2H5EA

Crystal structure of e.coli polypeptide release factor rf3
Total Genus 137
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
137
sequence length
527
structure length
488
Chain Sequence
LSPYLQEVAKRRTFAIISHPDAGKTTITEKVLLFGQITTSVMQFPYHDCLVNLLDTPGHEDFSEDTYRTLTAVDCCLMVIDAAKGVEDRTRKLMEVTRLRDTPILTFMNKLDRDIRDPMELLDEVENELKIGCAPITWPIGCGKLFKGVYHLYKDETYLYQSGKGHTIQEVRIVKGLNNPDLDAAVGEDLAQQLRDELELVKGASNEFDKELFLAGEITPVFFGTALGNFGVDHMLDGLVEWAPAPMPRQTDTRTVEASEDKFTGFVFKIQANMDPKHRDRVAFMRVVSGKYEKGMKLRQVRTAKDVVISDALTFMAVEEAYPGDILGLHNHGTIQIGDTFTQGEMMKFTGIPNFAPELFRRIRLKDPKQLLKGLVQLSEEGAVQVFRPISNNDLIVGAVGVLQFDVVVARLKSEYNVEAVYESVNVATARWVECADAKKFEEFKRKNESQLALDGGDNLAYIATSMVNLRLAQERYPDVQFHQTREH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title RF3 induces ribosomal conformational changes responsible for dissociation of class I release factors
pubmed doi rcsb
source organism Escherichia coli
molecule tags Translation
molecule keywords Peptide chain release factor RF-3
total genus 137
structure length 488
sequence length 527
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-05-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00009 GTP_EFTU Elongation factor Tu GTP binding domain
A PF03144 GTP_EFTU_D2 Elongation factor Tu domain 2
A PF16658 RF3_C Class II release factor RF3, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.3280 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2h5eA03
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2h5eA02
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2h5eA01
1VDZA 3A1UA 4W5WA 3ZVMA 4QNMA 4LUCA 1DAKA 4AKGA 4ASUD 2HXYA 2WJYA 3PENA 4TMKA 2QAGC 4PPNA 3ZYCA 1A5TA 2DFLA 2F1RA 1Z0IA 2FFAA 5DE3A 4NPHA 4DLVA 4DVGA 1W36B 5ANRB 2C2HA 1T9HA 1WP9A 4GMXA 4YMUA 3AP3A 2ZE8A 4QGAA 1G21E 4ON9A 3CRW1 2FSFA 3BWDD 4L9SA 4XOIA 4EUNA 1CLUA 3CNNA 4NU0A 3ZVLA 4JYBA 2C04A 3ND9A 4JLDA 4BFTA 2NG1A 3THWB 2ZRHA 4JBWA 4PHTA 3AUYA 4MH0R 4URVR 4RD0A 2W6JD 4A6XA 3BOSA 1CRQA 1FNMA 1P2TA 3LA6A 3FWYA 2J3EA 2VF7A 1J8MF 4HLUC 1TF7A 2XJ9A 4MKIA 4M1KA 3SYNA 4PHHA 2H5EA 3GFTA 5FH9A 4G5QA 3K0EA 3VNVA 2P6RA 4FMDF 2Z6VA 1RKBA 3BAFA 4QBHA 3ZIAA 3ZIAD 1LF5A 3Q7PA 5AJXA 2JDIA 3U3JA 4HATA 5CJPA 5DH9A 3AKCA 1WRBA 4CIDA 3A4NA 4EJSC 2FFBA 4HDCA 1N0WA 2FZLA 2PEYA 5JWRA 1KK3A 1D2EA 1YZQA 2NOAA 3LW7A 3PR1A 4CVNA 5KU1A 3ZVRA 4DLTA 2GILA 3FE2A 5CIWA 1P61B 4WOPA 2DHRA 4QGGA 5DYGA 4YMTA 1KAOA 1E2JA 1XF9A 4C2UA 4PHFA 1SVIA 4GRAA 3EX7C 4CT5A 3L8YA 2WJIA 2DB3A 1SKQA 1US8A 1N5LA 3B9PA 5G3ZA 4A1FA 4DBLC 1XEXA 1UJ2A 3MWJA 4MYUA 3M0EA 4A0FA 4JLKA 4II7A 1E0SA 4Q1EA 3T5DA 2VHCA 3HU1A 3IBYA 4MQBA 3TUJC 1IN4A 1E9CA 2RH5A 3OIWA 4F4JA 4B74A 2AWOA 4Q1CA 3NEJA 2P0EA 1P2SA 3F8TA 1UDWA 2VIIA 4GZLA 2CLCX 3GJ7A 1J70A 3R8CA 5L3QA 3IIJA 2H92A 3L0PA 3NBFA 2Q9BA 2G77B 2OXRA 4TMTA 2O8FA 4QNRA 3PEUA 3EA0A 2CE2X 4YXWD 2R62A 3RSLA 1OFIA 4W5JA 1KGDA 1RIFA 3TMKA 3FOZA 4XTCS 1Z0KA 4KI0A 5KNDA 3AP1A 4HAUA 1AGPA 4TL7A 5GVSA 3THYB 2CBZA 3UIEA 3KKPA 4TL6A 2BM0A 4ESHA 3LLUA 3ZDQA 1XJQA 4LBZA 5FFMA 3PEYA 1E0JA 2GBLC 1QHYA 3LX5A 3IBGA 1D5CA 2XITA 5KNBA 3BFXA 1G4UR 4XVRA 4IEEA 1YU9A 4PHGA 3ECCA 4Q7JB 4V0KA 4A92A 5KYKA 2PCLA 3THXB 4ZIRB 3IIMA 3LFUA 5HKKD 3CX7A 3J81k 4IRUB 1C9KA 2HEIA 2O0JA 3NBXX 2XSZA 4FW9A 1KK0A 3OIVA 4X8MA 1XD9A 2H16A 1XMSA 2QZ4A 4YMSA 3RYTC 3ZD6A 1CEEA 4B3CA 2EFDB 4CEIB 4A6PA 2ODNA 2BMDA 2FFQA 5HR5A 4OI1A 3KFVA 2W00A 2P5TB 4PO9A 5EXTA 1Q3TA 4U5XA 1COWA 1CJMA 2G9NA 3X2SA 4DCVA 2D7DA 2O8DA 1ZJ6A 4MKHA 4R71A 2QSZA 3AVVA 3CX6A 2EWVA 4DUGD 3QPUA 1RRGA 3N70A 1NN0A 1W49A 3A1VA 1SVWA 4Q47A 2O52A 1KSJA 1F2UB 4I1OA 4KFRA 4BFVA 5HZKA 3RS2A 4NCHA 1RRFA 4OK3A 1ZM7A 4AKHA 2VA8A 1Q1BA 4JLOA 1GM5A 4G3XA 2J0UA 1D8TA 1VYVA 2J0VA 1KO7A 3JVUA 4Q00A 5BN3A 1P6XA 4QBFA 2FA9A 4LJ9A 1L8QA 4HAWA 3UANA 1HEIA 4OK6A 4UXJA 3SC3A 1DG3A 4HZUB 1F3OA 5CK5A 1E2DA 1N5JA 1KIMA 5KPJA 1UPTA 1Z0JA 4IEIA 3A4MA 5LD2B 3RNLA 1E32A 5FBQB 2PT7A 5JEDA 1X1RA 2ORWA 2J46A 1GWNA 4FD2A 3UXMA 1P2UA 4ITRC 4TZ0A 4MA4A 5IT5A 2DPXA 2DWQA 1TX4B 4V0LA 3LRPA 2ZVQX 3TRFA 4WBSA 2ZITA 1XD8A 1D2MA 4PSAA 1QF9A 1W0KA 2J87A 1TPZA 3H2YA 1JAHA 1QHHB 3ETLA 3FKSD 4NH0A 1VKJA 2CLSA 3TVDA 3CO5A 3A8TA 3JVVA 4FCVA 3VTKA 5K8LA 5E3HA 2GKSA 1IY0A 4OJKA 1R0WA 3EZ9A 1M34E 1E9BA 2BJWA 2FG5A 3SU8A 5HE8A 3SYLA 5F98A 4TT3A 1FPMA 5DSZA 2KB0A 4QHSA 4Q1BA 2G83A 5FR2A 1NLYA 5CYOA 5J4KA 1M7HA 1M7BA 3MGCA 3VX3A 3U44B 4AYXA 3QY0A 4Y0AA 3FDIA 1LTQA 2ZI5A 4JKIA 4B44A 1ZU5A 2XZPA 3C5CA 1CJUC 2WOOA 621PA 3THYA 1XZPA 1XMVA 5BXQC 1Q3HA 1SVSA 4I1VA 4G5GA 5LPNA 4BZXA 4JLBA 4X8OA 1VCOA 4G5OA 4JT2A 1EFHA 4RKEA 3MMPA 2O0KA 2ZRLA 4PAOA 1YZLA 1H8HA 1KO8A 2V1XA 1ZM3A 4HDOB 2IYQA 5KDLA 1G3QA 2ZYWX 3QOFA 4BEJA 1OYWA 1QHXA 3QQ5A 3Q5EA 3M1IA 1AM4D 5TVKA 3WBKA 2AR7A 1P60A 3KFXA 1M7GA 1OIVA 3RS4A 4G5SA 4KV9A 4A8JC 1P9RA 2R2AA 3FHCB 2DBYA 3GD7A 2QROA 2HT1A 5E4FA 5C1BA 2CHVA 1U0JA 2R44A 3BJIC 3CM0A 2QQ0A 2W6JA 4FI3C 5EZ5A 2QAGB 1Y63A 1IXRC 4Q4HB 3UKDA 3FMIA 2R65A 3CRRA 5EE9A 4BEBA 2RB4A 1GRNA 3MWYW 3ZLJA 4JIMA 2OCAA 4Q9LA 3CNOA 1W4CA 1G8FA 3P1JA 5KOYA 4HEJA 4JJZA 4LC1A 1DAEA 2JAQA 1G16A 2QM7A 2SHKA 4O25A 2BKEA 1MO5A 1FMLA 3TBKA 1DO0A 2UZIR 3W5JA 1HQYE 4XVUA 1GILA 3RLFA 3NXSA 1EFCA 3ICEA 1R5NA 1P5ZB 2OHFA 4JSYA 1XPRA 2W2XA 2ZRKA 5J47A 2FOLA 2QU8A 5FTMA 3EZ7A 2G1KA 3IUYA 1I4TD 2NPIA 5KPDA 2JIZA 1XTSA 4PQRA 2OBNA 4WAUA 3K0AB 2GCPA 1XEWX 5JECA 2QAJA 2X19A 1AS2A 2VLIA 3LBHA 1G8PA 2OT3B 4L5BA 1KKLA 3T35A 2VRWA 2ZS9A 1GZSA 4DB4A 4JLPA 4LV8B 1CKEA 5FPYA 1CTQA 3B2EA 1E2MA 4LBWA 3QSYA 4FCWA 2QPTA 1GFIA 1JQJC 1EK0A 2GF0A 3E5HA 4BUJA 5FBVB 4GP6A 2RGXA 4Q5IA 1M2OB 1TU4A 4DLYA 3X1XA 2JJ2D 2C5LA 1EFRA 5E7IA 2NO6A 4BECA 1KDRA 1G3RA 3I92A 3KXKA 3RRZA 5E7JA 2ZXUA 3GP8A 1WCV1 3LD9A 4DZZA 5C2JB 1HT1E 5KDDA 4M53A 2QBYB 1M8PA 2A5JA 4KLNA 4A0RA 3IILA 3LQQA 2KSQA 3CR8A 4IOMA 1E2FA 4LHXA 2W0SA 3RWOA 3WMEA 3P27A 2QY9A 2ATVA 1F2TB 5GJBA 1HQCA 2A5FA 2YJTD 1N6LA 2MSCB 5IRCD 5F9FA 5CLLA 2MMCA 1J99A 1N5IA 4M8NE 4RSGA 3RABA 4JVSB 2VQSA 1G9XA 5IHPA 4DSNA 1F5NA 1NN5A 4IOJA 4V0ME 4Q02A 2ZJAA 3OFNA 5JRZA 3KQNA 1G8YA 1OLOA 3GJXC 1W7AA 3PITA 3GPLA 1D9ZA 1NG9A 1H65A 2FH5B 4BLQA 1GNPA 5G40A 4DEXA 4D25A 3EW9A 5B30A 1Q1ZA 3BFKA 4RFVA 4US2R 3B1VA 3K70B 3CLVA 4D4KA 2RGCA 2DY1A 4M9SA 4FMBB 1G7TA 1DAIA 1MRNA 4HB4A 3L0IB 1HE1C 3UMSA 3VQTA 2GXQA 2OG2A 4QFMA 1Q12A 2NZ8A 1GVNB 4TT3D 2BWJA 1QZXA 1NP6A 2ZREA 4AG6A 2H8KA 1JECA 1ZBDA 2C03A 1KK1A 1CS4C 2FEMA 5B58C 4JLJA 4X8HA 2EFHB 2AK2A 2P5SA 4X8LA 3U3KA 1N5KA 1T8TA 1TF5A 2FPKA 1VIYA 1Z47A 3BORA 4BLPA 4DUGA 5KSZA 1VHTA 4PR0A 2WKQA 4XSGA 4RD4A 2IWHA 3Q8XB 1NRJB 3NIBA 2IXEA 4MKGA 2IYTA 1PJRA 2AFHE 2OEPA 1Z3IX 4Q7LA 3SBEA 1YHNA 2IEYA 5BWMA 3UG7A 1P62B 5FPKA 1L7VC 1Q1QA 2CL7X 4Q7MB 3WNBA 1R8SA 2WWHA 2WIAA 4KFTA 1JR6A 2WPDA 4FINA 1R0ZA 1HUQA 1BKDR 4IJMA 4JLAA 3IPXA 4LJAA 5LB2A 3VR4A 1W47A 1JBKA 1VYUA 3WP1B 8OHMA 3K9LA 2VP5A 4K46A 5BQ5A 3FMPB 1C4OA 3HPQA 1N2CE 4PX9A 1E6CA 1LS6A 2LKCA 3PVSA 3A58B 1XU4A 3RWMB 3T12A 2BBSA 3PV0A 1KI7A 3AM1A 1MO4A 2GVDC 3GLGA 1HT2E 3CWZA 2I4IA 4TL9A 2FPMA 1AZSC 3FKSA 2A2ZA 5EQTA 2LWIA 3QPVA 2XXAB 1U90A 3OAAA 3MWKA 4ZKDA 3EPLA 3R9WA 4DCSA 3I62A 1XTKA 4DT1B 4L15A 1QHHA 3CF6R 4LYAA 5AUOB 1DO2A 3A6PC 5J5CA 4UKDA 2YC4C 1OXXK 4KYUA 1V43A 3BB3A 1P2VA 4FN5A 4A8JA 4A0HA 2EFEB 1OFTA 4URYR 4A9AA 1FMJA 1YZGA 5SZHB 4BE7B 4QL3A 1MT0A 3ASYA 2A78A 2BBWA 1MRSA 2VO1A 3CZPA 1OSNA 1E98A 1SXJC 5JFGA 2GXUA 3U3RA 3UATA 3D8BA 1RJ9A 4OQMA 5EP4A 3KB1A 2WWYA 1Z5ZA 4B3BA 2BBTA 2ECKA 3T1OA 2HT6A 3R20A 2HXSA 2IC5A 3KXLA 2R8RA 4C0QC 1E1RA 1ZMXA 1NVWQ 1ANKA 1UEJA 3I4LA 1RYFA 4OQNA 5H70A 4YDHB 1HY3A 1NIPA 4M22A 1D2NA 3IGFA 1XB2A 3RS7A 2KWIA 1W36C 2YC2C 2YOGA 1MR3F 1NVVR 1RPZA 5KO2A 4QJ4A 3GEIA 5GJVC 3NKVA 4HUQB 1N0UA 3TUZC 2OFXA 1W36D 5EE3A 3AP2A 3T34A 3A36A 2OV2A 4B6EA 4ACBA 1A2BA 1II8B 2JLSA 2GRJA 3GLIA 4CEIA 1T6NA 2NGRA 2ZU6A 4DT1A 2MSDB 3RAPR 2F9LA 4E07A 5JCZA 4E22A 4PFSA 3VU9B 1ZM2A 1RC8A 1W5TA 4K81B 4D26A 1LV7A 2YWHA 3CPJB 4MDEA 4IOLA 5EXPA 5IK2D 1AQUA 3I61A 1N6HA 1N6OA 4LYHA 1OJLA 1AJEA 4GMDA 4RJLA 4C0HA 2NPFA 4BQSA 1U9IC 3UWOA 4D0GA 1QRAA 4CRWB 3GLFE 3EPKA 4JBYA 3W6PA 3AVUA 5JSZA 4A2WA 3DDCA 5CDFE 3DL0A 2XJ4A 2W2TA 2HUPA 1FX0A 4G01B 4LYJA 3CUEF 1YQTA 1WXQA 5HZHA 3GJ5A 2VP0A 4RZXA 1MABA 5KSPA 5HKKA 4PAQA 1GL9B 4TMWA 4JVNA 3T1QA 2C9OA 2RGAA 4OK5A 1KMHA 4JL6A 3TAHA 1E99A 4FMCF 3B78A 2IEZA 1D6JA 1FTSA 5JI3E 2CNWA 1S2MA 4EFLA 5EP2A 4LPSA 4NCNA 2ZE5A 4BLRA 4ZCMA 1Z2CA 3LQRA 1NVUQ 2BJVA 4OHWA 3GLIE 4RCYA 2PCJA 3KZ1E 3O8BA 1S9HA 2WVJA 5BN4A 2C78A 4L9WA 4Q1AA 1P4SA 1NVVQ 2UZ3A 2QE7D 5JHHB 1U81A 2RKOA 1N6IA 1ONBA 3OIYA 5JSZB 4GNKA 1ZD9A 2JEOA 4AKEA 3DZ8A 5EE0A 1UEIA 2GF9A 1FQKA 1WBDA 1TU3A 3X1ZA 1ZNXA 3TGPA 4OI0A 4WZ6A 1W4BA 2IL1A 1FOEB 3SQWA 3BXZA 3KX2A 1KZ7B 3VNUA 2A5GA 2EYQA 4US0R 4BRUA 3IO3A 4OQFA 2IS2A 3VR1A 1ESNA 4PXAA 4ZI3A 2FDCA 4MRNA 5C46F 3B82A 2BKUA 1CXZA 1KNXA 4KJZA 3PEWA 3E2IA 2B8TA 3FPAA 1W4RA 1U99A 3K70D 3U7EB 3OE7D 5EE5B 3QBVA 2BVNA 3I5YA 4BLTA 3FGNA 4TSFD 5KUTA 1I2DA 1W46A 2JCSA 3FVQA 2A5YB 1ZM4A 4US1R 3NDPA 2IYXA 3ASZA 2QNRA 2HF9A 4LJ4A 2NO0A 1V5WA 4Z1MA 2J7PD 4XSHA 4D0LB 4DDWA 4GOXA 1DAGA 1S0UA 4TYQA 2Z4SA 3AF3A 4C0SA 4DSTA 1XMJA 4DLZA 3NVAA 3KKMA 4LV5B 4JL8A 4KITB 3TR5A 1K5DA 1NMXA 2RMKA 1TTTA 1AKYA 2GWHA 4WZBE 4YXWA 4AKIA 2PZFA 1EGAA 1S9DA 1T3SA 2QP9X 1YR6A 3LBIA 5JJLA 2KE5A 1AN0A 2VPPA 3GLGE 2IYRA 4KYIB 1XDBA 1YZNA 2W83A 3AVWA 1SXJA 3U7FB 1NI3A 3PJRA 1FFHA 4V03A 2QA5A 5CYPA 1NSTA 2C99A 4NYIR 1Q44A 3QKTA 1Z0FA 1IOZA 4DJTA 3VAAA 3B9QA 3QXHA 2JJ1D 4DRZA 1MV5A 5J4YA 4DDUA 2XZOA 1XCPA 5HCIA 4DC9A 2V3CC 4CGZA 2DYKA 1OIWA 3U6BA 4M9QA 1DAFA 1O3YA 1FP6A 3AEZA 4IVPA 4C3ZA 3WYAA 1K5GA 1ZU4A 4QHTA 2XAUA 1B23P 4HZIA 4ARZA 4QM7A 5A4JA 4HLCA 4JMPA 1G7SA 4LPKA 5FOWA 1TADA 3TJZA 1NVXQ 2RAPA 2FJUA 4HAVA 5EXSA 2IYYA 2XXAA 4N3NA 3Q85A 4WXPA 2V54A 4OQLA 4L8GA 4V0NA 2EU8A 5FBLB 4C0BA 3IDQA 4LRWA 2J0QA 4LBYA 5EP3A 1NBMD 1W1WA 3MRSA 4F4CA 2EQBA 3VKGA 4TMXA 1NBMA 1YZKA 3T06B 1QHIA 5BN5A 1TF2A 3CR7A 1KSFX 2OLKA 3ZS9A 1E2LA 1GRRA 2PH1A 1GDDA 1ZC3A 1EG7A 1PUIA 2DWPA 3K09C 4TLEA 2CHGA 2ZJYA 4EPRA 4JZKA 3M4YA 1E1QD 3FMFA 2VYFA 2IYWA 2JLRA 2ZR7A 4C7OB 4UNRA 1NIJA 2GDJA 5TARA 1N0VC 4EIWA 5JZVA 2GEVA 3EC1A 1VIAA 3BE4A 3GFOA 4NKRA 3GQBA 3PUWA 2QGZA 421PA 4BFXA 2P2LA 4BPBA 3R9XA 1KMHB 4JL5A 3U3MA 4UNPA 1BYUA 4BZPA 4BFYA 5J4VA 1OH5A 2NTYC 1HURA 5D3QA 4C0KA 3Q72A 2QENA 5F2EA 1IY2A 4R9UC 2O8BA 4DXAA 3LNCA 4GSYA 3A1WA 3Q3JB 1R7RA 2DFNA 5CK4A 2QTFA 2CNWD 4PZZA 2VTKA 3ZJYA 4RD1A 1FUKA 3ADDA 2FMXA 3IIKA 3OFND 1IN5A 4MRRA 5FPSA 3AUXA 3N2EA 2D3WA 2IUSA 1US8B 2Q0HA 2QN6A 4UJ5A 1JNYA 3MJRA 3VX4A 1R4AA 1Q57A 1FZQA 3VU9A 2VSFA 1Z6YA 2ZUBA 3HU2A 1ZUIA 2D2FA 3FFBA 4B2LA 2R6GA 2QE7A 2QMOA 5AUQA 4WVFA 2IS4A 1RVDA 1FUUA 1E2GA 4BASA 3LVQE 2PJZA 3TQFA 5KSYA 3U60B 1TQ2A 4MYTA 4DSUA 2IK8A 3BFVA 2GJ9A 1KI6A 4LCBA 1MO6A 2PBRA 4L4UA 2VP4A 4BFSA 2V55B 2ZRCA 3D31A 3HR7A 4HDQB 4A15A 5L3SB 4URXR 3ZZUA 1N3BA 2ZANA 3O8DA 2D7CA 2HYDA 5GVRA 4CEJB 3NEYA 3VKWA 1SVOA 1XTRA 2ERYA 2FV8A 4B33A 4KBGA 2YINC 3EIQA 1G4AE 2GXSA 5JMTA 5HTKA 1KY2A 2F43A 3X1WA 1NJFA 1LW7A 2D2EA 4LBVA 4HLDA 4QHYA 2GVZC 1GP2A 1E2KA 2HV8A 2RHMA 3LXRA 5IK2A 2IX3A 2IBMA 3QF4A 4JLMA 4B6FA 1P72A 2KJQA 1ZC4A 2H1LA 2ZVPX 1U2RA 3FHTA 2X1VA 3GCGA 1OB2A 2ZI4A 1WMSA 2BMEA 2XOKD 1NJGA 1II9A 1I4LD 3V9PA 4IOKA 2WBLC 1KI4A 2QMUA 1J7KA 1IJEA 1R2QA 2CMKA 3R7WB 4B73A 3RS3A 4ESVA 1FW6A 3AF4A 4P4TA 4M0LA 4QC2A 3C7KA 4MUBA 4YDSA 2R6AA 1X86B 4JVMA 4XTRA 3SJCA 5B2ZA 4NP6A 2F3TA 4DLSA 3NG1A 1JB1A 4POAA 5DI9A 1OE0A 4CDGA 4LHWA 1VECA 2V6IA 1GIAA 3GJ4A 5SZJA 2UVQA 5IDVA 3SHFA 1OHHD 1QG2A 1H8EA 3CF2A 4WZAE 2W6IA 4N0EA 2JDID 1VTKA 5L3SA 4JS0A 4KO8A 4GL2A 2OO7A 2JJ1A 1LS1A 3HP1A 4NONA 2ODWA 4URWR 2G3YA 3AKDA 1E2EA 1PZNA 3R8FA 4IDQA 2EWWA 3DEFA 3H84A 2VL7A 2BIFA 2CCJA 2OLJA 3KB2A 2XTZA 5TV2A 2VBCA 4HAXA 1UBGA 3VR6A 2O8DB 2QT1A 2IYVA 5J4HA 3BBPA 2QMHA 1WA5A 2GA8A 3DZDA 3N5CA 4FCTA 2K5UA 1Z6TA 3CZQA 2AXNA 2C9CA 3SZRA 2P3SA 4B35A 2XNDD 2QSYA 5TDHA 1HA3A 2BEKA 1PLKA 2IUUA 3TSZA 5SZIA 3S1AA 1G41A 3KTAB 4M21A 2RGDA 2GCNA 1KNQA 3GJ3A 1KAGA 4TSFA 2EVWX 3X1DA 1Z8FA 4DHEA 2ZM5A 1KY3A 3LH5A 1XEFA 5FTLA 2QORA 3B7GA 4D2IA 4KAXA 4ERNA 1MABB 2HCJB 4BFWA 2R6FA 2DFTA 1G7CA 4Z54A 5AUNB 4B2IA 1OPXA 3CH4B 3RANA 4TZ6A 2X77A 2J7PA 3AGQA 1Q20A 3EPHA 1PLJA 1A2KC 1Z29A 1ZNZA 2D62A 3DVLA 1KDPA 1E1QA 4NZYA 3T15A 4DLXA 4I99A 1N6KA 4XWKA 1GNRA 3AQ4A 2DWOA 2VP2A 1AKEA 4MRSA 2GZAA 1KKMA 2OE2A 3TKLA 1G64A 4AIIA 3MUFA 2A7QA 4Q03A 2WHXA 3GMTA 1DE0A 2A5DA 2W58A 4S2EA 3CIOA 2V1UA 2QP4A 3QUSA 4D81A 2WIBA 5F9HA 2ORVA 1L2TA 5FBWB 1S4QA 4HYYA 3VFDA 2CDNA 3UPUA 3H86A 2AFIE 1IXSB 1XXHB 1Z6AA 2YNMA 2QT0A 1KHTA 3OEEA 3RRNA 1OXSC 2OCYC 3MD0A 4Q4AA 4AWXA 2BMJA 3V4RA 4B3FX 4RD2A 1W5SA 4HUQA 3SQXA 2IA5A 1TQ6A 4W5HA 4OQXA 1Z0AA 3EARA 4S35A 4EFMA 4EPWA 2O0HA 2GNOA 3I73A 3K53A 3MG9A 2MSEB 5DO9A 5EZ6B 3QXCA 4NYMR 4NBSA 5GADl 1JPJA 1ZCAA 3OF5A 5CM9C 2C98A 4HI0E 5SZKB 5JHGB 3U7GA 1NMYA 3JZAA 5FOXA 3L82B 4OHYA 3SJBA 4CZ2A 1EFUA 5CIQA 3AVYA 3HJNA 3MWLA 2FZ4A 3ADBA 2FEOA 4C30A 3F0TA 2QI9C 1OF1A 4R2IA 1QVRA 1X3SA 4M9XA 2D06A 4AYTA 4HSEA 4TTRA 1S1MA 3O47A 2O8CB 5FUWA 3UMRA 3AH8A 2IYSA 2ZYTX 3H1TA 3CPEA 1EX7A 1U98A 1TUEA 3VMFA 5F3WB 1MH1A 1W44A 1IN7A 3ONWA 2DCUA 2NMVA 1IN8A 4C2TA 1QHGA 1ZM9A 4IDNA 2ZJ8A 4ASUA 1RE0A 5DHFA 2B6HA 1P9WA 2GJKA 3B1YA 3RC3A 4DIEA 1G8HA 1RRPA 3PXGA 1OKKD 4I4LA 4Q21A 1Z07A 2D74A 3UG6A 2V9PA 1KYIA 4B3XA 5H1YA 4A2QA 1BH2A 1VG0B 3OZXA 4F92B 4KU4A 1G291 3G82C 5LB4A 4NMMA 4QGFA 2J0UB 1NL3A 1KMQA 2GCOA 4P4SA 2IUTA 2ZSAA 1CR2A 3PIRA 2Q21A 2REBA 1KK2A 3K0FA 1GUAA 4EPVA 1Q22A 1G1MA 1BYIA 2JJ8A 2CCKA 4UXIA 3RC8A 2N42A 4EQ6A 3LDAA 1DVRA 3T5GA 3W6NA 2YOFA 3FTQA 3QEJA 1KI1A 4IFEA 4AY2A 2V7QA 1KI6B 4TLDA 3FB4A 2B7BA 3AVXA 2H18A 4HB0A 1XX6A 3GEHA 4B71A 2O8CA 1SHZA 3GFPA 5AK0A 5K8UA 4HLQB 2EFCB 1E4YA 2AHOA 2ZRFA 1OV4A 3DM9B 1M1YE 1IN6A 3JZMA 4PAMA 4NDZA 4Z1MD 3IEVA 4AC9A 3LLMA 4XIGS 3OIUA 2BMFA 221PA 2I1VB 3IPYA 1OHHA 4RCZA 1Z63A 1GTVA 2WAXA 2YZ2A 1ETUA 1XPUA 4TTQA 4Z51A 1AIPA 5EP1A 3U6KA 2FGKA 4MGYR 1XTIA 4RD3A 5FL3A 5GJCA 1CULC 5FOTA 3AVTA 1UKEA 2WV9A 3B6EA 3TR0A 3LAWA 4URUR 5FUVA 1WQ1R 4PC2A 3G5UA 4QG7A 1UAAA 4N0DA 2J9RA 4W9MC 3UMFA 4PQYA 2ONKA 3TIFA 3W9YA 4FXPA 1SXJE 5D3MA 2CVHA 3LY5A 4PPFA 1OXVA 3GJ0A 1E2NA 1SGWA 4HB3A 4H1VA 2FGJA 1WE2A 2O8EB 4D82A 1R0XA 2ZAOA 4Z8YA 2GAOA 2GEDA 4B43A 2Z4RA 4BLSA 3KTAA 4AI6A 121PA 3NH9A 1JJVA 3WMFA 2BCGY 4ZCIA 1WB9A 4YMVA 2PL3A 4JKYA 4B3GA 2C77A 3ADKA 1AZTA 3P4YA 4FIDA 4UXHA 4E09A 4W7SA 2KBFA 3GLHA 4CT4B 1YRAA 4KFUA 3QVUA 1P73A 1G6OA 3PFIA 3UK6A 2NO7A 2GETA 1HYQA 4U02A 4Q1FA 3MJHA 2JGNA 2QG6A 3SYKA 3BB1A 5B64A 3AVOA 4P3YA 5GJWC 4YQFA 2YYZA 4TYWA 1YR8A 5E95A 2LCFA 2ZSBA 4B75A 4D80A 1OT3A 3MFYA 1TQ4A 1ZD1A 1NMZA 4IKEA 4QKQA 4UQOA 2ZRGA 5M04A 1T91A 3KQLA 2HLDA 4XJXA 4Q1DA 3K70C 2OSBA 1W48A 3HU3A 1G17A 2ZS7A 1BO6A 2GEUA 3D6TB 1JALA 2Z43A 3HWSA 1A82A 3QJYA 521PA 3Q7QA 4ZDIA 1II8A 5JI2E 3ZZTA 3GLIB 2OAQ1 3KJHA 2QBYA 2REOA 2WWIA 3RS0A 1E0KA 4UNSA 1SVKA 3TLXA 3NH6A 1AS0A 4LYFA 1R6BX 4PO8A 1XMIA 3IQXA 3L8ZA 4MITA 4RZ3A 1KZGB 1L4YA 2B7CA 2CHQA 4EDHA 5J4LA 2ZETA 3C4JA 1JI0A 5CJ2A 4Z8XA 3WYGA 4PPQA 4C0LA 4DDTA 2XEXA 4CYMA 2X8AA 2CEAA 2H7VA 3GJ8A 3RHFA 3DOEA 4M1TA 1RFLA 4JLNA 3K0FB 2XSZD 4NYJQ 5TXGA 1DAHA 1QVAA 4C0JA 5CLQA 2GCOB 3AVPA 4XH9B 3PQCA 1KDTA 2JIZD 2YWEA 2R6DA 1KI8A 3HR8A 1BS1A 3NHAA 1AK2A 3QKSA 4H1UA 3RSOA 3RRMA 1WDTA 4BZQA 3WRYC 1OH6A 1OIXA 4JJKA 1Q21A 1ZCBA 4DIDA 3ZH9B 2FNAA 2O5VA 2Q9AA 1U8ZA 4QBGB 3THWA 1EX6A 1OH8A 3REFA 4LY6A 5JEEA 3C16C 1OFUX 2F9MA 2QUZA 4P4UA 1RYHA 1E9EA 2FE4A 5DHAA 4MRPA 5CDFA 4IDOA 3QXXA 3VR5A 4BFUA 2ZR0A 5H68A 5A0FA 4A8JB 2VEDA 5FI1B 4Q66C 2BDTA 1VG1A 5FI0B 2RGNC 1KDOA 4B47A 1KI3A 1T5LA 2N1BA 2WKPA 2WM9B 2VHUA 1YR7A 2G1JA 4GBMA 1EESA 2PT5A 1DG1G 4P33A 5FOVA 2UKDA 3KKOA 4ZDKA 1UKYA 3SR0A 3EA5A 3CRMA 2XB2A 3F3YA 2G88A 2OM2A 2FFHA 2Z5FA 3W8RA 1E2HA 3LV8A 2F7SA 4OHVA 3OEED 4WIAA 3GLFB 3FFAA 3FHOA 3C41J 2ZSFA 3PCRB 4OJQA 4LGMA 2C96A 5AR1A 1IM2A 1KSHA 1UBCA 4IVRA 4Q4JA 1TEXA 3SE0A 2OXCA 3E1SA 2ATXA 3BH0A 3U7HB 3SI7A 4CEHA 4QGHA 4XVQA 1W4AA 4KVGA 3SHWA 1IJFA 5EJEA 1S3SA 2F55A 4M1OA 3QI2A 1E79A 4DSOA 1NLFA 3IO5A 4NYIQ 3NBYC 3H4MA 3BB4A 4DDVA 2X2EA 1F48A 3GJ6A 1U0HC 4C0AC 4WXRA 5L8VA 1IBRA 3H0KA 4YMWA 5AJYA 3KQUA 3CWQA 2NIPA 3CW2A 4M4SA 3KQKA 3C5HA 2P6UA 1LY1A 1J2JA 2W2VA 1AS3A 3CB4A 3NC1C 5FL7A 4DCNA 5FBRB 2QEQA 2O8EA 2WSMA 3TSOA 3WNCA 1SXJD 2GK6A 4QXAA 5FOUA 3TQCA 2CL6X 2P65A 4Q9IA 2OCBA 3LO5A 1JXOA 1ZUHA 2P67A 3U44A 2REXB 4PO1A 2JA1A 1FQJA 3B8HA 3L2OB 2AKYA 2QGNA 2AL7A 1AA9A 1SHKA 2ZRBA 3HPRA 3I1FA 3K0CA 3PEVA 3QIAA 3I5XA 4KODA 1DADA 4LDJA 4NL4H 2JLUA 3QVVA 3S1AB 4Y0VA 4PC3A 4C7OA 3AF0A 1N25A 3WY9A 1A4RA 3W90A 1W2HA 1E2IA 3MAAC 4HB2A 2XTNA 1UF9A 4D6PA 2J41A 3I8SA 3AF1A 4R98A 4TWZA 4MKFA 1IONA 4TLCA 3EG5A 4KSCA 4CEHB 4ABYA 2IF2A 3MLEA 3SN6A 5A5GA 3W5IA 4Q4JB 5AJZA 4G5RA 1S96A 4QJ5A 3WHLA 2E87A 1KO1A 1HTWA 1N6RA 1NF3A 1ZYUA 3VHLB 1HE8B 2R6CA 4UNNA 4PZYA 3O8CA 1FTNA 4LHZA 4LHYA 1SXJB 4YONB 5JS8A 4NCIA 1CJKC 1WBBA 2P6NA 3TUIC 3U4QB 1UKVY 4OKSA 1ELOA 1N6NA 3QKRB 3K8YA 3CPHA 3IKJA 3SFZA 4P4SB 5FR1A 4V0OA 1Z0DA 3KDSE 1P9NA 5HCNA 1C1YA 1NY5A 2WMNB 1X8JA 2ZPTX 3IQWA 1GOTA 3AVQA 2YWFA 4NHOA 4TLBA 4TMZA 3TNFA 1G6HA 4LJYA 5JBQA 1S1CA 2ZRIA 3QENA 3OESA 4OHZA 5JJKA 1EFTA 3WYFA 2VSXA 4HAZA 2RCNA 5LD2C 2G6BA 3EIHA 2E9SA 4XD7D 1O87A 5DN6D 1J8YF 5B57C 3BERA 5DN6A 1R0YA 3R9IA 1YE8A 1P75A 4PSVA 2CE7A 2IS6A 4M9ZA 2DFKB 1GKIA 5KNCA 1GG2A 2L0XA 3BRWD 3NWJA 2YVUA 4ZDWA 1TAGA 2F1JA 1UBFA 2G0NA 1JJ7A 2F43B 4OYHA 2N46A 1QHSA 4M2LA 4U7DA 3A4LA 3K9GA 1OB5A 1FNNA 1Y3AA 2PZGA 4IVQA 5KHOC 4KSBA 1E9DA 5P21A 1G3MA 1QHNA 2ZRNA 5CB8A 4MYCA 2FX3A 4QBIA 5HE9A 1CR4A 1KSGA 5G41A 5C4GB 3SJAA 4AK9A 3AKYA 2ZE6A 1T4GA 1EFRD 1JQLB 1G3UA 2ZRPA 1GNQA 4KXFB 1MO3A 2IT1A 1KI9A 1U8YA 1Z28A 1VCNA 4PQFA 1GKYA 4F93B 3L43A 2ANBA 1GRQA 2IXFA 2J45A 2ZSDA 1GKUB 2LKDA 3KJGA 4B32A 5KSOA 3REGA 1FP7A 2QRZA 4ILEA 1NNEA 1Z06A 4NCJA 1IQPA 3GEEA 2CCGA 2OESA 1YR9A 2IYUA 2VF8A 3C15C 1XCMA 4V02A 5EUMA 3ZS8A 4O3MA 5J40A 3ADCA 3EWSA 2ZEJA 2B92A 1XWIA 1T5IA 5LDDC 5G53C 3QKUA 4MUAA 2VP6A 2FSIA 3K09A 2B8WA 4O0MA 4MYHA 4P31A 3M6AA 2NO9A 1KJWA 4Q18A 4C9BA 3P26A 5G3YA 4WW0A 2Q3MA 2RHDA 3DMNA 3LW8A 3ZVNA 3O8RA 3W3ZB 1R5OA 1CP2A 4M1MA 1E9SA 1U8AA 1GSIA 2BM1A 2J59A 1LNZA 1ZRHA 3K9HA 2YV5A 1TL7C 1X1SA 1RRCA 4Q48A 2ZYVX 1F6BA 4PZLA 3K1JA 2A3RA 3CRVA 4QM6A 4JYCA 4EAQA 3WRXC 4WA7A 2FSHA 4HLUA 3ZGXA 4IXMA 2BEJA 2IW3A 3BGWA 5FL7D 4MRVA 2HYIC 1XBTA 4Q4LA 1A1VA 1JXMA 2C95A 2W6ID 5EXXA 4BWYA 5DI3A 3QE0A 2J0SA 2VHQA 3K0CC 4KBFA 3BIFA 1FX0B 2EW1A 3AV0B 1ZVQA 1VG9B 2ANCA 5JS7A 2WWXA 3KJIA 1XTJA 3CONA 3W6OA 4BGDA 4P32A 3OEHD 2ZJ2A 1DTSA 4Q19A 1U94A 1A7JA 4A0GA 4EKDA 1U0LA 4TTPA 3TSWA 1VMAA 5JCPA 4LC0A 4CF7A 1DELA 2V4ZA 2WPDD 4TQAA 3THOA 4KCGA 4O2LA 1OH7A 1YZTA 3OE7A 2I3BA 4KLZA 5AWFC 4OI4A 1TUIA 2GZHA 3SS8A 2B21A 4EJSB 1T0JB 1Z6XA 1XXHE 2VHTA 1I4DD 1R8QA 2GTPA 4GT1A 4B2PA 3BC1A 2BCJQ 3VKHA 3R7WA 2IXGA 4EQ6B 1UM8A 2BV3A 3BS4A 4IDPA 1LVGA 1ZAKA 1XNJA 2AKAB 3GLHE 1R10A 3OAAD 5DIFA 3F5FA 2Y8EA 4C4PA 3QNUA 3NHBA 2G0TA 1M74A 1Z08A 3ZQ6A 5L3VA 2HJGA 3BK7A 3QF4B 1G5TA 3QKSB 4E5UA 4RD6A 1W0JD 4I81A 1W0JA 2ORIA 1E9AA 1YZUA 2NZJA 1Q0UA 4LJ5A 4DCTA 2WKRA 1Z6GA 1NY6A 3DO6A 4FWTA 1E3MA 1PUJA 3QPWA 4B48A 5L3RA 3AGPA 5JJIA 4EPYA 2H57A 3EC2A 5FTNA 1E2QA 4TL8A 4V0MA 3SFVA 1SVLA 4LJ6A 2IYLD 3TE6A 4EFNA 4UJ3A 2QTVB 2ZI7A 1JR3E 2XNSA 2J7KA 5DNYB 4MGIR 1VYTA 1G5PA 3TAUA 2GBLA 2WICA 2X2FA 3VR2A 2C9YA 1DEKA 2WWGA 3AF2A 2E1RA 3QF7A 3NTUA 1GAJA 1LFDB 2PX3A 4GZMA 2YOHA 4Q9HA 4AURA 1N6PA 5LBIA 1S3GA 2OFWA 4M1SA 4JT4A 1JAIA 3U2QA 1P3JA 3P20A 1CBUA 4AYWA 3V4FA 1SQ5A 1L4UA 2TMKA 4PTLA 3IHWA 1COWD 4TQUS 5JWOA 2ASEA 1S8FA 4PSKA 3U61B 1NKSA 2FSGA 4N1AA 3NC0C 2JLQA 1NSFA 3LBNA 3I3SR 4F91B 1JR3D 2CVFA 2GHIA 3KXIA 2YHSA 4I1UA 4PPGA 1T8UA 2FU5C 1EWQA 3DOFA 4KVAA 2HLDD 2GAAA 4PC7A 3KUCA 3EWAA 3WP0A 3E70C 2F3RA 2XGJA 3CKLA 4ZCLA 2JLYA 4DLWA 2Q9CA 1PVOA 3X1YA 4Q9KA 2XZLA 2ZI9A 2XTMA 3TH5A 4AG5A 3MSXA 2OZEA 1G8GA 2ZRDA 3W34A 4PC6A 4ACAA 2PEZA 1GITA 5CITA 2JLZA 5BW8A 4GFDA 4JSTA 5BYKA 3EXAA 3DMDA 2IYZA 4LI0A 2J5XA 2VHJA 2ZRJA 1JEEA 4YC7A 2OFOA 4AD8A 4LOAA 4NCKA 2EFGA 4TLAA 4XD7A 3WNDA 4D4MA 4GDFA 2V7QD 1VG8A 2KI5A 4KHZA 1MOZA 1DAMA 3TK1A 2QPAA 1NN3A 5TMPA 3CX8A 1YRBA 1XFAA 3DKVA 1F2TA 3QG1A 4YLGA 5FPTA 2ONJA 3SDZA 1UKZA 1B0UA 3SJZA 1CR1A 3NBZC 3IEUA 2A30A 2OBMA 3I72A 1CJTC 4LJ7A 1E79D 4XWOA 1VCIA 1SZPA 1LF0A 4NYMQ 4ARZB 4FMDB 3KKNA 2QQEA 5AJWA 4B76A 1X8LA 3EZFA 821PA 3WHKA 5CB6A 1ZNWA 3I32A 2V8OA 2QMEA 5EUQB 3BH6A 4P0TA 4MGKR 1KTVA 2EYUA 1II0A 3PG5A 4G0NA 3DHWC 2ZRMA 1HV8A 2IF0A 4TYNA 2ZSEA 5KDOA 3RRYA 3LWNA 3DPUA 2CJWA 4IFBA 4E03A 2QL6A 3TW8B 2CL0X 2PMKA 2ZQ5A 3N2IA 3D3QA 2AK3A 4KFSA 1E9RA 2FPLA 1CJVC 2GESA 2WJVA 3CNLA 1UBEA 4HZUA 1PLLA 4DLRA 1BOFA 4J0QA 3K0AA 3WMGA 2WWWA 1H8HD 1XRJA 2OBLA 4DLUA 1DBSA 4IHQA 5DYIA 5C4MA 1K8RA 4NE2A 3LXXA 4PANA 1E4VA 3U4QA 4LSGA 4BRWA 4U00A 4NYJR 1E1RD 2VH5R 5DISB 5FUXA 4Q01A 4ZI2A 4CEJA 1M6NA 1NLZA 2WJHA 3L0SA 2XOKA 3B60A 1XJCA 5TB5A 4K8OA 3CRQA 1QBKC 4A4DA 1RW4A 4RKFA 4DKXA 3HDTA 4F38A 4MDFA 2IHBA 1T3LA 2PX0A 3EAQA 4QRHA 1P7CA 4R2HA 2AXPA 1UADA 3NDBB 2Q3FA 1ODFA 3ICQB 1SKYE 3G0HA 3FKQA 4OBEA 3AKEA 1FL9A 1YJ5A 4DEYA 3T1TA 4DB2A 3EPJA 3B5JA 3TVTA 1H8ED 2HCBA 1D9XA 1VPLA 1Z2AA 3VHXA 3GLGB 1ZW6A 4ZIRA 4ZDJA 3BD9A 2BC9A 1DARA 2Q6TA 5AUPB 2JASA 4RFSA 2A9KA 1YKSA 1Z83A 2ZJ5A 1G19A 5EE1A 3K9NA 3T1VA 1QDEA 5HPYB 3OEHA 5DLQC 3T61A 2QTHA 1XZQA 2WSSD 5JRJA 4XWAA 2HDNB 2WSSA 4Q9JA 2OAP1 3CH5A 5H8WA 3HYRA 5FUYA 3GLHB 3QBTA 2ZUDA 4IXNA 2HF8A 4H9GA 1W0KD 2YWGA 1GL6A 6Q21A 2JLVA 1IY1A 3C14C 1X6VA 2AD5A 5KTYA 2QAGA 4MGZR 1ZNYA 2D4HA 2O8FB 2ZIAA 4RZ2A 1ZUNB 4LV6A 2ODEA 5ELXA 3SOPA 2WZQA 1ZP6A 2F1HA 1TEVA 3WXMA 3A1SA 1OYYA 2GJ8A 4LX0A 2BBOA 2F6RA 3UWKA 4OI2A 3THXA 5DGXA 2RGNA 1KOFA 2MMGA 2XB4A 2Z83A 3A37A 3D7MA 2IS1A 3TW4A 2GXAA 1Z22A 2H17A 2YKGA 4PC1A 4D4JA 4IW3B 1K6MA 4RFSB 3PUZA 2WOJA 4ZPXA 2RGEA 5FPHA 4FMCB 3DM5A 1XCGB 1W2GA 1SKYB 1ZINA 3SBDA 3B13B 1J90A 3ZZ0A 1OXTA 2RGBA 1G20E 1G3IA 1G5RA 4JVLA 2AN9A 2VP9A 2FWRA 3KJEA 2JLWA 1AQYA 4RY2A 2ZRAA 3EZ2A 3OHMA 3EZ6A 3RS5A 1EWRA 1IAQA 5JWHA 1UDXA 1E0AA 3EASA 3RVBA 3FYHA 1PV4A 1E9FA 3EIEA 3KKQA 2J1LA 2PLFA 1RZ3A 4L16A 4LHVA 2XX3A 1IXZA 2CXXA 2F1IA 4M1WA 2ZTSA 5E7MA 4UNQA 3U5ZB 2ZYUX 4O2RA 1EXMA 1XP8A 3W8NA 2RGGA 3WBJA 4I1SA 1IHUA 2QRNA 1ZIOA 1G7RA 4G1UC 2GZDA 4R7ZA 3P4XA 1XTQA 3RDPA 1CF4A 3DKPA 4BLOA 2ZJZA 3W3AA 4JLVA 2ZE7A 1RJ9B 1HH4A 1XD2A 2CJWB 2ZJOA 3QG5A 2NQ2C 3KQHA 1G18A 3SEAA 2GJAA 3ZQJA 4TQ9A 4TN1A 1ZD8A 1JR3A 1MKYA 1UFQA 2C8VA 2JLXA 5TY0A 2V6JA 1KJZA 1TNDA 1YVDA 1XPOA 2WMOB 2PJRA 1BIFA 1F60A 2PZEA 4QJ3A 1T3HA 1XD2B 4JBXA 1E2PA 2AX4A 4RVCA 4DCUA 3LX8A 4GP7A 1OKKA 2OCPA 2FN4A 2Z0MA 4URZR 5K8TA 1Q1EA 2AD1A 3B1ZA 3V00A 4EJSA 3PUYA 5FTKA 1KJYA 3ZD7A 5BYJA 3Q5DA 3QKRA 2PMDA 4QOSA 2HJVA 2QP3A 5FOSA 1ESMA 2IHYA 5CM8B 2AWNA 1JEDA 4TYYA 1ZIPA 2GJSA 4A82A 2Q3HA 4FWIB 4D4LA 1F2UA 2OUKA 3KL4A 4ZO4A 1CIPA 4ZV4A 2ZI3A 1OW3B 3ND8A 4D0NA 3MCAA 3QXJA 2ZU0C 1CRPA 1NBME 4Q7KA 3U3OA 1SULA 1TMKA 3PUXA 2GK7A 3P32A 2DR3A 1KO5A 2CLDX 3BH7A 4EPXA 4EPTA 1U9IA 4Q4AB 2JJ2A 5DI3B 2R9VA 1DPFA 1XXHA 3IHLA 1XEWY 2W0MA 3B85A 1E69A 3C8UA 3VR3A 3Q9LA 5K8IA 4BFZA 4LZZA 2NO1A 1TQDA 3CBQA 1AGRA 3SNHA 4B3DA 4Q4HA 2WAYA 4NTZA 5AJVB 2ZJBA 4GOJA 1E94E 1NKTA 4F7WA 2PLRA 3LVRE 4B34A 3L0OA 3K0SA 4GOKA 4F4IA 2BHRA 3I8XA 4OL0A 4CW7A 1DS6A 1NN1A 1X8KA 1XJ0A 2CK3D 4GI7A 2O8BB 1VHLA 2CK3A 3QXSA 2QM8A 2JATA 5D3MB 1R5BA 1SVMA 3PUVA 2ZROA 3FMOB 1LB1B 2ERXA 2QPOA 1CU1A 4LK2A 4RZUA 3A1TA 721PA 5JLJA 3QEOA 2IWRA 1GL7A 1WF3A 2WJJA 4DWJA 2XNDA 1VCMA 1XEXB 1E96A 2ZAMA 2VSOA 2ZS8A 1NG1A 2BOVA 4A2PA 1CR0A 4TYPA 1KO4A 1OXUA 4LWZA 4A36A 2WJGA 1KI2A 1I2MA 3CF0A 3HYTA 1JPNA 4GPTA 2ODBA 5C18A 2I1QA 1BMFD 2KBEA 4OHXA 1BMFA 3B1WA 4LJ8A 5L3QB 4HUTA 2ZR9A 4M1YA 4ZKEA 2ZUCA 2WTUA 1DOAA 1T0HB 3AB3A 3B1XA 2WWFA 1QG4A 4HAYA 5UKDA 5IF9A 2ZI6A 4TMVA 4IDHA 2FF7A 3KUDA 5FTJA 1OFHA 3GLFA 2OILA
chains in the Genus database with same CATH superfamily
1DWUA 3LFTA 1RJGA 2UZ1B 2ODTX 1YJVA 4LUCA 5C1IA 2VQFF 1DQ8A 4AKGA 1EFPB 4FUQA 4ND8A 1A5TA 1YQDA 1YFLA 4C1BA 1PGQA 2A1TS 4XJSA 4O4IA 5J2PB 4H0CA 5IXYA 1JU9A 3BWDD 4L9SA 1CLUA 1SHUX 1TUBB 4CM7A 4QIEA 5EIXA 3GB0A 3HRIA 2Y4NA 2W43A 2DHHA 1H6BA 2C2BA 3BYRA 3ZK8A 2GIQA 2PXCA 2RH4A 3GFTA 1WPXA 4MKRA 1RKBA 3E53A 1H2WA 3LP2A 4IH9A 5EPUA 4BGIA 1CZUA 2P9YA 3QELB 3AT1B 1RT6B 2A2CA 2PMBA 5DYGA 1J1UA 2NP6A 3L7LA 2CBGA 5L1LA 3C15B 4PHFA 3QJGA 4CT5A 2RGRA 3UUEA 1SC3A 2SKDA 1CP3A 3O7WA 4YAGA 2YX1A 1IN4A 1E9CA 3QTBA 4IWXA 2RKIA 2KG0A 1ZQ1A 3AW9A 2AWOA 2ZZMA 1MC5A 3COPA 5KOJB 2YVAA 5L3QA 3IIJA 1F1BA 3L0PA 2QD4A 3BBBA 4TMTA 3ZZRA 5D5QA 2BI8A 4GPEA 3LOQA 3M9WA 1WZEA 5B0AA 1IR0A 2F48A 4TL6A 5LZ4A 3NAIA 4LBZA 2P27A 5HEKA 1F3LA 4XVRA 1OS5A 3LE8A 3U81A 3J81k 1TLFA 2ZB2A 3PNQA 3RYTC 5U47A 2PX6A 5AT1A 4CEIB 5EXTA 3I12A 3D7LA 2Q50A 4F96A 4KIWA 2ZM6B 1WABA 1FF9A 4E5NA 5CD4A 1FEHA 3IEXA 4KFRA 2JGJA 3QZUA 1T6YA 3AC0A 3G8DA 5BRAA 2DH7A 5HQJA 1D8TA 3EVOA 1P7YA 3ROQA 3L1KA 3Q1KA 2J6BA 3UHPA 2R5WA 5E7OB 3ZBTA 3HHLD 1LSOA 2E7ZA 3WC0A 3A4MA 5JEDA 1FDSA 3X1MA 3ZY6A 4TUYF 1AQLA 2B8PA 4HCJA 3MMNA 3FKSD 4G4IA 3S4YA 3VTKA 1ZRSA 2X4IA 3LUAA 1KU6A 2K3IA 4DA0A 1T24A 4DG1A 5IU6A 3FYUB 3S8MA 4WN3A 3K6JA 3L7JA 4N3GA 3C3KA 2R85A 5KWSA 2IDJA 2IKQA 5EHNA 2BFCA 2WOOA 1IY8A 1Q3HA 3RUPA 3RE1A 2XNJA 4YBZA 2M8HA 3DRRB 1YZLA 5C7OO 4CYUB 1DWOA 4BEJA 3KFXA 2OO5A 3CE9A 1D9AA 2EGHA 3L6CA 2WE8A 3OI7A 2V0NA 3IDFA 5KNBH 4RELA 3T4PA 3E1GA 4F9TA 3PQ6A 3D6AA 2W6JA 2MKSA 5EEGA 3UKDA 5K0JA 2VJVA 1CQJA 3CRRA 3ZLJA 4JIMA 5CVVA 3M7VA 2ZUFA 2R7LA 1YSCA 3R5JA 2O7SA 4K2HA 4EA8A 3QE9Y 4O25A 3HZRA 1IVZA 1JV2B 4CTAA 4UE6A 5JOQA 4YAIA 4RPHA 2DAPA 1N1EA 4X6YA 3VAFA 3KR0A 5AHRA 3OJXA 1WC4A 1T9GS 3QPCA 1R5NA 1JYEA 3ETCA 4CUZA 1ST2A 3LUJA 2HBQA 2H1SA 2CRLA 3JTNA 4MRMA 2AJCA 3D2WA 3LA8A 1N3YA 2HCTA 3B12A 4EF6A 3UXEA 2WUEA 2DHSA 3E5HA 1W4LA 3HKBA 2BGLA 4TSKA 1FRKA 2BFFA 1MRZA 1ADBA 2IVMA 2HVZA 1FTCA 3L07A 2QW8A 4JYMA 2FDNA 4IUFA 4U8GA 4BNUA 1HDYA 4P3KA 1M2VB 4Z5XA 4OYAA 1Z34A 3NUZA 1J4AA 1CZRA 4RSGA 3EXEA 4R9SA 1M5HA 1NN5A 2VPQA 3TZLA 4NBTA 2WNIA 1P0FA 4EKEA 4KHMA 1CVJA 4US2R 5HUJA 1GZ4A 4X64F 3PWKA 4RDCA 3WV4A 4QFMA 3A25A 1S2IA 3ONNA 2BWJA 3PJ9A 4CN9A 1DQZA 3GUYA 4X92A 4YRGA 2H2WA 4JLJA 1L3VA 2C0QA 5KSZA 2C7BA 4FF3A 3B9RA 4ZAGA 2OBBA 3E9RA 3E1KA 5TRTA 1UKAA 2GSDA 2B9YA 5KX5F 1EZZB 3VZHA 4XQEA 3UN1A 1TIBA 1LLUA 3RT9A 1KP6A 1YOVA 4DLPA 5KOJA 3GROA 2I3GA 1JBKA 3RQSA 2QRVA 1T4DA 2RHHA 1ADYA 4FXOA 5COBA 1XU4A 2O0MA 1JHAA 3LWBA 3GLGA 1HT2E 1USUA 3VI4B 1A27A 4D74A 1GR0A 1KBZA 5DLYA 1FKOB 2O1SA 2RUSA 1RZRD 5D8HB 3ORHA 4UTRA 3ELDA 2QZPA 2C7PA 2I2AA 3BB3A 5G1OA 3N7AA 3IUMA 3OLWA 1QIJA 1DQSA 4RDHA 2B0GA 2FUEA 2I91A 1DV2A 2X8BA 4OQMA 5IEBA 4H60A 2N47A 5EP4A 3SDEB 1ISMA 2CUYA 4F2SA 3TTUA 3H2LA 4WWHA 3GCWP 2XWXA 3I4LA 2R1TB 3FJ1A 2DHCA 5IBQA 1CLEA 1ZZEA 2Y8YA 1Z4NA 5GJVC 3PL1A 4ETMA 3DU6A 3MWFA 4LTNA 3L77A 1HLPA 5EXPA 1AQUA 2I5JB 3W5YA 2PX5A 3D54D 4TKLA 3OU6A 3AVUA 3H19A 1E0DA 4RULA 2WFLB 3PQFA 4QT4A 4RZXA 2RHGB 4GLJA 3O38A 4CHGA 2VWPA 3ISTA 3V1UA 4RCYA 4INOA 3GFHA 4KGDA 1BD4A 2C78A 2BFCB 3E4CA 1EWVA 1BXGB 2PMEA 2JLBA 1FVHA 5EJAA 3TGPA 2C2EA 3M2VB 2FK7A 3F4LA 3ZX4A 3V55A 3BKTA 2Q6VA 4BMDA 3B52X 5JYEA 3NXZA 3MT8A 4FMPA 3G86A 1XNRJ 1RJWA 4MUNA 1BHJA 2W6MA 3DLGB 1M2NA 4GPD1 1L4EA 2KDOA 2EK1A 4Q37A 2IYXA 2NXCA 3AF3A 3WLOA 3TR5A 1O0BA 1Q83A 3SD7A 2UUCF 3PHHA 5FP0A 4CN8A 1HNWJ 3LBIA 2VPPA 1OI2A 2IVFB 3CTPA 1YZNA 4CG2A 2NS1B 2ZYHA 1RISA 2MJUA 2IYEA 1X39A 3VAAA 2Q7OE 2DNZA 4DRZA 3F4KA 3OLQA 4QHTA 2CXNA 3PACA 2H1YA 3NT2A 1MHTA 2FJUA 3C8DA 1L5WA 2IYYA 2XXAA 2KRBA 4OQLA 1R4MB 4GPIB 2QDXA 4O2AB 3AUJB 5EFZA 4LRWA 5LFAA 2YYSA 1EGMB 1J0CA 4JV0A 1DQ9A 2SBTA 4M54A 4PLCA 2IGTA 2QA2A 2ZH5A 2X5KO 3OA2A 1ONNA 2M88A 2WIFA 3ZNJ1 2ZJYA 4CM8B 5JFOA 4UT4A 2OP0A 3DAHA 2A0FB 5EMNA 4DR3J 1CULB 2VNSA 2OCXA 4BC0A 2P2LA 1KMHB 1F9EA 1IH8A 1L0BA 3PGXA 3WGHA 2FMXA 3N0RA 4NA3A 5EUHA 5KOHA 5FPSA 3CIFA 4M88A 4B40A 2LA4A 3NYRA 4EHDA 2GN2A 3C6TA 3TXYA 3E23A 5DDOC 3MW8A 5BR8F 2JHEA 3FK4A 5C25B 3G8YA 2ZANA 3PFKA 2VPYB 2OHHA 2ERYA 2Y9MB 4JC0A 3H0PA 1EK2A 3HN2A 4W4TA 3MR2A 3JQQA 4E3WA 5LA6A 3QYJA 5IK2A 2VQ6A 2IBMA 3BG5A 2KJQA 3S0JA 1ZC4A 3O31A 3IQFA 4MQLA 3GBVA 3ZCVA 4DR7F 2H9ZA 1XO1A 4AX8A 1FW6A 1K8AT 1UP4A 5KWJA 1X86B 3O0DA 4EFDA 4ED2A 2IP4A 5AI9A 2DFVA 2X14A 1FDBA 2GERA 1VECA 3OXGA 2XCSB 3N2LA 5A9SA 4TXHA 4BMXA 4FDTA 5L3SA 3NJ4A 4PAAA 1UODA 3ZZYA 2G3YA 2BZ2A 3O8NA 1HE3A 2XCTB 1WEXA 1E3IA 3PKIA 4EI9A 2O8DB 2FI1A 1G3OA 5KVCA 1X19A 1RWVB 4Y2IA 1QANA 1U3TA 4I9FA 3DMJB 2XBPA 4K9KA 4RGVA 1T43A 4CU2A 5CCXA 1MJHA 5AUNB 1TA9A 5LJLA 3RANA 3HFSA 3OJCA 2DR2A 3T99A 3A9RA 1PLJA 2H4ZA 3KVNA 4NZYA 2OKCA 3R0JA 1C2TA 4AIIA 4NU5A 1RAIB 2DY0A 1DE0A 2AYXA 1BU5A 4BNDA 3VFDA 2R2SA 4JQOA 4FJ0A 4JI7B 2JSXA 2QT0A 3CEJA 1G0OA 3ET6B 4L9AA 1GEGA 4Y2XA 4EMSA 3OPYI 2TRSB 4NMXA 2X0DA 4NBSA 1WG8A 1K8YB 2C94A 3KBBA 3WGLA 4FFBA 4N8DA 3ADBA 3F0TA 4R2IA 1QVRA 1DEXA 4HSEA 4TTRA 3L9XA 1N36F 3JARA 2BA9A 3KS9A 1KLMA 5J2UB 3QE3A 2HK3A 3OT1B 5ENVA 2I1RA 1RLMA 1QTIA 2VYVA 1WUHS 3GAAA 5K14B 3UH0A 4IIEA 4R5HA 4CM0A 4BO3A 1VG0B 2DUWA 2OMOA 2ZKUA 1NL3A 1GTSA 2DTDA 2R0QC 4V38A 3KR9A 3EW7A 3L7DA 3ITEA 5EXDA 1SVNA 2JFVA 1L5ZA 1TGYA 5AXCA 2CN1A 2DERA 1N54B 3D4PA 2CHFA 3IEVA 4CIWA 4Z4IA 4PWDB 4HGQA 1V8FA 2NAPA 4QLBA 1EQ0A 1NP3A 4NEQA 1RPTA 4PQUA 4B9TA 4N0DA 3LW5C 5CHCB 1JLFA 4FXPA 1WXXA 2XMVA 5E6SB 5LSRA 2O8EB 1R0XA 3LU1A 3BDPA 4G1MB 121PA 4B7CA 4B3GA 1MEJA 1RYMA 5JNWA 1MX3A 2C8JA 4FKYA 2DGTA 3UM9A 1YRAA 4JODA 4MI3A 2J3DA 2NO7A 5BT8A 4HDSB 2HMAA 2PDAA 4ZIVA 4Y9TA 4EGCB 5KWIA 2GZ2A 1OT3A 2Q8PA 4XTTA 1AU9A 2IYGA 2PIDA 4R54A 2CIMA 2Z43A 3QJYA 4J9VA 4UNSA 4DFKA 4BY9E 1L4YA 2I55A 3HNPA 1GXUA 4OXRA 3C4JA 2DLCX 4KBYA 3OQIB 3QJJA 1Y9AA 4AROA 1G2PA 3N6XA 3AKZA 2QG4A 4GC9A 3CJSA 3N3AC 3VXKA 1MW7A 2C0PA 1YOBA 2J0XA 1ZCBA 3C8YA 5EX0A 4GXQA 1XERA 2CHEA 3KSZO 3D8RA 2FK8A 1T4CA 5DBHX 4L4SA 1LWOA 5LOVB 4YRKA 4ED3A 5FI0B 2HH9A 4E4TA 1GAQA 4DLKA 4ZMRA 4N56A 1YR7A 2G1JA 4JB2A 4Y2TA 1PJ7A 3DDUA 1Q79A 4DJ5X 5K0ZA 1DDGA 3HO8A 4WZZA 3OPKA 4X97A 3W8RA 3IOMA 5JAMA 3OEED 2Q3JA 2IY8A 1UBCA 3K5OA 4R1QA 2A88A 1NPYA 3RG6A 4M1OA 1EU1A 4BV3A 5LZ7A 1LPBB 1F48A 5L8VA 4U63A 3BDVA 3KQKA 3T9EA 2O8EA 4HN4B 1TZJA 4UOEA 2P65A 2A58A 1JXOA 1FRMA 5G0WA 1P2BA 3K0CA 1AA9A 4MS1B 2VJAA 3QVVA 2AV6A 4FS3A 2WP8J 3WZ0A 1N25A 2NZ4A 3G5MA 4ZHQF 3TAMB 6FDRA 5DGDA 4GMKA 1OBFO 2W22A 3OBIA 3PJDA 4X7MA 1THMA 4LF9F 3U7IA 2PGAA 2LA6A 1NUAA 2ODQA 4Q5VA 1HE8B 2HIHA 4JI5J 3FI0A 2P6NA 1CUCA 3I9MA 1T2NA 1CNFA 2R79A 1DGQA 4KJIA 2EX0A 3G2NA 4DG9A 1GOTA 1DXHA 2YWFA 1CRZA 3G6KA 1O4WA 2BRKA 5L7YA 2AC7A 4M0CA 4Q45A 3UAOA 1EUCB 4XLTA 4KBIA 3ZTRA 3AI2A 3RVPA 4YT5A 5C34B 4YFUA 1A9NB 1YI1A 2Y0DA 4TXNA 2YVUA 1U4BA 4J0JA 2QQFA 4D4HA 3RROA 2A0UA 2IIVA 1JDPA 1QZUA 1XMOF 4KXFB 3K1ZA 1JSCA 3DXFA 3MTIA 2VUIB 3QGHA 4B32A 3TAPA 3TX8A 1DKOA 5BT9A 4YMIA 3V34A 1Y8RB 3FPLA 1NHWA 4WEOA 2ASYA 2UVPB 1Z5PA 1Q84A 3I6ZA 4DLAA 4CV0A 4UOFA 4MUAA 3ID6C 1K3UB 5ELLA 3HB9A 3P26A 5G3YA 3V8VA 1JEAA 4LJMA 4AZ0A 1VQYA 3KQPA 2J59A 2HFOA 5AKHA 4R3NA 4JI1J 4JYCA 2ZDOA 1M1KT 1JWWA 3SZGA 1O58A 1EP2B 2EC5A 4FD3A 4OHFA 4QPNA 5DGCA 1ULAA 3GAZA 3O6VA 4A16A 2FPXA 1VG9B 4BGDA 3RW6A 2IU6A 2JAOA 3KPUA 2C2YA 1LD3A 4A0GA 1F1JA 1RTHA 4FYYA 3M6FA 4USJC 1RQ2A 3IP9A 4RW9A 2ACWA 1GTL1 2C5GA 3DHYA 1BGWA 2M4MA 2GZHA 5TMBA 1ZBTA 4OHMA 3JD2A 4YI5A 1QE0A 3NYWA 3MWDA 2AEFA 4F86A 1FDVA 3W7BA 2E6UX 4EQ6B 2BV3A 4KOEC 4DDFA 3LFHA 4WNAB 2C29D 4IH1A 1XR5A 4U8YA 1YCDA 5CPFA 1E9AA 3OHSX 2OLEA 3R3SA 4N76A 1CW2B 1R8HA 3QPWA 1HL7A 2K4MA 4RTPA 1M33A 1SJ1A 3ZO7A 4MV3A 2QTVB 1UP1A 1EK6A 1EH5A 2Y2UA 3MC1A 4M49A 1G5PA 3VSCA 3PXDA 3SCZA 1FZTA 4Z7YA 1Y3KA 2OFWA 6REQA 4AYWA 2F8LA 2PL9A 1F7UA 2FSGA 2H0RA 1PAEX 3HHPA 3KHUA 2ZUGA 5KYYA 2VQEB 3I05A 5LZ5A 3BTOA 5BSKA 4RH3A 2JNWA 2OXIA 4LF8F 5FQNA 1ZITA 4HYTA 4MK4A 2DJWA 5D0RA 1P0IA 3BXGA 2CXPA 2M7SA 4B4KA 2XTMA 2XMZA 3MSXA 5AW7A 3AXSA 3DVSX 2QMWA 5A7HA 5T8KC 2B5WA 1VBFA 2J5XA 5GPBA 2OFOA 1F5AA 3MCOA 1DKRA 2WC1A 2GUGA 2WIGA 3PYLA 3FHJA 3R5BA 2XYHA 3WR5A 3JQBA 2LXFA 3VR3D 1TM5E 1LF0A 3OFKA 2OO3A 3EDRB 3Q2KA 2NTVA 3WV5A 4B76A 1NNI1 1GL3A 2AIRB 4MGKR 2IEIA 3GMIA 3T6BA 3DFKA 5CH3A 4W8GA 2J48A 1ZXXA 4KYTA 3WGQA 1NJWA 4YPVA 3IP8A 4HADA 4LOIA 4OBBA 1QE1A 1BOFA 4NLRA 3X2EA 1GA6A 1XRJA 2LP4Y 1C80A 3T7IA 3BCRA 3R77A 4OX6A 3V8EA 1SKMA 3C6XA 4QRHA 1EKSA 1P9OA 1YUBA 4YJKA 3ZLTA 2HBQB 2V58A 3EXFA 3PW2A 1VPLA 1NQWA 3IQEA 1ZW6A 2JBHA 4CKBB 2R2UA 1UVKA 3L4BA 3ZEIA 3OEHA 5LP6A 1H1LA 3T61A 4QLOA 4Q9JA 2DM6A 1NF2A 3JQAB 3ABOB 4MZXA 4DLEA 4KO1S 1VOMA 2AG0A 3WIDA 2WB2A 1TVEA 1ZUNB 4MULA 3SOPA 5JVDB 4QR0A 2WDZA 3ICVA 4R7TA 1YQHA 4NL5A 2ADCA 3CJRA 5FDLB 1Y98A 2PSFA 3SOZA 2L17A 4QOTA 4BMPB 5IFMA 4WCFB 4LWPA 4AN4A 4Q15A 3VAHA 3RVBA 5IQ6A 4IJ6A 3ZZ1A 4BQPA 2P41A 5BNFA 3TCXB 2PI5A 1JDSA 1N5TA 2VTBA 4GH5A 1CF4A 1PT6A 4G85A 1LBIA 3H59A 1TJYA 1ODTC 4L07A 2V9WA 1ZD8A 3HMKA 3UB2A 3MBKA 1JLGA 3FYUC 4MPJA 1E2PA 4RVCA 4UEJA 5ICSA 4MIBA 2E1MC 5FTKA 1S9FA 3Q5DA 3TOQA 3PX0A 1T8RA 3NRJA 1N92A 4C8LA 3R8XA 3ZNOA 4ZO4A 1RSZA 4Q39A 4J0GA 3P32A 5TJHA 2GBCA 3UPTA 4MV4A 4NRTA 3SXJA 4GOKA 3DL4A 1BMQA 4KAJA 5AK3A 1TLLA 4WCVA 1RP5A 4YDRA 3FCUB 4LHEA 4N54A 1LB1B 4LF5J 2WG1A 3R1HA 4TKTA 5L9XA 4MP8A 2WY2D 4CKWB 2WJGA 4GI3A 3F73A 2CQCA 1RMYA 2NXJA 1L7AA 4E1AA 2FFJA 2OK8A 3BH7B 1JLFB 3DKRA 4J3FA 5IEJA 3L7NA 5DV9A 4LRCA 3T3DA 3MSCA 1ESDA 3MAAB 3A1UA 5F8GA 1M2JA 4ASUD 1C7EA 4RY8A 4ETNA 2GD2A 4I5GA 1JT9A 2YNMD 4DYDA 5CB4F 4EHAA 1BVYF 2W2KB 3IWXA 4JBCA 3LJKA 3NOQA 1MV8A 2C9DA 3ND9A 4TQRA 4Q3DA 4JLDA 1WCWA 4BFTA 5CLIA 2ZRHA 4OA5A 4OM7A 2HQ3A 4URVR 2J5QA 2WONA 1QS0B 4OIXA 2DEJA 2MZTA 4M1KA 3ZIAA 3BAFA 2QC3A 3STVA 3ME5A 2ZBQA 3HCNA 2VOOA 3C19A 2FZLA 1YZQA 1RYZA 1QR6A 4DV5F 5CIWA 2DHRA 2HRRA 4ZN3A 4W6ZA 5C37A 4EYIB 3E61A 4ZHSA 2X76A 1FSSA 3X44A 1K7FB 2VG5B 4NASA 9MHTA 3WLHA 4G1IA 4Q1CA 1ZGGA 4AULA 1KE1A 4P82A 1T5SA 3QU9A 4QR2A 3AY7A 2VICA 3A2NA 1RI4A 1XMOB 1PP4A 4YXWD 1OJ7A 2WZDA 1KGDA 1K89A 3ZW8A 5E6SA 4DRXA 1LEOA 2AEEA 1K06A 4DUZJ 3ECAA 2HGSA 5ICEA 1AB8A 1WUJS 1PS0A 3HYLA 5K0TA 4KXNA 4OZJA 1IBLJ 3GJTA 1JHVA 7AT1B 3ZK9A 1NDHA 1CEEA 1U11A 4KWEA 3JWPA 3ZNUA 4X65B 4YRFA 4K2JA 2OC4A 5CD4H 3D3WA 1N7IA 2EWVA 3R7NB 1RABB 1SVWA 3V1YA 4DGQA 2KT3A 4E0BA 1JEQB 3S2EA 3ZUPA 1C7QA 4AKHA 1O51A 2DPGA 4ZEOA 2CLEB 1KLNA 1MWYA 3T4XA 3PR4A 2VDOB 1FA9A 1FIUA 1VL8A 5GAJA 3CD7A 2EFQA 1N5JA 5B0DA 3EMBA 1WF6A 3MFQA 5FBQB 2UUTA 1F2VA 1C3XA 1Y9JA 2H4JA 5C5EA 2K7KA 2VPZA 2ZVQX 3M3HA 4WBSA 3Q22A 1UW4A 3ZG6A 1GNLA 2WMDA 1PR9A 5E1MA 1Q11A 2FQQA 5L95A 1O54A 2CLSA 1UFVA 3VVTA 1YR1A 1R0WA 1M34E 1IMJA 1M5VC 1VRWA 3CVJA 2B8NA 1BS9A 3MWEB 1KY5A 3DV0A 4UHCA 2ZI5A 1ZHFA 3IWNC 4CTNA 4IRXA 4B8WA 5BSFA 3GCWA 4MUYA 5LPNA 2Z2MA 4TYBA 1SEPA 5F23A 5D78A 1DL5A 2OBXA 4V24A 5KDLA 4ZWNA 6ABPA 3Q5EA 2OYRA 4OZ1A 1JMTA 3FFIA 2IM2A 3RS4A 2MTLA 4A8JC 1F9EB 3NTQA 2B51A 1U0JA 5EIAA 4MSUA 4JJAA 2OUGA 1TZ2A 3WRWA 3FMIA 5E6UA 1HWUA 3PD7A 2HQDA 1QZTA 4FWBA 5ETPA 2Z8YM 3CZCA 3IMCA 3RAJA 5A3QA 3ZHTA 3QRRA 5FYDA 2ZW9A 2W4QA 3FCEA 3TBKA 3N0VA 4IH5A 4H54A 4PF1A 4LXXA 1GMWD 4OO3A 3IUYA 4PQRA 3SHTA 2AYMA 3K0AB 2Y1FA 1JEYB 3ENKA 2VHGA 2HX1A 5IM0B 4LV8B 2VA9A 2I4OA 1M2OB 4BMYA 4A8OA 2GM4A 3VZSA 3OT4A 1KDRA 3F8WA 3OJEA 4N6OA 2ZB7A 5K0GA 5JROA 5F2OA 3I39X 1GG8A 1KQNA 4BX2A 3BK1A 1M8PA 4LOLA 2AN5A 4JLUA 1UOQA 5LYJA 2FLKA 2LMIA 2G0JA 2ATVA 1F2TB 2XH8A 4M98A 4NA1A 2W2QA 3S28A 4I9NA 1NG9A 1H65A 5DTQA 5B30A 1Q1ZA 5JSFA 5I7WA 3ICOA 2HLTA 1NYQA 3D1QA 1QJ4A 3RB6A 4JQYA 3HADA 4AG6A 2IC3B 3JATB 1JECA 4ZLPA 3MMSA 3V4VB 5B58C 3K5MA 2QRMA 1EM6A 2CQIA 1VHTA 4GWKA 2PUDA 1X77A 2I34A 2L9DA 3D2AA 1MU2A 3H17A 8LDHA 2W2MP 2NQ8A 1R88A 1NM5C 1PYTA 3P2KA 4ADSG 3B2QA 1V1MA 1U0SA 2OPSB 1Z5UA 1UVJA 5A0TA 3HPQA 3NGUA 4XGQA 1HIYA 4R7GA 2FPMA 3AD8C 5DXAA 1BDIA 4LYYA 1DKQA 2X13A 4WZBA 2CKDA 5IHXA 3DLCA 1LW6E 4UNIA 4E88A 2YC4C 4Z9FA 1X7VA 3MRTA 3ZNNA 3NHZA 3IHTA 1V1JA 1EFAA 2RS2A 1KLMB 3PQ8A 3T7EA 1BY9A 3FF1A 4CLYA 1YI2S 1Z5ZA 3EQ2A 3T1OA 1L7PA 3R20A 4FPRA 3TLGB 2VJLA 3MR3A 1Z4QA 5H70A 2R6JA 2M6KA 1SXGA 2VK2A 3GXOA 1NVTA 1XKLA 4XD2A 3R2JA 4YO7A 3IRVA 3QU5A 1O0CA 3SM3A 5IFLA 3GLIA 4L50A 4WY2A 5LL6d 5JCZA 1XYGA 4WLFA 5KFNA 4MFBA 2R84A 4DR2F 1UK7A 2R47A 1I3NA 3W6ZA 1ODSA 3RGIA 3HSGA 5EMJA 1E3DA 2G5GX 4IQMA 3EPKA 2R7WA 1DKMA 3OCWA 1FSZA 2Y77A 3DL0A 4G01B 4EB8A 3GJ5A 3P94A 1ULTA 1Q0SA 4XIFA 3DEZA 1D6JA 4XQGA 4F7VA 4A8PA 3V33A 1CULA 4LPSA 4MCAA 4DSLA 1JNXX 5GV8A 2BJVA 3F1KA 4ONEA 3RIGA 2M9MA 4K5QA 3PO4A 1A9OA 2QE7D 4OI3A 2JIQA 4ED6A 3DW1X 4M46A 4K9QA 4AKEA 3JYQA 5EJ5A 2RQ4A 2CQDA 4YALA 2AKWB 1YFJA 1JZSA 4WZ6A 4N7BA 2H00A 5B3KA 3VNUA 3Q8MA 1RU2A 3VR1A 4CMBA 2RAUA 3E2IA 2VSNA 1IHOA 3LPEA 4L3WA 5KYNA 2V45A 3GD5A 4F67A 5KUTA 4J0CA 4K6GA 4K1XA 2F9DA 3O90A 2E4XA 3NDPA 2VRNA 3INTA 4QYRA 4D0LB 1HBJA 5IBPA 1RQGA 4O3QA 1VL5A 3L93A 1UA1A 4RW6B 1Z2NX 5AQEA 5TT0A 2MYFA 2CQ1A 2HA4A 5GGXA 5AVZA 1A1SA 4QQNA 1FFHA 4V03A 2I3ZA 4GC5A 4NYIR 3QKTA 1YS6A 3E3MA 1DQNA 1MV5A 4XLLA 4CNYA 5HCIA 2DYKA 1OIWA 4BBAA 5AM1A 2VTBB 1G2EA 5C0OE 3HB0A 4GAEA 2FRDC 4R8MA 3JSBA 3QFFA 5BV0A 4C3UA 4O4JF 1L3CA 1PL8A 1W25A 4EYKA 3NVMB 2B69A 3MRSA 2BUBA 4GOLD 1TF2A 1GRRA 5GONB 3S81A 2VVTA 4QDZA 3ELBA 2VPIA 4TLLB 4EYOA 4CMCA 5TARA 4TZTA 4JCCA 7MHTA 3EXHA 3D8HA 2DJIA 4G1EB 2J3LA 4BFYA 5DEOA 1QH1A 3OCZA 3STTA 4IXTA 3S2UA 3DCYA 2Q0HA 1FI4A 3MJRA 3G89A 2W7OA 3GIWA 4Q3CA 1NKBA 2VSFA 5THXA 3LVQE 1V16A 5EGNA 2V8DA 3HY6A 4OGGA 3PYGA 2EWHA 2BGKA 5JSHA 4QIVA 5TQJA 4A15A 4URXR 1EQ2A 3DT6A 5IUNC 4ARVA 3DMPA 5C3MA 1Y6GA 4ISBA 3D6FB 2HJWA 4W98A 4E7OA 3H0EA 1UPXA 3A6EA 4RW8A 2Q5FA 4IQ0A 3JYHA 5FULA 1S59A 4M7RA 3RTAA 2POCA 3I9NA 2H5JA 2AJ2A 5JAQA 3AF4A 4JVMA 4JITA 3HCRA 2F3TA 4DOZA 4BQOA 1I1QB 3PX6A 2W6IA 4U7FA 3BWYA 3V9AA 1KFDA 1PNVA 2JJ1A 1WOOA 3TSAA 3VHQA 3AKDA 5THKA 1N2CB 3UN5A 3AYXB 4MR9A 3VR6A 4HAXA 3ET6A 5D3GB 1R0RE 2WILA 2IYVA 4AQYF 2YHIA 1R27B 3PTWA 2OD9A 3C24A 3VPHA 3SZRA 5GWXA 1X5OA 4OOFA 5TDHA 3TSZA 3LTNC 4C87A 4E51A 4MT1A 2XYHB 4UM8B 4DBZA 3SCJE 2ADOA 1NT2A 3TRKA 1DRVA 4DR6J 3PGMA 3LG2A 4YTEA 4L4RA 2Y1XA 1U1LA 1KDPA 3PX3A 3FKJA 3V97A 1GNRA 2OE2A 4XI9A 3ZWOA 1TW3A 3R23A 2KJVA 4Q03A 3ROZA 1Z25A 3LGAA 2V1UA 4EW1A 4P5EA 1VQ1A 3OKAA 3A6GA 5EIWA 4WA8A 4IEFB 1BWRA 3M2TA 1HQEA 4IL5A 1U0OC 4UBKA 2XUJA 1JPJA 5SZKB 5F21A 3L8HA 4GGOA 3KHLA 4QU5A 2B56A 1E7QA 4NE9C 5IWAF 2HNZB 3VZPA 5JPCA 4QU7A 3T1YF 2WBMA 1IN8A 2GO7A 4I9UA 4ZI7B 1ZIYA 4KR3A 1EAYC 3HDQA 4EL0A 4I4LA 3I09A 5L51A 3H4IA 3HHDA 3MJFA 3G82C 4JA0A 3Q2TC 4D42A 1C2PA 1JIUA 1PR6A 4UXIA 4HDKA 4UUWA 3ZJVA 4DMGA 3M32A 3F6PA 3EUEA 2QLFA 4KVFA 2PLWA 2W9BB 4R81A 3JZMA 4NLOA 4ZGBA 3OIUA 4KMMA 4RCZA 4B5KA 1L5MA 1GQOA 3PV8A 4KQMA 4ZOLA 4GD3Q 4Q4DA 4LQ3A 2XKKA 4YYZA 3AOAA 4ANDA 1CULC 1KIAA 3R3JA 2EL7A 4PC2A 1UAAA 2PMWB 1LK7A 1L4MA 3BS9A 3TD6A 1H0RA 3AETA 2CZGA 1Q1NA 4HDAA 3VAIA 2Q2OA 3MQ4A 1LWEA 2H65B 1K8QA 2Z08A 3Q7SA 1AZTA 3E3OA 2JI6A 3QUQA 3MGJA 4BFCA 3V1NA 3RSGA 2OAEA 4OAQA 5HVGA 5LLSA 2C84A 1IKVB 2RF2A 1AC5A 3EVFA 1Z7GA 1SIWA 5A7GA 1W48A 5FPQA 1EKRA 3GLIB 2GJ2A 3UK2A 2REOA 1OPRA 2QS9A 1R6BX 4NLQA 1QE5A 2ZETA 1EHIA 1U1FA 2X8AA 4N5IX 2GN0A 5CTJA 4JLNA 1DAHA 1QVAA 5IYZA 3LHIA 3DE2X 2JIZD 2BT4A 3VO2A 2I99A 4DIDA 1JSLA 3PBKA 5FOQA 2WVGA 3O4IA 2F9MA 4TYMA 4MRPA 4IDOA 3WJ1A 4H0NA 3Q11A 2BDTA 2ZXEA 1HFWA 3UC5A 1RP7A 4MQEA 5DQHA 4ZDKA 3EA5A 2G88A 1T34A 5BMVF 5J2QA 1SU7A 5IWAB 2ZSFA 5AR1A 1MJNA 1ZD4A 1KSHA 3HULA 3UMYA 3KLIB 3K71B 2OZLA 1COZA 4X41A 2GF2A 3FVWA 2GHRA 2A0XA 2XD9A 3ELWA 4C0AC 3L4JA 3ETNA 3CW2A 1A9QA 2NIPA 4CMIB 2GNPA 1UBMS 4HMOA 4M9CA 1RHMB 4XDDA 1ISFA 3ZGYA 1S0MA 4KODA 4ITUA 3NP9A 3S1AB 3P97A 4J9KA 1XVLA 2PKQP 4HB2A 3AHJA 1QQ5A 3O92A 3HCBA 3U1VA 3A3OB 3SN6A 2ZD1B 4HNTA 3QWBA 1T9KA 1AUPA 3EUWA 1UWBB 5EHGA 3HD1A 1UOOA 1R0AA 3SHVA 3HKDB 1CJKC 2FVSA 3K8ZA 1UKVY 4X4NA 3UCEA 1PJ6A 1U0NA 4RJKA 1B2LA 5HCNA 3ZHQA 5CXUA 2ZH1A 4DV6J 2O20A 4TLBA 2IRUA 4IQXA 3PPWA 1DY3A 4IH6A 1J8YF 1DC3A 3KP1A 3JQ9C 4NJMB 1D1QA 2F43B 2QJOA 3GZ7A 2D9PA 2PZGA 4NJEB 4KSBA 4F84A 3WLPA 4KJXA 4F71A 3DN9A 2ZE6A 1M5PC 1ZICA 1YDHA 3F5QA 3IV7A 3K8OE 4IXWA 5BN4B 5KTOA 1GKUB 2LDXA 4A47A 1FP7A 1KDZA 3RRBA 1VSVA 1ZOIA 3GEEA 1V9LA 2OESA 1YR9A 3C15C 2RG1A 3UC9A 3HV2A 1F1BB 4UCFA 4DV0B 2MT9A 4C5AA 4R31A 1UJ4A 4Q18A 4WW0A 3KPVA 2QZ9A 1GSIA 4CF4A 4FDFA 5D3ZA 4EAQA 3ZDRA 1YJ8A 1UM9B 3JWEA 4H4CA 3IKMB 4K9LA 1FTRA 4KBFA 1WXDA 3N5BA 3D8UA 4FBMA 4WHMA 4J2OA 4U0JA 3UMMA 5BSGA 4UQPA 2QD1A 4C11A 3OE7A 1DMSA 1U0TA 1NX9A 1PR5A 4FZ5A 2QSJA 4B6GA 5DETA 2UUCB 5A2QA 3W9SA 1H5UA 1PDWA 2WA2A 3BC1A 3STHA 3DC7A 4U3JB 3KG4A 1KFEB 4TWJA 2WF6A 3GPCA 5IJWA 3AM3A 2XLIA 3EIUA 3H6KA 5B36A 4U2KA 4MYSA 3CE6A 3MVEA 4ZVFA 4NXNF 3KNGA 1SVUA 5EHZA 4G5FA 1PG0A 2CF5A 1LRJA 3Q24A 4CM5A 1YVFA 2WTAA 5CD1A 2NYAA 2ZI7A 3HP4A 4DYHA 5DNYB 1XP5A 2GBLA 2WICA 4CODB 3HI6A 2F8HA 1BXKA 4K6KA 3S2GA 1GAJA 3GNQA 4X60A 4LFBF 2FLOA 1NJIT 5JRDS 4KXQA 3F44A 4USHA 1YIOA 4V0SA 2GAIA 1S8FA 3VNQA 2Y1LB 1NSFA 4YUXA 3VU3A 2HWYA 3EDQA 1P80A 3O8QA 4Z4FA 2A9FA 4L7QA 1E8DA 4XQ0A 3FDZA 3V1TC 1VRQC 4CMKA 4BTLA 1AX9A 2OORA 2SECE 1CY1A 4NQZA 3KR2A 2OZEA 3W34A 2QIFA 1MPXA 3TZZA 3HP7A 3UAWA 3WNDA 3KO8A 1QUEA 3J80A 3TK1A 2QPAA 2Z6UA 3V81B 1GPJA 3OTCA 7ADHA 3DT8A 2ONJA 5K5EA 1RYRA 1IRXA 1CJTC 4UDXX 1U48A 3AEKB 3AZQA 1WHSB 1YKGA 3QPDA 1AUVA 2YVQA 3AJEA 3COVA 4FGJA 3U19A 3BH6A 4IRMA 3W1VA 3C3JA 3HWRA 2R2GA 8GPBA 2CJWA 4IFBA 2IYOA 1FSPA 3EWNA 4YEDA 1Z2OX 1M0EA 1UBEA 1YBVA 4DLRA 3D0IE 4NE2A 2V6MA 4NYJR 5DISB 5FUXA 5BQPA 5JW6A 1DFIA 5JQGA 1YRTA 2A86A 1R37A 3G82A 3OTQA 1RXOB 1UWLA 3HO1A 1X7YB 4QPPA 3FBTA 4D9MA 1WEZA 1B8UA 5DT9A 4IR1A 4KMRA 4DB2A 1SUWA 3MCTA 4PGGA 5J58A 4WKOA 2BELA 1RXWA 3TSCA 3SQGA 1H42A 4BNMA 1Z9BA 1TU0A 2X4GA 2QTHA 3MR5A 3C43A 1JXLA 1OD6A 3USCS 5AW3A 3QBTA 2XA9A 4IXNA 2YWGA 3I30X 2VKRA 3IALA 4R8LA 1PTJA 3R3TA