2H5EA

Crystal structure of e.coli polypeptide release factor rf3
Total Genus 137
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
137
sequence length
527
structure length
488
Chain Sequence
LSPYLQEVAKRRTFAIISHPDAGKTTITEKVLLFGQITTSVMQFPYHDCLVNLLDTPGHEDFSEDTYRTLTAVDCCLMVIDAAKGVEDRTRKLMEVTRLRDTPILTFMNKLDRDIRDPMELLDEVENELKIGCAPITWPIGCGKLFKGVYHLYKDETYLYQSGKGHTIQEVRIVKGLNNPDLDAAVGEDLAQQLRDELELVKGASNEFDKELFLAGEITPVFFGTALGNFGVDHMLDGLVEWAPAPMPRQTDTRTVEASEDKFTGFVFKIQANMDPKHRDRVAFMRVVSGKYEKGMKLRQVRTAKDVVISDALTFMAVEEAYPGDILGLHNHGTIQIGDTFTQGEMMKFTGIPNFAPELFRRIRLKDPKQLLKGLVQLSEEGAVQVFRPISNNDLIVGAVGVLQFDVVVARLKSEYNVEAVYESVNVATARWVECADAKKFEEFKRKNESQLALDGGDNLAYIATSMVNLRLAQERYPDVQFHQTREH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title RF3 induces ribosomal conformational changes responsible for dissociation of class I release factors
pubmed doi rcsb
source organism Escherichia coli
molecule tags Translation
molecule keywords Peptide chain release factor RF-3
total genus 137
structure length 488
sequence length 527
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-05-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00009 GTP_EFTU Elongation factor Tu GTP binding domain
A PF03144 GTP_EFTU_D2 Elongation factor Tu domain 2
A PF16658 RF3_C Class II release factor RF3, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.3280 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2h5eA03
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2h5eA02
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2h5eA01
2IEZA 4ESHA 5DISB 2IYVA 3AVUA 3A6PC 1I4TD 2QT0A 4IOMA 3DMDA 4PC2A 5JI3E 4D0NA 3ZD6A 4D4LA 2P5SA 2Q9CA 4C0QC 2XITA 2O8FB 3C5HA 1GVNB 3QKUA 1LV7A 2YOHA 4QM6A 2O0HA 3OEHA 4DLSA 4XD7A 2ZSDA 3DEFA 4UJ5A 2H92A 2IW3A 4G5RA 1E2HA 1I2MA 1WXQA 3TK1A 4BLPA 1R2QA 1X1RA 3NEJA 3UPUA 4Q5IA 4MGZR 3U5ZB 2ZM5A 1UKYA 2EFGA 1QBKC 1Z08A 3WBJA 1LB1B 5K8UA 2WV9A 1NMZA 4HYYA 4RFSB 4URVR 1FP6A 2KJQA 2RGNC 4QL3A 1ZAKA 3CH4B 1W4BA 2H17A 1AA9A 2Z5FA 2BIFA 1BH2A 3K0CA 5EUMA 2WJVA 3FTQA 1QHXA 3OE7A 4G5SA 3MWYW 1KY3A 1TPZA 3AF1A 2A5GA 2XTNA 2P2LA 1UKVY 3A4NA 3OE7D 4QHTA 1QHNA 2C78A 3B7GA 1US8A 5FOTA 5JS8A 2H8KA 1S96A 5JJLA 4XSGA 2FG5A 1HUQA 1UF9A 1OT3A 1XD2B 1N0WA 3GPLA 3W6OA 4O2LA 4B76A 4A1FA 4MRSA 4UNQA 4BECA 3VKGA 4W5WA 1VYUA 4GOKA 4GZMA 2R6AA 4Q18A 4Y0AA 2WSSA 1AQYA 5FH9A 3Q7PA 4JLDA 2ZROA 2VP6A 4LJ9A 4WIAA 5CM9C 5BXQC 1WB9A 4IFEA 2WJIA 4NYIR 1NG9A 1OXVA 4QBHA 1XCPA 1S2MA 2CJWB 1A5TA 1TUIA 4V0LA 2NO7A 4C0AC 2QSZA 3THXB 1DAGA 1OXSC 1QVAA 2Z4SA 3NHAA 3AVVA 2ZETA 3GLIA 3OFND 5DI3B 2LKCA 2CE7A 4PPGA 5EXPA 3OAAA 5AWFC 3IILA 1JAHA 5BQ5A 5KSYA 3LRPA 1OH5A 1BYIA 1II9A 1FOEB 4Q47A 3AVOA 3GQBA 1SVKA 1ZC3A 3RHFA 2QU8A 2FH5B 3QXCA 4NP6A 3UMFA 4UXIA 4TZ6A 5C4GB 3SJCA 4LWZA 4TLBA 5FOSA 4D6PA 1KJWA 1EX6A 2JASA 1XTKA 2QMOA 3F8TA 5CLLA 2RGBA 1F60A 4QC2A 1G21E 4TYQA 2PT7A 1XEFA 3BH6A 3AF0A 1KZ7B 4EQ6B 1YR8A 4JJKA 4KO8A 3TNFA 1W5TA 1GAJA 1KI6B 3GFOA 3CNNA 2NPFA 3IIMA 3SFZA 2H1LA 4TSFA 1WBDA 4A2QA 2A5FA 4TMZA 5B30A 1NP6A 1HA3A 1TF7A 4DT1B 1VCNA 1PUIA 3F0TA 3KKOA 4HAXA 4P4SB 2MSDB 3AP3A 2RGEA 2IUTA 3BE4A 4CW7A 2WJYA 1Y3AA 2J87A 1GKUB 2XXAA 5GJCA 1IHUA 5DLQC 1KMHB 2NO6A 2PEZA 4LBZA 4RCYA 3ZIAD 2W6ID 1EFCA 5DH9A 4TLEA 4C0HA 2CE2X 3I72A 3UWOA 3ZVMA 2IT1A 2ZS9A 5FTJA 5J4VA 1H8EA 4B3DA 1TQ2A 1T3LA 3FPAA 3PUVA 3LQQA 1JI0A 2PZGA 2CBZA 621PA 3RS3A 4LOAA 4UXHA 3C15C 4MKIA 4Q66C 3QI2A 2QRNA 4MRPA 4IXMA 5TVKA 4OI4A 5FOWA 3SZRA 2VF8A 2VSXA 4M9ZA 2C2HA 3ADBA 1P9WA 2AFIE 4OJQA 1RRCA 2FNAA 1Z63A 2BV3A 1YKSA 1G8PA 1SVLA 2ZSBA 3GJ5A 1G5RA 3IBGA 3I8XA 1Z5ZA 3A1UA 4CYMA 2CL6X 4IDNA 3I3SR 4YDHB 3LBNA 1ZD1A 1R0XA 2EWWA 4EQ6A 3R9WA 1N5KA 3TW4A 1U90A 2BEKA 4M22A 3KQNA 3AP2A 4KVGA 4G5QA 2X1VA 5SZKB 1E1QA 1T3HA 2QGNA 4TLDA 5AJYA 5CDFE 1WF3A 2BDTA 1N0VC 1J70A 5JWHA 5C4MA 2X19A 1NIJA 1TQ4A 1NKSA 4MGYR 2V3CC 2VF7A 3CX6A 1QHGA 5G3ZA 2IUUA 3VMFA 2VEDA 5EE3A 3TIFA 4HI0E 2WKRA 1D2MA 1DEKA 2V1XA 2YC2C 1R6BX 4JT4A 4TL7A 3K9GA 5EZ5A 1J8MF 1G5TA 5E3HA 4KITB 5KSPA 4BFUA 3B82A 2D62A 2GWHA 3CB4A 5B57C 1XMIA 2HJGA 2ZRDA 3MJHA 4TMWA 3T61A 2R6DA 1XD8A 4LI0A 1G7RA 5J5CA 2WZQA 4RCZA 2JDID 2IYRA 1JALA 5EE9A 1GP2A 2GJSA 2WIAA 2BM1A 2ZYUX 5L3SA 2QBYB 2YWGA 3UXMA 2X2EA 2J46A 2ERYA 3LO5A 4TYPA 1LTQA 3VR4A 4YMVA 2BBTA 1ODFA 3D7MA 1IXZA 3DVLA 4JLAA 1ZM9A 2FFHA 2JJ8A 2RGGA 3H84A 3UG7A 4BZQA 2JEOA 3LNCA 2BHRA 4RD2A 2JJ2D 1P9NA 2ATVA 1YRBA 2BKUA 1ZNZA 4FMBB 1M7GA 5AUQA 4TTRA 5FI0B 2WPDD 1OV4A 3HJNA 2YWHA 4TT3D 4FWIB 2AKYA 2OESA 1OH6A 3VTKA 4BRUA 3SQXA 3BOSA 1E4VA 1SXJE 2CHQA 4M1MA 1YZQA 2IYTA 4QNMA 4HLCA 3TUIC 2PZFA 2WMNB 1GNQA 4LBYA 4A6PA 1ZJ6A 2KSQA 4PC7A 4WZAE 4NE2A 5AK0A 3EZ6A 1WA5A 3O8BA 4A82A 3DZDA 2IBMA 3VQTA 1P2SA 2RMKA 2VYFA 3LW7A 4AIIA 2WJGA 1GDDA 2Q0HA 4NYMR 2QTFA 4GOJA 4JVNA 4NCIA 1KAGA 2V1UA 3L2OB 5KHOC 5IRCD 1KDTA 4I1SA 3X1WA 1CR1A 2GZAA 3JVVA 2IYYA 3C14C 4F92B 3FGNA 2WIBA 4JYBA 2W0SA 4HB2A 4TLAA 5G53C 2NO1A 1W36C 1WBBA 2BWJA 2WWFA 5FTKA 5CK4A 5UKDA 1COWD 2ATXA 1S4QA 2FJUA 2OBNA 3TUZC 4FMDF 3Q5EA 1ONBA 4E5UA 1F2TA 3NBZC 3TBKA 1PV4A 2RGAA 3RNLA 3P26A 2RKOA 3OFNA 4LYJA 4MUBA 1X8LA 5FI1B 4PAOA 4W5HA 2GAAA 4B3GA 5HZKA 2EW1A 1D8TA 3KQUA 4N3NA 2HT1A 4Y0VA 4MKHA 2OM2A 2ZREA 1G4AE 4DZZA 2Q3MA 4YMTA 5KDOA 1XNJA 1RC8A 1UFQA 1A4RA 1FPMA 2G1KA 3CONA 1MO6A 5HKKD 5FUXA 2GJ8A 5ANRB 3IIKA 2R65A 4DUGA 1VCOA 2FSFA 3RWMB 3FMOB 3SHFA 2BJVA 1A1VA 2WOOA 4QJ4A 5A4JA 2FE4A 3BFXA 4JVSB 1EGAA 4H1UA 3BS4A 2Q3HA 1KMHA 2IYZA 4F7WA 3QKRB 4A0FA 1G18A 1VG8A 2XZPA 4BLOA 2QTVB 4V0KA 4KYIB 1Z0FA 2DFKB 3C7KA 1FQKA 5LD2C 1KJYA 4NDZA 4HATA 1XWIA 2PMDA 3PV0A 5HZHA 2QM8A 2CHGA 2X8AA 3CF2A 1OB2A 1Z3IX 4QJ5A 1T9HA 1CP2A 4DLTA 1WQ1R 1U0JA 2OZEA 2PBRA 5J4KA 2J0VA 4KSCA 1U2RA 4OQFA 2VHCA 3U3MA 5HE8A 5KOYA 2ZE8A 1NNEA 3QKTA 2P0EA 1YHNA 2N46A 1JPNA 1LVGA 1N6HA 4D0GA 2QN6A 2QP4A 2AX4A 4Q4AA 1WMSA 4XD7D 3OEHD 3EPLA 3H0KA 4LCBA 4G3XA 2J0QA 3RDPA 5JCZA 2PZEA 2CLDX 2IXGA 4IOJA 4EPVA 4V03A 1EX7A 3E5HA 3EA5A 1Q1EA 3QF4B 2N1BA 2W6JA 4QOSA 4PAMA 4ZO4A 2R9VA 5FBQB 3CZQA 3TGPA 1RJ9B 2DWOA 4LV5B 4P32A 2A2ZA 2GCOB 2W83A 1E2LA 3RRMA 4M1YA 4DLVA 3ZDQA 3ZLJA 1TAGA 3GLHE 3VHXA 1U81A 3DHWC 4M1TA 3X1ZA 5JBQA 4LSGA 4L8GA 2ZRCA 4IHQA 3W34A 1CJUC 4OHWA 1CRPA 3GCGA 4XJXA 1DOAA 3Q5DA 4BLSA 2QG6A 3BORA 2VHTA 3UATA 4AI6A 3NVAA 1I2DA 4TN1A 4FXPA 1NBMD 4N1AA 4QHSA 2JCSA 1TUEA 1TNDA 1XEXB 3CKLA 5EQTA 1K8RA 1Q1ZA 1KI7A 2EFCB 1HQYE 4AG5A 1Z83A 2YJTD 1JR3E 2OG2A 3LBIA 1VCIA 3EZFA 4DBLC 3Q7QA 4II7A 1NLYA 1AS0A 3NWJA 2F43B 1OIXA 1RRFA 4G01B 4M4SA 1YQTA 1HE1C 3P1JA 3QKSB 4TYWA 3AP1A 2GXQA 3PQCA 4FD2A 4DB4A 1SVOA 2XNSA 1ZRHA 3HU1A 2CCJA 2L0XA 2FFQA 5IDVA 4OK3A 3ZZ0A 2G77B 2QE7A 2OCBA 4TMTA 1NY6A 1FX0A 1P2VA 4PHHA 3SS8A 2R6FA 2A9KA 4U00A 1JEEA 3BB4A 4LV8B 1RKBA 2ZUBA 2XEXA 2HEIA 3G82C 1ZNYA 1ZUIA 1Z22A 1RFLA 1IOZA 4TTPA 1VYTA 4B44A 3Q3JB 2GCOA 2AD5A 4ZIRA 1XDBA 3CLVA 1RPZA 1VDZA 2OO7A 5TB5A 4I1OA 3IO5A 2OUKA 3PENA 3NEYA 4A6XA 1UBEA 5LDDC 4HUQA 3ASZA 3VAAA 1W4CA 1OFUX 3NH9A 4Q9LA 2QP9X 4B74A 2EYUA 5B58C 2D2FA 1GSIA 3D8BA 3WNDA 1XMJA 1D2EA 2ZRMA 3BERA 2F1RA 1M74A 2GKSA 1R5OA 5FL3A 3PIRA 2B8WA 5EP4A 1HURA 4HAUA 4AY2A 1KI4A 1I4LD 2QENA 4B32A 3UANA 2QP3A 2PMKA 3TRFA 3EC2A 3M4YA 1F2TB 3OAAD 1R5NA 2ZE6A 1P72A 3K9LA 4L4UA 4ZI2A 2ZRNA 3PCRB 2V9PA 4F38A 2QEQA 2J5XA 4LRWA 3BB3A 3U4QA 2GEVA 3HYTA 2G9NA 2WMOB 4KLZA 2BBSA 3BRWD 4KXFB 1KDOA 1L4UA 5H68A 1KMQA 2I1QA 4A0HA 4IEIA 4B6EA 4CIDA 1S3SA 3AVTA 2P65A 1ZM2A 1SVMA 4HB0A 2ZYVX 4WVFA 4RKEA 1E2DA 1E6CA 1U98A 4EUNA 2ODNA 3DMNA 4NPHA 3VU9A 1G8HA 3ZVLA 3QVVA 2EFHB 2RGXA 4IEEA 2C98A 4EIWA 1LW7A 3SBDA 4B34A 4CEHA 3P4YA 4CEIB 1IN7A 3I5YA 4B2IA 4ACAA 5L3QB 4JIMA 5BYKA 1VHLA 5DI9A 1UBCA 3IEUA 2W0MA 5GVSA 1KHTA 1XBTA 2NGRA 5J47A 2JLUA 3K8YA 4M0LA 1G7CA 2HF9A 1UEJA 5CDFA 4OI2A 1E94E 2D4HA 2RB4A 5DN6A 1OE0A 3REGA 1Z6GA 1N5LA 2J3EA 3KTAA 1Z0DA 2WAYA 2WKPA 3W9YA 4ARZB 2R2AA 4XTRA 5M04A 4FCWA 3FMFA 2FSGA 5KSZA 3WP0A 4Q9JA 1YR6A 1Z06A 1Z47A 1E2KA 4K46A 4K8OA 2DYKA 5HE9A 3VR1A 3LXRA 1EWQA 2FV8A 5BW8A 2BCJQ 1ZVQA 3V4FA 3KJHA 4HLDA 4W9MC 4A9AA 2JLZA 1ZNWA 4BUJA 4BFSA 4UNNA 3K9NA 4CT5A 4JL5A 1HT2E 2D7CA 2IA5A 1CJKC 2WSMA 1F6BA 4RZUA 1E9BA 2OCAA 1T0HB 1W0KA 2YZ2A 2R62A 2PCLA 3A4MA 5JJKA 1COWA 4IOKA 1KSGA 2NMVA 5KU1A 3KB1A 4NYJR 1G8GA 3UKDA 5EP1A 2OBLA 3U2QA 3PEYA 2B21A 3ONWA 2BMDA 3FE2A 5F9FA 2PL3A 4GMXA 4JZKA 4A36A 4DIEA 2EFDB 2NPIA 2EYQA 4K81B 3GLGA 3TAUA 3LLMA 1KO1A 2ZIAA 4PSKA 1BO6A 1DE0A 1A2BA 2ZJYA 1CEEA 2OV2A 1GUAA 4RVCA 1E98A 3O8RA 1M8PA 2ZS7A 1RZ3A 4MYCA 1CJVC 4MDEA 3K70C 3U4QB 5EE0A 4POAA 3KQKA 2MSCB 2EFEB 3CH5A 1ZD8A 1VG1A 5B2ZA 1ZU5A 4ILEA 4IKEA 3VR5A 5AUPB 3CRMA 3SQWA 2ZI4A 2ZITA 2D74A 1MR3F 2C9CA 1E2PA 3E1SA 4FINA 2OBMA 3C8UA 4L15A 1AK2A 1P6XA 1VMAA 3PEVA 3IGFA 1G5PA 2G3YA 2NOAA 4DJTA 3PEWA 2IHYA 2ZVQX 1Z0JA 3VU9B 1ZM3A 3DM5A 4D0LB 4C2UA 3AKDA 3RANA 1E1RD 3TAHA 1AS2A 1LNZA 2G6BA 3Q9LA 1FNNA 4GPTA 3A8TA 1G3QA 4B48A 1G16A 3GEIA 5EXTA 3GLGE 4M9SA 5DO9A 1G3IA 1IAQA 1W2HA 1EFUA 2NO9A 1II8B 3C4JA 2AWOA 2W2XA 3QNUA 1ZIOA 2DFLA 2EU8A 2O0JA 3DDCA 4Q4JA 3W8NA 1KI8A 1U8AA 1UEIA 4HDQB 2GJ9A 2V4ZA 3WNCA 2HV8A 2GILA 4Q01A 5FBLB 1J7KA 1KI1A 1KO5A 2F6RA 2UVQA 1XB2A 2HCJB 3W90A 3G5UA 1TU4A 2WICA 5JWRA 2QZ4A 1HYQA 2GA8A 3CF0A 5F9HA 3WNBA 3KJIA 3CM0A 5CYOA 5B64A 1E0AA 2PH1A 4Z8YA 2VP9A 4C4PA 3KX2A 2QQEA 1U0HC 1B23P 2RAPA 4B73A 3VKWA 4NCJA 1AS3A 3I1FA 4FN5A 3U6KA 1CULC 1E2JA 3JVUA 3W3AA 4CVNA 2H18A 2QROA 1FZQA 1OIWA 221PA 4FI3C 2ZUDA 3SJBA 1E32A 4C0LA 1IN5A 3GJ4A 3ZVNA 3MWLA 1UM8A 3T5DA 4OJKA 4HLQB 2FPKA 1DELA 3DZ8A 4HEJA 1JXOA 4RD1A 4QBGB 1NI3A 1G7TA 3C5CA 1G1MA 2NG1A 5C18A 3QKRA 5KUTA 5G40A 1AKYA 1E0KA 1VPLA 2PT5A 2Z43A 4FW9A 4AD8A 1MABB 4MGIR 3CIOA 3KUDA 1IN4A 1AQUA 4XH9B 3FFAA 4BRWA 4JLNA 1N25A 1OXXK 2JA1A 4HB3A 2BMEA 3UMSA 1H8HD 3AKYA 2C8VA 4R9UC 4YMWA 3WRXC 4EFMA 1MABA 2FSHA 2QBYA 4DCSA 2ZRAA 1V5WA 4DSTA 4QRHA 4AURA 2ZSEA 4DSUA 3KZ1E 3R9IA 1MO4A 4KVAA 2QRZA 3IIJA 4YQFA 1Q20A 1KO7A 1JR6A 4DCNA 3VNVA 4HB4A 5JS7A 1ZMXA 1XJQA 2ZI6A 1F3OA 1WDTA 1S1CA 1AM4D 2J1LA 5FTNA 2LCFA 3K0FB 4YONB 3EARA 4M21A 1FW6A 2RGDA 3U61B 4QKQA 1CS4C 2ZU0C 1A82A 4Q21A 1H65A 1E2IA 1E2MA 1Q1BA 4AG6A 1W0KD 2WJHA 3BH7A 5AJZA 3CR7A 4P31A 3TKLA 3B78A 2YVUA 2A3RA 1RRPA 1TU3A 4RY2A 2MSEB 4Q7JB 3KKNA 3B1YA 3IPYA 5DSZA 3SHWA 3GLIB 5JFGA 3RYTC 3A58B 2CLSA 4URWR 1ETUA 3H86A 3L0IB 2QI9C 1DADA 3GLIE 2A5JA 1G20E 1OHHA 3TE6A 3ZS8A 2V55B 4LHYA 4DRZA 4Q03A 1L7VC 3GFTA 5BN4A 1W0JD 4OI0A 2DWQA 1R0ZA 1QHYA 5AR1A 3TJZA 3X1YA 5CITA 3FWYA 2VSFA 1MV5A 3GD7A 3QEJA 2J7PD 5L3VA 1GFIA 2D06A 4Z54A 3Q72A 2GVZC 2J0UA 4Q4HA 1SXJA 4LX0A 4YMUA 5AJXA 5DN6D 5EP2A 5CIQA 4O0MA 4CRWB 3GJXC 1G3MA 4NCKA 4Q1CA 3QG5A 3TVDA 5H8WA 2ZRHA 4HAWA 3D31A 4PANA 4CEJB 1SGWA 4LPKA 1RVDA 5CB8A 1YZGA 1S9HA 2IS2A 2O8FA 4YXWA 2KI5A 4L5BA 2GXAA 2E87A 4TMVA 2AFHE 1D9ZA 5H1YA 2ZS8A 1GNPA 2VIIA 3I8SA 4J0QA 3WYFA 5E7IA 4LZZA 5JHGB 5JRJA 3B2EA 1DAKA 2CK3D 1UDXA 3FDIA 3P20A 4PTLA 4CZ2A 4BEBA 3SYLA 4B2LA 2ZSAA 2Q9BA 4G1UC 2OT3B 4RFSA 1CR4A 3W6NA 3QJYA 1LY1A 2JLQA 5JLJA 1E9FA 4LUCA 4OKSA 1K5DA 4BQSA 4GOXA 2H16A 1L2TA 3NDBB 4B71A 1M7HA 1VCMA 2IK8A 1P61B 3BWDD 3X1XA 2JLYA 4JL6A 4KCGA 4OQNA 4CGZA 1TQDA 1Z29A 5FR2A 3TQFA 3NBFA 3BK7A 1Z6AA 1CRQA 4BE7B 2EQBA 3K70D 4A2PA 3PVSA 3U6BA 1CXZA 3C41J 2ZRKA 1G3UA 3B1ZA 3MCAA 4HZUB 4UQOA 5JCPA 1KK0A 2H7VA 2AKAB 4NL4H 4D4KA 1M6NA 2V6IA 1PLJA 3CX7A 5BWMA 3PG5A 1J90A 1E9CA 3EA0A 2FU5C 3L43A 3W5JA 5A0FA 3MLEA 2HF8A 3LH5A 4NYMQ 3OEED 2ZANA 2GEDA 3K0FA 4Q00A 4R7ZA 2A30A 4LDJA 2ZQ5A 3A1WA 4TQAA 3TLXA 3QBVA 1KDPA 2ZAMA 3HU2A 4A2WA 4MDFA 2E1RA 4LGMA 1VIAA 1PLLA 4OI1A 1OH8A 2WJJA 5F98A 3B1VA 2GDJA 4JJZA 1XEWX 3OEEA 3NBXX 2NQ2C 3AB3A 4ZPXA 2G0TA 5K8LA 5IT5A 4YMSA 3DKVA 1YZUA 2ONKA 3BJIC 3HWSA 2XNDD 5TV2A 1W5SA 1OXTA 2F3RA 1YU9A 3R8CA 3S1AB 2FF7A 2IYLD 2JAQA 3AM1A 2PJRA 1BMFA 4BFTA 1KI2A 3EIHA 4D4MA 1W4RA 1DAHA 3EW9A 3FHCB 4JLKA 3LWNA 1XJ0A 4X8LA 2IC5A 1KSJA 2BOVA 1Z2CA 3O8CA 4CEHB 4CEIA 3PFIA 3WBKA 5KPJA 3T1VA 1J8YF 4S2EA 3FYHA 4R71A 1OH7A 2X77A 5CM8B 2NZ8A 1FL9A 3IDQA 3EASA 1XP8A 4R2HA 4I99A 4PPFA 3T5GA 1PLKA 2XSZA 2WVJA 3BBPA 3ZQJA 2BCGY 1YR9A 4KSBA 2C9YA 4A8JB 3THYA 2CEAA 3BB1A 2P6RA 2W2TA 2QAGA 4JLJA 5FR1A 1W48A 1OF1A 2V7QD 3HDTA 3WP1B 3B1WA 4ZDWA 4A15A 1MO5A 4XTCS 2XZLA 2NTYC 5D3QA 2F9MA 4V0ME 3K0SA 1XPOA 1T8UA 2JLVA 4JVMA 4DT1A 4ZKDA 3OIWA 1DVRA 1E2GA 2IF2A 3NDPA 2XGJA 1YE8A 2H5EA 2QT1A 5HCIA 3ADKA 1OJLA 1Z0AA 4LBWA 4RD6A 4WAUA 4DXAA 2J45A 1NIPA 1T0JB 2A5YB 4PHFA 2AK2A 4HAZA 5DYGA 3NG1A 1S0UA 1OYWA 3NH6A 4ABYA 4LJ8A 2ZJZA 2HXYA 2DFNA 2WWHA 4DUGD 1UBFA 4I81A 1QZXA 2P67A 4Q4JB 4CDGA 4PHTA 2IYWA 4I1VA 4LJ7A 4EJSA 3J81k 3KUCA 2DBYA 5TMPA 4MRVA 4KYUA 3CNOA 1JB1A 2WOJA 4BZXA 2WM9B 1X8KA 5KYKA 3A1TA 3AF3A 1JJVA 1JQJC 4A92A 3UIEA 2P3SA 3FOZA 1MT0A 3KFXA 2O8CA 2D2EA 3U60B 1JAIA 4XIGS 1SXJD 4UJ3A 2ZTSA 1L8QA 2QAJA 4Q4AB 3LQRA 3RS2A 3U44A 1IXSB 3KXLA 4Q1DA 1W0JA 4Q7KA 1NLFA 1C1YA 1E2NA 1GTVA 2CMKA 3UK6A 5FTMA 5CJ2A 2JLRA 1TEVA 3QIAA 4DIDA 2QGZA 1E2FA 3OF5A 4TL8A 2VHUA 4UXJA 4F4CA 1XMSA 4PO8A 5KPDA 2VA8A 4P4SA 2F55A 1TF2A 3A1SA 5GJWC 1TX4B 5CJPA 3CBQA 2PLRA 1RYHA 3K70B 2X2FA 3EZ9A 1E2QA 5DHAA 1MRSA 1GL9B 4MKGA 4OL0A 4WZBE 4D81A 4TL6A 2GBLC 1GG2A 2V54A 4WOPA 3IKJA 2ZJ8A 4BFWA 4MA4A 3VR2A 1QDEA 4BZPA 3G0HA 1ZNXA 4JL8A 3VKHA 1IY1A 1G8FA 1RRGA 2QQ0A 3QE0A 4ZDKA 4IVPA 5EJEA 3DPUA 2OSBA 4BLQA 2FEOA 4PZYA 8OHMA 1R10A 1M1YE 4PPNA 1NN0A 4E03A 1YZKA 1DAMA 1ZM4A 1AN0A 1E9EA 4C7OB 2ORWA 1NG1A 2W2VA 4GMDA 4BFZA 2PX0A 4FCVA 2IUSA 3L8ZA 2GJKA 2O8BA 3QEOA 4YLGA 2VSOA 4HDCA 4LBVA 3B6EA 3IPXA 2O8BB 2CDNA 3QKSA 3PJRA 1QRAA 3GLFB 2F43A 3T1QA 4EJSC 4WXRA 3LXXA 3T12A 5CLQA 3A4LA 2REXB 4DSOA 1VECA 1X3SA 2G1JA 2UZ3A 1FX0B 3SN6A 2C5LA 4LPSA 5DYIA 1CLUA 4UNRA 2EVWX 2JDIA 3MAAC 4M2LA 1RE0A 4WZ6A 4PSVA 4BPBA 5FOUA 4C30A 4FWTA 4JMPA 2FWRA 4ZI3A 4UKDA 4P0TA 1IY2A 2XZOA 1RJ9A 4OQMA 4D2IA 4C0KA 1NN3A 4Q1BA 2ZE5A 2FOLA 2ZEJA 1NRJB 1SULA 5KSOA 2ERXA 4QXAA 2AK3A 4GI7A 1Q0UA 4PZZA 4DDWA 4FIDA 4P3YA 3FVQA 3IO3A 1NY5A 5DHFA 4ASUA 3MWJA 2ZI7A 2QL6A 3RRNA 1KK2A 2FZLA 3I32A 1EFRD 5DGXA 1YVDA 6Q21A 1QHIA 3T35A 3HPRA 1EK0A 4BLRA 3A37A 2FPMA 2HJVA 1RYFA 3ZQ6A 3I73A 1NVWQ 4XOIA 2GTPA 3B1XA 1HY3A 1NN1A 3CRRA 3WHLA 2ZJAA 4HUTA 2YWEA 3K09C 1IM2A 4C0BA 3H2YA 2VRWA 3CPHA 1Z8FA 4NYJQ 4O2RA 1W4AA 4BFVA 5DIFA 5JSZB 2BMFA 4DHEA 4OBEA 3A36A 3CF6R 3RS4A 3RS0A 2DPXA 4OQXA 4RFVA 5FTLA 5EXSA 4Z1MD 4TQUS 4QBFA 2QPAA 2DCUA 3U7HB 2QPTA 5EE5B 3LY5A 1G8YA 3R20A 4DLWA 2NZJA 2QMUA 5JWOA 2O8EB 1IN8A 4V0MA 2FZ4A 4JLVA 1TADA 1NMXA 2B92A 3CPJB 4BWYA 1GITA 4R2IA 2ECKA 4RJLA 3O8DA 4DCTA 3TVTA 2XOKD 2REBA 4R98A 5CK5A 5KNDA 2O0KA 4AK9A 5C2JB 2FA9A 1R4AA 4URUR 1XEWY 3SU8A 3ND9A 1R0WA 1X8JA 1U8YA 2VH5R 1T5IA 2HXSA 2QSYA 3V00A 3PUYA 4TWZA 1NL3A 4MGKR 1Z6YA 1ZP6A 3TSWA 1FMJA 3MGCA 1XMVA 1II8A 5D3MA 1G41A 1N6RA 3OIVA 4JLOA 4XWOA 3GJ3A 1FTSA 3LAWA 4C9BA 4Z51A 2OXRA 2QA5A 4PO1A 3LX5A 3QVUA 1SVWA 2GCNA 4JYCA 2BEJA 4C3ZA 2J0UB 3B8HA 1Q1QA 3EG5A 3QPVA 4GNKA 4IDPA 2DY1A 4AWXA 2ANBA 1KOFA 2BMJA 1KYIA 1W36D 1OFTA 2GF9A 3LVRE 1E99A 3B60A 2ODBA 3KXKA 1XXHA 4US0R 3VX3A 3CPEA 4N0DA 1DAEA 1XXHB 1KO8A 3FHTA 4ITRC 4KBGA 2VHQA 3GMTA 5IK2D 2V6JA 4HDOB 3AUXA 5IF9A 1SKYE 4Q1FA 5TY0A 2BJWA 1PUJA 5EZ6B 3SFVA 4ACBA 1C9KA 3N5CA 2IX3A 4PR0A 3QPUA 1S8FA 4TTQA 3NHBA 3K09A 4M1WA 1OYYA 3K1JA 5JEDA 3PEUA 4FMDB 4G5GA 2HCBA 2OFWA 3LBHA 4TMKA 1UJ2A 5KO2A 1F48A 1SQ5A 1YR7A 3QG1A 4KLNA 2C96A 2FGJA 1W2GA 2C95A 4X8OA 3LW8A 3R7WA 1UKZA 2GZHA 5KTYA 4LHWA 1WCV1 5L3QA 3M0EA 2OHFA 1E79D 1KSHA 3OZXA 1XTIA 5JRZA 3TR0A 2PX3A 5JZVA 4JBWA 2PEYA 4M1KA 1NLZA 4ZV4A 4BLTA 2RH5A 1UPTA 2JLWA 2CHVA 2JJ1D 3KDSE 3N2EA 4KU4A 3SEAA 2ZRPA 2CK3A 2WPDA 2C9OA 4OK5A 2G0NA 2Q6TA 3IHLA 4LY6A 2ZI3A 2ZR7A 2HYIC 5KDLA 5F3WB 3FKQA 1N3BA 2KWIA 3K0CC 4DDUA 2DWPA 4W5JA 3GLHA 3WY9A 1IJFA 5J4YA 4M8NE 4XWKA 1XPRA 1N6NA 1NN5A 2IEYA 4NTZA 2XXAB 2O8EA 2ANCA 5FBRB 3MWKA 5LB2A 4URZR 1P3JA 1YJ5A 4DSNA 3EZ7A 1E0SA 3MUFA 2F1IA 4YXWD 4AKHA 4QGGA 1BIFA 5TXGA 4Q19A 2CL7X 2WWWA 3RS5A 2GCPA 4O25A 3IQWA 4EJSB 3EPJA 3X2SA 5BN5A 2ZRIA 3LX8A 3CO5A 5DNYB 4DWJA 3LA6A 4ZKEA 2OILA 4XVRA 3QUSA 2PLFA 4UNPA 1TTTA 3EWAA 4MQBA 3GJ8A 5KNCA 1OW3B 4ESVA 4JKYA 1FUKA 2WBLC 3FFBA 1ZM7A 5KDDA 2Y8EA 3F5FA 4FMCB 2SHKA 3EC1A 3ZZTA 3GLGB 3ZGXA 3EPHA 1E1QD 4JT2A 1TEXA 2FDCA 2ZR0A 1GM5A 5BN3A 1O87A 2IYUA 1ZBDA 2A5DA 3KJEA 3L8YA 3KL4A 4FMCF 4NH0A 3DO6A 4RD3A 2D3WA 5FPYA 4P33A 4P4UA 2F1HA 5ELXA 4TQ9A 3T1OA 1J99A 3E2IA 1SXJB 1GILA 4Q9IA 1JXMA 2MMCA 2ODEA 5K8TA 4BEJA 1SVSA 2WTUA 1PZNA 2QAGB 5JEEA 1KKLA 2GK7A 3ND8A 4PXAA 1GIAA 3MRSA 2AWNA 1DAIA 1B0UA 3GLFE 1IY0A 1Q12A 1HTWA 5FUVA 4IFBA 2JJ1A 2IYQA 2V7QA 1IXRC 121PA 3CZPA 4A8JC 4PPQA 4V0OA 2NO0A 2YKGA 4QGAA 2QNRA 3ZS9A 5CYPA 1GNRA 1ZYUA 4KAXA 2AXPA 3RSOA 2FMXA 4C0SA 1KAOA 1H8HA 1M2OB 4JSTA 3X1DA 4JBYA 2CCGA 5SZHB 4LHVA 1CR0A 3GEHA 4U7DA 4ERNA 1G4UR 5E7JA 2W00A 1US8B 3I92A 3VR3A 4M9XA 2CXXA 3FMPB 3E70C 4M9QA 4F4JA 1KKMA 1KZGB 2ZJ2A 4PO9A 5FOVA 2Z6VA 4KFSA 1GKYA 2IWHA 4B3FX 2GK6A 3FKSD 1R0YA 3OIUA 4EFLA 1JJ7A 1P9RA 1XJCA 3GLFA 3GLHB 1XXHE 2UZIR 3KKPA 3CNLA 4IVQA 4X8HA 5IK2A 4PC3A 1G6OA 2W6JD 3ZVRA 2VQSA 4LYFA 2FFAA 4Q1EA 1AGPA 1NSTA 4DVGA 2RHMA 3ZJYA 4B3CA 1BS1A 3NKVA 3QBTA 4EPWA 3KKQA 4I1UA 3LD9A 1W49A 2B7CA 2BBWA 2C04A 1J2JA 1Z28A 4DEXA 1OKKD 5JMTA 2F3TA 2QMEA 5AUOB 1VG0B 4DLZA 5LPNA 4HSEA 3WYAA 2KB0A 2VL7A 2ZRFA 1XTQA 4KJZA 2IYXA 1MOZA 3TSZA 3ZYCA 4EAQA 2R6GA 2ZVPX 3AKEA 2OEPA 3DM9B 4D4JA 4DCVA 1Q3HA 2GNOA 4LK2A 2GJAA 1CR2A 1VKJA 5GJVC 2G88A 3TMKA 4QJ3A 1U8ZA 4ZCMA 1HQCA 1E9DA 1P4SA 3HP1A 4X8MA 3SI7A 2AR7A 2QORA 4PC6A 1PVOA 2ZR9A 3RRZA 1QG2A 4PAQA 5J40A 2A78A 1CTQA 2JJ2A 3FB4A 1KO4A 1RW4A 2BKEA 2YYZA 2AXNA 2C77A 1BKDR 2BVNA 4PZLA 3TW8B 3ICEA 4DDVA 2QTHA 3QPWA 2XB2A 3MJRA 4C7OA 1GWNA 2HT6A 4MYTA 1DO2A 1JBKA 4CEJA 1G3RA 1ZUHA 1F2UA 2RGNA 3D3QA 4G5OA 4V0NA 1M7BA 1SVIA 1QHSA 3CW2A 3I4LA 2OXCA 2XJ9A 4JLBA 2JLSA 4AYTA 1LS6A 2OAQ1 4O3MA 4JLPA 4EKDA 1CU1A 1JQLB 1YZLA 3W5IA 2R44A 2AD1A 3I5XA 4IVRA 2IL1A 1VHTA 2XX3A 3TUJC 2YNMA 1U9IC 4LJ5A 4OHXA 1XTJA 2CNWA 2W58A 2EWVA 1ZC4A 5JECA 2XSZD 3K9HA 1IJEA 5FPTA 1AZSC 1G19A 1Z6XA 3RSLA 2DHRA 4EPXA 2NIPA 4Q48A 3CWZA 2R6CA 1NVXQ 4A0GA 2ORVA 1DG1G 2WAXA 4GT1A 4TYYA 3OHMA 4H1VA 1JR3A 5CIWA 1AJEA 4JLMA 4QGFA 1FMLA 2RHDA 4M1OA 4H9GA 1EFRA 1T4GA 1DPFA 2FFBA 4PFSA 1XPUA 2F9LA 4LJ4A 2ZI5A 2O8CB 1BMFD 2WWGA 4AKEA 3PR1A 1N5IA 5E7MA 1R5BA 2FN4A 3IHWA 1U99A 5KNBA 3R8FA 3V9PA 3VNUA 4OHYA 2XNDA 5FPKA 1AIPA 5LB4A 2A7QA 2IYSA 1OFIA 4I4LA 1D9XA 2ZYTX 4MKFA 5FBWB 3KKMA 3VR6A 3CRW1 1KI9A 4GRAA 1P62B 1N6KA 1Q57A 3NTUA 1D6JA 4DCUA 1K5GA 1UBGA 1VIYA 2XJ4A 5HTKA 4KHZA 4RZ2A 2VBCA 1L4YA 1CJMA 1W47A 4L9SA 5FUYA 4WA7A 5FBVB 5FOXA 4MH0R 1DG3A 2UKDA 4HLUC 2P6NA 4A4DA 1EFHA 2GXSA 1W7AA 3BFKA 3IBYA 3SYNA 3ASYA 4U5XA 3B5JA 3FKSA 4NCNA 3WXMA 2PJZA 1X86B 3NC1C 4DLYA 1EWRA 2ZRJA 1E9AA 3W6PA 4B43A 4NMMA 4S35A 4KV9A 4QNRA 3L0OA 2I3BA 5A5GA 1S9DA 4TMXA 4YDSA 3SDZA 4LJ6A 1ZW6A 1OPXA 4L16A 3CUEF 3P32A 1XU4A 5P21A 3JZMA 1Z07A 1P73A 2XB4A 3B9PA 4JSYA 2HDNB 2XTZA 3KTAB 4HZIA 4M1SA 2B7BA 1ZU4A 2CCKA 4Q4LA 4US1R 5JSZA 4PHGA 3QSYA 3QENA 3BD9A 3O47A 1F2UB 3L0PA 1G7SA 4MITA 1KK3A 2P5TB 4WW0A 4RZXA 3AQ4A 4C2TA 1KSFX 1O3YA 3NXSA 1KK1A 2R8RA 3K0EA 3CRVA 1EG7A 1PJRA 3QF7A 3KJGA 2YV5A 4KFUA 2HUPA 5DI3A 2IXFA 1XFAA 4KBFA 3ZD7A 1MO3A 3P4XA 1DTSA 1T8TA 2LWIA 3GJ6A 3GFPA 3IUYA 4DLXA 3QQ5A 4LV6A 1OB5A 2OLKA 4D82A 1HE8B 1P7CA 3U3RA 1GL7A 1UAAA 3MFYA 5HCNA 2OLJA 3EIQA 2ZRGA 1KNQA 2WSSD 4KFRA 1OKKA 1AZTA 1Y63A 4EDHA 2GZDA 3RWOA 1XEXA 3AVWA 3F3YA 4Z8XA 3ZH9B 2ORIA 4HLUA 4W7SA 3ADCA 3QY0A 4QFMA 5JJIA 1H8ED 3SYKA 1E1RA 1LFDB 1F5NA 5IHPA 4A8JA 4M53A 4UNSA 3T34A 1W46A 1ESMA 4C0JA 2Z83A 1NVVQ 2Q3FA 1K6MA 2W6IA 3SNHA 1TMKA 1WP9A 1OSNA 1HH4A 2AN9A 4JS0A 4E09A 2YWFA 1VYVA 4BFYA 3RC8A 3B9QA 3T15A 3ZZUA 2C99A 2QE7D 2ZU6A 1Z0KA 2Q9AA 1T3SA 3K53A 3DKPA 4NHOA 3LFUA 1G6HA 3BXZA 4IXNA 3RABA 3DL0A 3LV8A 2VP5A 3B13B 5JI2E 2ODWA 4E22A 1CIPA 3EWSA 1GRNA 1G291 3BAFA 4A0RA 5E95A 4NBSA 2DR3A 1AGRA 1M34E 2QUZA 3AVXA 1NBMA 1P2TA 2GVDC 5EUQB 3RVBA 2CVFA 1CF4A 3PUZA 1NJFA 3I61A 1DO0A 3BH0A 1YRAA 1G17A 1LF5A 1ZUNB 2Q21A 3MSXA 4B3BA 4KODA 3WMEA 5GADl 3U3OA 2ZUCA 3H1TA 4TSFD 1EESA 3AVQA 3L0SA 4RKFA 2KBFA 2HYDA 2J0SA 3TR5A 4HUQB 5E4FA 5EE1A 1GOTA 5J4LA 5LBIA 1U9IA 2WWIA 3EPKA 1BOFA 4ZDIA 1IQPA 1MKYA 3CRQA 4NONA 1QG4A 4ZCLA 1BYUA 4DDTA 1JECA 1JR3D 3FMIA 2N42A 2B8TA 1FFHA 1S1MA 4PX9A 1XD9A 3HYRA 1XZQA 3SR0A 2VTKA 1KIMA 1IN6A 3KB2A 4PQRA 4AC9A 421PA 3THWA 1Z0IA 3M6AA 1SKQA 4RD0A 5EXXA 3KQLA 3SOPA 1QHHB 1EXMA 1FP7A 3LVQE 4F93B 1WRBA 1HV8A 3AVPA 2XOKA 4CF7A 1X6VA 2KBEA 3THWB 1Z6TA 4HAYA 4Q7LA 4P4TA 1Q21A 2ASEA 4GP6A 1SXJC 2WKQA 3TQCA 3AKCA 4IOLA 3RS7A 1Q3TA 2HLDA 1E4YA 1XTSA 2QAGC 1N6IA 4NU0A 4URYR 3THOA 2YOFA 2WWYA 5JHHB 1HT1E 2D7DA 3IQXA 3AF4A 5AUNB 3REFA 5C1BA 1N6LA 2O52A 1NJGA 1FNMA 2MMGA 3ETLA 5H70A 1HEIA 3R7WB 2ONJA 1ELOA 5HPYB 1V43A 4MYUA 4WBSA 3UMRA 4BFXA 3PUWA 1KI3A 5BYJA 1R8QA 4B3XA 4L9WA 1KGDA 1OXUA 2J59A 5AJWA 1XD2A 5DE3A 4MYHA 2JGNA 1GZSA 3KQHA 2ZJ5A 2ZSFA 4HZUA 2LKDA 5FPHA 4JVLA 4IDQA 2ZI9A 1NMYA 1GKIA 2QY9A 4GSYA 4KFTA 4Q02A 1SHKA 1Z2AA 2VP2A 3AGPA 3SE0A 4OHVA 3TSOA 2OCPA 3NIBA 4TLCA 4Z1MA 2CLCX 3C16C 4PQFA 3W3ZB 1YZTA 5HKKA 2IS6A 1Q22A 1E79A 1AKEA 3ICQB 4DB2A 2FGKA 1KNXA 4ASUD 2GF0A 1E69A 1KTVA 3D6TB 1E9RA 4QHYA 4RZ3A 4US2R 1MH1A 5HR5A 3HU3A 4QM7A 721PA 2I1VB 3QF4A 1A2KC 4KI0A 2KE5A 4DLRA 3HPQA 4IRUB 2VPPA 1ZIPA 3CR8A 1ZINA 3THXA 2K5UA 4IDOA 5FL7D 1OFHA 3UG6A 1XTRA 1N6PA 3AUYA 1T91A 1R8SA 2I4IA 3BGWA 3NC0C 4LYHA 5FUWA 3N2IA 1CKEA 1OHHD 3ADDA 4XWAA 4GBMA 5D3MB 1IONA 1D5CA 1XZPA 2J7PA 2OAP1 4AYXA 1ANKA 821PA 3IEVA 3HR8A 5C46F 1KY2A 5L8VA 4ZCIA 4YC7A 1OLOA 1EFTA 1GRRA 2GETA 4Q7MB 1NBME 3N70A 4QG7A 4BGDA 3EAQA 1JEDA 4NYIQ 4GZLA 4F4IA 3MD0A 2DFTA 3JZAA 1D2NA 4IDHA 1XRJA 4Q4HB 2ZXUA 2YC4C 4MRRA 2GRJA 4TL9A 3BIFA 4LHXA 5L3RA 3EZ2A 1X1SA 4AKGA 1P75A 3U7FB 1Q44A 3OESA 2ZPTX 4XVQA 1E3MA 1E0JA 2JIZA 4JKIA 1XCGB 3RLFA 2VP4A 3CWQA 4LYAA 4F91B 2Z0MA 4PSAA 2ZRLA 1JPJA 2FSIA 4ZDJA 3HR7A 5SZJA 4XVUA 1W44A 4XSHA 5EP3A 3AV0B 1N6OA 2QPOA 3PITA 2TMKA 4OHZA 3EX7C 1UKEA 3QXHA 4D25A 5G3YA 3VX4A 4B75A 2GESA 4TT3A 3BFVA 3SJZA 3DOFA 4MUAA 1JNYA 1XX6A 2O5VA 2J7KA 1SKYB 3M1IA 1KJZA 4LC1A 4HAVA 2O8DA 4EPRA 2ZJBA 4ON9A 1OIVA 5TARA 3TH5A 3W8RA 1G9XA 2BC9A 1TQ6A 4QBIA 1I4DD 4QGHA 1E9SA 3THYB 2O8DB 1T5LA 1GL6A 4Q9HA 4DKXA 3VFDA 1KDRA 2OFXA 3B85A 3SBEA 4LJYA 1RIFA 2CL0X 2JLXA 5F2EA 3K0AB 1E2EA 3L82B 4LC0A 4RD4A 1P2UA 3WMFA 2JATA 1ESNA 3V4RA 2IS1A 2AL7A 3MMPA 4ARZA 3AH8A 1GRQA 3KFVA 4AYWA 3GJ7A 4EFNA 4MRNA 4Q1AA 1G64A 2BBOA 2CVHA 3U7GA 3AGQA 2CJWA 4JBXA 1FUUA 2ZRBA 2F7SA 3U44B 3PXGA 2YINC 1N2CE 2QMHA 2ZYWX 1NKTA 4NZYA 2GXUA 2ZAOA 1P5ZB 4V02A 1ZCAA 3ECCA 5FL7A 521PA 2IHBA 1NVVR 4EPYA 5CB6A 1SHZA 1W36B 1FQJA 1T6NA 1ZCBA 3VHLB 1ZD9A 2CNWD 2ZJOA 1QHHA 3WHKA 2PCJA 1DARA 1SZPA 3EIEA 4URXR 1CJTC 4LJAA 1N5JA 3S1AA 3OIYA 2XTMA 1LF0A 3EXAA 4RSGA 4PC1A 3RC3A 4G0NA 1DBSA 2C03A 2OCYC 1NF3A 4NKRA 4OQLA 5AJVB 2V8OA 3QXXA 2VO1A 2FEMA 1NSFA 2IXEA 3GJ0A 3WMGA 1UDWA 2OE2A 4IJMA 1CBUA 3U3KA 1FTNA 2IF0A 3GEEA 3DOEA 1U0LA 4GDFA 4AKIA 3AVYA 2E9SA 4Q9KA 1II0A 5L3SB 5G41A 4B47A 5FFMA 4EPTA 1KI6A 2RCNA 2YOGA 3H4MA 2VHJA 2GHIA 3ZIAA 4B2PA 1C4OA 4OYHA 3SJAA 3LLUA 4D80A 1LS1A 1QF9A 3K0AA 4LHZA 2YHSA 3AF2A 5TDHA 2J41A 2GBLA 3MG9A 2AHOA 2GAOA 2RGCA 1N0UA 2WWXA 3WYGA 3T06B 3GP8A 3R9XA 4GL2A 3Q85A 4GP7A 2F1JA 4TZ0A 4TYNA 1TF5A 2H57A 2XAUA 3T1TA 5GJBA 2IWRA 4GFDA 5LD2B 1U94A 1DAFA 3FHOA 3WRYC 4B35A 3AEZA 5GVRA 1MRNA 4E07A 1E96A 1TL7C 3A1VA 2HLDD 2G83A 4FCTA 3RAPR 1YZNA 2IS4A 2WHXA 1S3GA 5SZIA 2P6UA 3BC1A 4CT4B 3NBYC 3U7EB 1XF9A 4IW3B 3RRYA 1NVUQ 2VLIA 1VG9B 3QXJA 2REOA 4ZIRB 1UADA 2QM7A 4OK6A 2OFOA 2ZE7A 3PUXA 4BASA 4B33A 3QXSA 4DEYA 2BM0A 2J9RA 3UWKA 4D26A 1P60A 1R7RA 1IBRA 4DLUA 2JIZD 4PQYA 2VP0A 4N0EA 1DS6A 3LDAA 3QOFA 5FPSA 1XCMA 2GEUA 2Z4RA 3Q8XB 1W1WA 5J4HA 1QVRA 3P27A 4B6FA 1VTKA 1A7JA 3KXIA 3I62A 4NCHA 3CX8A 2DB3A 2FX3A 4DC9A 3SC3A 1WE2A 5K8IA 4WXPA 2FPLA 4U02A 2B6HA 3U3JA
chains in the Genus database with same CATH superfamily
2F4FA 5DBHX 3ILVA 3HMQA 4WFYA 4HWOA 1YKGA 1ZBQA 2HNDA 3OEHA 1U7ZA 2H92A 1B4SA 4XRRA 1Z08A 2NXEA 1RYBA 2XDAA 1UVNA 2EGHA 4HYYA 2VDRB 4ES6A 2LQJA 1J0XO 1PGJA 4HDAA 4QL3A 2IM2A 3D54D 3EY4A 3ESRA 4BNDA 3A4NA 2PA8D 1HYHA 4NL5A 4DN6A 1V37A 1UKBA 2LNDA 1VC0A 1IR0A 1OT3A 1N0WA 1HNWJ 4L0MA 5I9IA 4W5WA 1VYUA 3IRVA 3NJ8A 4JKOA 5D5HA 4KRGA 4XFKA 2R5FA 3W2EA 4OL9A 3E5NA 1QVAA 1RWPA 1JMYA 3LOQA 4FBUA 2NX2A 4QUGA 2IOQA 3CNBA 2AC4A 2CIMA 4D6PA 4Y1FA 1XTKA 3CCSS 4GO1A 3O1HB 2PT7A 3G9XA 1WEXA 3BN7A 2HXGA 5KVVA 5EIHA 3GFOA 1BFUA 5FJ4A 4P2FA 1NP6A 1M5OC 1HA3A 4E21A 2YIVX 3PNQA 1FVOA 1QM5A 3BE4A 2WJYA 3U4AA 1GKUB 1C7QA 1PTJC 4F9FA 4LBZA 2AOUA 4GDMA 4TLEA 2IT1A 2DGQA 3GTYX 2KM1A 2CBZA 3G6ES 3GHYA 1AYEA 1WB6A 5KS2A 4MRPA 1SBYA 4WJLA 4W82A 1DFDA 1DC6A 3C6QA 3NAGA 5IYZF 3ADBA 1CR6A 2CUYA 3T9BA 4L9RA 2NAPA 3R97A 3UMYA 2PIAA 1TAQA 3T52A 1U90A 2QD3A 5JXJA 2X1VA 5KFIA 5LU8A 3L79A 4MUHA 3C14A 2XZDB 3FYTA 1Z45A 5EIBD 1E63A 3CX6A 2A9PA 2G5PA 5EZ5A 3JS9A 3KWMA 1XMIA 5JH7A 2FVQA 2WRZA 4MR7B 2QTCA 4GLOA 2A2DA 3BBBA 1VL5A 4PQGA 1WB5A 1N8TA 3VZDA 1ZM9A 4CT8A 2D0OB 2FN3A 3FYCA 1JDJA 2Q3CA 1NDQA 2E5WA 2JHAA 5AUQA 4KGZB 3KTFA 3TR6A 1OV4A 3TRIA 2UZ0A 3SQXA 2NUTB 3EGCA 2EBGA 3DDOA 3NS5A 1GNQA 1SA0B 5EHGA 1NXTA 2RC5A 3DE6X 2CRLA 3TG2A 4BNLA 2EGUA 4JVNA 1RYDA 2R0QC 4R84A 5EX3A 1P19A 1K8QA 1FRZA 3BA6A 4E5VA 4PGHA 4TUYA 2OV4A 2FWAA 2WTFA 1COWD 2MSTA 3C8DA 1UPAA 2Y66A 4JI5F 4ID9A 2WYWA 1NSPA 5HZKA 1K0FA 3CNQS 1D8TA 1KFKB 4BC0A 3ZDAA 4B17A 4Q3EA 5JPIA 2ZZMA 2ZREA 1TL5A 5KDOA 3PJWA 2GJ8A 1XU7A 2FSFA 2GAFA 2L9WA 1FP1D 3ZHYA 3QMPA 3EXHA 4AUMA 3GG2A 3NYWA 2RKIA 3FX2A 4ZC1A 5EHIA 5D86A 4JYAB 3ZWVA 1U2RA 2EJBA 3TQOA 3NYQA 3IS9B 4MVYA 5J2TA 3KLFB 2VJVA 1YQ9A 1ISGA 4EEYA 4JBHA 4PAMA 5C25B 4IICA 4RBUA 3UJDA 3RRMA 4FVTA 4DLVA 5HJ7A 1RYYA 1QP0A 3NOGA 3F1LA 3JPWA 2ZIVB 5CFQA 3BYZA 3GPBA 5TMDA 5KG2A 1XKXA 3TIVA 2XVXA 4N1AA 1GJRA 2NO5A 1XEXB 4UUWA 2PFFB 3GBVA 1DRVA 1NXXA 3HDQA 3LBIA 3KUKA 4ZMSA 2IEBA 3Q7QA 1M6EX 3NWJA 1XYGA 5L95A 5TJ9A 3R9XB 4PWWA 3QKSB 2HURA 3PQCA 1X2EA 3EQ8A 3CKMA 3JQ7B 2VG7B 5IX8A 1RXIA 1B8VA 4FVMA 3U81A 1PSZA 2VAXA 3ZV6A 1XDBA 3KK0A 5AI8A 4L5IA 1VDZA 1X31C 5I7EA 1ZQ1A 5CA1B 2OUKA 5DIZA 5D85A 5LDDC 2WNSA 4HUQA 5EERA 3UK0A 4QWEA 2DUWA 3COSA 1GLNA 4MICA 3GU3A 4BYGA 3G0OA 3ZW9A 4I68A 3PIRA 1LQ2A 3PFOA 3OU7A 3TOZA 4DL7A 5B4UA 4KO0B 4Y3CA 2HZ7A 4L4UA 4P53A 3OFJA 4E8UA 1O4VA 1KDOA 2FPPB 5DLEA 1Q8KA 3CVWA 1U2CA 4MO2A 3QW2A 4YXFA 2ZYVX 3IT2A 1E2DA 3I9NA 1U98A 2VJQA 2EFHB 1LW7A 4A6EA 1SC4B 5DNDA 3I5YA 4JIMA 3DZIA 5LMUJ 3OO1A 2Z57A 3TTUA 5J47A 4QUJA 3K8YA 4OZ3A 2Q4BA 3C46A 2WD7B 1Z6GA 4Z4GA 2WAYA 2AYBA 1PU2A 5A9RA 2QSFA 1YR6A 1Z06A 2O14A 4CNZA 5J2UB 1I6MA 5BW8A 3V4FA 3GJQA 4HLDA 4AQYJ 2JLZA 1FYXA 4YJGB 1FRXA 3K9NA 4WKBA 4PRLA 1DRKA 3H9EO 4LS3A 2M8DB 2VQ6A 1FFWA 1Y3DE 4ZN1A 5JJKA 3KB1A 3LTEA 2BP7A 4BWVA 2HF7A 2BQRA 2EFDB 2Q1YA 2DM6A 3IKMB 2NVUA 4G0YA 1DIOB 5G1OA 4O4HF 3FF4A 2G5CA 1YMUA 3PXUA 1L3KA 2SKDA 5AUPB 4DRXA 3UPDA 2ZITA 6ABPA 1UJCA 4L15A 3PEVA 3IGFA 1FBNA 2G3YA 1U28A 2HZAA 1O0PA 1ECGA 2WYOA 1R4MA 4C5CA 1EFUA 1JLQA 3S7RA 1I94F 5F8NA 5KWIA 5IUJC 1EZ4A 1BE8A 3DDCA 4O29A 1U8AA 3ZY6A 1KQKA 1I5RA 3ENNA 2WICA 3O38A 1HYQA 1G20A 3X44A 4RVDA 4XA8A 1S6PA 3S27A 4KI7A 4PYQA 1AKTA 3R5XA 3IP9A 2WTXA 4PZCA 3ZE7A 1LSSA 5LOVF 3IEKA 5DSTA 4GQAA 2FLKA 4OB7A 4MIYA 3ZVNA 2P0AA 3DZ8A 4PU0A 3FCSB 4MUIA 5KUTA 1BU8A 4CIOA 4FW9A 1VPLA 1MABB 3MIIA 4L6CA 3KUDA 4WCFB 1GG8A 4Q3OA 2VYND 3D67A 4BHQA 1MABA 2ZRAA 4V38A 3ORFA 4N12A 5BWNA 1PW5A 2XT9A 2DTDA 3EOZA 4YPOA 1MOPA 2FQWA 3TOSA 4L08A 4PPZA 2ET6A 4Q24A 4RQTA 2X0IA 3R8XA 4MULA 2ZWOA 1L5GB 4NC9A 1J8VA 4B79A 3LW5C 2Z8XA 4F2PA 3EARA 2F90A 3DJYA 2LP4Y 4RPHA 3PK0A 3V2UA 3I3OA 1HW9A 3BXGA 5KYXB 3B78A 2YVUA 1JEQA 4G65A 2Z8QA 4M5KA 4HVAA 4TXMA 3FKJA 1K4KA 4LXIA 3FROA 3M3DA 3J7ZT 1PR5A 3LZCA 2GF2A 2IYEA 1L9KA 3OJ0A 1QHYA 2CJXA 5CGQB 1PWZA 3IURA 1LCIA 1MV5A 3QEJA 3UT0A 4RVHA 1QYRA 2HFNA 1FCAA 4JCOA 4XW2A 3KUEA 2ZRHA 4ZJUA 2BJ3A 2Q3EA 5GONA 4LDAA 1FK9A 2C8LA 5AYVA 2O8FA 3M8QB 5K0JA 1Z15A 2EZUA 4X66F 1LQTA 2YW9A 3I8SA 4J0QA 4C8OA 5A8WA 4AZ0B 1CG6A 3RU9A 4N3BA 4P0PB 2BEVB 5KT7A 4PAGA 5HEKA 4BQSA 4PWUA 1NAIA 4GOXA 4X62J 2TSYB 2QFJA 1AF7A 4C4XA 1AKMA 2ICAA 5JYDA 2VPXB 5DLPA 1FXDA 1U8WA 2R79A 2GO1A 2JLAA 2JL1A 4UQOA 4HZUB 1KKUA 3DI6A 3O26A 1U3CA 4IWXA 1KD1T 5FHRA 1T0UA 4BKOA 1W30A 1YBMA 2FHSA 1EVZA 2DIUA 5JDIC 3LQYA 2B0CA 1ONNA 1E7WA 2ZM6F 3C4QA 3WIEA 2VDHA 1JG6A 4K0KB 4TM8A 4X71A 4I1YA 4E70A 4XCXA 1BMFA 4O4IF 3BN4A 3ZH2A 1BRMA 4TYAA 4DMLA 2B36A 1N5TA 1RRKA 2HGZA 1AUDA 3S29A 1DT3A 2X77A 4CLOA 2DF8A 2VWPA 3MCOA 2Q66A 1YR9A 5KC8A 3JQMA 3IAS9 4UUAA 2CQ3A 3AW9A 3IE2A 3MJ4A 1B7GO 5AM3A 4S0MA 1VIDA 5C2GA 1SA0A 3AB4B 2DGXA 1ADJA 4JVMA 2RK3A 3NDPA 1E60A 2AR0A 3HHNB 3AHFA 1A98A 1OYWA 1SBRA 4MHSA 5BOSA 3DRRA 2HXYA 4EATA 1HQDA 1TFYA 4Q4DA 2B4VA 3K31A 2Z6QA 2HHPA 3M5CA 2ZFHA 3NWEA 3P9SA 3L0CA 1HK7A 3W62A 2H3EB 3PQ4A 1ICIA 3AF3A 2SCUB 4YRMA 5E7OB 2RH9B 4DOMA 4Q4CA 1MLDA 2DLCX 2ARKA 2M6LA 2Z6UA 1SOWA 2WHYA 1B76A 3LDFA 3U44A 5AW3A 1LLQA 4AXIA 5EIEA 3WGIA 2QTBA 3HUUA 1O0CA 3TKAA 3SE7A 2JLRA 3WO0A 1GSOA 4JC5A 2VA8A 2FZVA 1TF2A 3LX4A 2XE8A 3ZXWA 4UARA 1DHRA 4BZPA 1ZNXA 3NBQA 4GR9A 5ALYA 4X65F 1OBCA 1NOJA 4O5AA 3GGJA 1CUXA 2QJRA 2P4QA 2D8AA 1KNZA 3MAAC 4WZ6A 2UU9F 3ZCPA 1BXZA 2DNOA 2CBXA 1C29B 4KO3S 5L7YA 4Y2QA 4D9JA 1VMKA 3GP3A 2PT6A 4GNRA 5FI3A 1CULB 3ESYA 3RRNA 1EFRD 3ZE1B 4LR8A 4MEAA 5C24A 1PZFA 3Q89A 1NN1A 2B37A 5A04A 4M6WB 3CPHA 3KVOA 4BPRA 3GN2A 3F96A 3A36A 3K6SA 2ZOFA 3IMFA 4KK4A 3Q4GA 3TQHA 3ZHRA 4A16A 2GM5A 3CCTA 1EM8B 3DKRA 3QO9A 1H72C 2UVUA 4JLVA 1RUSA 3AESA 3TYTA 1XVIA 2R8EA 3PJXA 1BEUB 1YJWS 4IKAA 3VJKA 5JCOC 3VZSA 4CTNA 2HA0A 3Q7EA 4AJ1A 4Z51A 2OXRA 2I4MA 2QA5A 2OK8A 2M6SA 3FVWA 3P9PA 4NAVA 1WTCA 4GBGA 4PLVA 5HDQA 2A1UB 5IEJA 1ORHA 2DKNA 5K2MA 4KHRA 2WF5A 3HZRA 4PR0A 1Q15A 4NASA 3AUAA 3CJRA 3C7TA 3CJ2A 2WA2A 3CW2C 3ZXYA 5KTYA 1P9QC 3OZXA 1FDNA 2RHLA 2QRRA 4P2GA 4UHBA 3H5NA 3EPRA 5JSHA 4TS1A 1NMEB 3MXHP 4NTZA 5FF9A 4A8FA 4G4SP 3QLEA 4Y28C 3EZ7A 1YBUA 2F1IA 2HK9A 3GU0A 2I67A 4Q3KA 5CDGA 4OQPA 1V5EA 5FD1A 3D4LA 4DEZA 1T5HX 4ZREA 4F71A 5AQEA 3N8DA 3QAEA 2WIDA 3QH4A 2Y8EA 3MS7A 1MFZA 2OPRB 3FFIB 1GPBA 1X9GA 2VZEA 3OCJA 5L38A 3KJEA 4NH0A 4G0WA 2DR8A 1X9IA 4JFAA 3C0KA 5IQ6A 5A05A 4GECA 2N47A 3BRQA 1PZNA 3BCSA 4YQEA 3ND8A 2W8ZA 4K4VA 4AVYA 2CC2A 2OFPA 3EJ6A 4BCDA 3A1FA 2YKGA 4IDKB 3RVNA 4CMIB 1K08A 2B1IA 1KYTA 4C0SA 4NWBA 3CBGA 1XCLA 3OLBA 3KB6A 2OO4A 4GKKB 1S8NA 3KC2A 3LBYA 3AI1A 3ZLBA 1PBAA 3CUSA 2MYFA 1KZGB 2VHGA 3AXMA 1R0YA 3L1IA 3T0GA 4WEOA 1NM5C 5A2GA 1E6KA 1AGPA 1LNQA 4DVGA 2CPIA 3TRGA 3BH7B 2PGLA 4I1UA 2B7CA 1IMJA 4MK8A 1VZ2A 5KTPA 4I19A 4ZCRA 4WFBQ 1JHXA 1E61A 4YDDB 5JRDS 3W9UA 1EFLA 2FFJA 1V8OA 5GOTA 1IKYB 4CM1A 1MA3A 1B6RA 4C88A 3FMVA 3AEYA 1R9GA 3TMKA 5EZYF 4ZCMA 1HQCA 5HI7A 1UTAA 5CPFA 2AR7A 3H83A 2COUA 2RE1A 1I30A 3G0BA 3MEGB 2BD0A 1KGSA 3DBVO 3MWDA 3FJYA 4CEJA 1W26A 5CYGA 1HKAA 1QHSA 2NYIA 4DGSA 3CZCA 7FD1A 2VF5X 2YMPA 4PR6A 4XLTA 4GVPA 4JOQA 4UU1A 1UZNA 5BVHA 4ML3A 5B1IA 3P2OA 1CZUA 3SHOA 2GBCA 2MSLA 3B20A 4Q48A 4A0GA 4IHJA 4EL0A 2P1ZA 4DV4J 3E3AA 1QG6A 1RPAA 4YDQA 1DPFA 3IMKA 1FX2A 3ETDA 5FPKA 1CC1S 2LIVA 1QIGA 3CRW1 2Y67A 3D7SA 2RHTA 4FGSA 2XUPA 3HDVA 3VPAA 1VIYA 3T3HA 4RZ2A 3RAGA 5IT9Y 3T99A 4EW3A 1DG3A 4O6VA 2AVDA 3B5JA 4RORA 5TMBA 2ZRJA 1LW6E 2NTNA 3QTLA 3CUEF 4RHEA 4F3MA 1N5SA 2WNHA 4NH4A 3TVYA 5J1EB 4FNOA 4WY8A 1WABA 4BNTA 1HSOA 1O96A 1SUEA 3M32B 3OE1A 4N48A 1CSJA 1PJCA 3EQ2A 4Q12A 1M2HA 3ZOKA 2NSHA 2XUDA 1SIZA 4DC1A 1XEXA 3QY0A 5JJIA 3ORSA 4FM9A 1T9KA 3VPGA 2V4RA 1V5FA 2R3VA 2XUJA 4KDEA 4DSJA 4L0DA 1E3WA 3OTIA 3BZBA 2HQDA 3ROGA 3T95A 1FD2A 2XVMA 3FNEA 3RLIA 4ZK6A 1DKMA 1B3RA 1NUEA 1B0PA 2HSZA 2KBFA 5KNBD 4Y2CA 3V8NA 4YCBA 1BOFA 1PILA 3FYSA 3BJMA 3QE2A 3GC6A 4PQRA 4ZN6A 3N59A 4JX9A 3PWSA 4M83A 3UGTA 3RRJA 3KQLA 1SWWA 2V9ZA 3UVJB 1RXUA 4K3VA 3IE1A 2XOKA 3ENQA 3HSJA 4IOLA 3TQCA 2IDMA 4P82A 4YQZA 1QM9A 3PNLA 1Q0LA 1T03A 3HNPA 4G9EA 4ZEXA 3GVCA 3IQXA 2FGCA 1F0NA 3JALA 1FNMA 3MM5B 1UPPA 2JFXA 4WBSA 3UMRA 4IJQA 2LPMA 2HX1A 4L9WA 2J59A 3ELBA 2CGEA 3CMMA 3GPCA 2X42A 4RH3A 4HZUA 3DOJA 3H13A 3T7EA 1GO2A 2UXBB 1P0CA 4Q02A 1PQWA 1SHKA 1SZCA 3MUNA 4FGKA 2V0CA 4PQFA 4HRXA 5INTA 1QYVA 4OOFA 4ASUD 2PUAA 2FJWA 4V3CA 1KFBB 1QTQA 1LDNA 1ZIPA 1Z4KA 3T7CA 3K2IA 1YUNA 1XDGA 3D81A 3NNNA 4F8JA 1A97A 5C46F 5L8VA 1W93A 5K3SA 3E05A 3EAQA 5F8GA 2DXFA 5A9TA 2RJNA 1RAOA 5IAAA 4F0KA 1Q44A 4CQMA 3WKCA 4M54A 3NTXA 1ZEJA 2B9EA 4PSAA 2ZRLA 3RFXA 5EP3A 3PUJA 3GFRA 3GSDA 4BNIA 2GYWA 4HLBA 2ZJ0A 2ZCJA 4DUTA 1VJGA 3AJ1A 2J7KA 2HWKA 4LEIA 4WZMA 4QAJA 3MECA 2EJCA 1AF4A 1G9XA 1I4DD 4B3MB 5D4PA 1VZ3A 4DKXA 5CD1A 1RU3A 2NXUA 3ET6A 3A6ZA 3IRXA 4MWDA 4YB7A 3O3CA 1C0KA 1P2UA 3WMFA 1AZSB 3G82A 3MMPA 1GRQA 1W85B 4AYWA 3IMCA 3X1JA 4O3NA 1CY8A 3PXGA 1BDJA 1N2CE 3KU1A 7AT1B 3ROMA 3ND7A 4YBZA 2ZAOA 4GWLA 5FL7A 521PA 1SHZA 3H1PA 3OWHA 4NLLA 3IHKA 1PQYA 2ES4A 4LJAA 1N6QB 1OY6A 4MLZA 3QX7A 4L2IA 2R7LA 3M70A 1QFJA 1L7NA 2A35A 2VOEA 2QRJA 4BBPA 5EJ9A 4AX8A 3GJ0A 3V81A 3FYUC 1FLNA 3AG6A 2OA0A 2YNGB 1HBUA 4WK4B 4N8DA 2YOGA 4P2SA 4OYHA 1FNSA 1QF9A 1KMNA 1NXWA 4K6FA 4KQMA 3BGRB 3R6LB 1NQXA 4RW8A 3T06B 4WD3A 2OUGA 1Y1TA 3T1TA 3KJFA 3G6WA 5J2MA 1Z4LA 4ICLA 3RNOA 2GS8A 3T5AA 3OH8A 4IW3B 4Y2SA 3H6HA 2TECE 3QXJA 3WZ0A 4OK6A 1R8AA 2OLWA 1SUAA 4ZPAA 3UNGC 1VP3A 4EI7A 1VHQA 3I28A 1UK9A 3CT6A 5EIAA 2EBWA 2NLWA 3KBOA 1TZBA 2G67A 1YJ9S 2DB3A 4QPCA 2VOPA 3IT0A 4IJUA 4DLEA 1BMQA 2MY8A 4X63A 5A7HA 4DNXA 2X0NA 1YTYA 1ZJZA 4MW7A 3VKVA 3DLIA 3H9QA 5A2QY 5EXDA 3RVSA 4YI3A 5CXQA 1ORVA 4MFBB 1F1JA 4R0VA 4WZZA 4KB7A 5EUMA 4O3OA 4M46A 4Z3OA 1TPZA 5ALVA 1QCDA 3HDHA 3DFMA 3N6LA 3OE7D 4YA6A 2C78A 1Z6QA 4L3VA 3L9ZA 1M0WA 2YNFB 3FM9A 3FSXA 3OV7A 2ISSD 4OV6A 3VGTA 2I1RA 3NTQA 3PFGA 2OO5A 2H65A 4NYIR 1NG9A 5BJRA 1OXVA 4TKVB 2ZBDA 4U6QA 4C0AC 1Y8RA 3NHAA 4H4KA 3IBCB 2AOXA 1J06A 4PPGA 5AWFC 1OH5A 2C29D 2CD7A 3T3EA 1FDOA 1ZC3A 4D98A 2JCVA 2VQDA 4NE9C 1VI7A 1OIAA 4GVXA 4FYWB 4KHPF 5BT8A 4HNHA 4QC2A 1BZYA 3WV4A 5CT6A 4QLBA 2P8IA 1GXUA 1NXQA 3PW4A 3LUHA 2J85A 1GAJA 5HYVA 4MAKA 1Q0NA 2I4NA 1VCNA 5J63A 3EVFA 3BS9A 4XYLA 1FDUA 1KMHB 2G9RA 2NO6A 1E1CA 1B8PA 2I29A 3ZVMA 4TROA 1KVIA 4EOGA 5KKCA 3Q3GE 1ZLYA 1TUWA 1B8UA 2PZGA 2G8LA 4WGGA 1R0CB 2QYGA 3SDEA 1CHDA 1D6SA 3H04A 5AJTA 2VSXA 1XTVA 1P9WA 4OJQA 3LUAA 2H52A 4IWNA 1XA3A 3TTWA 3I8XA 1QCYA 1LDYA 3A1UA 4LHEA 3H1BA 4YDHB 4PCVA 4AUKA 4D3YA 3ZWBA 1T3HA 1QQ5A 1PDWA 5HNKA 2C97A 3CSKA 4INZA 3NBAA 4WOKA 1IY8A 1VQSA 4M99A 3NHRA 4BFUA 5JR3A 1G98A 3VVUA 2ZRDA 1RXWA 5K14B 4TMWA 1TKCA 5JTUA 4XAQA 1EXWA 2X9VA 4KQWA 3F5DA 1RT7A 2YWGA 1KLMB 5LZ8A 2BHRA 2JIBA 1G2EA 3W5AA 4CMJA 3MQ4A 4Z4FA 2ZVJA 3NHLA 1HNVA 1IG3A 3FRJA 1X7XB 3VTKA 4BRUA 3N8GA 4DUYB 1F9HA 5C5DA 3E9NA 5JS6A 3EDYA 1AB8A 2E89A 5KFRA 1GNVA 4V2UA 4NCIA 2W6CX 1RAAA 5KQPA 1RAFA 4HB2A 2YCLA 2GW8A 4X91A 1DURA 1BFDA 1YMVA 3Q5EA 4U7JA 1ZTWA 3WGZA 1P3DA 1ZZFA 3OFNA 5IWAB 2I71A 2EW1A 1U2PA 1ADFA 3FYUB 4FYVB 3C3CA 3PQ3A 2VV5A 5HKKD 4F4UA 3FC9A 4GQBA 4H6WA 4QJ4A 4EB3A 5A4JA 5I3ZA 4BHTA 5KT2A 2XA1A 1DQRA 2QTVB 2DFKB 3C7KA 1KR2A 5JCJD 4FDMA 1CP2A 2LDIA 4CR8A 4JV2A 3TZXA 3MTGA 1TKAA 4B09A 5ETKA 1RMTA 4WYLA 3UCUP 1FDVA 3C15B 4UHCA 5ECYA 4G37A 5C8DA 4BBYA 4Q4AA 4LCBA 2DGOA 4HGNA 4GI2A 1M8GA 5C81A 2CYCA 4BGVA 2DCLA 1K73T 3UY4A 4JDUA 3FPSA 3ROQA 3ZDQA 4YUAA 1U81A 3GG0A 4EUKA 1U1FA 3N8HA 2OBFA 4BLSA 2QG6A 1XHFA 2VHTA 3GD5A 2R96A 2G80A 5B7PA 1NBMD 2FRDC 3QOXA 4RIEA 1FVQA 2W9CB 1R9MA 1KRXA 1VFNA 3SY8A 4ZI7B 1SQ0A 2A0FB 1TA9A 4JY7A 2H0AA 2ALJA 3EAFA 3ROEA 4HS4A 5KKAA 1RRFA 2CHEA 2IH4A 3HM2A 3AP1A 4HFNA 3TRKA 2VJLA 3HUEA 4RF4A 5BN1A 5E3RA 4QXRA 4Q6WA 2FHJD 4E4TA 2VHWA 2ZUBA 3WZLA 2YQ5A 1TUGA 3D66A 5DGDA 4PCUA 5GVQA 4KXYA 3M8WA 3HUTA 1WB4A 4FXOA 2BUNA 4AUNA 2BP7B 4N9WA 1SBTA 2KPOA 2G13A 1T8YA 3EGVA 2B8WA 2R86A 5B36A 3RUFA 1NVKA 1NMQA 4CQ1A 4Z49A 1PKXA 4R6WA 5CPBA 2GTHA 2WW4A 2ZRNA 2GEVA 4C4RA 5ALUA 2V3VA 3K2EA 4DIOA 2CVOA 2I1QA 5LM3A 4A0HA 1BHJA 2MKCA 1V1MB 3JQ6A 5DGIA 4XLLA 5F0UA 4JZYA 4PFJA 3AONB 4B34A 3RF7A 2X6QA 4OQQA 2WYHA 5DTEA 3DZFA 3NCPA 3A04A 3JQFC 1O08A 4A0QA 1AUOA 1OE0A 1N5LA 1WUHS 1Z0DA 4XWTA 3M49A 4CN8A 5KSZA 1PJAA 1Y0BA 4Q9JA 4XASA 4UM9D 4YHHF 4TYBA 5HE9A 3UFCX 1DP4A 3BK2A 2G7ZA 4JI8B 4URGA 2PSJA 2E7WA 4JI2F 1DQAA 2CHFA 3MEKA 5IJXA 3Q0TA 1HNZJ 3O4VA 2OBLA 3RYHB 3PEYA 3EDRB 1TVRB 2EEPA 4XE5A 1DE0A 3KYCB 3S6EA 3NT5A 2PYIA 2AQHA 1CEEA 1AXQA 3O8RA 2BLNA 1KOHA 2B7BB 4POAA 3RTBA 2EFEB 2HWWA 3KUGA 1A9NB 1I1GA 1S4FA 4U4AA 1NC1A 1E2PA 1I36A 2HWUA 2QUKA 2ZR8A 3LQ2A 3ON5A 3OC6A 3RANA 5TGDA 3TP2A 1G16A 4BX8A 5DO9A 1IAQA 3GFXA 5DGCA 4HMPA 4EFAC 1LWEB 4G25A 4JASB 2HNZA 4MZXA 2GJ9A 4MIAA 4G1CA 4PZAA 1KO5A 3KP1A 1SN7A 1J0BA 1KA9H 4EHNA 5CYOA 1IBKF 3FCWA 2JGDB 4JROA 3LQ1A 5AKIA 4NCJA 1Y10A 2VPQA 3U6KA 2ZE2A 6YASA 2JIQA 4RW4B 5IT9U 3SIPB 3DHYA 3ITHA 3J81j 1IN5A 1G6KA 4KRXA 1YQQA 2I6QA 2WTNA 3D6UA 1UPMB 2FB9A 2H08A 4IDGA 3K6RA 1JHPA 1UC5B 4R9UC 6GPBA 5FBKA 2NXNA 2EDCA 2J32A 4X4UA 2QRZA 2CNLA 2IQ5A 1Q14A 2PX8A 3UN1A 1AGNA 5BYRA 1J5PA 4G81A 4DDHA 3ENAA 2XODA 3BWBA 1NCLA 3PTAA 4CM8B 1XVTA 1HA1A 4DCOA 1R6XA 3I5AA 5HKLA 2DH9A 1OWPA 4Y6OA 5DNVA 4L5YA 2I8AA 4BB9A 1H0SA 3LPEA 4HX2A 3L0IB 1ZMBA 4TMFA 4IG3B 2OB2A 2V9WA 4P3XA 1R37A 4MQMA 1HFKA 1XFDA 4RH0A 2HSEA 3FWNA 4IDFA 1M5KC 3OZUA 3CRZA 5AJXA 2ZYSA 1FFSA 1PGNA 1QZ3A 4PCAA 1FRVA 3OOHA 3LKBA 4LPKA 4KPYA 1YZGA 3ZNPA 1TMJA 4CPDA 5DTJA 3M1VB 4TMVA 2AFHE 4JNKA 1HQKA 1TYBE 4ROSA 2JZCA 4OYOA 2CK3D 1UDXA 4WZAB 2QQFA 3LGAA 3QJYA 5AOCA 3I52A 2IK8A 3E82A 4K86A 3X1XA 4B0PA 4MP3A 3FPLA 2X58A 3IQDB 3BK7A 1NFQA 2EQBA 2XIQA 3D3EA 4A2PA 4OGWA 4G86A 4ECQA 5JADA 4ZU1X 1E9CA 1HHSA 3DHXA 5HX7A 3D0OA 4CM8A 3DRPB 4EA8A 3A1WA 1QZTA 4WADA 1XA4A 3ZTTA 4PWDA 3PKYA 2QQGA 1IBKB 4MS1A 2W7PA 1F06A 2RRAA 2PWPA 1P44A 3VGJA 3EW9A 1U0EA 2GBPA 3O8CA 4C6AA 3CKKA 4TRNA 1MLAA 2OD2A 5CTAA 4R2HA 1SKUB 3W63A 3HT0A 1SIWB 3FHLA 4ZO6A 1M2FA 5FR1A 3WP1B 3EVGA 4ZDWA 5EI5A 1KOOA 1I5OA 1XPOA 4GKKJ 2OD7A 3HMKA 4CCYA 3DO8A 2AK2A 5DYGA 3NG1A 1NUUA 5EJGA 4UNIA 4D9GA 3MFQA 3KUCA 2W43A 4B87A 1D0VA 1SUDA 4O44B 1FW8A 1PC4A 3D0GE 1OJ4A 4AD6A 3ER6A 5DEIA 2O8CA 3OSZA 2SCUA 3KFWX 2C8KA 5G0WA 4J07A 3R0ZA 4Q7KA 1U6ZA 5ADUS 3UK6A 3HDJA 4X61A 3AOCA 4EJMA 1C2PA 3R3YA 2P4UA 3AL2A 4QLOA 4I2NA 2I9PA 3K70B 1R7IA 1E2QA 4D81A 1MRSA 4OL0A 1H1TA 5F5XA 1U0NA 3KKFA 1ISRA 4MA4A 1QDEA 1UP7A 3CC2S 2ZSJA 2FZKA 4HVTA 3VH2A 9LDBA 3P0IA 4PZYA 3EGWB 2XNHA 4NEZA 1ZM4A 3GGGA 1NG1A 1NQVA 2KG0A 3ZWMA 4ZVKA 3QEOA 4HDCA 1POXA 5GAEU 4QIHA 3T7SA 5JY1A 3JXEA 4PXDA 1CZKA 1N77A 2REXB 3VR6D 2PM8A 7AT1A 4QYIB 2FSPA 2L41A 1RE0A 4C30A 4H4OA 3G9QA 4UKDA 4RYDA 4R2LA 2V2KA 5K0GA 4HN2A 2FETA 1F20A 4WK6A 1YDFA 2HS0A 4FIDA 1ZS6A 4B5KA 1XZGA 3K1AB 1WKVA 2BFNA 2KZMA 2AG5A 3ESCA 3B1XA 3W9HA 2YWEA 4JB8A 3GQCA 3HNOA 3ZJVA 4JI4B 1WMFA 4IJVA 3I8OA 4G63A 4A03A 3CO9A 2HK8A 2BEFA 4W9RA 3M33A 3T5PA 2C9ZA 2BKVA 3CE6A 3RYFA 4AZ0A 2W2LD 4HGZA 3DWGA 3LG2A 4CUKA 1TADA 4DCTA 2DNPA 2ECKA 3D5MA 1V7CA 5IJZA 2I2FA 2CLOB 1ODKA 3QJ5A 1R0WA 2RI6A 2BTQA 4HPWA 1W6UA 2QVCA 1OS5A 1XMVA 4YAWA 3D3NA 1W7WA 2XSJA 2ZUFA 4D9NA 1Q1QA 3EG5A 4GOOD 3TI7A 2GJ4A 3ML1A 1QQAA 1JE1A 2GIRA 3PKMA 3MBKA 2I03A 3STYA 5JAIA 4FVCA 1R6DA 3IGNA 5C31A 3AL3A 1Q5PA 1BJTA 2YMMA 2BJWA 4WPGA 4ED8A 3F49S 4I4IA 4BNMA 4ZV7A 3LSYA 3O3LA 2BGKA 4FMDB 4KK3A 1VYHA 3ZDZB 5K01A 1M1YB 4TOIA 2XMKA 3DBLA 4KXLA 2WQ7A 2OHFA 3TB4A 1XTIA 2I4LA 1LRJA 3IAS6 3WMRA 3N2EA 2YHIB 2ASVA 2CK3A 4MVWA 3M3HA 3MF4A 5NULA 5DW3A 3E2PA 5HHTA 4ED2A 2DWPA 3PTWA 3LL4A 2YJ6A 4RDHA 1RK8A 2HZVA 1PD0A 5LXRA 3FNRA 4OKIA 5LB2A 1CY1A 2HREA 1ZL0A 1BIFA 1UL1X 1B4DA 2WWWA 4F04A 1K27A 1KL7A 2VFTA 3DYIA 3QUSA 2VDWB 1Z2EA 4C4AA 4CM0A 2VPYB 1W8IA 3RTEA 2OELA 1VGRA 2ZIXA 4G36A 3ZY5A 4Q44A 2YS7A 2BEUB 3ULHA 4XDZA 2Y1EA 3GLFE 1DEXA 1JNXX 4IFBA 5LP6F 121PA 2AZDA 2QXYA 4X7BA 2X2PA 4KR7A 5DDQC 4PUOA 1FDTA 2HDHA 1VQMS 4G0MA 3U16A 2PK3A 3I1JA 5ALQA 1E6MA 1CR0A 3G88A 3RU2A 4JQYA 3PQ6A 3A4TA 1IOVA 4WP3A 3ZNJ1 2IMWP 2YZKA 3FCEA 3PDIA 1GKKA 3ZHOA 3HCDA 3E1GA 5IK2A 1BXRB 1UKUA 2K7JA 5EZSA 2W6JD 3PQ5A 4Q1EA 1KJ8A 3KZCA 5BORA 1Y1QA 2DKOA 4RNOA 2PVCA 3TSZA 2IYXA 5A0YB 4A48A 2R6GA 4DCVA 3H9BA 2FSVA 5DTQA 1VKJA 3S8MA 4QJ3A 2UZAA 2PFSA 4PC6A 1PVOA 2A78A 1CTQA 2QQ5A 2BKEA 2VZLA 4UDYX 3MCSA 5K3DA 2B6AA 2GLXA 1I3LA 4BO1A 5CA0F 4X4SA 4BRZA 4M8SA 2JLSA 3GCWP 2DR0A 4MVJM 4M5IA 1WC6A 3ZLTA 4D99A 2HAIA 4Y67A 2W98A 3LJKA 2VK1A 1GGHA 2ORVA 4KHPB 4JLMA 4AL6A 4I50A 2UYCA 4BLGA 2PX6A 3RS9A 5FP0A 3IHWA 3VNUA 2HJSA 3PNVA 3OT9A 5I4MA 1LA2A 3ZTOA 4I4LA 2IYSA 5FBWB 3VR6A 1K5PA 1OAAA 1N6KA 4JP3A 2B4RO 1MROB 5JARA 3I6YA 1YOVA 1U1NA 3WBZA 2B4KA 5AIBA 3NBPA 3ASYA 3ZZYA 2RGUA 3R7AA 5A5GA 4O0IA 4FYYA 4ILMA 2E85A 3C16B 1ZRMA 4QUAA 3P32A 1P73A 1YG0A 2RH3A 1P1LA 3R23A 1IOWA 3G7SA 1FRLA 4ZT6A 3W5ZA 1GFZA 4NPAA 1TELA 4DR7B 3JR7A 1VGYA 4IOAQ 1G7SA 4BC9A 2BR3A 4IIJB 1T1JA 4RYLA 2W2KA 4RHCA 5AXKA 4ZO9A 3TLCA 4PXSA 2ZIEA 3GJ6A 1ZOTA 3IUYA 4DLXA 4LV6A 3AK4A 1BE1A 1JTVA 4NA1A 5C5EA 4RJIA 1U6JA 4R1NA 4BV8A 4TXJA 1BE0A 1UQUA 3F67A 2XUAA 4YJ2B 5CYQB 1KBQA 3TGWA 2P9YA 3QTTA 5JDIA 2C3OA 1S79A 2D1SA 2CNOB 1FLVA 4QYMA 1AE1A 4Z8XA 1B1AA 2R1UA 4EEZA 3DPIA 1L5YA 2YKNB 1LFDB 1CJBA 4R9RA 3M89A 2C2XA 2Z83A 1I4OA 5KSWB 4RL4A 2PMBA 1UXIA 3RC8A 4X45A 2FHJA 1TZCA 1EWTA 1K9SA 3WL3A 4UHDA 5L39A 3G7NA 1S7CA 1P27B 3HFVA 3IC1A 2VHEA 3EWSA 1GRNA 5D6NA 3RW7A 1PYOB 2WILA 2CADA 4X20A 1HLPA 1UOEA 1IC6A 4MTPA 3PF8A 2SICE 4S04A 1XDSA 5J4LA 3G2OA 1T2FA 3IAS1 3UEOA 3W8FA 5LVAA 1BYUA 3CQ9A 3V5NA 1IN6A 2QX4A 2NVWA 1O6XA 4ICIA 3M3PA 4RD0A 3RVLA 1MGOA 3E2EA 3DDIA 1TT7A 3EXIB 4JCCA 1KWKA 4EY8A 3NFYA 3H2IA 5AUNB 1YVFA 4OLPA 4C6HA 1NLKL 2RJ3A 2C61A 1ELOA 1EU1A 4EGFA 2JFWA 2YIJA 2L9DA 1HL3A 2ZB3A 1VIXA 2YY3A 3JB9k 3H1AA 2ZJ5A 4EDFA 2OOKA 2ZI9A 4G0PA 2Q99A 4YVFA