2H56A

Crystal structure of dna-3-methyladenine glycosidase (10174367) from bacillus halodurans at 2.55 a resolution
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
218
structure length
218
Chain Sequence
HMRYFSTDSPEVKTIVAQDSRLFQFIEIAGEVQLPTKPNPFQSLVSSIVEQQLSIKAASAIYGRVEQLVGGALEKPEQLYRVSDEALRQAGVSKRKIEYIRHVCEHVESGRLDFTELEGAEATTVIEKLTAIKGIGQWTAEMFMMFSLGRLDVLSVGDVGLQRGAKWLYGNGEGDGKKLLIYHGKAWAPYETVACLYLWKAAGTFAEEYRSLEELLHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-3-methyladenine glycosidase
publication title Crystal structure of DNA-3-methyladenine glycosidase (10174367) from Bacillus halodurans at 2.55 A resolution
rcsb
source organism Bacillus halodurans
molecule tags Hydrolase
total genus 70
structure length 218
sequence length 218
chains with identical sequence B, C
ec nomenclature ec 3.2.2.-:
pdb deposition date 2006-05-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00730 HhH-GPD HhH-GPD superfamily base excision DNA repair protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.340.30 Mainly Alpha Orthogonal Bundle Endonuclease III; domain 1 Hypothetical protein; domain 2 2h56A02
1.10.1670.40 Mainly Alpha Orthogonal Bundle Endonuclease Iii, domain 2 Endonuclease Iii, domain 2 2h56A01
1MUNA 3I0WA 4E9HA 2JG6A 1N3CA 1XG7A 1M3QA 3I0XA 1YQLA 1PU7A 4OFHA 3FHFA 4EA4A 4OFEA 4E9GA 1NKUA 1KG6A 4YPHA 1DIZA 3F0ZA 5KN9A 1VRLA 1FN7A 3IHOA 2JHNA 4EA5A 3F10A 4PIIA 2NOHA 3KTUA 1LWVA 2I5WA 2YG9A 1ORNA 4B21A 1MUYA 4YOQA 1NGNA 3N0UA 2YG8A 2NOZA 1XQPA 1LMZA 1RRSA 1KQJA 1WEIA 4E9FA 3OH6A 1KG7A 4EVVA 3OGDA 1MPGA 4HSBA 3N5NX 3OH9A 5DPKA 1N39A 4E9EA 4OFAA 4B23A 4EJZA 1PVSA 1MUDA 4YPRA 2OFKA 4EW4A 1YQMA 2ABKA 1PU8A 4AIAA 4UNFA 1N3AA 1KO9A 3IH7A 3CWUA 4EJYA 1LWYA 5CHZA 1KG2A 1KG5A 2NOFA 2XHIA 3FSPA 5AN4A 1YQRA 1WEGA 2NOEA 1XQOA 3FHGA 3KNTA 3CVSA 2H56A 1KG3A 1EBMA 1P59A 5KN8A 1YQKA 2NOIA 3CWTA 1KG4A 3S6IA 2OFIA 4AI5A 1WEFA 3CWAA 1M3HA 1LWWA 2NOBA 4B22A 4DK9A 1ORPA 4AI4A 1HU0A 3CVTA 3CW7A 2NOLA 3CWSA 2JHJA 3D4VA 1P7MA 3G0QA 1PU6A 4EW0A 4B24A 4UOBA 1RRQA 1KEAA
chains in the Genus database with same CATH superfamily
1MUNA 3I0WA 4E9HA 2JG6A 3OYLA 1N3CA 3L2VA 1XG7A 3L2QA 1M3QA 2JPSA 3I0XA 1YQLA 1PU7A 3L2UA 4OFHA 3FHFA 4EA4A 4BDYA 4OFEA 4E9GA 1NKUA 1KG6A 4BE2A 4E7LA 4YPHA 1DIZA 4E7JA 2W03A 3OYAA 3F0ZA 5KN9A 1VRLA 1FN7A 3IHOA 2JHNA 4EA5A 3F10A 4PIIA 2NOHA 3KTUA 1LWVA 3OYNA 2I5WA 2YG9A 4BE1A 2W04A 1ORNA 4B21A 1MUYA 4YOQA 1NGNA 3N0UA 2YG8A 3OS0A 3L2RA 3VW4A 3OS2A 2NOZA 1XQPA 1LMZA 4BACA 1RRSA 3LCNA 5FRMA 1KQJA 1WEIA 4E9FA 1U84A 3OH6A 1KG7A 4EVVA 3S3NA 3OGDA 1MPGA 4HSBA 3N5NX 3OH9A 3OYIA 5DPKA 1N39A 3OYJA 4E7IA 4E9EA 4OFAA 4B23A 4EJZA 1PVSA 3OYKA 1MUDA 3OYHA 4YPRA 2OFKA 4EW4A 1YQMA 3OY9A 2ABKA 3S3OA 3OS1A 4BE0A 1PU8A 4AIAA 4UNFA 4ZTJA 1N3AA 5FRNA 1KO9A 3IH7A 3CWUA 4EJYA 1LWYA 5CHZA 1KG2A 1KG5A 2NOFA 2XHIA 3FSPA 5AN4A 4E7KA 3L2WA 1YQRA 1WEGA 2NOEA 4BDZA 5FROA 1XQOA 4NZGA 3FHGA 3KNTA 3CVSA 2H56A 1KG3A 1EBMA 4ZTFA 1P59A 5KN8A 1YQKA 2NOIA 3CWTA 3R2XC 1KG4A 3S6IA 2OFIA 4AI5A 1WEFA 3CWAA 3OYFA 1M3HA 1LWWA 4E7HA 2NOBA 4B22A 3S3MA 4DK9A 2V75A 1ORPA 3OYEA 4AI4A 1HU0A 3CVTA 3CW7A 2NOLA 3NNQA 4IKFA 3OYGA 3CWSA 2JHJA 3D4VA 3OYDA 3OYCA 1P7MA 3G0QA 1PU6A 4EW0A 4B24A 3OYMA 4UOBA 3OYBA 1RRQA 1KEAA
chains in the Genus database with same CATH topology
1MUNA 3I0WA 4E9HA 2JG6A 1N3CA 1XG7A 1M3QA 3I0XA 1YQLA 1PU7A 4OFHA 3FHFA 4EA4A 4OFEA 4E9GA 1NKUA 1KG6A 4YPHA 1DIZA 3F0ZA 5KN9A 1VRLA 1FN7A 3IHOA 2JHNA 4EA5A 3F10A 4PIIA 2NOHA 3KTUA 1LWVA 2I5WA 2YG9A 1ORNA 4B21A 1MUYA 4YOQA 1NGNA 3N0UA 2YG8A 2NOZA 1XQPA 1LMZA 1RRSA 1KQJA 1WEIA 4E9FA 3OH6A 1KG7A 4EVVA 3OGDA 1MPGA 4HSBA 3N5NX 3OH9A 5DPKA 1N39A 4E9EA 4OFAA 4B23A 4EJZA 1PVSA 1MUDA 4YPRA 2OFKA 4EW4A 1YQMA 2ABKA 1PU8A 4AIAA 4UNFA 1N3AA 1KO9A 3IH7A 3CWUA 4EJYA 1LWYA 5CHZA 1KG2A 1KG5A 2NOFA 2XHIA 3FSPA 5AN4A 1YQRA 1WEGA 2NOEA 1XQOA 3FHGA 3KNTA 3CVSA 2H56A 1KG3A 1EBMA 1P59A 5KN8A 1YQKA 2NOIA 3CWTA 1KG4A 3S6IA 2OFIA 4AI5A 1WEFA 3CWAA 1M3HA 1LWWA 2NOBA 4B22A 4DK9A 1ORPA 4AI4A 1HU0A 3CVTA 3CW7A 2NOLA 3CWSA 2JHJA 3D4VA 1P7MA 3G0QA 1PU6A 4EW0A 4B24A 4UOBA 1RRQA 1KEAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1MUN A;  3I0W A;  4E9H A;  2JG6 A;  1N3C A;  1XG7 A;  1M3Q A;  3I0X A;  1YQL A;  1PU7 A;  4OFH A;  3FHF A;  4EA4 A;  4OFE A;  4E9G A;  1NKU A;  1KG6 A;  4YPH A;  1DIZ A;  3F0Z A;  5KN9 A;  1VRL A;  1FN7 A;  3IHO A;  2JHN A;  4EA5 A;  3F10 A;  4PII A;  2NOH A;  3KTU A;  1LWV A;  2I5W A;  2YG9 A;  1ORN A;  4B21 A;  1MUY A;  4YOQ A;  1NGN A;  3N0U A;  2YG8 A;  2NOZ A;  1XQP A;  1LMZ A;  1RRS A;  1KQJ A;  1WEI A;  4E9F A;  3OH6 A;  1KG7 A;  4EVV A;  3OGD A;  1MPG A;  4HSB A;  3N5N X;  3OH9 A;  5DPK A;  1N39 A;  4E9E A;  4OFA A;  4B23 A;  4EJZ A;  1PVS A;  1MUD A;  4YPR A;  2OFK A;  4EW4 A;  1YQM A;  2ABK A;  1PU8 A;  4AIA A;  4UNF A;  1N3A A;  1KO9 A;  3IH7 A;  3CWU A;  4EJY A;  1LWY A;  5CHZ A;  1KG2 A;  1KG5 A;  2NOF A;  2XHI A;  3FSP A;  5AN4 A;  1YQR A;  1WEG A;  2NOE A;  1XQO A;  3FHG A;  3KNT A;  3CVS A;  2H56 A;  1KG3 A;  1EBM A;  1P59 A;  5KN8 A;  1YQK A;  2NOI A;  3CWT A;  1KG4 A;  3S6I A;  2OFI A;  4AI5 A;  1WEF A;  3CWA A;  1M3H A;  1LWW A;  2NOB A;  4B22 A;  4DK9 A;  1ORP A;  4AI4 A;  1HU0 A;  3CVT A;  3CW7 A;  2NOL A;  3CWS A;  2JHJ A;  3D4V A;  1P7M A;  3G0Q A;  1PU6 A;  4EW0 A;  4B24 A;  4UOB A;  1RRQ A;  1KEA A; 
#chains in the Genus database with same CATH topology
 1MUN A;  3I0W A;  4E9H A;  2JG6 A;  3OYL A;  1N3C A;  3L2V A;  1XG7 A;  3L2Q A;  1M3Q A;  2JPS A;  3I0X A;  1YQL A;  1PU7 A;  3L2U A;  4OFH A;  3FHF A;  4EA4 A;  4BDY A;  4OFE A;  4E9G A;  1NKU A;  1KG6 A;  4BE2 A;  4E7L A;  4YPH A;  1DIZ A;  4E7J A;  2W03 A;  3OYA A;  3F0Z A;  5KN9 A;  1VRL A;  1FN7 A;  3IHO A;  2JHN A;  4EA5 A;  3F10 A;  4PII A;  2NOH A;  3KTU A;  1LWV A;  3OYN A;  2I5W A;  2YG9 A;  4BE1 A;  2W04 A;  1ORN A;  4B21 A;  1MUY A;  4YOQ A;  1NGN A;  3N0U A;  2YG8 A;  3OS0 A;  3L2R A;  3VW4 A;  3OS2 A;  2NOZ A;  1XQP A;  1LMZ A;  4BAC A;  1RRS A;  3LCN A;  5FRM A;  1KQJ A;  1WEI A;  4E9F A;  1U84 A;  3OH6 A;  1KG7 A;  4EVV A;  3S3N A;  3OGD A;  1MPG A;  4HSB A;  3N5N X;  3OH9 A;  3OYI A;  5DPK A;  1N39 A;  3OYJ A;  4E7I A;  4E9E A;  4OFA A;  4B23 A;  4EJZ A;  1PVS A;  3OYK A;  1MUD A;  3OYH A;  4YPR A;  2OFK A;  4EW4 A;  1YQM A;  3OY9 A;  2ABK A;  3S3O A;  3OS1 A;  4BE0 A;  1PU8 A;  4AIA A;  4UNF A;  4ZTJ A;  1N3A A;  5FRN A;  1KO9 A;  3IH7 A;  3CWU A;  4EJY A;  1LWY A;  5CHZ A;  1KG2 A;  1KG5 A;  2NOF A;  2XHI A;  3FSP A;  5AN4 A;  4E7K A;  3L2W A;  1YQR A;  1WEG A;  2NOE A;  4BDZ A;  5FRO A;  1XQO A;  4NZG A;  3FHG A;  3KNT A;  3CVS A;  2H56 A;  1KG3 A;  1EBM A;  4ZTF A;  1P59 A;  5KN8 A;  1YQK A;  2NOI A;  3CWT A;  3R2X C;  1KG4 A;  3S6I A;  2OFI A;  4AI5 A;  1WEF A;  3CWA A;  3OYF A;  1M3H A;  1LWW A;  4E7H A;  2NOB A;  4B22 A;  3S3M A;  4DK9 A;  2V75 A;  1ORP A;  3OYE A;  4AI4 A;  1HU0 A;  3CVT A;  3CW7 A;  2NOL A;  3NNQ A;  4IKF A;  3OYG A;  3CWS A;  2JHJ A;  3D4V A;  3OYD A;  3OYC A;  1P7M A;  3G0Q A;  1PU6 A;  4EW0 A;  4B24 A;  3OYM A;  4UOB A;  3OYB A;  1RRQ A;  1KEA A; 
#chains in the Genus database with same CATH homology
 1MUN A;  3I0W A;  4E9H A;  2JG6 A;  1N3C A;  1XG7 A;  1M3Q A;  3I0X A;  1YQL A;  1PU7 A;  4OFH A;  3FHF A;  4EA4 A;  4OFE A;  4E9G A;  1NKU A;  1KG6 A;  4YPH A;  1DIZ A;  3F0Z A;  5KN9 A;  1VRL A;  1FN7 A;  3IHO A;  2JHN A;  4EA5 A;  3F10 A;  4PII A;  2NOH A;  3KTU A;  1LWV A;  2I5W A;  2YG9 A;  1ORN A;  4B21 A;  1MUY A;  4YOQ A;  1NGN A;  3N0U A;  2YG8 A;  2NOZ A;  1XQP A;  1LMZ A;  1RRS A;  1KQJ A;  1WEI A;  4E9F A;  3OH6 A;  1KG7 A;  4EVV A;  3OGD A;  1MPG A;  4HSB A;  3N5N X;  3OH9 A;  5DPK A;  1N39 A;  4E9E A;  4OFA A;  4B23 A;  4EJZ A;  1PVS A;  1MUD A;  4YPR A;  2OFK A;  4EW4 A;  1YQM A;  2ABK A;  1PU8 A;  4AIA A;  4UNF A;  1N3A A;  1KO9 A;  3IH7 A;  3CWU A;  4EJY A;  1LWY A;  5CHZ A;  1KG2 A;  1KG5 A;  2NOF A;  2XHI A;  3FSP A;  5AN4 A;  1YQR A;  1WEG A;  2NOE A;  1XQO A;  3FHG A;  3KNT A;  3CVS A;  2H56 A;  1KG3 A;  1EBM A;  1P59 A;  5KN8 A;  1YQK A;  2NOI A;  3CWT A;  1KG4 A;  3S6I A;  2OFI A;  4AI5 A;  1WEF A;  3CWA A;  1M3H A;  1LWW A;  2NOB A;  4B22 A;  4DK9 A;  1ORP A;  4AI4 A;  1HU0 A;  3CVT A;  3CW7 A;  2NOL A;  3CWS A;  2JHJ A;  3D4V A;  1P7M A;  3G0Q A;  1PU6 A;  4EW0 A;  4B24 A;  4UOB A;  1RRQ A;  1KEA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...