2H5MA

Nmr solution structure of a gcn5-like putative n-acetyltransferase from staphylococcus aureus complexed with acetyl-coa. northeast structural genomics consortium target zr31
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
102
structure length
102
Chain Sequence
MSNLEIKQGENKFYIGDDENNALAEITYRFVDNNEINIDHTGVSDELGGQGVGKKLLKAVVEHARENNLKIIASCSFAKHMLEKEDSYQDVYLGLEHHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Acetyltransferase, GNAT family
publication title Structure of an acetyl-CoA binding protein from Staphylococcus aureus representing a novel subfamily of GCN5-related N-acetyltransferase-like proteins
pubmed doi rcsb
source organism Staphylococcus aureus subsp. aureus
molecule tags Transferase
total genus 31
structure length 102
sequence length 102
ec nomenclature
pdb deposition date 2006-05-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14542 Acetyltransf_CG GCN5-related N-acetyl-transferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 2h5mA00
1Q2YA 3CXSA 4XNHC 4HNWB 4XPKA 2REFA 1QSNA 4PK2A 1WWZA 4PSWA 2X7BA 1MJBA 5HMNA 2AJ6A 3OWCA 3G3SA 4JD6A 3PP9A 1NMTA 3C26A 2BEIA 1FY7A 5IX3A 2VXKA 2QIRA 2OZGA 1RXTA 2ZW4A 4KOUA 3MGDA 1M44A 2J8NA 2PC1A 3R9FA 1PUAA 4E2AA 4FD5A 1YK3A 2B5GB 1V0CA 3LODA 2Y0MA 3TFYA 5GCNA 2WPXA 4R3LA 2EVNA 4K30A 3FNCA 4NF1A 3D3SA 1S7FA 2KCWA 3KKWA 5IB0A 2FT0A 2HV2A 4HNYB 4CAXA 4IF5A 2Z11A 4B5PB 4XPDC 2FXFA 2P6FA 4FD4A 1S7LA 2ATRA 1YREA 3DSBA 4QC6A 5F47A 1I12A 4KORA 3S6GA 1Y7RA 2GE3A 4NCZA 4OAEA 2B5GA 3CXPA 4QVTA 4X5KA 3F8KA 2CY2A 3EC4A 4KLVA 3EY5A 4UWJA 3P2HA 4NXYA 3WR7A 3TO7A 5KTDA 5JPHA 3TOBA 3GYAA 5FVJA 2OB0A 4MJ8A 3LD2A 4QUSA 4KVOE 2R98A 2D4PA 2VQYA 4PSXA 2RC4A 2Q04A 3PGPA 4YGOA 2R8VA 3T90A 1Q2CA 3GKRA 3FIXA 2JLMA 2PQ8A 3CXQA 4JXRA 2K5TA 3FXTA 3F5BA 4U9YA 3TO6A 4U9ZA 1IICA 5J8FA 3ZZIA 3N7ZA 4AVAA 1S5KA 1IB1E 2H5MA 4L8AA 1TIQA 2OZHA 3F0AA 2CNSA 2EUIA 4ONUA 1J4JA 2A4NA 3QB8A 1VKCA 3TTHA 3FRMA 3W91A 3S6KA 1BOBA 4I49A 1KUVA 2QMLA 2BSWA 3IGRA 4RS2A 4QBJA 4OLLA 2NMTA 4NEXA 1KUXA 1NE9A 2PR1A 2IL4A 3DR8A 2C27A 4ORFA 2O28A 1XF8A 3TCVA 4R87A 1CM0A 2D4OA 2VZZA 3R9EA 2AE6A 4CAVA 2FCKA 2JEVA 3IWGA 1NSLA 4H6UA 1SQHA 4JXQA 3TE4A 5C88A 1XE4A 2J8MA 1U6MA 3D2PA 2FIWA 5DWMA 2ZW7A 4JLYA 4KOTA 1Z4RA 1OZPA 3W6XA 2Q4VA 4PK3A 4CRYB 4XNHB 2CNTA 3FB3A 3SHPA 4CS0B 2PR8A 5F49A 5E96A 2GIVA 3DNSA 4EVYA 1CJWA 1YX0A 4MY3A 2VBQA 2FS5A 1B87A 2CNMA 1QSRA 4MHDA 2Z0ZA 4PV6A 5HH1A 2B3UA 1I21A 3DR6A 1MJAA 4J3GA 3S6HA 3VWDA 4JJXA 1MJ9A 2OZUA 5KTCA 2BL1A 4DNCA 4KUAA 3ZJ0A 5H86A 4M3SA 4AG9A 5IV0A 3EFAA 4KVME 1S7KA 4UA3A 2FE7A 4XPDB 1QSMA 4Y49C 4E8OA 2I79A 4UBRA 2B4DA 3UY5A 1M4GA 1PU9A 4U5YA 3NE7A 1M4DA 2R1IA 4II9A 4MBUA 3T9YA 3W6SA 4LUAA 4NSQA 3S6FA 3RYOA 2B3VA 4L89A 4H89A 1XIXA 3R96A 2B4BA 4AB7A 4MI4A 1IYLA 1YLEA 4JWPA 5F48A 5C82A 1I1DA 2VI7A 4AVCA 4F6AA 2FL4A 2VEZA 2JDDA 4YRHA 4FD6A 4R9MA 4LX9A 3V8IA 1BO4A 1QSTA 4GS4A 2Q4YA 3G8WA 2ARHA 1Z9UA 2JDCA 1LRZA 4KZTA 2PSWA 3EXNA 1S3ZA 4KOSA 1YGHA 3P2FA 2REEA 3EO4A 4FD7A 2QECA 3E0KA 3FYNA 5JQ4A 1N71A 4UWIA 3TO9A 4MY0A 4KOWA 1Z4EA 4XPLA 3PZJA 5H84A 4HKFA 2G0BA 4AG7A 1RO5A 2G3AA 2ZW5A 2OU2A 1Q2DA 5ISVA 1MK4A 3GY9A 4OADA 2R7HA 1YR0A 1R57A 2PDOA 1KZFA 2FSRA 1M4IA 2Z10A 1Y9KA 4E0AA 4BMHA 1QSOA 3QAHA 1YVOA 3R1KA 1P4NA 2BUEA 2HUZA 4KVXA 2PRBA 3R95A 2ZXVA 2B4DB 1L0CA 3B8GA 2DXQA 3DDDA 1P0HA 3K9UA 2ZPAA 4KUBA 4H6ZA 4CRZB 2F5IA 3H4QA 4IUSA 1S7NA 1IIDA 2GANA 4RI1A 1B6BA 2Q7BA 1K4JA 2I00A 3VWEA 4CAWA 1S60A 4F0YA 3TOAA 3SXNA 2OH1A 4HNXB 4B5PA 4QB9A 4YFJA 5KTAA 2ZW6A 2WPWA 5EC4A 2FIAA 4M85A 4AVBA 1VHSA 2B58A 1M1DA 2P0WA 1KUYA 1WK4A 2HQYA 2Q0YA 1Y9WA 3BJ8A 4KOXA 3FBUA 3JVNA 3R9GA 3I3GA 3SXOA 5J8CA 3JUWA 4R3KA 2P6EA 2Q44A 3TT2A 3D8PA 4ZBGA 1GHEA 4R57A 2VZYA 3BLNA 1YVKA 1XEBA 2J8RA 1ON0A 3D2MA 3I9SA 4KOVA 5F46A 1UFHA 3BJ7A 2G3TA 5CNPA 1XMTA 4B5OA 5I0CA 1IYKA 4KLWA 5DWNA 2P6GA 4KOYA 5EBVA 4Y49B
chains in the Genus database with same CATH superfamily
2DF5A 1Q2YA 4P4EA 3CXSA 4XNHC 4X8IA 5A28A 4ZY0A 4HNWB 4XPKA 2REFA 2OOTA 4CGOA 1YW6A 4MHZA 1IU8A 4C2XA 4A30A 3RAMA 1QSNA 4B14A 4PK2A 8CPAA 2ODFA 4UCNA 1WWZA 4PSWA 2X7BA 3FF3A 4MFQA 3SJEA 1MJBA 3V7ZA 5HMNA 2AJ6A 4LQGA 3OWCA 4G1PA 2WZNA 3G3SA 4JD6A 3GB0A 3KI9A 3PP9A 2BO9A 1CPXA 1ARLA 1QMUA 1NMTA 1XBUA 2IMOA 2BEIA 1FY7A 2XEFA 2O4HA 3C26A 2Z3MA 5K8OA 5IX3A 3NH4A 2VXKA 2QIRA 3D7HA 2OZGA 1RXTA 4P10A 2ZOGA 2ZW4A 1VHEA 2V8DA 4KOUA 1PYTB 3MGDA 4JZ0A 3FMCA 4RN7A 1M44A 3WC5A 2J8NA 2PC1A 3R9FA 1PUAA 4MCQA 4CAEA 4E2AA 4FD5A 1YK3A 2B5GB 1V0CA 3LODA 3SJGA 2Y0MA 2NYQA 3TFYA 2AFMA 5GCNA 2WPXA 2EBJA 3QAYA 4EWTA 4R3LA 2EVNA 2HC9A 4P4FA 1YQEA 2Q43A 3FNCA 4K30A 4NF1A 4CYOA 2PJ7A 3D3SA 1CBXA 2KCWA 1S7FA 3KKWA 4X2TA 5IB0A 1F2OA 1LAMA 2FT0A 2HV2A 2J9AA 2ZEFA 4HNYB 4IF5A 2Z11A 3TC8A 4B5PB 4CAXA 4B13A 4CGPA 1TF8A 2JBKA 5AG5A 4XPDC 2FXFA 2P6FA 4FD4A 1S7LA 4YWYA 4UFXA 2ATRA 1YREA 3DSBA 4QC6A 5F47A 1PCAA 1I12A 4KORA 5G1ZA 3S6GA 1BLLE 2GLFA 2F8HA 1Y7RA 2GE3A 3IJ3A 4NCZA 3GUXA 4OAEA 2B5GA 4A33A 4BINA 3CXPA 4K3NA 4NGQA 4QVTA 4Q36A 4AXVA 4UFWA 4X5KA 3F8KA 2CY2A 3KHXA 2ZEDA 3EC4A 4KLVA 3IC1A 3EY5A 4UCMA 3P2HA 4UWJA 4F0XA 1IY7A 4CYQA 2I3CA 4MXUA 5ELYA 2QYVA 1VGYA 4NXYA 3WR7A 2ZEHA 3TO7A 4BD9A 5KTDA 3D68A 4UF4A 4B10A 3IO1A 3FX6A 3NH8A 2Z3NA 5JPHA 3TOBA 3GYAA 3B3VA 4C68A 5FVJA 1AMPA 4MCPA 2OB0A 3KL9A 4NJQA 1DE4C 4OIWA 4MJ8A 3LD2A 4MFPA 3LACA 4P44A 4QUSA 3S9LA 4KVOE 2R98A 2D4PA 1XMBA 2V8VA 2F7VA 2VQYA 2RC4A 2ZEOA 4PSXA 3RNZA 3H5ZA 4OMEA 2Q04A 3IU2A 4M6GA 3PGPA 1TF9A 2R8VA 4YGOA 3T90A 2C6CA 4MCSA 4UEEA 1Q2CA 3GKRA 4A32A 3JTKA 4FBEA 3FIXA 2JLMA 2PQ8A 3KZWA 3CXQA 4JXRA 2K5TA 3CZXA 3FXTA 4PXDA 5CPAA 3R96A 5BWAB 3F5BA 4U9YA 4ZY2A 2PJ4A 4P4DA 3TO6A 4U9ZA 1IICA 4ZI6A 1FNOA 2PJ2A 2IQ6A 5J8FA 3D7DA 2PIZA 2Q51A 3ISXA 3VATA 3ZZIA 3N7ZA 4PXEA 2OR4A 4AVAA 4C7IA 1S5KA 1JQGA 1IB1E 5JM6A 2H5MA 3D7FA 1M4LA 4L8AA 1LANA 4TNUA 1TIQA 2OZHA 3F0AA 3HUVA 2CNSA 2EUIA 3IWWA 1XOVA 4ONUA 1J4JA 4PXCA 2A4NA 1Z2LA 4NGRA 3QB8A 1VKCA 3TTHA 3FRMA 4P45A 1YLOA 3W91A 2Q7SA 1Q7LA 3S6KA 3GIUA 5LRJA 2YNCC 1BOBA 4M6HA 2Z3KA 2ZEGA 3WC7A 4I49A 3BI0A 1KUVA 1X12A 2QMLA 3FEDA 1VHOA 2BSWA 1RTQA 2C6GA 2AFZA 2AFWA 3WC6A 3IGRA 4RS2A 4NGTA 4QBJA 4OLLA 2PJ3A 2NMTA 2Z3OA 4NEXA 5J1QA 2PJ8A 1KUXA 1NE9A 2DEAA 3S9MA 2PR1A 2IL4A 3DR8A 2C27A 1A2ZA 4ORFA 2O28A 1XF8A 3TCVA 4CYPA 1FT7A 4R87A 1CM0A 4CGLA 1QQ9A 2D4OA 3GLJA 2HB6A 2VZZA 1AUGA 3R9EA 2AE6A 4CAVA 4C7HA 2FCKA 2JEVA 3IWGA 4Q7AA 1NSLA 3WABA 5A27A 4H6UA 3A9LA 3KQXA 3S9NA 1SQHA 4JXQA 4Q38A 3TE4A 3KQZA 3PBBA 2GU2A 4H2KA 5C88A 4NFRA 4R6TA 1XE4A 2QVPA 3B3SA 2J8MA 3HLPA 1U6MA 4P6YA 3D2PA 2O53A 5AG6A 2FIWA 2PJ6A 3BI1A 4MHPA 5DWMA 3ISZA 2ZW7A 5K8NA 4JLYA 5EMIA 2AFSA 4A39A 1ELLP 3MRUA 4KOTA 1Z4RA 1OZPA 1TKHA 4MFLA 3W6XA 2Q4VA 4PK3A 4CRYB 3NA6A 3RZAA 4XNHB 1F2PA 4DUKA 2CNTA 5HXDA 3FB3A 2FVGA 3SHPA 1XFOA 2CIJA 4UEFA 4CS0B 2PR8A 3NH5A 1IGBA 5F49A 1X10A 5E96A 3K9TA 2GIVA 3DNSA 4MFZA 4EVYA 1CJWA 1CX8A 1YX0A 2PJBA 3RBUA 4MY3A 1Z8XA 2G9DA 3D66A 2VBQA 2FS5A 1LFWA 2JEWA 2ABZA 1B87A 5CBMA 4IAVA 2CNMA 1QSRA 4MHDA 2Z0ZA 4PV6A 5HH1A 2B3UA 4NGSA 4OC3A 2BOAA 5F09A 1I21A 4WJBA 1MJAA 3DR6A 4FWUA 3NFZA 2XEJA 4J3GA 4C2ZA 5LYFA 4FUUA 3S6HA 2PJAA 4NGMA 4ZX9A 3CDXA 2Q4ZA 3B7IA 3DGVA 3K2KA 3VWDA 5G21A 4JJXA 1MJ9A 2OZUA 1ZG9A 2CTBA 4M6IA 4P4JA 5KTCA 3MN8A 4UIAA 2BL1A 4DNCA 5LYDA 4KUAA 3SI1A 3ZJ0A 2YNCA 5G22A 5LRKA 4BBHA 5H86A 4DJLA 4OC1A 2ANPA 1EE3P 1XRYA 4M3SA 4AG9A 5IV0A 2EK8A 2PVWA 5K8PA 1Y7EA 3EFAA 3PFOA 4KVME 3FJUA 4YU9A 2DPSA 1S7KA 4UA3A 4OC0A 2FE7A 4XPDB 1QSMA 4Y49C 4E8OA 3B3TA 1IOFA 3PRTA 4TWEA 3IWEA 4F9UA 2I79A 4UBRA 2B4DA 4CGMA 2AFOA 1TKJA 3UY5A 1LOKA 3D4UA 4IHMA 1M4GA 1PU9A 5DS0A 4U5YA 4X3RA 1YW4A 1ZG7A 1YSJA 1HEEA 3NE7A 1M4DA 2R1IA 3KASA 4PQAA 4II9A 4MBUA 2YNEA 4A37A 3T9YA 4IK2A 3W6SA 1LCPA 2GREA 2PJ5A 4LUAA 2ZEPA 3KR4A 4NSQA 3S6FA 4B12A 3RYOA 2V8GA 2B3VA 4L89A 3T8WA 4OC2A 4H89A 1XIXA 3FECA 2V8HA 2B4BA 2NSMA 4GM5A 4O23A 4P4BA 3KR5A 1Z8LA 4MI4A 4AB7A 1IYLA 2ZOFA 2PIYA 4MHYA 4KS9A 2YNDA 1KWMA 1YLEA 6CPAA 3SJXA 2RFHA 3QNVA 1R3NA 3KGQA 4JWPA 4JYWA 1OBRA 4R7MA 3PBEA 4MHNA 3V38A 1CPSA 5LYLA 4OP4A 4RUHA 1Z5RA 5F48A 3CPXA 4LQ6A 5C82A 1I1DA 1XJOA 4GXHA 2VI7A 2AFUA 3PB8X 3PFEA 4AVCA 4F6AA 2FL4A 4PXBA 2VEZA 2PVVA 2JDDA 3DLJA 4YRHA 3H8GA 1Y0YA 3CPAA 4FD6A 1HDQA 3SI2A 2RB7A 3N5FA 4R9MA 2PE3A 2POKA 4LX9A 3BXMA 4KSFA 5AGEA 2BCOA 3V8IA 1BO4A 1QSTA 4GS4A 2Q4YA 4CYNA 4F8ZA 3TX8A 3G8WA 2ARHA 1Z9UA 2JDCA 4CGNA 1LRZA 4KZTA 2PSWA 1Y0RA 3EXNA 1S3ZA 4KOSA 2WYRA 1YGHA 2ZENA 1CG2A 2REEA 3EO4A 3P2FA 2C1CA 2QECA 4FD7A 4DYOA 4F9VA 3E0KA 1JWQA 3FYNA 3PB9X 1Z8TA 4OKOA 5JQ4A 1IOIA 5JH9A 2YGWA 3B35A 4CAFA 3IEHA 3PEIA 1N71A 3PB7X 4UWIA 3TO9A 2CTCA 4ONWA 3BHXA 1UWYA 4KOWA 1BPNA 1Z4EA 2PCUA 4MY0A 2CXAA 3PZJA 4XPLA 4HPSA 5H84A 1ZO0A 4HKFA 4MCRA 4MFJA 2GLJA 1Z8WA 1CP6A 2G0BA 2EK9A 3PB4X 4AG7A 5JGFA 1RO5A 2G3AA 2ZW5A 2CF4A 2OU2A 5D29A 1Q2DA 4Z65A 5ISVA 1MK4A 1TXRA 3GY9A 2R7HA 3B3CA 1YR0A 1AYEA 2JBJA 4OADA 1H8LA 2Z3LA 4A31A 4EFDA 4FAIA 1R57A 2PDOA 1KZFA 4ZX8A 4PPZA 2FSRA 3LWUA 1M4IA 2PJCA 2Z10A 1Y9KA 2ZELA 4C2YA 4BMHA 4E0AA 1QSOA 3QAHA 1YVOA 3LMSA 5LYIA 4UIBA 3R1KA 1P4NA 2BUEA 1TKFA 5HVHA 2HUZA 1ELMP 4KVXA 2PRBA 2XEGA 5D8NA 3R95A 1GYTA 2ZXVA 5K8MA 4B6ZA 4W9YA 2B4DB 2GFQA 1L0CA 1YMEA 3B8GA 5HVFA 3IU1A 2DXQA 3VH9A 1F57A 4NGPA 3DDDA 1P0HA 3K9UA 2ZPAA 1LAPA 4KUBA 4H6ZA 4R8FA 2EWBA 4CRZB 5IB9A 2F5IA 4KSAA 3H4QA 2QJ8A 4IUSA 1S7NA 3B3WA 1IIDA 4MFKA 3FVLA 2GANA 4RI1A 1B6BA 2Q7BA 1K4JA 2PRQA 2I00A 1ZG8A 3FH4A 1ZLIA 3NE8A 1DTDA 3VWEA 2AFXA 4CAWA 5AG7A 1BAVA 1S60A 2ZEMA 4F0YA 2VL1A 3SXNA 2OH1A 3H8EA 4HNXB 4UCPA 3TOAA 3B2YA 4B5PA 4QB9A 3CT9A 4ZGYB 4YFJA 3JRUA 5KTAA 2ZW6A 1R43A 2WPWA 5EC4A 2FIAA 3WT4A 4M85A 4AVBA 4MRIA 1VHSA 2B58A 3VARA 1M1DA 2P0WA 1KUYA 1WK4A 3D7GA 4OIDA 2HQYA 2Q0YA 1Y9WA 3BJ8A 3KHZA 5LRGA 4EMEA 4NGNA 4KOXA 3FBUA 5I4MA 3SJFA 3JVNA 2XEIA 3R9GA 3I3GA 3SXOA 5J8CA 2ZEEA 2WSAA 3JUWA 3IIBA 4UFVA 1HDUA 2WUUA 4R3KA 4ZYQA 2P6EA 2IJZA 2Q44A 2PJ0A 4KSIA 3TT2A 3D8PA 1NSAA 4ZBGA 5AG4A 1GHEA 2V77A 3D67A 4CPAA 4R57A 2VZYA 3PB6X 3BLNA 1YVKA 1ZLHA 4A2ZA 1XEBA 4MMOA 2J8RA 3H8FA 4NJRA 1ARMA 1ON0A 4P4IA 3D2MA 3I9SA 4KOVA 4OC4A 5F46A 1BPMA 1UFHA 3I1UA 3BJ7A 2G3TA 5CNPA 2Z3PA 7CPAA 4WWVA 3FEEA 1VIXA 3IFEA 1XMTA 3SI0A 2DPTA 4R76A 4B5OA 5I0CA 1CP7A 2C6PA 2PJ1A 4OC5A 1IYKA 4KLWA 5G20A 4A95A 5DWNA 2EO8A 3L2NA 5HVGA 3RO0A 4ZY1A 4UEZA 5THWA 2P6GA 4A94A 4B11A 4KOYA 5EBVA 4Y49B 4A38A 2PJ9A
chains in the Genus database with same CATH topology
1Q2YA 3CXSA 4XNHC 5A28A 4HNWB 4XPKA 2REFA 4CGOA 4C2XA 4A30A 1QSNA 4B14A 4PK2A 4UCNA 1WWZA 4PSWA 2X7BA 4MFQA 1MJBA 5HMNA 2AJ6A 3OWCA 3G3SA 4JD6A 3PP9A 1NMTA 3C26A 2BEIA 1FY7A 2Z3MA 5IX3A 2VXKA 2QIRA 2OZGA 1RXTA 2ZW4A 4KOUA 3MGDA 1M44A 2J8NA 2PC1A 3R9FA 1PUAA 4CAEA 4E2AA 4FD5A 1YK3A 2B5GB 1V0CA 3LODA 2Y0MA 3TFYA 5GCNA 2WPXA 4R3LA 2EVNA 4K30A 3FNCA 4NF1A 4CYOA 3D3SA 1S7FA 2KCWA 3KKWA 5IB0A 2FT0A 2HV2A 4HNYB 4CAXA 4IF5A 2Z11A 4B5PB 4B13A 4CGPA 5AG5A 4XPDC 2FXFA 2P6FA 4FD4A 1S7LA 4UFXA 2ATRA 1YREA 3DSBA 4QC6A 5F47A 1I12A 4KORA 5G1ZA 3S6GA 1Y7RA 2GE3A 4NCZA 4OAEA 4A33A 2B5GA 3CXPA 4QVTA 4Q36A 4UFWA 4X5KA 3F8KA 2CY2A 3EC4A 4KLVA 3EY5A 4UCMA 3P2HA 4UWJA 4F0XA 4CYQA 4NXYA 3WR7A 3TO7A 5KTDA 4B10A 5JPHA 2Z3NA 3TOBA 3GYAA 4C68A 5FVJA 2OB0A 4MJ8A 3LD2A 4MFPA 4QUSA 4KVOE 2R98A 2D4PA 2VQYA 4PSXA 2RC4A 3H5ZA 2Q04A 3IU2A 3PGPA 4YGOA 2R8VA 3T90A 1Q2CA 3GKRA 4A32A 3JTKA 3FIXA 2JLMA 2PQ8A 3CXQA 4JXRA 2K5TA 3FXTA 5BWAB 3F5BA 4U9YA 3TO6A 4U9ZA 1IICA 5J8FA 3ZZIA 3N7ZA 4AVAA 4C7IA 1S5KA 1IB1E 2H5MA 4L8AA 1TIQA 2OZHA 3F0AA 2CNSA 2EUIA 4ONUA 1J4JA 2A4NA 3QB8A 1VKCA 3TTHA 3FRMA 3W91A 3S6KA 2YNCC 1BOBA 2Z3KA 4I49A 1KUVA 2QMLA 2BSWA 3IGRA 4RS2A 4QBJA 4OLLA 2NMTA 2Z3OA 4NEXA 1KUXA 1NE9A 2PR1A 2IL4A 3DR8A 2C27A 4ORFA 2O28A 1XF8A 3TCVA 4CYPA 4R87A 1CM0A 4CGLA 2D4OA 2VZZA 3R9EA 2AE6A 4CAVA 4C7HA 2FCKA 2JEVA 3IWGA 1NSLA 5A27A 4H6UA 3A9LA 1SQHA 4JXQA 4Q38A 3TE4A 5C88A 1XE4A 5AG6A 2J8MA 1U6MA 3D2PA 2FIWA 5DWMA 2ZW7A 4JLYA 4KOTA 1Z4RA 1OZPA 4MFLA 3W6XA 2Q4VA 4PK3A 4CRYB 4XNHB 2CNTA 3FB3A 3SHPA 4CS0B 2PR8A 5F49A 5E96A 2GIVA 3DNSA 4MFZA 4EVYA 1CJWA 1YX0A 4MY3A 2VBQA 2FS5A 1B87A 2CNMA 1QSRA 4MHDA 2Z0ZA 4PV6A 5HH1A 2B3UA 1I21A 3DR6A 1MJAA 4J3GA 4C2ZA 3S6HA 3VWDA 5G21A 4JJXA 1MJ9A 2OZUA 5KTCA 2BL1A 4DNCA 4KUAA 3ZJ0A 2YNCA 5G22A 4BBHA 5H86A 4M3SA 4AG9A 5IV0A 3EFAA 4KVME 2DPSA 1S7KA 4UA3A 2FE7A 4XPDB 1QSMA 4Y49C 4E8OA 3IWEA 2I79A 4UBRA 2B4DA 4CGMA 3UY5A 1M4GA 1PU9A 4U5YA 3NE7A 1M4DA 2R1IA 4II9A 4MBUA 2YNEA 3T9YA 3W6SA 4LUAA 4NSQA 3S6FA 4B12A 3RYOA 2B3VA 4L89A 4H89A 1XIXA 3R96A 2B4BA 4AB7A 4MI4A 1IYLA 4KS9A 2YNDA 1YLEA 4JWPA 5F48A 5C82A 1I1DA 2VI7A 4AVCA 4F6AA 2FL4A 2VEZA 2JDDA 4YRHA 4FD6A 4R9MA 4LX9A 4KSFA 5AGEA 3V8IA 1BO4A 1QSTA 4GS4A 2Q4YA 4CYNA 3G8WA 2ARHA 1Z9UA 2JDCA 4CGNA 1LRZA 4KZTA 2PSWA 3EXNA 1S3ZA 4KOSA 1YGHA 3P2FA 2REEA 3EO4A 4FD7A 2QECA 3E0KA 3FYNA 5JQ4A 2YGWA 4CAFA 1N71A 4UWIA 3TO9A 4MY0A 4KOWA 1Z4EA 4XPLA 2CXAA 3PZJA 5H84A 1ZO0A 4HKFA 2G0BA 4AG7A 1RO5A 2G3AA 2ZW5A 2OU2A 1Q2DA 5ISVA 1MK4A 3GY9A 4OADA 2R7HA 4A31A 1YR0A 2Z3LA 1R57A 2PDOA 1KZFA 2FSRA 1M4IA 2Z10A 4C2YA 1Y9KA 4E0AA 4BMHA 1QSOA 3QAHA 1YVOA 3R1KA 1P4NA 2BUEA 2HUZA 4KVXA 2PRBA 3R95A 2ZXVA 2B4DB 1L0CA 3B8GA 3IU1A 2DXQA 3DDDA 1P0HA 3K9UA 2ZPAA 4KUBA 4H6ZA 4CRZB 2F5IA 4KSAA 3H4QA 4IUSA 1S7NA 4MFKA 1IIDA 2GANA 4RI1A 1B6BA 2Q7BA 1K4JA 2I00A 3VWEA 4CAWA 5AG7A 1S60A 4F0YA 3TOAA 3SXNA 2OH1A 4HNXB 4UCPA 4B5PA 4QB9A 4ZGYB 4YFJA 5KTAA 2ZW6A 2WPWA 5EC4A 2FIAA 4M85A 4AVBA 1VHSA 2B58A 1M1DA 2P0WA 1KUYA 1WK4A 2HQYA 2Q0YA 1Y9WA 3BJ8A 4KOXA 3FBUA 3JVNA 3R9GA 3I3GA 3SXOA 5J8CA 2WSAA 3JUWA 4UFVA 2WUUA 4R3KA 2P6EA 2Q44A 3TT2A 3D8PA 4ZBGA 5AG4A 1GHEA 4R57A 2VZYA 3BLNA 1YVKA 4A2ZA 1XEBA 2J8RA 1ON0A 3D2MA 3I9SA 4KOVA 5F46A 1UFHA 3BJ7A 2G3TA 5CNPA 2Z3PA 1XMTA 2DPTA 4B5OA 5I0CA 1IYKA 4KLWA 5G20A 4A95A 5DWNA 2P6GA 4B11A 4KOYA 5EBVA 4Y49B 4MFJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1Q2Y A;  3CXS A;  4XNH C;  4HNW B;  4XPK A;  2REF A;  1QSN A;  4PK2 A;  1WWZ A;  4PSW A;  2X7B A;  1MJB A;  5HMN A;  2AJ6 A;  3OWC A;  3G3S A;  4JD6 A;  3PP9 A;  1NMT A;  3C26 A;  2BEI A;  1FY7 A;  5IX3 A;  2VXK A;  2QIR A;  2OZG A;  1RXT A;  2ZW4 A;  4KOU A;  3MGD A;  1M44 A;  2J8N A;  2PC1 A;  3R9F A;  1PUA A;  4E2A A;  4FD5 A;  1YK3 A;  2B5G B;  1V0C A;  3LOD A;  2Y0M A;  3TFY A;  5GCN A;  2WPX A;  4R3L A;  2EVN A;  4K30 A;  3FNC A;  4NF1 A;  3D3S A;  1S7F A;  2KCW A;  3KKW A;  5IB0 A;  2FT0 A;  2HV2 A;  4HNY B;  4CAX A;  4IF5 A;  2Z11 A;  4B5P B;  4XPD C;  2FXF A;  2P6F A;  4FD4 A;  1S7L A;  2ATR A;  1YRE A;  3DSB A;  4QC6 A;  5F47 A;  1I12 A;  4KOR A;  3S6G A;  1Y7R A;  2GE3 A;  4NCZ A;  4OAE A;  2B5G A;  3CXP A;  4QVT A;  4X5K A;  3F8K A;  2CY2 A;  3EC4 A;  4KLV A;  3EY5 A;  4UWJ A;  3P2H A;  4NXY A;  3WR7 A;  3TO7 A;  5KTD A;  5JPH A;  3TOB A;  3GYA A;  5FVJ A;  2OB0 A;  4MJ8 A;  3LD2 A;  4QUS A;  4KVO E;  2R98 A;  2D4P A;  2VQY A;  4PSX A;  2RC4 A;  2Q04 A;  3PGP A;  4YGO A;  2R8V A;  3T90 A;  1Q2C A;  3GKR A;  3FIX A;  2JLM A;  2PQ8 A;  3CXQ A;  4JXR A;  2K5T A;  3FXT A;  3F5B A;  4U9Y A;  3TO6 A;  4U9Z A;  1IIC A;  5J8F A;  3ZZI A;  3N7Z A;  4AVA A;  1S5K A;  1IB1 E;  2H5M A;  4L8A A;  1TIQ A;  2OZH A;  3F0A A;  2CNS A;  2EUI A;  4ONU A;  1J4J A;  2A4N A;  3QB8 A;  1VKC A;  3TTH A;  3FRM A;  3W91 A;  3S6K A;  1BOB A;  4I49 A;  1KUV A;  2QML A;  2BSW A;  3IGR A;  4RS2 A;  4QBJ A;  4OLL A;  2NMT A;  4NEX A;  1KUX A;  1NE9 A;  2PR1 A;  2IL4 A;  3DR8 A;  2C27 A;  4ORF A;  2O28 A;  1XF8 A;  3TCV A;  4R87 A;  1CM0 A;  2D4O A;  2VZZ A;  3R9E A;  2AE6 A;  4CAV A;  2FCK A;  2JEV A;  3IWG A;  1NSL A;  4H6U A;  1SQH A;  4JXQ A;  3TE4 A;  5C88 A;  1XE4 A;  2J8M A;  1U6M A;  3D2P A;  2FIW A;  5DWM A;  2ZW7 A;  4JLY A;  4KOT A;  1Z4R A;  1OZP A;  3W6X A;  2Q4V A;  4PK3 A;  4CRY B;  4XNH B;  2CNT A;  3FB3 A;  3SHP A;  4CS0 B;  2PR8 A;  5F49 A;  5E96 A;  2GIV A;  3DNS A;  4EVY A;  1CJW A;  1YX0 A;  4MY3 A;  2VBQ A;  2FS5 A;  1B87 A;  2CNM A;  1QSR A;  4MHD A;  2Z0Z A;  4PV6 A;  5HH1 A;  2B3U A;  1I21 A;  3DR6 A;  1MJA A;  4J3G A;  3S6H A;  3VWD A;  4JJX A;  1MJ9 A;  2OZU A;  5KTC A;  2BL1 A;  4DNC A;  4KUA A;  3ZJ0 A;  5H86 A;  4M3S A;  4AG9 A;  5IV0 A;  3EFA A;  4KVM E;  1S7K A;  4UA3 A;  2FE7 A;  4XPD B;  1QSM A;  4Y49 C;  4E8O A;  2I79 A;  4UBR A;  2B4D A;  3UY5 A;  1M4G A;  1PU9 A;  4U5Y A;  3NE7 A;  1M4D A;  2R1I A;  4II9 A;  4MBU A;  3T9Y A;  3W6S A;  4LUA A;  4NSQ A;  3S6F A;  3RYO A;  2B3V A;  4L89 A;  4H89 A;  1XIX A;  3R96 A;  2B4B A;  4AB7 A;  4MI4 A;  1IYL A;  1YLE A;  4JWP A;  5F48 A;  5C82 A;  1I1D A;  2VI7 A;  4AVC A;  4F6A A;  2FL4 A;  2VEZ A;  2JDD A;  4YRH A;  4FD6 A;  4R9M A;  4LX9 A;  3V8I A;  1BO4 A;  1QST A;  4GS4 A;  2Q4Y A;  3G8W A;  2ARH A;  1Z9U A;  2JDC A;  1LRZ A;  4KZT A;  2PSW A;  3EXN A;  1S3Z A;  4KOS A;  1YGH A;  3P2F A;  2REE A;  3EO4 A;  4FD7 A;  2QEC A;  3E0K A;  3FYN A;  5JQ4 A;  1N71 A;  4UWI A;  3TO9 A;  4MY0 A;  4KOW A;  1Z4E A;  4XPL A;  3PZJ A;  5H84 A;  4HKF A;  2G0B A;  4AG7 A;  1RO5 A;  2G3A A;  2ZW5 A;  2OU2 A;  1Q2D A;  5ISV A;  1MK4 A;  3GY9 A;  4OAD A;  2R7H A;  1YR0 A;  1R57 A;  2PDO A;  1KZF A;  2FSR A;  1M4I A;  2Z10 A;  1Y9K A;  4E0A A;  4BMH A;  1QSO A;  3QAH A;  1YVO A;  3R1K A;  1P4N A;  2BUE A;  2HUZ A;  4KVX A;  2PRB A;  3R95 A;  2ZXV A;  2B4D B;  1L0C A;  3B8G A;  2DXQ A;  3DDD A;  1P0H A;  3K9U A;  2ZPA A;  4KUB A;  4H6Z A;  4CRZ B;  2F5I A;  3H4Q A;  4IUS A;  1S7N A;  1IID A;  2GAN A;  4RI1 A;  1B6B A;  2Q7B A;  1K4J A;  2I00 A;  3VWE A;  4CAW A;  1S60 A;  4F0Y A;  3TOA A;  3SXN A;  2OH1 A;  4HNX B;  4B5P A;  4QB9 A;  4YFJ A;  5KTA A;  2ZW6 A;  2WPW A;  5EC4 A;  2FIA A;  4M85 A;  4AVB A;  1VHS A;  2B58 A;  1M1D A;  2P0W A;  1KUY A;  1WK4 A;  2HQY A;  2Q0Y A;  1Y9W A;  3BJ8 A;  4KOX A;  3FBU A;  3JVN A;  3R9G A;  3I3G A;  3SXO A;  5J8C A;  3JUW A;  4R3K A;  2P6E A;  2Q44 A;  3TT2 A;  3D8P A;  4ZBG A;  1GHE A;  4R57 A;  2VZY A;  3BLN A;  1YVK A;  1XEB A;  2J8R A;  1ON0 A;  3D2M A;  3I9S A;  4KOV A;  5F46 A;  1UFH A;  3BJ7 A;  2G3T A;  5CNP A;  1XMT A;  4B5O A;  5I0C A;  1IYK A;  4KLW A;  5DWN A;  2P6G A;  4KOY A;  5EBV A;  4Y49 B; 
#chains in the Genus database with same CATH topology
 2DF5 A;  1Q2Y A;  4P4E A;  3CXS A;  4XNH C;  4X8I A;  5A28 A;  4ZY0 A;  4HNW B;  4XPK A;  2REF A;  2OOT A;  4CGO A;  1YW6 A;  4MHZ A;  1IU8 A;  4C2X A;  4A30 A;  3RAM A;  1QSN A;  4B14 A;  4PK2 A;  8CPA A;  2ODF A;  4UCN A;  1WWZ A;  4PSW A;  2X7B A;  3FF3 A;  4MFQ A;  3SJE A;  1MJB A;  3V7Z A;  5HMN A;  2AJ6 A;  4LQG A;  3OWC A;  4G1P A;  2WZN A;  3G3S A;  4JD6 A;  3GB0 A;  3KI9 A;  3PP9 A;  2BO9 A;  1CPX A;  1ARL A;  1QMU A;  1NMT A;  1XBU A;  2IMO A;  2BEI A;  1FY7 A;  2XEF A;  2O4H A;  3C26 A;  2Z3M A;  5K8O A;  5IX3 A;  3NH4 A;  2VXK A;  2QIR A;  3D7H A;  2OZG A;  1RXT A;  4P10 A;  2ZOG A;  2ZW4 A;  1VHE A;  2V8D A;  4KOU A;  1PYT B;  3MGD A;  4JZ0 A;  3FMC A;  4RN7 A;  1M44 A;  3WC5 A;  2J8N A;  2PC1 A;  3R9F A;  1PUA A;  4MCQ A;  4CAE A;  4E2A A;  4FD5 A;  1YK3 A;  2B5G B;  1V0C A;  3LOD A;  3SJG A;  2Y0M A;  2NYQ A;  3TFY A;  2AFM A;  5GCN A;  2WPX A;  2EBJ A;  3QAY A;  4EWT A;  4R3L A;  2EVN A;  2HC9 A;  4P4F A;  1YQE A;  2Q43 A;  3FNC A;  4K30 A;  4NF1 A;  4CYO A;  2PJ7 A;  3D3S A;  1CBX A;  2KCW A;  1S7F A;  3KKW A;  4X2T A;  5IB0 A;  1F2O A;  1LAM A;  2FT0 A;  2HV2 A;  2J9A A;  2ZEF A;  4HNY B;  4IF5 A;  2Z11 A;  3TC8 A;  4B5P B;  4CAX A;  4B13 A;  4CGP A;  1TF8 A;  2JBK A;  5AG5 A;  4XPD C;  2FXF A;  2P6F A;  4FD4 A;  1S7L A;  4YWY A;  4UFX A;  2ATR A;  1YRE A;  3DSB A;  4QC6 A;  5F47 A;  1PCA A;  1I12 A;  4KOR A;  5G1Z A;  3S6G A;  1BLL E;  2GLF A;  2F8H A;  1Y7R A;  2GE3 A;  3IJ3 A;  4NCZ A;  3GUX A;  4OAE A;  2B5G A;  4A33 A;  4BIN A;  3CXP A;  4K3N A;  4NGQ A;  4QVT A;  4Q36 A;  4AXV A;  4UFW A;  4X5K A;  3F8K A;  2CY2 A;  3KHX A;  2ZED A;  3EC4 A;  4KLV A;  3IC1 A;  3EY5 A;  4UCM A;  3P2H A;  4UWJ A;  4F0X A;  1IY7 A;  4CYQ A;  2I3C A;  4MXU A;  5ELY A;  2QYV A;  1VGY A;  4NXY A;  3WR7 A;  2ZEH A;  3TO7 A;  4BD9 A;  5KTD A;  3D68 A;  4UF4 A;  4B10 A;  3IO1 A;  3FX6 A;  3NH8 A;  2Z3N A;  5JPH A;  3TOB A;  3GYA A;  3B3V A;  4C68 A;  5FVJ A;  1AMP A;  4MCP A;  2OB0 A;  3KL9 A;  4NJQ A;  1DE4 C;  4OIW A;  4MJ8 A;  3LD2 A;  4MFP A;  3LAC A;  4P44 A;  4QUS A;  3S9L A;  4KVO E;  2R98 A;  2D4P A;  1XMB A;  2V8V A;  2F7V A;  2VQY A;  2RC4 A;  2ZEO A;  4PSX A;  3RNZ A;  3H5Z A;  4OME A;  2Q04 A;  3IU2 A;  4M6G A;  3PGP A;  1TF9 A;  2R8V A;  4YGO A;  3T90 A;  2C6C A;  4MCS A;  4UEE A;  1Q2C A;  3GKR A;  4A32 A;  3JTK A;  4FBE A;  3FIX A;  2JLM A;  2PQ8 A;  3KZW A;  3CXQ A;  4JXR A;  2K5T A;  3CZX A;  3FXT A;  4PXD A;  5CPA A;  3R96 A;  5BWA B;  3F5B A;  4U9Y A;  4ZY2 A;  2PJ4 A;  4P4D A;  3TO6 A;  4U9Z A;  1IIC A;  4ZI6 A;  1FNO A;  2PJ2 A;  2IQ6 A;  5J8F A;  3D7D A;  2PIZ A;  2Q51 A;  3ISX A;  3VAT A;  3ZZI A;  3N7Z A;  4PXE A;  2OR4 A;  4AVA A;  4C7I A;  1S5K A;  1JQG A;  1IB1 E;  5JM6 A;  2H5M A;  3D7F A;  1M4L A;  4L8A A;  1LAN A;  4TNU A;  1TIQ A;  2OZH A;  3F0A A;  3HUV A;  2CNS A;  2EUI A;  3IWW A;  1XOV A;  4ONU A;  1J4J A;  4PXC A;  2A4N A;  1Z2L A;  4NGR A;  3QB8 A;  1VKC A;  3TTH A;  3FRM A;  4P45 A;  1YLO A;  3W91 A;  2Q7S A;  1Q7L A;  3S6K A;  3GIU A;  5LRJ A;  2YNC C;  1BOB A;  4M6H A;  2Z3K A;  2ZEG A;  3WC7 A;  4I49 A;  3BI0 A;  1KUV A;  1X12 A;  2QML A;  3FED A;  1VHO A;  2BSW A;  1RTQ A;  2C6G A;  2AFZ A;  2AFW A;  3WC6 A;  3IGR A;  4RS2 A;  4NGT A;  4QBJ A;  4OLL A;  2PJ3 A;  2NMT A;  2Z3O A;  4NEX A;  5J1Q A;  2PJ8 A;  1KUX A;  1NE9 A;  2DEA A;  3S9M A;  2PR1 A;  2IL4 A;  3DR8 A;  2C27 A;  1A2Z A;  4ORF A;  2O28 A;  1XF8 A;  3TCV A;  4CYP A;  1FT7 A;  4R87 A;  1CM0 A;  4CGL A;  1QQ9 A;  2D4O A;  3GLJ A;  2HB6 A;  2VZZ A;  1AUG A;  3R9E A;  2AE6 A;  4CAV A;  4C7H A;  2FCK A;  2JEV A;  3IWG A;  4Q7A A;  1NSL A;  3WAB A;  5A27 A;  4H6U A;  3A9L A;  3KQX A;  3S9N A;  1SQH A;  4JXQ A;  4Q38 A;  3TE4 A;  3KQZ A;  3PBB A;  2GU2 A;  4H2K A;  5C88 A;  4NFR A;  4R6T A;  1XE4 A;  2QVP A;  3B3S A;  2J8M A;  3HLP A;  1U6M A;  4P6Y A;  3D2P A;  2O53 A;  5AG6 A;  2FIW A;  2PJ6 A;  3BI1 A;  4MHP A;  5DWM A;  3ISZ A;  2ZW7 A;  5K8N A;  4JLY A;  5EMI A;  2AFS A;  4A39 A;  1ELL P;  3MRU A;  4KOT A;  1Z4R A;  1OZP A;  1TKH A;  4MFL A;  3W6X A;  2Q4V A;  4PK3 A;  4CRY B;  3NA6 A;  3RZA A;  4XNH B;  1F2P A;  4DUK A;  2CNT A;  5HXD A;  3FB3 A;  2FVG A;  3SHP A;  1XFO A;  2CIJ A;  4UEF A;  4CS0 B;  2PR8 A;  3NH5 A;  1IGB A;  5F49 A;  1X10 A;  5E96 A;  3K9T A;  2GIV A;  3DNS A;  4MFZ A;  4EVY A;  1CJW A;  1CX8 A;  1YX0 A;  2PJB A;  3RBU A;  4MY3 A;  1Z8X A;  2G9D A;  3D66 A;  2VBQ A;  2FS5 A;  1LFW A;  2JEW A;  2ABZ A;  1B87 A;  5CBM A;  4IAV A;  2CNM A;  1QSR A;  4MHD A;  2Z0Z A;  4PV6 A;  5HH1 A;  2B3U A;  4NGS A;  4OC3 A;  2BOA A;  5F09 A;  1I21 A;  4WJB A;  1MJA A;  3DR6 A;  4FWU A;  3NFZ A;  2XEJ A;  4J3G A;  4C2Z A;  5LYF A;  4FUU A;  3S6H A;  2PJA A;  4NGM A;  4ZX9 A;  3CDX A;  2Q4Z A;  3B7I A;  3DGV A;  3K2K A;  3VWD A;  5G21 A;  4JJX A;  1MJ9 A;  2OZU A;  1ZG9 A;  2CTB A;  4M6I A;  4P4J A;  5KTC A;  3MN8 A;  4UIA A;  2BL1 A;  4DNC A;  5LYD A;  4KUA A;  3SI1 A;  3ZJ0 A;  2YNC A;  5G22 A;  5LRK A;  4BBH A;  5H86 A;  4DJL A;  4OC1 A;  2ANP A;  1EE3 P;  1XRY A;  4M3S A;  4AG9 A;  5IV0 A;  2EK8 A;  2PVW A;  5K8P A;  1Y7E A;  3EFA A;  3PFO A;  4KVM E;  3FJU A;  4YU9 A;  2DPS A;  1S7K A;  4UA3 A;  4OC0 A;  2FE7 A;  4XPD B;  1QSM A;  4Y49 C;  4E8O A;  3B3T A;  1IOF A;  3PRT A;  4TWE A;  3IWE A;  4F9U A;  2I79 A;  4UBR A;  2B4D A;  4CGM A;  2AFO A;  1TKJ A;  3UY5 A;  1LOK A;  3D4U A;  4IHM A;  1M4G A;  1PU9 A;  5DS0 A;  4U5Y A;  4X3R A;  1YW4 A;  1ZG7 A;  1YSJ A;  1HEE A;  3NE7 A;  1M4D A;  2R1I A;  3KAS A;  4PQA A;  4II9 A;  4MBU A;  2YNE A;  4A37 A;  3T9Y A;  4IK2 A;  3W6S A;  1LCP A;  2GRE A;  2PJ5 A;  4LUA A;  2ZEP A;  3KR4 A;  4NSQ A;  3S6F A;  4B12 A;  3RYO A;  2V8G A;  2B3V A;  4L89 A;  3T8W A;  4OC2 A;  4H89 A;  1XIX A;  3FEC A;  2V8H A;  2B4B A;  2NSM A;  4GM5 A;  4O23 A;  4P4B A;  3KR5 A;  1Z8L A;  4MI4 A;  4AB7 A;  1IYL A;  2ZOF A;  2PIY A;  4MHY A;  4KS9 A;  2YND A;  1KWM A;  1YLE A;  6CPA A;  3SJX A;  2RFH A;  3QNV A;  1R3N A;  3KGQ A;  4JWP A;  4JYW A;  1OBR A;  4R7M A;  3PBE A;  4MHN A;  3V38 A;  1CPS A;  5LYL A;  4OP4 A;  4RUH A;  1Z5R A;  5F48 A;  3CPX A;  4LQ6 A;  5C82 A;  1I1D A;  1XJO A;  4GXH A;  2VI7 A;  2AFU A;  3PB8 X;  3PFE A;  4AVC A;  4F6A A;  2FL4 A;  4PXB A;  2VEZ A;  2PVV A;  2JDD A;  3DLJ A;  4YRH A;  3H8G A;  1Y0Y A;  3CPA A;  4FD6 A;  1HDQ A;  3SI2 A;  2RB7 A;  3N5F A;  4R9M A;  2PE3 A;  2POK A;  4LX9 A;  3BXM A;  4KSF A;  5AGE A;  2BCO A;  3V8I A;  1BO4 A;  1QST A;  4GS4 A;  2Q4Y A;  4CYN A;  4F8Z A;  3TX8 A;  3G8W A;  2ARH A;  1Z9U A;  2JDC A;  4CGN A;  1LRZ A;  4KZT A;  2PSW A;  1Y0R A;  3EXN A;  1S3Z A;  4KOS A;  2WYR A;  1YGH A;  2ZEN A;  1CG2 A;  2REE A;  3EO4 A;  3P2F A;  2C1C A;  2QEC A;  4FD7 A;  4DYO A;  4F9V A;  3E0K A;  1JWQ A;  3FYN A;  3PB9 X;  1Z8T A;  4OKO A;  5JQ4 A;  1IOI A;  5JH9 A;  2YGW A;  3B35 A;  4CAF A;  3IEH A;  3PEI A;  1N71 A;  3PB7 X;  4UWI A;  3TO9 A;  2CTC A;  4ONW A;  3BHX A;  1UWY A;  4KOW A;  1BPN A;  1Z4E A;  2PCU A;  4MY0 A;  2CXA A;  3PZJ A;  4XPL A;  4HPS A;  5H84 A;  1ZO0 A;  4HKF A;  4MCR A;  4MFJ A;  2GLJ A;  1Z8W A;  1CP6 A;  2G0B A;  2EK9 A;  3PB4 X;  4AG7 A;  5JGF A;  1RO5 A;  2G3A A;  2ZW5 A;  2CF4 A;  2OU2 A;  5D29 A;  1Q2D A;  4Z65 A;  5ISV A;  1MK4 A;  1TXR A;  3GY9 A;  2R7H A;  3B3C A;  1YR0 A;  1AYE A;  2JBJ A;  4OAD A;  1H8L A;  2Z3L A;  4A31 A;  4EFD A;  4FAI A;  1R57 A;  2PDO A;  1KZF A;  4ZX8 A;  4PPZ A;  2FSR A;  3LWU A;  1M4I A;  2PJC A;  2Z10 A;  1Y9K A;  2ZEL A;  4C2Y A;  4BMH A;  4E0A A;  1QSO A;  3QAH A;  1YVO A;  3LMS A;  5LYI A;  4UIB A;  3R1K A;  1P4N A;  2BUE A;  1TKF A;  5HVH A;  2HUZ A;  1ELM P;  4KVX A;  2PRB A;  2XEG A;  5D8N A;  3R95 A;  1GYT A;  2ZXV A;  5K8M A;  4B6Z A;  4W9Y A;  2B4D B;  2GFQ A;  1L0C A;  1YME A;  3B8G A;  5HVF A;  3IU1 A;  2DXQ A;  3VH9 A;  1F57 A;  4NGP A;  3DDD A;  1P0H A;  3K9U A;  2ZPA A;  1LAP A;  4KUB A;  4H6Z A;  4R8F A;  2EWB A;  4CRZ B;  5IB9 A;  2F5I A;  4KSA A;  3H4Q A;  2QJ8 A;  4IUS A;  1S7N A;  3B3W A;  1IID A;  4MFK A;  3FVL A;  2GAN A;  4RI1 A;  1B6B A;  2Q7B A;  1K4J A;  2PRQ A;  2I00 A;  1ZG8 A;  3FH4 A;  1ZLI A;  3NE8 A;  1DTD A;  3VWE A;  2AFX A;  4CAW A;  5AG7 A;  1BAV A;  1S60 A;  2ZEM A;  4F0Y A;  2VL1 A;  3SXN A;  2OH1 A;  3H8E A;  4HNX B;  4UCP A;  3TOA A;  3B2Y A;  4B5P A;  4QB9 A;  3CT9 A;  4ZGY B;  4YFJ A;  3JRU A;  5KTA A;  2ZW6 A;  1R43 A;  2WPW A;  5EC4 A;  2FIA A;  3WT4 A;  4M85 A;  4AVB A;  4MRI A;  1VHS A;  2B58 A;  3VAR A;  1M1D A;  2P0W A;  1KUY A;  1WK4 A;  3D7G A;  4OID A;  2HQY A;  2Q0Y A;  1Y9W A;  3BJ8 A;  3KHZ A;  5LRG A;  4EME A;  4NGN A;  4KOX A;  3FBU A;  5I4M A;  3SJF A;  3JVN A;  2XEI A;  3R9G A;  3I3G A;  3SXO A;  5J8C A;  2ZEE A;  2WSA A;  3JUW A;  3IIB A;  4UFV A;  1HDU A;  2WUU A;  4R3K A;  4ZYQ A;  2P6E A;  2IJZ A;  2Q44 A;  2PJ0 A;  4KSI A;  3TT2 A;  3D8P A;  1NSA A;  4ZBG A;  5AG4 A;  1GHE A;  2V77 A;  3D67 A;  4CPA A;  4R57 A;  2VZY A;  3PB6 X;  3BLN A;  1YVK A;  1ZLH A;  4A2Z A;  1XEB A;  4MMO A;  2J8R A;  3H8F A;  4NJR A;  1ARM A;  1ON0 A;  4P4I A;  3D2M A;  3I9S A;  4KOV A;  4OC4 A;  5F46 A;  1BPM A;  1UFH A;  3I1U A;  3BJ7 A;  2G3T A;  5CNP A;  2Z3P A;  7CPA A;  4WWV A;  3FEE A;  1VIX A;  3IFE A;  1XMT A;  3SI0 A;  2DPT A;  4R76 A;  4B5O A;  5I0C A;  1CP7 A;  2C6P A;  2PJ1 A;  4OC5 A;  1IYK A;  4KLW A;  5G20 A;  4A95 A;  5DWN A;  2EO8 A;  3L2N A;  5HVG A;  3RO0 A;  4ZY1 A;  4UEZ A;  5THW A;  2P6G A;  4A94 A;  4B11 A;  4KOY A;  5EBV A;  4Y49 B;  4A38 A;  2PJ9 A; 
#chains in the Genus database with same CATH homology
 1Q2Y A;  3CXS A;  4XNH C;  5A28 A;  4HNW B;  4XPK A;  2REF A;  4CGO A;  4C2X A;  4A30 A;  1QSN A;  4B14 A;  4PK2 A;  4UCN A;  1WWZ A;  4PSW A;  2X7B A;  4MFQ A;  1MJB A;  5HMN A;  2AJ6 A;  3OWC A;  3G3S A;  4JD6 A;  3PP9 A;  1NMT A;  3C26 A;  2BEI A;  1FY7 A;  2Z3M A;  5IX3 A;  2VXK A;  2QIR A;  2OZG A;  1RXT A;  2ZW4 A;  4KOU A;  3MGD A;  1M44 A;  2J8N A;  2PC1 A;  3R9F A;  1PUA A;  4CAE A;  4E2A A;  4FD5 A;  1YK3 A;  2B5G B;  1V0C A;  3LOD A;  2Y0M A;  3TFY A;  5GCN A;  2WPX A;  4R3L A;  2EVN A;  4K30 A;  3FNC A;  4NF1 A;  4CYO A;  3D3S A;  1S7F A;  2KCW A;  3KKW A;  5IB0 A;  2FT0 A;  2HV2 A;  4HNY B;  4CAX A;  4IF5 A;  2Z11 A;  4B5P B;  4B13 A;  4CGP A;  5AG5 A;  4XPD C;  2FXF A;  2P6F A;  4FD4 A;  1S7L A;  4UFX A;  2ATR A;  1YRE A;  3DSB A;  4QC6 A;  5F47 A;  1I12 A;  4KOR A;  5G1Z A;  3S6G A;  1Y7R A;  2GE3 A;  4NCZ A;  4OAE A;  4A33 A;  2B5G A;  3CXP A;  4QVT A;  4Q36 A;  4UFW A;  4X5K A;  3F8K A;  2CY2 A;  3EC4 A;  4KLV A;  3EY5 A;  4UCM A;  3P2H A;  4UWJ A;  4F0X A;  4CYQ A;  4NXY A;  3WR7 A;  3TO7 A;  5KTD A;  4B10 A;  5JPH A;  2Z3N A;  3TOB A;  3GYA A;  4C68 A;  5FVJ A;  2OB0 A;  4MJ8 A;  3LD2 A;  4MFP A;  4QUS A;  4KVO E;  2R98 A;  2D4P A;  2VQY A;  4PSX A;  2RC4 A;  3H5Z A;  2Q04 A;  3IU2 A;  3PGP A;  4YGO A;  2R8V A;  3T90 A;  1Q2C A;  3GKR A;  4A32 A;  3JTK A;  3FIX A;  2JLM A;  2PQ8 A;  3CXQ A;  4JXR A;  2K5T A;  3FXT A;  5BWA B;  3F5B A;  4U9Y A;  3TO6 A;  4U9Z A;  1IIC A;  5J8F A;  3ZZI A;  3N7Z A;  4AVA A;  4C7I A;  1S5K A;  1IB1 E;  2H5M A;  4L8A A;  1TIQ A;  2OZH A;  3F0A A;  2CNS A;  2EUI A;  4ONU A;  1J4J A;  2A4N A;  3QB8 A;  1VKC A;  3TTH A;  3FRM A;  3W91 A;  3S6K A;  2YNC C;  1BOB A;  2Z3K A;  4I49 A;  1KUV A;  2QML A;  2BSW A;  3IGR A;  4RS2 A;  4QBJ A;  4OLL A;  2NMT A;  2Z3O A;  4NEX A;  1KUX A;  1NE9 A;  2PR1 A;  2IL4 A;  3DR8 A;  2C27 A;  4ORF A;  2O28 A;  1XF8 A;  3TCV A;  4CYP A;  4R87 A;  1CM0 A;  4CGL A;  2D4O A;  2VZZ A;  3R9E A;  2AE6 A;  4CAV A;  4C7H A;  2FCK A;  2JEV A;  3IWG A;  1NSL A;  5A27 A;  4H6U A;  3A9L A;  1SQH A;  4JXQ A;  4Q38 A;  3TE4 A;  5C88 A;  1XE4 A;  5AG6 A;  2J8M A;  1U6M A;  3D2P A;  2FIW A;  5DWM A;  2ZW7 A;  4JLY A;  4KOT A;  1Z4R A;  1OZP A;  4MFL A;  3W6X A;  2Q4V A;  4PK3 A;  4CRY B;  4XNH B;  2CNT A;  3FB3 A;  3SHP A;  4CS0 B;  2PR8 A;  5F49 A;  5E96 A;  2GIV A;  3DNS A;  4MFZ A;  4EVY A;  1CJW A;  1YX0 A;  4MY3 A;  2VBQ A;  2FS5 A;  1B87 A;  2CNM A;  1QSR A;  4MHD A;  2Z0Z A;  4PV6 A;  5HH1 A;  2B3U A;  1I21 A;  3DR6 A;  1MJA A;  4J3G A;  4C2Z A;  3S6H A;  3VWD A;  5G21 A;  4JJX A;  1MJ9 A;  2OZU A;  5KTC A;  2BL1 A;  4DNC A;  4KUA A;  3ZJ0 A;  2YNC A;  5G22 A;  4BBH A;  5H86 A;  4M3S A;  4AG9 A;  5IV0 A;  3EFA A;  4KVM E;  2DPS A;  1S7K A;  4UA3 A;  2FE7 A;  4XPD B;  1QSM A;  4Y49 C;  4E8O A;  3IWE A;  2I79 A;  4UBR A;  2B4D A;  4CGM A;  3UY5 A;  1M4G A;  1PU9 A;  4U5Y A;  3NE7 A;  1M4D A;  2R1I A;  4II9 A;  4MBU A;  2YNE A;  3T9Y A;  3W6S A;  4LUA A;  4NSQ A;  3S6F A;  4B12 A;  3RYO A;  2B3V A;  4L89 A;  4H89 A;  1XIX A;  3R96 A;  2B4B A;  4AB7 A;  4MI4 A;  1IYL A;  4KS9 A;  2YND A;  1YLE A;  4JWP A;  5F48 A;  5C82 A;  1I1D A;  2VI7 A;  4AVC A;  4F6A A;  2FL4 A;  2VEZ A;  2JDD A;  4YRH A;  4FD6 A;  4R9M A;  4LX9 A;  4KSF A;  5AGE A;  3V8I A;  1BO4 A;  1QST A;  4GS4 A;  2Q4Y A;  4CYN A;  3G8W A;  2ARH A;  1Z9U A;  2JDC A;  4CGN A;  1LRZ A;  4KZT A;  2PSW A;  3EXN A;  1S3Z A;  4KOS A;  1YGH A;  3P2F A;  2REE A;  3EO4 A;  4FD7 A;  2QEC A;  3E0K A;  3FYN A;  5JQ4 A;  2YGW A;  4CAF A;  1N71 A;  4UWI A;  3TO9 A;  4MY0 A;  4KOW A;  1Z4E A;  4XPL A;  2CXA A;  3PZJ A;  5H84 A;  1ZO0 A;  4HKF A;  2G0B A;  4AG7 A;  1RO5 A;  2G3A A;  2ZW5 A;  2OU2 A;  1Q2D A;  5ISV A;  1MK4 A;  3GY9 A;  4OAD A;  2R7H A;  4A31 A;  1YR0 A;  2Z3L A;  1R57 A;  2PDO A;  1KZF A;  2FSR A;  1M4I A;  2Z10 A;  4C2Y A;  1Y9K A;  4E0A A;  4BMH A;  1QSO A;  3QAH A;  1YVO A;  3R1K A;  1P4N A;  2BUE A;  2HUZ A;  4KVX A;  2PRB A;  3R95 A;  2ZXV A;  2B4D B;  1L0C A;  3B8G A;  3IU1 A;  2DXQ A;  3DDD A;  1P0H A;  3K9U A;  2ZPA A;  4KUB A;  4H6Z A;  4CRZ B;  2F5I A;  4KSA A;  3H4Q A;  4IUS A;  1S7N A;  4MFK A;  1IID A;  2GAN A;  4RI1 A;  1B6B A;  2Q7B A;  1K4J A;  2I00 A;  3VWE A;  4CAW A;  5AG7 A;  1S60 A;  4F0Y A;  3TOA A;  3SXN A;  2OH1 A;  4HNX B;  4UCP A;  4B5P A;  4QB9 A;  4ZGY B;  4YFJ A;  5KTA A;  2ZW6 A;  2WPW A;  5EC4 A;  2FIA A;  4M85 A;  4AVB A;  1VHS A;  2B58 A;  1M1D A;  2P0W A;  1KUY A;  1WK4 A;  2HQY A;  2Q0Y A;  1Y9W A;  3BJ8 A;  4KOX A;  3FBU A;  3JVN A;  3R9G A;  3I3G A;  3SXO A;  5J8C A;  2WSA A;  3JUW A;  4UFV A;  2WUU A;  4R3K A;  2P6E A;  2Q44 A;  3TT2 A;  3D8P A;  4ZBG A;  5AG4 A;  1GHE A;  4R57 A;  2VZY A;  3BLN A;  1YVK A;  4A2Z A;  1XEB A;  2J8R A;  1ON0 A;  3D2M A;  3I9S A;  4KOV A;  5F46 A;  1UFH A;  3BJ7 A;  2G3T A;  5CNP A;  2Z3P A;  1XMT A;  2DPT A;  4B5O A;  5I0C A;  1IYK A;  4KLW A;  5G20 A;  4A95 A;  5DWN A;  2P6G A;  4B11 A;  4KOY A;  5EBV A;  4Y49 B;  4MFJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...