4A 1NP6A 1PEDA 1WOYA 2UXCB 4F2HA 2LW7A 2QGNA 2AKAB 2R84A 3HP4A 4Y8VA 4YO7A 3ZWMA 4KNWA 4DCMA 1S5PA 1NI5A 4RXTA 1A3CA 1DZIA 4CLHA 1WBBA 4RTKA 3AKEA 4QFDA 1YNOA 4WXHA 1ZJZA 2VTVA 2Y4OA 3C3CA 3FFBA 2OHFA 4RORA 3RKRA 4FT4A 1VYVA 3GR6A 4BZZA 5C7IO 1PGNA 1RFLA 1M6VA 2QZ9A 2B8NA 2XE6A 2QW0X 4BFXA 2YVLA 1XYYA 4BCBA 1T3ZA 1DEXA 2G4LA 3DLBA 3IQFA 4PFSA 4YP9A 3AJDA 2EFJA 1X1RA 1T9GR 4GUAA 2EX0A 1PIWA 3N2KB 2VJPA 2XYRA 4L3OA 4YJ2F 4S12A 4PZLA 1USGA 1YZGA 1CFZA 3LKZA 4KI0A 4OMUA 2XMGA 5JZOA 5LXTB 4JGIA 3CA8A 4YUZA 4W63A 1B8NA 2WYHA 2B4AA 3O9ZA 4HQNA 4QRHA 4Y2QA 1U8TA 2BFCB 2DUWA 2P2CA 2EW8A 4DQ0A 2Z5FA 1VKOA 2X4LA 3HUFA 5EOVA 3TLXA 3T7DA 4Y9DA 1KZHA 4XUEA 3F9CA 1XEWY 3VYVA 5ADHA 1NLYA 2ZB3A 4M1OA 4KP7A 3E2PA 4L51A 4AMZA 3MB8A 1EYZA 2X3YA 3CE6A 2VG8A 4JUCA 1GPUA 4FM9A 4PS1A 4H2DA 1E5QA 1ZDMA 2B9VA 3KCNA 4Q18A 1ND6A 2BGLA 3EN0A 4XGRA 5FOVA 5JHGB 1IN1A 4XH9B 1X87A 3AHFA 5BN5A 3H1TA 1ZSNA 4XTRA 4NMXB 4OY3A 3DKKA 1T3SA 4IAOA 4MW2A 3HV0A 1SC6A 3CPJB 1JPUA 3OPQA 4V0KA 3VI4B 3DZ8A 1A2BA 4J0EA 1YU9A 2O7NA 3R24A 1WHTA 3RRJA 3EDMA 2EJCA 2JVKA 4ATNA 1B6SA 2O2GA 3IURA 3HCAA 1Q0QA 1G5QA 1WD5A 4NX2A 4OHMA 1PLKA 3HKBB 3LLMA 4MW7A 4UZEA 5J59A 1N0VC 3F5MA 1DWQA 4B4VA 1Y6GA 1OHHD 4E2ZA 2GO1A 2WHPB 3MCZA 3QKSB 4G37A 4HXEB 3LL4A 3P2JA 4E1BA 5AM2A 1NW3A 1XRLA 2LPMA 1QH8B 3CNHA 1OXVA 5KC8A 1D07A 2ZQZA 4IDHA 3D1LA 1KBQA 4TS4A 5DHRA 5L3ZA 5AW7A 1WZIA 3VH3A 2O1EA 3HDYA 4FC7A 4GVLA 1PDOA 5L7TA 1JBQA 1V3UA 3M7IA 3VXKA 1SUDA 1KZ4A 1T34A 2EBWA 2PXAA 2ZI6A 3DDNA 2EW2A 1TQDA 1IHPA 1LX6A 1PNQA 4Q3LA 3I2IA 4TUYF 1AQJA 4LCEA 3EIOA 2PH7A 1SUCA 2FSIA 2Q5IA 1SOWA 3FUWA 5LD2B 1M5RA 2HY7A 2JGAA 1H3EA 2R25B 4WZBE 1P4SA 2GTHA 3LWBA 1GYQA 4TV8A 3IQXA 1GKYA 1TTHA 5HSGA 4XAQA 2LR0A 5G1OA 4QXQA 1E9VA 3FI0A 1G7SA 1BN7A 1KJ9A 2VDPB 1QAQA 3LC0A 3QJ5A 4I5FA 4LF6B 2DHCA 3PDUA 1QYRA 3JQFA 3PE3A 5C5CA 3TGPA 1KO8A 4C2BA 3DTNA 3ZPXA 1YBVA 2D0IA 2YJ6A 1NNEA 4PC1A 3E18A 4ARIA 1D6NA 2G4VA 4BLWA 5FA6A 4B5KA 4CUZA 5KOJB 2PCLA 1JW9B 1HDXA 4N7RA 5HDQA 1B8UA 2HWUA 4FD3A 1AVTA 2Z9DA 4JB2A 1AQLA 2HFKA 4BWGA 2OO3A 4K03A 2FRDA 3H0CA 3KZOA 4Q21A 2AQHA 4DRZA 1HURA 3FPCA 4XW2A 4FFDA 4JT2A 3O0TA 2WJAA 3QXGA 2F4NA 5ECWA 3WQSB 3LIIA 1ZK4A 3MJEA 4I5EA 4MWEA 1I14A 3W6ZA 3GZ4A 4IQGA 6YASA 1HNZB 5D01A 2OV6A 1UXKA 2BVNA 5B2EA 2YY7A 2EHJA 5FL7D 3WIVA 1BROA 5CDSA 1S8AA 2HIAA 3PA6A 2OG2A 3UAGA 2QZSA 3LLSA 4RM3A 5EMMA 2PQ2A 3JQAD 5A3SA 4E33A 3EXIB 2QT1A 3X0DA 3ZXUB 4O08A 3ZHOA 2E5FA 1G1AA 4IX1A 3I45A 4JLSA 4LCBA 4M0KA 4PO8A 1V8FA 4OATA 3HVRA 4K40A 1H4QA 2VBGA 3OIDA 1RJEA 4MJLA 4I1IA 5DF1A 1WBDA 1H0HA 2C8LA 3T61A 3ZWQA 2R6DA 2D00A 4EGFA 1J8VA 1QPBA 4LCJA 3FGZA 3WGMA 1I01A 1QNFA 2PZ8A 4U5XA 3I28A 2BC9A 5I8PA 5L3VA 1JEDA 1QGYA 1KJWA 2HBQA 1HZZA 3KAJA 4TSFA 3O2NA 4CM4B 4D9CA 8AT1A 5G40A 2V7QD 2HV8A 4HWSA 4G1FA 2QAGB 1LZLA 4XM2A 3GWZA 3ONEA 2HHJA 4NH0A 3T3DA 1IEXA 3B3QA 3EG9B 3L7MA 3WZ2A 1GCOA 4XDZA 3KTFA 4MQ5A 4KGXA 2RD2A 4DZZA 2I80A 2WG1A 2A33A 3QSGA 1U3UA 1FFAA 1QSGA 3S2FA 3R7NA 1BXRA 1WQ4A 2VBIA 5D7BA 1WQ3A 1BG6A 2VJNA 3HHPA 4C4OA 4F9FA 3I8XA 2PUWA 1K5HA 3N8HA 4P82A 4XX0A 1U8YA 2QTRA 1FRQA 2AVDA 3L01A 4U39A 1JBEA 4IV0A 2AOWA 1SKAA 1F2VA 5ER9A 4IJ6A 5J63A 2EGHA 2WUEA 4WCFC 5D5PA 4BL5A 1KVQA 4YP6A 4HUTA 3ROXA 3L1UA 4GQBA 5JS8A 2XA9A 3GOQA 2DQKA 5AXDA 5J2TA 4MV4A 3K5PA 2FN7A 4PHFA 4ZI5A 3DOHA 3MWJA 5DP2A 4O2AB 1KK1A 2DJ5A 1BD4A 1A76A 1XGKA 1KEVA 2NZJA 3U48A 4CM8A 3MT8A 1LDGA 1JIVA 2VIIA 3C39A 2VSFA 4KSCA 3SZRA 4N7BA 1YVRA 5DM0A 4L5CA 4R8MA 1O97D 1L7MA 1KMIY 3V2HA 4DILA 3CC8A 2FB9A 3VOAA 3CINA 1GHTA 4JC5A 4YMLA 2YOGA 4M7PA 4EG4A 3NHUA 3H5OA 3FD8A 3ANNA 3ITNA 1AGXA 3GVHA 1EFPB 4B3IA 3CKLA 5AM3A 1BHQ1 2YYYA 2IRWA 2V3WA 3QOYA 4MAFA 4D02A 1XEXB 4OHCA 4UOEA 4HNHA 5KQSA 1IHDA 2IU3A 3X3HA 1OWNA 4HAOA 4J2TA 1VQ1A 1YQQA 2ILVA 1JG1A 2QTGA 3B6KA 3PPVA 2HAEA 4H18A 3WO0A 4YV0A 3PNVA 1VMDA 4Q19A 4ZQCB 1F12A 4G1MB 1KOGA 4JXZA 3AKZA 2DFDA 2G17A 1V3TA 3SF8B 1V71A 3I42A 3KB8A 2LCQA 1R6VA 1OTYA 1CYEA 1T9GS 5LKRA 4V02A 1E1KA 4CKYA 1OI3A 2A92A 4ZODA 1J39A 1O3YA 2XCQA 3N2ZB 1Q0LA 1YHNA 2OHHA 4OQMA 1TJPB 2GBFA 4DQXA 1GT6A 2PSEA 2XITA 4X41A 2C3MA 4FUTA 3QMPA 2VA9A 3NR2A 1P7VA 3PKJA 3PQ8A 2EAUA 4JKIA 1ST3A 4AD8A 3HS3A 3SX0A 4Y2YA 4XX1A 3GPDG 3TSYA 1BTOA 2WSSD 4HFRA 3AERB 1Y3IA 4KIWA 2GEVA 2P2GA 2NXWA 3E8MA 1VL0A 4NE2A 1EE9A 2FX3A 3F6YA 1DO8A 5AJWA 3R9XB 3ZE1B 4MYRA 2O2SA 2ZBRA 5TMDA 1VG8A 5FA8A 2H63A 1GYRA 4M7WA 3RUPA 3VSAA 2W0SA 4BVGA 1LI7A 3P32A 2O1SA 1E7WA 2C2BA 3IR5A 1LTKA 3OT1B 4RTQA 4PZ9A 1RAAA 1M0EA 3HU2A 1S2MA 1MORA 5DH9A 2JLVA 1AS2A 2ZJZA 4KI7A 4MUMA 2HCBA 1VPWA 2YJGA 2Q2WA 4KODA 1KOJA 1QX3A 1EA7A 1JMKC 1P1IA 2J9RA 2YYSA 3FZQA 3L06A 5FDFA 2FHPA 3ZD7A 2QNRA 1G3QA 1B6GA 3TW6A 5AI0A 1LQTA 5DHAA 3F5FA 1EFHA 4CLRB 2IA5A 2FXIA 3MD0A 3TBHA 1ZCAA 2ZRHA 2ZJ5A 3GRUA 3INTA 4KQ9A 2AI1A 3RSLA 2WZCA 4X63A 3X1XA 3UPUA 3R7DA 3TPZA 1B8OA 1VCNA 3V6MA 3NDRA 4HQ0A 1UXJA 1E32A 3DOOA 3H2IA 4AAYA 1XPUA 1WCXA 2ZVJA 1N6LA 2V5VA 5K3FA 2DE0X 3H1BA 3HNPA 1FVHA 3N2GB 2OC9A 4YACA 3TJRA 1R4ZA 4F60A 2WQ7A 2AJTA 4Q3BA 4ZCLA 2OZVA 1I6WA 4J4HA 3DFKA 2N1BA 4O02B 1FX0A 1LPAB 3BIWA 4MUIA 5F2NA 1JEYB 1UBFA 1RI4A 1Y3CE 2RHMA 4CEIB 3KSRA 1RLJA 3H18A 4ITVA 5AKEA 1OQAA 3AQIA 3DDZX 3KQQA 3STWA 2YCBA 2GK7A 3WR5A 4MKZA 2WMNB 3QEKA 4PZEA 3KR9A 2J48A 3EBPA 4GOXA 2P3OA 3EFHA 4XEUA 5DRTA 3W3AH 4PWYA 5LQAA 1U81A 4N8SA 1DARA 2W2TA 2ZJOA 4Q4AA 4U7FA 2UAGA 3KQMA 3L93A 4M1EA 4B4UA 5IT5A 4BP9A 2WIFA 2VFAA 4ZAVA 4EL0A 1ZD3A 4M1ZA 4ZI7B 3T7KA 3L7LA 3LBHA 4DHWA 1BX0A 3NW9A 1DC6A 2IL1A 3F98A 4AYXA 2XMSA 1LPMA 2JCXA 3QXSA 2ZRBA 3CV3A 2CHEA 3F7MA 1NVDA 4LY3A 4PINA 4ZAFA 4YLEA 2ERCA 1R0WA 4BZQA 4EHFA 5AVKA 1WABA 3TLKA 3P97A 1G0OA 2RC6A 1SKYB 4BMSA 2YBDA 2PKYX 1UOOA 3U6KA 5BP7A 1W52X 2DSTA 4TTSA 3HUDA 3REQB 4D57A 2R7KA 5A1TA 4NK4A 1D9XA 2CMFA 4OHXA 3SLKA 3LBFA 4HTAA 4P4SA 4Z51A 3GRZA 3FNIA 4RK6A 1NLUA 3KYDB 2GYUA 4YT5A 2VCHA 2CD7A 3I3OA 3G68A 4JLMA 1ODCA 2H07A 3DMFA 3FWPA 4I8DA 4PE5B 3A4LA 3K6SA 2G0NA 1VBMA 4G5RA 1QE5A 4XB2A 3WYEA 4PLYA 2HPAA 1UP4A 2EJTA 1Q16A 4M22A 5AM0A 3DEJA 3MGBA 5ARBA 1XFDA 1QKJA 2ZRIA 3DAPA 2H4YA 2I3ZA 4GWLA 2EBUA 4GYJA 3ZI0A 1XEFA 3TRJA 4YMVA 2XUHA 2G07A 1DAFA 1JSRA 2PD4A 2I29A 2ZS7A 3LFHA 3OMWA 3OJWA 4XQ0A 5JXGA 4MVJG 5KYUA 3U2QA 3ZDAA 3AHDA 1NKSA 4IXWA 4E4TA 1AA6A 4NBLA 4RZXA 1AU9A 1U2ZA 4OV6B 2XMQA 5JXJA 1VB5A 3EPKA 4YRRA 3IXQA 4Y6PA 3H75A 4N5IX 2XB6A 4J1QA 3TLCA 1ICIA 3P0HA 4DWJA 3KJHA 1D2EA 4HDNB 4HV4A 4BNVA 3AR7A 3MMXA 3RI3A 3TQRA 2NUBA 4K9NA 4MUXA 1NXQA 1TO6A 5GINE 3R5JA 3OZWA 4L0QA 4PGMA 5CFLA 4B3FX 1PSWA 1FDOA 5K3BA 4UFNA 4MA5A 3NX4A 1DUVG 5ELXA 3KTAB 1F2UB 3TZCA 1TTPB 1T9DA 4ETIA 5BUSA 5A2QA 1UOPA 5LMCA 3EVDA 5DB4A 5KWSA 2I54A 4PGGA 5CIYA 1IN7A 1JHDA 1SCJA 3CLUC 3H8VA 4DDVA 2DZDA 4XTCS 4Q3NA 2QQGA 4GRDA 5TVKA 4MH0R 2OV8A 4MW5A 3PD1A 3ERCA 2G1AA 2H16A 3CR7A 3T3GA 3ZY3A 5MN6A 1P2TA 4BO0A 1EWQA 2ZZMA 3TD9A 1EDBA 2E49A 5C1DA 1HF3A 3L0YA 5IKPA 5JI2E 5KQMA 2MYTA 4F7DA 1EDDA 2H1CA 5B6IA 2YJ3A 2C88A 3HL4A 3D8HA 1VC2A 4OQ4A 4TQGA 4W7SA 2BEVB 4BRZA 1T35A 4KXXA 5DYTA 3VYUB 4B3HA 1E6UA 3EYAA 3LUJA 3R3UA 4FNOA 4J0GA 4JQYA 5GJBA 1N7IA 5JS2A 3INYA 4FW9A 2ZJAA 4PG8A 5BORA 3V4RA 4NNPA 2ZYHA 1V6CA 1R74A 4MB6A 3ZCSA 4NE7A 1C4WA 1VDMA 3AW8A 3ZQKA 4DJEC 2JIRA 4JL5A 4JGBA 1O9HA 4DIFA 4KWHA 2CYBA 1PJSA 3GDOA 1VJGA 4L8LA 3OC6A 1DHTA 1IOZA 1FU4A 5JO9A 4HLQB 2QPLA 3GGCA 4AUKA 1WBJB 3AVPA 5HFAA 3K9BA 2C77A 2JVJA 3SE0A 2QJTA 2FDCA 2VQFB 3FPGA 4INPA 3CBQA 4L8WB 4M8SA 4NYMR 4L9RA 4KXYA 2WMYA 2O3QA 2C2KA 2PZBA 5L4LA 2GPTA 3SQWA 1OFGA 2JKZA 2SKEA 3IELA 1KYYA 4HADA 3U3MA 4V1CI 5LYJB 1W30A 1NAHA 4YRJA 4JITA 2FWIA 3ETDA 2E48A 3QLUA 2H1RA 1Y3DE 4KK4A 1Z28A 5F1YA 3UHOA 1BRTA 5CVCA 4FINA 3AEUA 2W37A 4M9XA 4QELA 4KMOA 5CDTA 2Q3CA 1NUAA 1Y9ZA 4QRIA 2XGJA 3DP7A 3ETLA 5B3AA 3ROEA 1PJTA 1OT5A 3AF0A 2J9YB 3I4FA 2A14A 2UVPA 1OJ7A 2AFHB 4P81A 3TK1A 3UMRA 3WRYA 3BFJA 3B9BA 1K6JA 2PT5A 3JARB 1XK7A 4G0PA 3C1TA 3H1FA 1MH1A 3DC7A 3VJKA 4G41A 3KB2A 2PR7A 3V8RA 4BO4A 3U0BA 3O84A 1KVTA 1SVNA 1LQ2A 3QF4B 1JQAA 4RDHA 4M8KA 3HFGA 5LBIA 1FUUA 2VH5R 4DCCA 5D85A 1LRLA 2DFKB 5TV2A 3THWA 5JWHA 4OVKA 1WLYA 2Q3MA 4II2A 1NSTA 2XYVA 4X3CA 2HPZA 3G0DA 1GP2A 3F46A 3Q5EA 3E2IA 4GZMA 4YP1A 1DC7A 5HS6A 4ZK2A 4OFXA 4AJ2A 5EKDA 1Y8QA 2VUTA 4HGPA 2MMCA 2Y9MB 5I9TA 3TEMA 5EWMB 5FNVA 3AR2A 4PO9A 3HMKA 3SZLA 1CT9A 3EFOB 2P4QA 2J8ZA 3BIJA 3HMQA 4UMVA 5EVJA 4B82A 5EJ9A 4B33A 4HVAA 1J90A 1BQ3A 1D5WA 3D81A 3W3ZB 4YEDA 4UBMA 5KPDA 4WZAA 3DLHA 1D2AA 1YFKA 1NVBA 1NBEA 6NULA 4OX9Y 3T12A 5TGTA 2XQFA 1P5JA 1VE3A 4IEEA 3K70C 2X42A 4IP0A 3FSEA 1VPEA 2VAMA 4D8YA 1BH6A 4F4CA 1LV8A 2X40A 1NJ5A 3NZEA 2CXRA 4E3ZA 1QH1A 1V9CA 1C0LA 1YZUA 3PEWA 3M9XA 1NKTA 3E7XA 1U2GA 3V1LA 2ZWAA 1BFDA 3VO8A 2Y1GA 2FN4A 2P8SA 3E5MA 4HS4A 4QBHA 2VQ6A 1WW2A 2WU4A 4YRZA 2QDXA 4II7A 5A6VA 1A8HA 2X2OA 1HMYA 2QP4A 1FFSA 4YJKA 3X1WA 1J7JA 5EHIA 1R18A 2DWUA 1HDIA 2VP6A 3ISJA 2P35A 4PIPA 1N2OA 1QORA 3VKHA 1L4GA 2CVOA 5LZ2A 3TX2A 4ER6A 3TQQA 2O48X 1J0CA 1D2MA 1P7CA 1XZHA 3G2JA 5IF3A 2O14A 3U9TA 4F4HA 2YMLA 4EKYA 3Q11A 5IDWA 5KSZA 5IXSA 3JV7A 3AX6A 1NT4A 3ILYA 2B4YA 3DVRX 1W59A 3EDYA 3PDIB 4GXQA 3ZX4A 7REQA 1YDMA 1HSZA 3LECA 3LU1A 2VHQA 3U7QA 3EX7C 2Z2IA 3HBJA 2UUAB 3P8ZA 3RJTA 2W48A 2C4UA 3U1VA 3FUCA 1U7HA 1C9EA 3KOXA 3GP8A 4WFQA 3PFIA 4HDRB 4W99A 1XQWA 1GG8A 2FAXA 1K4MA 4PNPA 1GXSA 4UULA 1CEEA 4HJXA 1JEYA 3ZV3A 1ZR4A 3I39X 2X8BA 3H0KA 4R9NA 2VHZA 1SC9A 4WNAB 3GUYA 5GJCA 1JQ5A 3ZS8A 2GB4A 1DB3A 1XTVA 4H7KA 1C0IA 2FETA 1E20A 3N8IA 3SZGA 2WJIA 4FFBB 4M6WB 1NBMA 2AG0A 4KU4A 4IIFA 3NTRA 2OQVA 1VE9A 2IUTA 2OZEA 1H4VB 4F72A 2YUIA 2EEZA 1G8AA 1W44A 5COAA 3OTWA 5JNLA 5A4FS 1KYIA 1N7HA 1TA0A 3C3PA 1W5BA 4KWIA 5A3VA 3VR4A 3K2BA 1F9AA 1XZMA 4GC9A 4W8HA 3GLUA 4EAAA 2ZSAA 2GSWA 1O95A 1KQ3A 2QL5A 2VXYA 3E9EA 2Q5CA 4WLOA 4FIZA 4B2IA 1QE3A 1CJCA 1U7ZA 4HTFA 2WYWA 3DMDA 2EBHX 3UPDA 2WT4A 4DB2A 4HRYA 4GSLA 1J97A 3GIWA 4Q7EA 4F9EA 1PRYA 1SCDA 3G6KA 2YHBA 4DB4A 2JFYA 3FNRA 5HTKA 1GRVA 3QFFA 4BAZA 2VTDA 1ADYA 3PK0A 3WJ7A 3CF2A 2YNMC 2GASA 2X0NA 3IS3A 5GJWC 4KOEC 3UFXA 1KKMA 3V8BA 4IILA 1NMXA 1QGUB 1XD9A 3KKNA 4NBUA 5JSKA 1D2CA 4EI8A 2GCEA 1NZJA 2DYKA 1SBHA 1X7XA 1RLOA 1YAJA 2ZAOA 3CXUA 4KLZA 4NDZA 4OKSA 5ALTA 1MP0A 1N9KA 3RSOA 1JIUA 3Q3IA 1Z5PA 5AKGA 2VYND 1FTSA 3SYLA 3PNYA 1PFGA 4AMYA 4CHGA 2BEVA 4DVJA 1FRVA 4U0KA 1KETA 2I4MA 2MT9A 2P27A 5IC5A 2RK3A 2GPNA 4NOMA 4JCCA 1YVPA 4G4GA 3B51X 3EZ7A 5ESDA 3SXJA 1NMZA 3D9QX 4ZICA 1GGVA 4GYKA 4OFBA 3RBXA 1FFXA 1PQPA 2YXPX 1GLNA 3FMVA 2FRDC 3IQGX 3KTDA 4OO3A 2P40A 4KR0A 4KK3A 1KMCA 1JYSA 2Q1XA 4OK6A 2AJ8A 2WV7A 2WW8A 1FTGA 2SBTA 2ZI5A 2JI6A 5CGZA 3ZGXA 3MBOA 4R1QA 2O0HA 4CEHB 2A9VA 2E18A 1Q1AA 5JNSA 3TIFA 2XUIA 2PUCA 1RJWA 4TUYA 2X1LA 3N28A 4YAWA 2P3LA 4LAFA 3K32A 2SCUB 4WV3A 5BUZA 3EVEA 3E48A 3COSA 1RQRA 4YBRA 5BV8A 1U3WA 5I8ZA 1WU8A 1PFKA 1SUAA 3NVMB 4M87A 1WMDA 3VR2A 1W76A 5LP6A 4YI3A 3G7NA 4Y6GB 4RETA 1UC4B 5FI5A 3LPDA 1I1QB 4IDDA 1PZHA 4XARA 2C61A 2CNBA 2PT9A 3RT7A 5BV0A 4DIUA 5JMTA 4RMNA 1LFDB 2P6UA 2ZIAA 3RHFA 4PEVA 5LR6A 2IHTA 3ELWA 1S01A 3IEUA 4O4LA 1DG3A 4D8XA 5MHTA 3C14C 4L50A 4Q1AA 3AF5A 2PKRA 4A73A 1XLVA 3T5GA 2GJ4A 1Y4ZA 1RXUA 5AM4A 1C7JA 1MC1A 1NLZA 1Q95A 3ODPA 1DQSA 1GYPA 3BJZA 3BZBA 2XQVA 5AFSA 1IL0A 1NV9A 5ER6A 3NVAA 3PR2B 2H1WA 4BN5A 4HYQA 1KFBB 2QZPA 4OLAA 4MKRA 3N70A 2IYPA 1EGHA 2HBZA 4HWOA 3U4CA 1UH5A 3C5EA 3RLFA 1E98A 2REOA 3VR6D 3IAM1 1NZDA 1AV7A 2FW6A 4B87A 3CXRA 1L5SA 1SHUX 3AKCA 1BU8A 2ACEA 3I64A 4XCQA 2O8CB 1N36B 1E3WA 3JQAB 3OQJA 1DSSG 2C1EA 5F9FA 5KKNB 3Q5GA 1EGVB 4FOPA 3HE3A 3PWKA 4GGPA 5CVUA 3QGMA 3QEMA 1W0JA 2EYUA 4IG4A 4HQRA 4LV8B 4MS4A 2C2GA 2D5LA 4ZOQI 5AI6A 4UQOA 4HAUA 3LKBA 3RHSA 4DNFA 3TECE 3ZWAA 4EG7A 4BV9A 2IBTA 4FYHA 4N3AA 4DLBA 2C0QA 3G8YA 3L6BA 5LP6B 1O6ZA 5HF6A 4X61A 4BNGA 4DIEA 4B3TB 4GPIB 1G4HA 3NU1A 3NHYA 1EJ6A 3PPYA 2OXEA 3I1FA 2P30A 4P6VF 1SURA 3BL8A 3CUUA 4YV7A 2Z04A 3SM9A 5JEDA 4JI0B 5A4AA 2PL5A 1AMNA 4PYMA 2TMYA 3LT1A 3OJFA 1X38A 4X8LA 4BNMA 3N7AA 3DF9A 1V8BA 3TEJA 3R6GA 4AG3A 4X45A 4X85A 3VX3A 3WMWA 3W4JA 4JC4A 4Q3OA 4R2MA 2V0GA 3ROPA 1BS9A 2I6FA 3I34X 4Q1CA 5JSFA 1J2UA 3KQWA 1PJ3A 4C4ZA 2EFHB 4D0LB 5EXTA 2WVJA 5JCXA 3GZNA 5CK4A 1CUXA 4AUMA 4TM7A 5HCIA 1O57A 5IVDA 2FR1A 1TM7E 1WXFA 2QGZA 3DXFA 4MAAA 3UMVA 4YLGA 4B7ZA 5K8TA 4D4HA 2XXJA 3NYRA 3K73O 4GKAA 4MSUA 5FAXA 1E6KA 4F11A 1NW4A 1RZVA 1M0SA 5BNFA 3SIXA 3S29A 1U9CA 1XXLA 3NB0A 1BCSA 2LP4Y 3A31A 1AUOA 2O23A 4FMDF 4NOLA 2A2ZA 3UKOA 3F47A 4D82A 1ORDA 2HCRA 3C16C 1CQXA 2JIQA 4NI5A 1DOAA 4R0MA 2J9FA 2JLZA 3ZW8A 2NO0A 4M8IA 1CNFA 3MMNA 4YREA 3W1WA 2XB8A 2BEKA 2GM4A 3N2LA 3DL4A 3IVMA 1CLEA 4JVSB 1EWRA 3QTLA 1TVEA 1ZXBA 3ORSA 3IP1A 1LB1B 4K05A 4UVHA 1JJVA 1ZD8A 2CLCX 3V34A 1GVNB 4HLNA 3WGKA 5CB8A 3DVLA 3VPHA 4NBTA 3H87A 1GUBA 2CSUA 5JLAA 2D1RA 1NVGA 1GKUB 3JD1A 4L76A 2B36A 5AVRA 2DBVO 2G08A 2IZZA 3GLGB 5FPKA 2IYLD 2AMVA 3GH3A 1TAQA 1UK9A 3DFFA 4L8FA 1JR6A 1BQEA 1K6IA 5EQFA 1QP8A 2H51A 1ZVVA 4H16A 1Z8HA 1YCHA 3ESZA 3WLIA 1DG1G 2AXPA 4A3SA 4IEFB 1YCFA 4E31A 3LP5A 5HYVA 4C5BA 4C4YA 3A3KA 4CMAA 5CA1B 3I62A 1TZKA 1RWNA 4CIYA 4I4CA 1RVV1 1FPQA 1MMFB 1SGWA 2IEGA 3QYFA 3ZIUA 4JQOA 5DDIP 1CUVA 2GPSA 2HJWA 4KQWA 3QVUA 4WNAA 4ZQEA 3VSEA 1YTLA 3WWYA 3TFOA 4IXTA 2FJPA 4TXJA 3BGOS 1VMAA 1YQXA 4QM7A 1XCMA 3M6XA 4KE7A 3PXAA 5CJ2A 3R8XA 5BR7A 1VL8A 1Z7WA 2VT3A 3D8NA 3SSMA 3DF7A 2HK6A 5FKJA 3NS7A 3STHA 3VKGA 1MT0A 2H8GA 3RYFA 3EW9A 5JSYA 4DFDA 7REQB 2H00A 1N5RA 3BXXA 3A11A 4WT7A 1DC8A 1BE6A 4XVQA 1HYBA 4WXRA 5DZSA 3UUEA 4ZHQF 1MRNA 3GGGA 2XGOA 3V33A 4ZOLA 5KPJA 3RVPA 4KTTE 4C76A 5B1EA 4B35A 4ZRNA 1ZUIA 7ABPA 5KNDA 5BSVA 5LIPA 1TU4A 4RZIA 1XQYA 1WUKS 2PSJA 3F6CA 5EJGA 9LDTA 1QZXA 2O4UX 5JDIA 5K0TA 5LWHA 3SVLA 3GFOA 3H9UA 3VKUA 3HBMA 3NG1A 1SPXA 2JLCA 1MOSA 1NMEA 2VZ8A 1XDWA 3L82B 3NOOA 4UBIA 2DKNA 3VR4D 1BW9B 2Y0DA 3C5VA 2SECE 4C03A 4DLKA 1BDHA 4JLDA 4DKXA 1IPFA 1N2EA 1QG6A 1SU4A 2DLNA 2Q4TA 4QASA 1LKZA 1AN9A 4HX9A 2XNKA 4IIEA 4WHMA 3PNKA 5CJPA 1PV4A 2PUTA 1IULA 5FJIA 3A1FA 3CMMA 5L45A 4U8GA 5I7WA 1F17A 1CUUA 3H19A 3IAS1 3ZU3A 3JD2A 3EZFA 3M4JA 4JUIA 4R69A 3SIPA 4D9GA 5IEBA 4DLNA 3PUWA 1IQ0A 3HYLA 3PIRA 4HLDA 1NW5A 5J1SB 1NI3A 3EGEA 3ZJYA 4MGYR 2H52A 1NN1A 1NA5A 2QUJA 3W78A 1DO0A 1N0HA 3AVQA 4HNRA 3FYTA 2Z58A 3UT5B 4ZYZA 1X3LA 3O26A 4BLVA 4IGIA 3NBKA 2ENUA 4M1TA 4JB3A 4B46A 1UWLA 2P8JA 1DVRA 2FPGB 4N5DA 5LZ5A 3CX4A 1V1MA 2Y92A 4GYYA 3EVAA 3FCSB 4TTTS 3GJTA 5CJJA 4E70A 5HCNA 4C04A 1E2JA 5EFZA 5CT5A 4B9EA 2ZSKA 1I5OA 2P5YA 4RNDB 8LDHA 1JKFA 3BL5A 1L5ZA 5T7BA 3VSBA 1PX0A 3OCZA 4N01A 4ARCA 5EKUA 2UZ0A 1RIIA 2C8VA 2CJYA 2OAP1 1G19A 4TKZA 4TWRA 4WZ6A 1S9HA 4N48A 3DV0B 4JNKA 2DTXA 2JFZA 4G01B 4M88A 4PAGA 4XRGA 3HR8A 1W4CA 3VAZA 2XYQA 2QMUA 2ZXEA 3B6JA 3S2SA 2DUJA 2LNDA 1MJFA 3GJQA 3IX7A 3C8MA 3OZIA 3LSYA 5E6SB 3SMQA 1M0TA 4JXXA 3V48A 4HNUA 1O4VA 3FOWA 4Y2PA 4INAA 2G36A 1MV5A 3CNQS 1ZGCA 2C5BA 1VJTA 3DCIA 1RADA 4G1UC 2BV3A 4NMMA 3DOIA 5DSZA 3GWGA 3VPXA 3WWCA 3RK4A 3BWCA 5TEWA 2FMKA 3JVEA 3U19A 4EFKA 4HATA 4WINA 1YU6A 2HWKA 4OG2A 3TO5A 2Q1YA 4UNNA 2GF2A 4LWPA 5REQA 3UT0A 4I4TB 5JW6A 5JWOA 4EO9A 1K7SN 4QXAA 2J87A 2QDKA 1CPYA 3AFMA 1O95D 5F21A 3WB1A 4BQOA 3A27A 2A9FA 5TMPA 3KB1A 5IG2A 3DZBA 3HRIA 4I8XA 4BEVA 2B37A 2BSQA 4XR4A 3K2QA 2W2NA 3IKMB 1W85A 3LY8A 2D6FA 5HOEA 4K1LA 3W5AA 5M29A 4JYAB 5EYPA 2BISA 2CL6X 4PTLA 3ITDA 2QQEA 3LNCA 5AJYA 3MEQA 4R5HA 3SC2A 4CIVA 3R9IA 2H54A 1NUHA 4R5MA 2JKYA 1HYQA 1NJ8A 1ENOA 5DASA 5FWYA 1N5MA 1EFDN 2ZU0C 1UKCA 1U3DA 1KAEA 3D8TA 2EJVA 3EOZA 1G63A 3L41A 4JP8A 3JRWA 3LXXA 5ADVA 1NJ2A 1TF5A 2Q8QA 2Y68A 5EG5A 2ODNA 1M6WA 2R6GA 3O4GA 2ZM6B 3AUYA 5FL3A 3U7RA 1VI2A 5ALWA 2OTCA 621PA 1EHYA 1M2NA 3ISTA 2QTLA 2FMUA 4RZQA 1FXWA 1FB5A 1Z83A 3C24A 4B74A 4XGKA 1JUDA 5FUVA 4MIYA 3DVAB 5JZVA 1QS0A 1Q17A 2NTNA 1ODKA 1E66A 1PHRA 4U2BA 2NSDA 1J5EB 2AH5A 4KSYA 3BTOA 2D4AA 3A6FA 4UOQA 5DI3B 4C07A 4TV9A 1ODJA 3QX8A 4CW7A 3EVGA 3EWNA 4DMCA 2K7FA 3ZWKA 2VF7A 1M8KA 1ISSA 3KDSE 4C5AA 3TX6A 3N1UA 4YMSA 1JJAA 1Z5ZA 2I71A 2BZ0A 3ZE0B 3LVFO 4AMGA 1K2VN 1EVZA 1YRQA 3VC7A 1B74A 2NV6A 3KTAA 4Y9RA 4EECA 1GRQA 2FPXA 2HH9A 3W9SA 5BW5A