2H56A

Crystal structure of dna-3-methyladenine glycosidase (10174367) from bacillus halodurans at 2.55 a resolution
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
218
structure length
218
Chain Sequence
HMRYFSTDSPEVKTIVAQDSRLFQFIEIAGEVQLPTKPNPFQSLVSSIVEQQLSIKAASAIYGRVEQLVGGALEKPEQLYRVSDEALRQAGVSKRKIEYIRHVCEHVESGRLDFTELEGAEATTVIEKLTAIKGIGQWTAEMFMMFSLGRLDVLSVGDVGLQRGAKWLYGNGEGDGKKLLIYHGKAWAPYETVACLYLWKAAGTFAEEYRSLEELLHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-3-methyladenine glycosidase
publication title Crystal structure of DNA-3-methyladenine glycosidase (10174367) from Bacillus halodurans at 2.55 A resolution
rcsb
source organism Bacillus halodurans
molecule tags Hydrolase
total genus 70
structure length 218
sequence length 218
chains with identical sequence B, C
ec nomenclature ec 3.2.2.-:
pdb deposition date 2006-05-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00730 HhH-GPD HhH-GPD superfamily base excision DNA repair protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.340.30 Mainly Alpha Orthogonal Bundle Endonuclease III; domain 1 Hypothetical protein; domain 2 2h56A02
1.10.1670.40 Mainly Alpha Orthogonal Bundle Endonuclease Iii, domain 2 Endonuclease Iii, domain 2 2h56A01
3N5NX 1PU8A 3I0WA 2NOHA 3KNTA 4B23A 2OFIA 4EW0A 2JHJA 1XQOA 4HSBA 1YQRA 3FSPA 1KO9A 2YG8A 1YQLA 4B22A 2YG9A 4E9EA 3D4VA 2NOIA 3OH6A 3IH7A 2I5WA 4OFEA 1KQJA 5CHZA 2JG6A 1M3QA 4EW4A 1RRQA 4EA4A 1LWWA 2NOFA 1PU7A 3CWTA 1MUYA 1PVSA 1MUDA 4DK9A 4YPRA 1LWVA 1NKUA 5KN9A 2OFKA 4E9GA 4EA5A 5DPKA 4OFAA 1KG5A 4UOBA 1WEIA 4AIAA 3OGDA 3F0ZA 3CWUA 1N39A 3FHGA 5KN8A 3OH9A 1M3HA 1YQMA 1KG7A 1LMZA 1VRLA 1KG2A 1P59A 2JHNA 4EJYA 1MUNA 2ABKA 3KTUA 1WEGA 2NOEA 4PIIA 2H56A 2NOZA 1N3AA 4B21A 1N3CA 1XQPA 3CWAA 3CVTA 1KEAA 4E9FA 1DIZA 1FN7A 3IHOA 1WEFA 4YPHA 4OFHA 4E9HA 1EBMA 4B24A 3I0XA 1RRSA 1LWYA 1KG6A 3F10A 1MPGA 4EVVA 2NOLA 1ORNA 4UNFA 2NOBA 3G0QA 3CW7A 1XG7A 2XHIA 1YQKA 1ORPA 1PU6A 1KG4A 1NGNA 4AI5A 1P7MA 3N0UA 5AN4A 3S6IA 3FHFA 4AI4A 3CVSA 1HU0A 1KG3A 3CWSA 4YOQA 4EJZA
chains in the Genus database with same CATH superfamily
3N5NX 1PU8A 3I0WA 2NOHA 3KNTA 4B23A 3S3NA 2OFIA 4EW0A 2JHJA 1XQOA 4HSBA 1YQRA 4E7KA 3FSPA 1KO9A 2YG8A 1YQLA 4B22A 2YG9A 4E9EA 3OY9A 3D4VA 2NOIA 3OH6A 3IH7A 3OYIA 4E7IA 2I5WA 4OFEA 5FRMA 1KQJA 5CHZA 4BDYA 4E7HA 3L2VA 2JG6A 4E7JA 1M3QA 4EW4A 1RRQA 3L2WA 4EA4A 3VW4A 1LWWA 2NOFA 1PU7A 3LCNA 3CWTA 1MUYA 1PVSA 1MUDA 4DK9A 4YPRA 1LWVA 1NKUA 3L2UA 5KN9A 2OFKA 4E9GA 4EA5A 5DPKA 4OFAA 3OS2A 3OYEA 1KG5A 4UOBA 3OYGA 1WEIA 4AIAA 3OGDA 4ZTFA 3F0ZA 3OYAA 3CWUA 1N39A 3FHGA 5KN8A 3OH9A 1M3HA 1U84A 1YQMA 5FROA 1KG7A 1LMZA 1VRLA 1KG2A 1P59A 2JHNA 4EJYA 3OYDA 1MUNA 3OYLA 3OYKA 3S3MA 4BE1A 2ABKA 3KTUA 4ZTJA 1WEGA 2NOEA 4PIIA 2V75A 5FRNA 2H56A 3OYJA 3R2XC 1N3AA 4B21A 2NOZA 1N3CA 1XQPA 3CWAA 3L2QA 3CVTA 3OYHA 1KEAA 3OYBA 2W04A 4E9FA 1DIZA 1FN7A 3IHOA 1WEFA 4YPHA 4OFHA 4E9HA 1EBMA 4B24A 3OS1A 4BE0A 4BACA 4E7LA 3I0XA 1RRSA 1LWYA 1KG6A 3F10A 1MPGA 4EVVA 2NOLA 4IKFA 3OS0A 1ORNA 3L2RA 3S3OA 4UNFA 2NOBA 3G0QA 3CW7A 1XG7A 3OYFA 2W03A 2XHIA 3OYCA 1YQKA 1ORPA 1PU6A 4BE2A 1KG4A 4BDZA 1NGNA 4AI5A 1P7MA 3N0UA 4NZGA 5AN4A 3S6IA 2JPSA 3FHFA 3OYMA 4AI4A 3OYNA 3CVSA 1HU0A 1KG3A 3NNQA 3CWSA 4YOQA 4EJZA
chains in the Genus database with same CATH topology
3N5NX 1PU8A 3I0WA 2NOHA 3KNTA 4B23A 2OFIA 4EW0A 2JHJA 1XQOA 4HSBA 1YQRA 3FSPA 1KO9A 2YG8A 1YQLA 4B22A 2YG9A 4E9EA 3D4VA 2NOIA 3OH6A 3IH7A 2I5WA 4OFEA 1KQJA 5CHZA 2JG6A 1M3QA 4EW4A 1RRQA 4EA4A 1LWWA 2NOFA 1PU7A 3CWTA 1MUYA 1PVSA 1MUDA 4DK9A 4YPRA 1LWVA 1NKUA 5KN9A 2OFKA 4E9GA 4EA5A 5DPKA 4OFAA 1KG5A 4UOBA 1WEIA 4AIAA 3OGDA 3F0ZA 3CWUA 1N39A 3FHGA 5KN8A 3OH9A 1M3HA 1YQMA 1KG7A 1LMZA 1VRLA 1KG2A 1P59A 2JHNA 4EJYA 1MUNA 2ABKA 3KTUA 1WEGA 2NOEA 4PIIA 2H56A 2NOZA 1N3AA 4B21A 1N3CA 1XQPA 3CWAA 3CVTA 1KEAA 4E9FA 1DIZA 1FN7A 3IHOA 1WEFA 4YPHA 4OFHA 4E9HA 1EBMA 4B24A 3I0XA 1RRSA 1LWYA 1KG6A 3F10A 1MPGA 4EVVA 2NOLA 1ORNA 4UNFA 2NOBA 3G0QA 3CW7A 1XG7A 2XHIA 1YQKA 1ORPA 1PU6A 1KG4A 1NGNA 4AI5A 1P7MA 3N0UA 5AN4A 3S6IA 3FHFA 4AI4A 3CVSA 1HU0A 1KG3A 3CWSA 4YOQA 4EJZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3N5N X;  1PU8 A;  3I0W A;  2NOH A;  3KNT A;  4B23 A;  2OFI A;  4EW0 A;  2JHJ A;  1XQO A;  4HSB A;  1YQR A;  3FSP A;  1KO9 A;  2YG8 A;  1YQL A;  4B22 A;  2YG9 A;  4E9E A;  3D4V A;  2NOI A;  3OH6 A;  3IH7 A;  2I5W A;  4OFE A;  1KQJ A;  5CHZ A;  2JG6 A;  1M3Q A;  4EW4 A;  1RRQ A;  4EA4 A;  1LWW A;  2NOF A;  1PU7 A;  3CWT A;  1MUY A;  1PVS A;  1MUD A;  4DK9 A;  4YPR A;  1LWV A;  1NKU A;  5KN9 A;  2OFK A;  4E9G A;  4EA5 A;  5DPK A;  4OFA A;  1KG5 A;  4UOB A;  1WEI A;  4AIA A;  3OGD A;  3F0Z A;  3CWU A;  1N39 A;  3FHG A;  5KN8 A;  3OH9 A;  1M3H A;  1YQM A;  1KG7 A;  1LMZ A;  1VRL A;  1KG2 A;  1P59 A;  2JHN A;  4EJY A;  1MUN A;  2ABK A;  3KTU A;  1WEG A;  2NOE A;  4PII A;  2H56 A;  2NOZ A;  1N3A A;  4B21 A;  1N3C A;  1XQP A;  3CWA A;  3CVT A;  1KEA A;  4E9F A;  1DIZ A;  1FN7 A;  3IHO A;  1WEF A;  4YPH A;  4OFH A;  4E9H A;  1EBM A;  4B24 A;  3I0X A;  1RRS A;  1LWY A;  1KG6 A;  3F10 A;  1MPG A;  4EVV A;  2NOL A;  1ORN A;  4UNF A;  2NOB A;  3G0Q A;  3CW7 A;  1XG7 A;  2XHI A;  1YQK A;  1ORP A;  1PU6 A;  1KG4 A;  1NGN A;  4AI5 A;  1P7M A;  3N0U A;  5AN4 A;  3S6I A;  3FHF A;  4AI4 A;  3CVS A;  1HU0 A;  1KG3 A;  3CWS A;  4YOQ A;  4EJZ A; 
#chains in the Genus database with same CATH topology
 3N5N X;  1PU8 A;  3I0W A;  2NOH A;  3KNT A;  4B23 A;  3S3N A;  2OFI A;  4EW0 A;  2JHJ A;  1XQO A;  4HSB A;  1YQR A;  4E7K A;  3FSP A;  1KO9 A;  2YG8 A;  1YQL A;  4B22 A;  2YG9 A;  4E9E A;  3OY9 A;  3D4V A;  2NOI A;  3OH6 A;  3IH7 A;  3OYI A;  4E7I A;  2I5W A;  4OFE A;  5FRM A;  1KQJ A;  5CHZ A;  4BDY A;  4E7H A;  3L2V A;  2JG6 A;  4E7J A;  1M3Q A;  4EW4 A;  1RRQ A;  3L2W A;  4EA4 A;  3VW4 A;  1LWW A;  2NOF A;  1PU7 A;  3LCN A;  3CWT A;  1MUY A;  1PVS A;  1MUD A;  4DK9 A;  4YPR A;  1LWV A;  1NKU A;  3L2U A;  5KN9 A;  2OFK A;  4E9G A;  4EA5 A;  5DPK A;  4OFA A;  3OS2 A;  3OYE A;  1KG5 A;  4UOB A;  3OYG A;  1WEI A;  4AIA A;  3OGD A;  4ZTF A;  3F0Z A;  3OYA A;  3CWU A;  1N39 A;  3FHG A;  5KN8 A;  3OH9 A;  1M3H A;  1U84 A;  1YQM A;  5FRO A;  1KG7 A;  1LMZ A;  1VRL A;  1KG2 A;  1P59 A;  2JHN A;  4EJY A;  3OYD A;  1MUN A;  3OYL A;  3OYK A;  3S3M A;  4BE1 A;  2ABK A;  3KTU A;  4ZTJ A;  1WEG A;  2NOE A;  4PII A;  2V75 A;  5FRN A;  2H56 A;  3OYJ A;  3R2X C;  1N3A A;  4B21 A;  2NOZ A;  1N3C A;  1XQP A;  3CWA A;  3L2Q A;  3CVT A;  3OYH A;  1KEA A;  3OYB A;  2W04 A;  4E9F A;  1DIZ A;  1FN7 A;  3IHO A;  1WEF A;  4YPH A;  4OFH A;  4E9H A;  1EBM A;  4B24 A;  3OS1 A;  4BE0 A;  4BAC A;  4E7L A;  3I0X A;  1RRS A;  1LWY A;  1KG6 A;  3F10 A;  1MPG A;  4EVV A;  2NOL A;  4IKF A;  3OS0 A;  1ORN A;  3L2R A;  3S3O A;  4UNF A;  2NOB A;  3G0Q A;  3CW7 A;  1XG7 A;  3OYF A;  2W03 A;  2XHI A;  3OYC A;  1YQK A;  1ORP A;  1PU6 A;  4BE2 A;  1KG4 A;  4BDZ A;  1NGN A;  4AI5 A;  1P7M A;  3N0U A;  4NZG A;  5AN4 A;  3S6I A;  2JPS A;  3FHF A;  3OYM A;  4AI4 A;  3OYN A;  3CVS A;  1HU0 A;  1KG3 A;  3NNQ A;  3CWS A;  4YOQ A;  4EJZ A; 
#chains in the Genus database with same CATH homology
 3N5N X;  1PU8 A;  3I0W A;  2NOH A;  3KNT A;  4B23 A;  2OFI A;  4EW0 A;  2JHJ A;  1XQO A;  4HSB A;  1YQR A;  3FSP A;  1KO9 A;  2YG8 A;  1YQL A;  4B22 A;  2YG9 A;  4E9E A;  3D4V A;  2NOI A;  3OH6 A;  3IH7 A;  2I5W A;  4OFE A;  1KQJ A;  5CHZ A;  2JG6 A;  1M3Q A;  4EW4 A;  1RRQ A;  4EA4 A;  1LWW A;  2NOF A;  1PU7 A;  3CWT A;  1MUY A;  1PVS A;  1MUD A;  4DK9 A;  4YPR A;  1LWV A;  1NKU A;  5KN9 A;  2OFK A;  4E9G A;  4EA5 A;  5DPK A;  4OFA A;  1KG5 A;  4UOB A;  1WEI A;  4AIA A;  3OGD A;  3F0Z A;  3CWU A;  1N39 A;  3FHG A;  5KN8 A;  3OH9 A;  1M3H A;  1YQM A;  1KG7 A;  1LMZ A;  1VRL A;  1KG2 A;  1P59 A;  2JHN A;  4EJY A;  1MUN A;  2ABK A;  3KTU A;  1WEG A;  2NOE A;  4PII A;  2H56 A;  2NOZ A;  1N3A A;  4B21 A;  1N3C A;  1XQP A;  3CWA A;  3CVT A;  1KEA A;  4E9F A;  1DIZ A;  1FN7 A;  3IHO A;  1WEF A;  4YPH A;  4OFH A;  4E9H A;  1EBM A;  4B24 A;  3I0X A;  1RRS A;  1LWY A;  1KG6 A;  3F10 A;  1MPG A;  4EVV A;  2NOL A;  1ORN A;  4UNF A;  2NOB A;  3G0Q A;  3CW7 A;  1XG7 A;  2XHI A;  1YQK A;  1ORP A;  1PU6 A;  1KG4 A;  1NGN A;  4AI5 A;  1P7M A;  3N0U A;  5AN4 A;  3S6I A;  3FHF A;  4AI4 A;  3CVS A;  1HU0 A;  1KG3 A;  3CWS A;  4YOQ A;  4EJZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...