2H5MA

Nmr solution structure of a gcn5-like putative n-acetyltransferase from staphylococcus aureus complexed with acetyl-coa. northeast structural genomics consortium target zr31
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
102
structure length
102
Chain Sequence
MSNLEIKQGENKFYIGDDENNALAEITYRFVDNNEINIDHTGVSDELGGQGVGKKLLKAVVEHARENNLKIIASCSFAKHMLEKEDSYQDVYLGLEHHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Acetyltransferase, GNAT family
publication title Structure of an acetyl-CoA binding protein from Staphylococcus aureus representing a novel subfamily of GCN5-related N-acetyltransferase-like proteins
pubmed doi rcsb
source organism Staphylococcus aureus subsp. aureus
molecule tags Transferase
total genus 31
structure length 102
sequence length 102
ec nomenclature
pdb deposition date 2006-05-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14542 Acetyltransf_CG GCN5-related N-acetyl-transferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 2h5mA00
3FNCA 3TO7A 3V8IA 4K30A 4B5PA 1KUVA 4MBUA 4E0AA 2BUEA 2VBQA 4I49A 1Y9WA 5JPHA 4E2AA 2NMTA 2WPXA 5J8FA 5KTCA 2Y0MA 4KLWA 2G3TA 1NMTA 4UA3A 2OB0A 3G8WA 2CY2A 2EVNA 4KORA 3P2FA 4OADA 4AVCA 2RC4A 2Q44A 2ZW7A 4QC6A 2VI7A 5F47A 4XPLA 1QSOA 2FL4A 3GY9A 2A4NA 2VEZA 1KUYA 3K9UA 4XPKA 4L89A 1K4JA 2VZZA 3R1KA 2BSWA 4H6ZA 1S7FA 1YREA 3T9YA 4NXYA 3NE7A 2HV2A 2PR8A 2REEA 4FD4A 5DWMA 5J8CA 4II9A 4NEXA 2QMLA 2J8MA 4KZTA 5I0CA 1IB1E 3FB3A 4JLYA 1YVOA 3DR8A 4PK3A 1L0CA 2PR1A 2VZYA 3IWGA 1IYLA 1CJWA 3I9SA 4DNCA 3F8KA 2ZPAA 5GCNA 3WR7A 3TCVA 3F0AA 1BO4A 5CNPA 4KOUA 5HMNA 1VKCA 2X7BA 3R9FA 3UY5A 4UWIA 5C82A 1YX0A 1XF8A 4KOVA 1Y7RA 2Z0ZA 2D4PA 4KOXA 3D2MA 4RI1A 2Q7BA 4U9YA 2REFA 4B5OA 4Y49C 3LD2A 3ZJ0A 5EC4A 1QSRA 2PRBA 4LUAA 4YFJA 2B5GA 4KVME 4R9MA 4GS4A 1S7NA 1XEBA 4YGOA 5DWNA 4IF5A 3B8GA 1PU9A 4KLVA 2G3AA 3FXTA 4QBJA 1KZFA 3GYAA 4PSWA 4UBRA 1XMTA 2GE3A 4MJ8A 5F46A 4MY3A 2C27A 2B58A 2Z11A 2DXQA 2R1IA 2R98A 3KKWA 2I79A 3PGPA 2O28A 2R7HA 3W91A 4R3LA 2P6GA 3F5BA 5C88A 2GANA 4OAEA 3D2PA 4H89A 1R57A 4B5PB 1YVKA 4FD6A 4KOYA 3SXOA 2F5IA 3R95A 1RXTA 1J4JA 1S60A 4UWJA 3TO6A 2PC1A 2P6EA 2Q4VA 4CS0B 3JUWA 4M3SA 3TTHA 3E0KA 2GIVA 3QAHA 2OU2A 1QSTA 4JWPA 5KTDA 4EVYA 4OLLA 5EBVA 3H4QA 3GKRA 2HQYA 1OZPA 4R57A 4MY0A 5KTAA 4QB9A 4F0YA 2OH1A 1VHSA 4U9ZA 3CXPA 2FCKA 3FIXA 4CAVA 2JDDA 1KUXA 2I00A 2P0WA 2B4DA 3SXNA 5ISVA 2JLMA 2P6FA 2CNMA 3LODA 2G0BA 2ZXVA 4HKFA 1V0CA 3FBUA 1WWZA 1BOBA 4KUBA 4L8AA 4AVBA 3C26A 2FS5A 1MK4A 3W6SA 3EFAA 4PV6A 4AB7A 2FIAA 4E8OA 1M4GA 4LX9A 3RYOA 2BL1A 2WPWA 2D4OA 2QECA 3R9EA 2FT0A 1M1DA 3MGDA 3TT2A 2Q04A 3EO4A 1LRZA 4MI4A 4ZBGA 3EY5A 4KVXA 2Q4YA 4BMHA 1RO5A 2KCWA 1UFHA 2ZW6A 4KOWA 1N71A 2B5GB 5IB0A 3DNSA 2B3VA 3DSBA 2JDCA 2FIWA 1IYKA 4JXQA 3R96A 4CRYB 3OWCA 4MHDA 3PZJA 2AJ6A 1WK4A 4JJXA 2CNTA 1TIQA 5IV0A 2QIRA 2H5MA 1YLEA 2ARHA 4XPDC 3N7ZA 4AG9A 4J3GA 4QUSA 4Y49B 3CXSA 1YGHA 2Q0YA 2VXKA 1S7LA 3BLNA 3FYNA 4XNHC 2AE6A 1P4NA 4YRHA 4HNYB 3D3SA 3CXQA 2CNSA 2ATRA 5E96A 2JEVA 1MJBA 4IUSA 4ONUA 1ON0A 1YR0A 1Q2YA 4JD6A 2PSWA 1Z9UA 4KOTA 3ZZIA 2B4BA 3VWDA 4U5YA 2BEIA 1M4DA 4JXRA 4ORFA 1M44A 4CAWA 4XPDB 4HNWB 1S7KA 1Z4EA 5H86A 5IX3A 2OZUA 2FE7A 2PQ8A 2HUZA 3IGRA 3TE4A 4XNHB 1B6BA 3DDDA 3R9GA 3EXNA 5F49A 4M85A 3VWEA 1QSMA 1U6MA 5HH1A 3S6KA 3TFYA 3JVNA 2OZHA 3EC4A 2ZW4A 2B4DB 4R3KA 4PSXA 2IL4A 2B3UA 2Z10A 3TOAA 2ZW5A 2J8NA 4NF1A 4F6AA 1XIXA 3W6XA 3S6HA 1S3ZA 1I21A 1Q2CA 4H6UA 1P0HA 3BJ8A 4RS2A 1XE4A 4NCZA 4CRZB 4QVTA 1Z4RA 1QSNA 3I3GA 2VQYA 1CM0A 3P2HA 5JQ4A 3QB8A 4NSQA 3G3SA 5FVJA 5H84A 4KVOE 4KUAA 3T90A 3TOBA 4R87A 2FXFA 2OZGA 1NE9A 4HNXB 1IIDA 4KOSA 4X5KA 1PUAA 1FY7A 4FD7A 3FRMA 1MJAA 1MJ9A 3BJ7A 1S5KA 4AG7A 2EUIA 5F48A 1YK3A 2J8RA 3PP9A 2R8VA 1B87A 1Y9KA 1I12A 4FD5A 1M4IA 1GHEA 3DR6A 3SHPA 4AVAA 1I1DA 4PK2A 3S6GA 3TO9A 2FSRA 1IICA 2PDOA 3D8PA 1NSLA 2K5TA 4CAXA 3S6FA 1SQHA 1Q2DA
chains in the Genus database with same CATH superfamily
1CG2A 3FNCA 3TO7A 3V8IA 1R43A 4OP4A 4K30A 4B5PA 1KUVA 3D4UA 1HDQA 4MBUA 4A95A 4E0AA 1M4LA 2BUEA 2O53A 4MFLA 2VBQA 1Z8LA 4I49A 2AFOA 1Y9WA 5JPHA 2Z3NA 4E2AA 4IK2A 2NMTA 2ZOFA 3PB8X 2WPXA 5J8FA 2QJ8A 2BCOA 3NFZA 5KTCA 2OOTA 2Y0MA 4KLWA 2ZOGA 2G3TA 2RB7A 3SI2A 1NMTA 4UA3A 2OB0A 3G8WA 2C6GA 2CY2A 4P45A 4UCMA 1TKJA 4WWVA 2EVNA 3B7IA 3CPAA 4Z65A 4KORA 3P2FA 4OADA 4AVCA 1ZG9A 2RC4A 3D67A 2Q44A 4M6IA 4WJBA 2ZW7A 3ISXA 3A9LA 4QC6A 3KZWA 2VI7A 5F09A 3PFEA 5F47A 1IU8A 4CAFA 3I1UA 4XPLA 4NJRA 5LYDA 2PJ3A 1QSOA 2CF4A 2FL4A 2Q7SA 2WZNA 2CIJA 1LAPA 2A4NA 2VEZA 2ZEGA 3GY9A 2GREA 3SI1A 4A31A 4UCNA 1KUYA 3K9UA 4XPKA 4ZY2A 4L89A 4BD9A 4RUHA 1K4JA 2VZZA 3GB0A 3R1KA 2BSWA 4H6ZA 1S7FA 1YREA 1AMPA 4MCRA 3T9YA 4C2ZA 4TWEA 4NXYA 3NE7A 2EK9A 3CT9A 2HV2A 5THWA 5IB9A 4PXCA 2V8VA 3NE8A 2PR8A 2REEA 3GIUA 3L2NA 4ZGYB 4FWUA 1ZLHA 4FD4A 5A28A 1Z8XA 1YW4A 5DWMA 2ZEEA 5J8CA 4II9A 1Z8WA 2XEJA 3LACA 4NEXA 2QMLA 2J8MA 4UFWA 4KZTA 3B3WA 2Q51A 5I0CA 1IB1E 4UEZA 3FB3A 4JLYA 1YVOA 1TXRA 3ISZA 3DR8A 4PK3A 1L0CA 4NGSA 2YNEA 1PCAA 2PR1A 1QQ9A 2VZYA 4MFQA 3GUXA 3IWGA 1OBRA 2POKA 1IYLA 1CJWA 3I9SA 1CX8A 4CPAA 4DNCA 4MFKA 3F8KA 4O23A 2ZPAA 5GCNA 3WR7A 3TCVA 3F0AA 1BO4A 5CNPA 2HB6A 4ZX8A 4B10A 4KOUA 5HMNA 3BXMA 1X12A 2EBJA 3TX8A 1XOVA 2I3CA 3IO1A 3IU2A 4B6ZA 3VATA 1VKCA 1FT7A 5HXDA 2AFZA 3IWWA 3H8EA 2X7BA 2CXAA 1LOKA 3R9FA 3UY5A 4NGNA 3IFEA 2AFSA 4UWIA 5C82A 4NGPA 1ZG7A 2EO8A 4KSAA 4C7HA 1YX0A 1XF8A 4X8IA 2YGWA 4KOVA 2O4HA 2JEWA 3V38A 1JQGA 1Y7RA 5D29A 2PVWA 3BHXA 3K9TA 2Z0ZA 5CPAA 2D4PA 4KOXA 3D2MA 4RI1A 4YWYA 3WC7A 2Q7BA 2WSAA 1VHEA 4KSIA 4MCQA 2PJ4A 4U9YA 1XBUA 4BBHA 3BI1A 4KSFA 3KHZA 2REFA 2AFMA 4OC2A 4B5OA 2RFHA 2V8HA 1LAMA 3LD2A 4Y49C 5EC4A 3ZJ0A 4MHYA 2J9AA 4UFVA 4EMEA 1QSRA 2PRBA 4LUAA 5DS0A 5HVHA 4YFJA 2B5GA 4KVME 2QYVA 4R9MA 4GS4A 2F8HA 1CPXA 3S9LA 4A37A 1S7NA 1XEBA 3CPXA 3D7GA 3PBEA 4YGOA 4IF5A 3B8GA 5DWNA 3VARA 4C2YA 1PU9A 4KLVA 3B2YA 4B14A 3SJXA 4DUKA 2ZEFA 2G3AA 2ZENA 3FXTA 4QBJA 1KZFA 1Z8TA 3GYAA 2PJBA 4PSWA 5AG5A 3H5ZA 4K3NA 4OMEA 4UBRA 1XMTA 2GE3A 5K8PA 4MJ8A 5F46A 4MY3A 1F2OA 5LYLA 1F57A 2C27A 2B58A 3FMCA 3CDXA 2Z11A 2DXQA 2R1IA 3KR5A 4B12A 2Z3PA 2JBKA 4CGOA 2R98A 3KKWA 2I79A 3PGPA 2O28A 2R7HA 4MHNA 3W91A 2GLJA 4R3LA 4CYPA 2P6GA 1F2PA 2DF5A 2YNCA 2EK8A 3F5BA 4P4DA 5C88A 2GANA 1Q7LA 4OAEA 4CGMA 3D2PA 4DYOA 2NSMA 4H89A 1R57A 1ARLA 1Z5RA 4B5PB 1YVKA 4FD6A 3B3TA 4KOYA 3SJFA 3SXOA 3D7FA 4LQGA 1BLLE 4UEEA 2F5IA 3S9NA 3R95A 4GM5A 1RXTA 1J4JA 1S60A 2PRQA 4UWJA 3TO6A 3FEDA 3LWUA 2QVPA 2PC1A 3WT4A 2P6EA 2Q4VA 5I4MA 4P10A 5A27A 2PJ2A 2ANPA 4CS0B 3JUWA 1YW6A 4M3SA 4NGTA 3TTHA 3E0KA 2ODFA 3RAMA 4OC1A 4R8FA 2GIVA 3QAHA 2OU2A 4F8ZA 4X3RA 1QSTA 4JWPA 5KTDA 4EVYA 4YU9A 3B3CA 4OLLA 5EBVA 3H4QA 3GKRA 5LYFA 1TF8A 3FEEA 4A38A 4A2ZA 4P4FA 2Q4ZA 3SI0A 4B13A 1QMUA 2HQYA 1CBXA 2C1CA 3PB6X 1OZPA 4R57A 3FX6A 4IHMA 4MY0A 1IOIA 3KL9A 4Q36A 5KTAA 2PJ7A 4G1PA 3KQXA 4NGMA 4QB9A 4F0YA 2OH1A 1VHSA 4PXBA 2Z3LA 4MHPA 1LANA 4U9ZA 1XMBA 4P6YA 5AGEA 3CXPA 2FCKA 1ZO0A 3FIXA 4X2TA 3CZXA 2C6CA 3FJUA 2JDDA 4CAVA 1LFWA 1KUXA 2I00A 2PCUA 4ONWA 2P0WA 5JH9A 2B4DA 2XEGA 4R7MA 3SXNA 1Y0RA 4MFJA 5ISVA 2JLMA 2P6FA 4OC0A 3FF3A 4TNUA 3JRUA 2V8DA 2CNMA 4F9VA 3LODA 2PJ6A 2G0BA 2ZXVA 2V77A 1XRYA 4HKFA 4PXDA 5ELYA 1V0CA 3FBUA 1WWZA 2PIZA 1BOBA 2CTCA 2ZEHA 4KUBA 3N5FA 4L8AA 4CYNA 4A94A 4AVBA 3C26A 2FS5A 1MK4A 4CAEA 1TF9A 2PIYA 1XJOA 3W6SA 5LYIA 3EFAA 4MCPA 4PV6A 4AB7A 2FIAA 2NYQA 3PB4X 1ARMA 4E8OA 5CBMA 2YNDA 4M6GA 4NFRA 1M4GA 2IQ6A 3DLJA 1A2ZA 1HDUA 4LX9A 4PPZA 4Q7AA 3RYOA 2BL1A 2JBJA 3IEHA 2WPWA 2D4OA 2XEIA 2QECA 5LRJA 2PJAA 3R9EA 4NGQA 4AG7A 5J1QA 2OR4A 2FT0A 1M1DA 2BO9A 3MGDA 3TT2A 2Q04A 3EO4A 1HEEA 1LRZA 2YNCC 2PJ5A 4MI4A 4ZBGA 5HVFA 3EY5A 3RO0A 4EFDA 4OIWA 2ZELA 4W9YA 2IMOA 4KVXA 2Q4YA 1ZG8A 5AG7A 5K8NA 4UCPA 4BMHA 1RO5A 2AFXA 2CTBA 2KCWA 2WUUA 1JWQA 1UFHA 2ZW6A 4KOWA 5AG4A 1GYTA 1N71A 3FECA 1PYTB 2B5GB 2ZEPA 4PQAA 5HVGA 3DNSA 4CGLA 2XEFA 5IB0A 1ZLIA 2B3VA 3DSBA 4GXHA 3VH9A 1CP7A 1IY7A 2JDCA 2FIWA 1IYKA 1Y0YA 3DGVA 4JXQA 3R96A 2Z3MA 4CRYB 3D66A 3OWCA 5LRKA 1VHOA 4MHDA 3PZJA 1ELLP 3H8FA 1KWMA 1WK4A 2AJ6A 4FUUA 4HPSA 4JJXA 5JGFA 4C2XA 1AYEA 2CNTA 3MN8A 5EMIA 1TIQA 5G1ZA 1VGYA 5IV0A 1BPNA 3PB9X 3TC8A 4PXEA 3KGQA 3D7HA 2QIRA 3IU1A 2H5MA 1VIXA 4F0XA 1YLEA 2ARHA 4P4JA 4XPDC 4ZI6A 3N7ZA 4AG9A 4J3GA 4QUSA 3WC6A 4C68A 1DTDA 2PJ0A 3V7ZA 4FAIA 3GLJA 3NH5A 5AG6A 3QAYA 2AFWA 4Y49B 8CPAA 3CXSA 1CPSA 1Y7EA 1YGHA 2Q0YA 2VXKA 1S7LA 3BLNA 3FYNA 2Q43A 3IWEA 2AE6A 4MRIA 1P4NA 4XNHC 4YRHA 4HNYB 4P4BA 1IOFA 3H8GA 4RN7A 4UEFA 3D3SA 3CXQA 1CP6A 2CNSA 2ATRA 5E96A 2JEVA 3S9MA 1RTQA 1MJBA 4IUSA 4ONUA 1ON0A 1FNOA 3D68A 4CGPA 2GLFA 1YR0A 1Q2YA 4JD6A 2PJ8A 4JZ0A 4NJQA 2PSWA 1YMEA 3FH4A 4KS9A 1YLOA 1Z9UA 4KOTA 5G21A 5K8OA 1TKFA 4B11A 3ZZIA 2B4BA 3NA6A 3VWDA 4U5YA 2BEIA 1M4DA 4P4EA 4MCSA 4JXRA 4ORFA 1M44A 4CAWA 2PJCA 4XPDB 4HNWB 1R3NA 1S7KA 1Z4EA 1UWYA 2FVGA 3KR4A 3PFOA 5H86A 4AXVA 2OZUA 2FE7A 2PQ8A 2EWBA 2BOAA 2HUZA 2V8GA 4UF4A 3IGRA 4MFPA 3SJEA 3PEIA 3KQZA 3SJGA 3TE4A 4XNHB 5IX3A 1B6BA 5K8MA 1X10A 3DDDA 3R9GA 3EXNA 2HC9A 5F49A 1LCPA 4M85A 1EE3P 3VWEA 3IC1A 3RNZA 1QSMA 1U6MA 3NH4A 5HH1A 3S6KA 4P4IA 3TFYA 4A33A 2PVVA 4ZYQA 3WABA 3JVNA 2OZHA 3EC4A 3KI9A 2PJ1A 4A32A 2ZW4A 2B4DB 4R3KA 4UFXA 4BINA 4PSXA 4H2KA 2IL4A 3IJ3A 2ZEMA 2B3UA 1XFOA 2Z10A 3TOAA 3K2KA 2ZW5A 2J8NA 3IIBA 4NF1A 1BAVA 1YQEA 4OC4A 2Z3KA 4F6AA 3T8WA 4LQ6A 1XIXA 3W6XA 3S6HA 1S3ZA 1I21A 1DE4C 1Q2CA 4H6UA 1P0HA 3BJ8A 4RS2A 1XE4A 4DJLA 1Z2LA 4NCZA 4F9UA 3NH8A 4CRZB 3KHXA 1Z4RA 4QVTA 1QSNA 4Q38A 4MXUA 4MFZA 3JTKA 3I3GA 4R76A 2VQYA 1CM0A 3P2HA 5JQ4A 3QB8A 4A30A 4ZY1A 3D7DA 4OC3A 3PBBA 4NSQA 3HLPA 5D8NA 1NSAA 4CYOA 1H8LA 3G3SA 5FVJA 5H84A 1AUGA 4KVOE 4KUAA 4JYWA 3T90A 2DPTA 4M6HA 4R87A 3RZAA 3TOBA 1BPMA 2DPSA 2ABZA 1TKHA 2FXFA 3BI0A 2OZGA 3HUVA 1NE9A 4HNXB 2GU2A 1IIDA 4UIAA 4EWTA 5BWAB 2ZEDA 1ELMP 4KOSA 4X5KA 1PUAA 4OIDA 1IGBA 3RBUA 2ZEOA 7CPAA 1FY7A 4FD7A 2IJZA 3FRMA 1MJAA 1MJ9A 3B3VA 3BJ7A 1S5KA 3QNVA 4MMOA 3WC5A 2EUIA 2VL1A 5F48A 1YK3A 2J8RA 3PP9A 4NGRA 4OC5A 4ZX9A 3KASA 6CPAA 2G9DA 2DEAA 2R8VA 2AFUA 3PRTA 4A39A 2PJ9A 1B87A 1Y9KA 4C7IA 4CYQA 2PE3A 1I12A 5JM6A 1YSJA 4CGNA 4UIBA 2WYRA 4FD5A 4R6TA 1M4IA 4MHZA 1GHEA 3DR6A 4OKOA 3B35A 3SHPA 3LMSA 1I1DA 3PB7X 4PK2A 3S6GA 4AVAA 3TO9A 2C6PA 3B3SA 4FBEA 4ZY0A 2FSRA 1IICA 2Z3OA 2PDOA 2F7VA 3D8PA 4P44A 5G20A 5G22A 5LRGA 1NSLA 2K5TA 4IAVA 3FVLA 4CAXA 3S6FA 3MRUA 1SQHA 1Q2DA 2GFQA
chains in the Genus database with same CATH topology
3FNCA 3TO7A 3V8IA 4K30A 4B5PA 1KUVA 4MBUA 4E0AA 4A95A 2BUEA 4MFLA 2VBQA 4I49A 1Y9WA 5JPHA 2Z3NA 4E2AA 2NMTA 2WPXA 5J8FA 5KTCA 2Y0MA 4KLWA 2G3TA 1NMTA 4UA3A 2OB0A 3G8WA 2CY2A 4UCMA 2EVNA 4KORA 3P2FA 4OADA 4AVCA 2RC4A 2Q44A 2ZW7A 3A9LA 4QC6A 2VI7A 5F47A 4CAFA 4XPLA 1QSOA 2FL4A 3GY9A 2A4NA 2VEZA 4A31A 4UCNA 1KUYA 3K9UA 4XPKA 4L89A 1K4JA 2VZZA 3R1KA 2BSWA 4H6ZA 1S7FA 1YREA 3T9YA 4C2ZA 4NXYA 3NE7A 2HV2A 2PR8A 2REEA 4ZGYB 4FD4A 5A28A 5DWMA 5J8CA 4II9A 4NEXA 2QMLA 2J8MA 4UFWA 4KZTA 5I0CA 1IB1E 3FB3A 4JLYA 1YVOA 3DR8A 4PK3A 1L0CA 2YNEA 2PR1A 2VZYA 4MFQA 3IWGA 1IYLA 1CJWA 3I9SA 4DNCA 4MFKA 3F8KA 2ZPAA 5GCNA 3WR7A 3TCVA 3F0AA 1BO4A 5CNPA 4B10A 4KOUA 5HMNA 3IU2A 1VKCA 2X7BA 2CXAA 3R9FA 3UY5A 4UWIA 5C82A 4KSAA 4C7HA 1YX0A 1XF8A 2YGWA 4KOVA 1Y7RA 2Z0ZA 2D4PA 4KOXA 3D2MA 4RI1A 2Q7BA 2WSAA 4U9YA 4KSFA 2REFA 4B5OA 4Y49C 3LD2A 3ZJ0A 5EC4A 4UFVA 1QSRA 2PRBA 4LUAA 4YFJA 2B5GA 4KVME 4R9MA 4GS4A 1S7NA 1XEBA 4YGOA 5DWNA 4IF5A 3B8GA 4C2YA 1PU9A 4KLVA 4B14A 2G3AA 3FXTA 4QBJA 1KZFA 3GYAA 4PSWA 5AG5A 3H5ZA 4UBRA 1XMTA 2GE3A 4MJ8A 5F46A 4MY3A 2C27A 2B58A 2Z11A 2DXQA 2R1IA 4B12A 2Z3PA 4CGOA 2R98A 3KKWA 2I79A 3PGPA 2O28A 2R7HA 3W91A 4R3LA 4CYPA 2P6GA 2YNCA 3F5BA 5C88A 2GANA 4OAEA 4CGMA 3D2PA 4H89A 1R57A 4B5PB 4FD6A 1YVKA 4KOYA 3SXOA 2F5IA 3R95A 1RXTA 1J4JA 1S60A 4UWJA 3TO6A 2PC1A 2P6EA 2Q4VA 5A27A 4CS0B 3JUWA 4M3SA 3TTHA 3E0KA 2GIVA 3QAHA 2OU2A 1QSTA 4JWPA 5KTDA 4EVYA 4OLLA 5EBVA 3H4QA 3GKRA 4A2ZA 4B13A 2HQYA 1OZPA 4R57A 4MY0A 4Q36A 5KTAA 4QB9A 4F0YA 2OH1A 1VHSA 2Z3LA 4U9ZA 5AGEA 3CXPA 2FCKA 1ZO0A 3FIXA 4CAVA 2JDDA 1KUXA 2I00A 2P0WA 2B4DA 3SXNA 4MFJA 5ISVA 2JLMA 2P6FA 2CNMA 3LODA 2G0BA 2ZXVA 4HKFA 1V0CA 3FBUA 1WWZA 1BOBA 4KUBA 4L8AA 4CYNA 4AVBA 3C26A 2FS5A 1MK4A 4CAEA 3W6SA 3EFAA 4PV6A 4AB7A 2FIAA 4E8OA 2YNDA 1M4GA 4LX9A 3RYOA 2BL1A 2WPWA 2D4OA 2QECA 3R9EA 2FT0A 1M1DA 3MGDA 3TT2A 2Q04A 3EO4A 1LRZA 2YNCC 4MI4A 4ZBGA 3EY5A 4KVXA 2Q4YA 5AG7A 4UCPA 4BMHA 1RO5A 2KCWA 2WUUA 1UFHA 2ZW6A 5AG4A 4KOWA 1N71A 2B5GB 5IB0A 3DNSA 4CGLA 2B3VA 3DSBA 2JDCA 2FIWA 1IYKA 4JXQA 3R96A 2Z3MA 4CRYB 3OWCA 4MHDA 3PZJA 2AJ6A 1WK4A 4JJXA 4C2XA 2CNTA 1TIQA 5G1ZA 5IV0A 2QIRA 3IU1A 2H5MA 4F0XA 1YLEA 2ARHA 4XPDC 3N7ZA 4AG9A 4J3GA 4QUSA 4C68A 5AG6A 4Y49B 3CXSA 1YGHA 2Q0YA 2VXKA 1S7LA 3BLNA 3FYNA 3IWEA 4XNHC 2AE6A 1P4NA 4YRHA 4HNYB 3D3SA 3CXQA 2CNSA 2ATRA 5E96A 2JEVA 1MJBA 4IUSA 4ONUA 1ON0A 4CGPA 1YR0A 1Q2YA 4JD6A 2PSWA 4KS9A 1Z9UA 5G21A 4KOTA 4B11A 3ZZIA 2B4BA 3VWDA 4U5YA 2BEIA 1M4DA 4JXRA 4ORFA 1M44A 4CAWA 4XPDB 4HNWB 1S7KA 1Z4EA 5H86A 5IX3A 2OZUA 2FE7A 2PQ8A 2HUZA 3IGRA 4MFPA 3TE4A 4XNHB 1B6BA 3DDDA 3R9GA 3EXNA 5F49A 4M85A 3VWEA 1QSMA 1U6MA 5HH1A 3S6KA 3TFYA 4A33A 3JVNA 2OZHA 3EC4A 4A32A 2ZW4A 2B4DB 4R3KA 4UFXA 4PSXA 2IL4A 2B3UA 2Z10A 3TOAA 2ZW5A 2J8NA 4NF1A 2Z3KA 4F6AA 1XIXA 3W6XA 3S6HA 1S3ZA 1I21A 1Q2CA 4H6UA 1P0HA 3BJ8A 4RS2A 1XE4A 4NCZA 4CRZB 4QVTA 1Z4RA 1QSNA 4Q38A 4MFZA 3JTKA 3I3GA 2VQYA 1CM0A 3P2HA 5JQ4A 3QB8A 4A30A 4NSQA 4CYOA 3G3SA 5FVJA 5H84A 4KVOE 4KUAA 3T90A 2DPTA 3TOBA 4R87A 2DPSA 2FXFA 2OZGA 1NE9A 4HNXB 1IIDA 5BWAB 4KOSA 4X5KA 1PUAA 1FY7A 4FD7A 3FRMA 1MJAA 1MJ9A 3BJ7A 1S5KA 4AG7A 2EUIA 5F48A 1YK3A 2J8RA 3PP9A 2R8VA 1B87A 1Y9KA 4C7IA 4CYQA 1I12A 4CGNA 4FD5A 1M4IA 1GHEA 3DR6A 3SHPA 4AVAA 1I1DA 4PK2A 3S6GA 3TO9A 2FSRA 1IICA 2Z3OA 2PDOA 3D8PA 5G20A 5G22A 1NSLA 2K5TA 4CAXA 3S6FA 1SQHA 1Q2DA 4BBHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3FNC A;  3TO7 A;  3V8I A;  4K30 A;  4B5P A;  1KUV A;  4MBU A;  4E0A A;  2BUE A;  2VBQ A;  4I49 A;  1Y9W A;  5JPH A;  4E2A A;  2NMT A;  2WPX A;  5J8F A;  5KTC A;  2Y0M A;  4KLW A;  2G3T A;  1NMT A;  4UA3 A;  2OB0 A;  3G8W A;  2CY2 A;  2EVN A;  4KOR A;  3P2F A;  4OAD A;  4AVC A;  2RC4 A;  2Q44 A;  2ZW7 A;  4QC6 A;  2VI7 A;  5F47 A;  4XPL A;  1QSO A;  2FL4 A;  3GY9 A;  2A4N A;  2VEZ A;  1KUY A;  3K9U A;  4XPK A;  4L89 A;  1K4J A;  2VZZ A;  3R1K A;  2BSW A;  4H6Z A;  1S7F A;  1YRE A;  3T9Y A;  4NXY A;  3NE7 A;  2HV2 A;  2PR8 A;  2REE A;  4FD4 A;  5DWM A;  5J8C A;  4II9 A;  4NEX A;  2QML A;  2J8M A;  4KZT A;  5I0C A;  1IB1 E;  3FB3 A;  4JLY A;  1YVO A;  3DR8 A;  4PK3 A;  1L0C A;  2PR1 A;  2VZY A;  3IWG A;  1IYL A;  1CJW A;  3I9S A;  4DNC A;  3F8K A;  2ZPA A;  5GCN A;  3WR7 A;  3TCV A;  3F0A A;  1BO4 A;  5CNP A;  4KOU A;  5HMN A;  1VKC A;  2X7B A;  3R9F A;  3UY5 A;  4UWI A;  5C82 A;  1YX0 A;  1XF8 A;  4KOV A;  1Y7R A;  2Z0Z A;  2D4P A;  4KOX A;  3D2M A;  4RI1 A;  2Q7B A;  4U9Y A;  2REF A;  4B5O A;  4Y49 C;  3LD2 A;  3ZJ0 A;  5EC4 A;  1QSR A;  2PRB A;  4LUA A;  4YFJ A;  2B5G A;  4KVM E;  4R9M A;  4GS4 A;  1S7N A;  1XEB A;  4YGO A;  5DWN A;  4IF5 A;  3B8G A;  1PU9 A;  4KLV A;  2G3A A;  3FXT A;  4QBJ A;  1KZF A;  3GYA A;  4PSW A;  4UBR A;  1XMT A;  2GE3 A;  4MJ8 A;  5F46 A;  4MY3 A;  2C27 A;  2B58 A;  2Z11 A;  2DXQ A;  2R1I A;  2R98 A;  3KKW A;  2I79 A;  3PGP A;  2O28 A;  2R7H A;  3W91 A;  4R3L A;  2P6G A;  3F5B A;  5C88 A;  2GAN A;  4OAE A;  3D2P A;  4H89 A;  1R57 A;  4B5P B;  1YVK A;  4FD6 A;  4KOY A;  3SXO A;  2F5I A;  3R95 A;  1RXT A;  1J4J A;  1S60 A;  4UWJ A;  3TO6 A;  2PC1 A;  2P6E A;  2Q4V A;  4CS0 B;  3JUW A;  4M3S A;  3TTH A;  3E0K A;  2GIV A;  3QAH A;  2OU2 A;  1QST A;  4JWP A;  5KTD A;  4EVY A;  4OLL A;  5EBV A;  3H4Q A;  3GKR A;  2HQY A;  1OZP A;  4R57 A;  4MY0 A;  5KTA A;  4QB9 A;  4F0Y A;  2OH1 A;  1VHS A;  4U9Z A;  3CXP A;  2FCK A;  3FIX A;  4CAV A;  2JDD A;  1KUX A;  2I00 A;  2P0W A;  2B4D A;  3SXN A;  5ISV A;  2JLM A;  2P6F A;  2CNM A;  3LOD A;  2G0B A;  2ZXV A;  4HKF A;  1V0C A;  3FBU A;  1WWZ A;  1BOB A;  4KUB A;  4L8A A;  4AVB A;  3C26 A;  2FS5 A;  1MK4 A;  3W6S A;  3EFA A;  4PV6 A;  4AB7 A;  2FIA A;  4E8O A;  1M4G A;  4LX9 A;  3RYO A;  2BL1 A;  2WPW A;  2D4O A;  2QEC A;  3R9E A;  2FT0 A;  1M1D A;  3MGD A;  3TT2 A;  2Q04 A;  3EO4 A;  1LRZ A;  4MI4 A;  4ZBG A;  3EY5 A;  4KVX A;  2Q4Y A;  4BMH A;  1RO5 A;  2KCW A;  1UFH A;  2ZW6 A;  4KOW A;  1N71 A;  2B5G B;  5IB0 A;  3DNS A;  2B3V A;  3DSB A;  2JDC A;  2FIW A;  1IYK A;  4JXQ A;  3R96 A;  4CRY B;  3OWC A;  4MHD A;  3PZJ A;  2AJ6 A;  1WK4 A;  4JJX A;  2CNT A;  1TIQ A;  5IV0 A;  2QIR A;  2H5M A;  1YLE A;  2ARH A;  4XPD C;  3N7Z A;  4AG9 A;  4J3G A;  4QUS A;  4Y49 B;  3CXS A;  1YGH A;  2Q0Y A;  2VXK A;  1S7L A;  3BLN A;  3FYN A;  4XNH C;  2AE6 A;  1P4N A;  4YRH A;  4HNY B;  3D3S A;  3CXQ A;  2CNS A;  2ATR A;  5E96 A;  2JEV A;  1MJB A;  4IUS A;  4ONU A;  1ON0 A;  1YR0 A;  1Q2Y A;  4JD6 A;  2PSW A;  1Z9U A;  4KOT A;  3ZZI A;  2B4B A;  3VWD A;  4U5Y A;  2BEI A;  1M4D A;  4JXR A;  4ORF A;  1M44 A;  4CAW A;  4XPD B;  4HNW B;  1S7K A;  1Z4E A;  5H86 A;  5IX3 A;  2OZU A;  2FE7 A;  2PQ8 A;  2HUZ A;  3IGR A;  3TE4 A;  4XNH B;  1B6B A;  3DDD A;  3R9G A;  3EXN A;  5F49 A;  4M85 A;  3VWE A;  1QSM A;  1U6M A;  5HH1 A;  3S6K A;  3TFY A;  3JVN A;  2OZH A;  3EC4 A;  2ZW4 A;  2B4D B;  4R3K A;  4PSX A;  2IL4 A;  2B3U A;  2Z10 A;  3TOA A;  2ZW5 A;  2J8N A;  4NF1 A;  4F6A A;  1XIX A;  3W6X A;  3S6H A;  1S3Z A;  1I21 A;  1Q2C A;  4H6U A;  1P0H A;  3BJ8 A;  4RS2 A;  1XE4 A;  4NCZ A;  4CRZ B;  4QVT A;  1Z4R A;  1QSN A;  3I3G A;  2VQY A;  1CM0 A;  3P2H A;  5JQ4 A;  3QB8 A;  4NSQ A;  3G3S A;  5FVJ A;  5H84 A;  4KVO E;  4KUA A;  3T90 A;  3TOB A;  4R87 A;  2FXF A;  2OZG A;  1NE9 A;  4HNX B;  1IID A;  4KOS A;  4X5K A;  1PUA A;  1FY7 A;  4FD7 A;  3FRM A;  1MJA A;  1MJ9 A;  3BJ7 A;  1S5K A;  4AG7 A;  2EUI A;  5F48 A;  1YK3 A;  2J8R A;  3PP9 A;  2R8V A;  1B87 A;  1Y9K A;  1I12 A;  4FD5 A;  1M4I A;  1GHE A;  3DR6 A;  3SHP A;  4AVA A;  1I1D A;  4PK2 A;  3S6G A;  3TO9 A;  2FSR A;  1IIC A;  2PDO A;  3D8P A;  1NSL A;  2K5T A;  4CAX A;  3S6F A;  1SQH A;  1Q2D A; 
#chains in the Genus database with same CATH topology
 1CG2 A;  3FNC A;  3TO7 A;  3V8I A;  1R43 A;  4OP4 A;  4K30 A;  4B5P A;  1KUV A;  3D4U A;  1HDQ A;  4MBU A;  4A95 A;  4E0A A;  1M4L A;  2BUE A;  2O53 A;  4MFL A;  2VBQ A;  1Z8L A;  4I49 A;  2AFO A;  1Y9W A;  5JPH A;  2Z3N A;  4E2A A;  4IK2 A;  2NMT A;  2ZOF A;  3PB8 X;  2WPX A;  5J8F A;  2QJ8 A;  2BCO A;  3NFZ A;  5KTC A;  2OOT A;  2Y0M A;  4KLW A;  2ZOG A;  2G3T A;  2RB7 A;  3SI2 A;  1NMT A;  4UA3 A;  2OB0 A;  3G8W A;  2C6G A;  2CY2 A;  4P45 A;  4UCM A;  1TKJ A;  4WWV A;  2EVN A;  3B7I A;  3CPA A;  4Z65 A;  4KOR A;  3P2F A;  4OAD A;  4AVC A;  1ZG9 A;  2RC4 A;  3D67 A;  2Q44 A;  4M6I A;  4WJB A;  2ZW7 A;  3ISX A;  3A9L A;  4QC6 A;  3KZW A;  2VI7 A;  5F09 A;  3PFE A;  5F47 A;  1IU8 A;  4CAF A;  3I1U A;  4XPL A;  4NJR A;  5LYD A;  2PJ3 A;  1QSO A;  2CF4 A;  2FL4 A;  2Q7S A;  2WZN A;  2CIJ A;  1LAP A;  2A4N A;  2VEZ A;  2ZEG A;  3GY9 A;  2GRE A;  3SI1 A;  4A31 A;  4UCN A;  1KUY A;  3K9U A;  4XPK A;  4ZY2 A;  4L89 A;  4BD9 A;  4RUH A;  1K4J A;  2VZZ A;  3GB0 A;  3R1K A;  2BSW A;  4H6Z A;  1S7F A;  1YRE A;  1AMP A;  4MCR A;  3T9Y A;  4C2Z A;  4TWE A;  4NXY A;  3NE7 A;  2EK9 A;  3CT9 A;  2HV2 A;  5THW A;  5IB9 A;  4PXC A;  2V8V A;  3NE8 A;  2PR8 A;  2REE A;  3GIU A;  3L2N A;  4ZGY B;  4FWU A;  1ZLH A;  4FD4 A;  5A28 A;  1Z8X A;  1YW4 A;  5DWM A;  2ZEE A;  5J8C A;  4II9 A;  1Z8W A;  2XEJ A;  3LAC A;  4NEX A;  2QML A;  2J8M A;  4UFW A;  4KZT A;  3B3W A;  2Q51 A;  5I0C A;  1IB1 E;  4UEZ A;  3FB3 A;  4JLY A;  1YVO A;  1TXR A;  3ISZ A;  3DR8 A;  4PK3 A;  1L0C A;  4NGS A;  2YNE A;  1PCA A;  2PR1 A;  1QQ9 A;  2VZY A;  4MFQ A;  3GUX A;  3IWG A;  1OBR A;  2POK A;  1IYL A;  1CJW A;  3I9S A;  1CX8 A;  4CPA A;  4DNC A;  4MFK A;  3F8K A;  4O23 A;  2ZPA A;  5GCN A;  3WR7 A;  3TCV A;  3F0A A;  1BO4 A;  5CNP A;  2HB6 A;  4ZX8 A;  4B10 A;  4KOU A;  5HMN A;  3BXM A;  1X12 A;  2EBJ A;  3TX8 A;  1XOV A;  2I3C A;  3IO1 A;  3IU2 A;  4B6Z A;  3VAT A;  1VKC A;  1FT7 A;  5HXD A;  2AFZ A;  3IWW A;  3H8E A;  2X7B A;  2CXA A;  1LOK A;  3R9F A;  3UY5 A;  4NGN A;  3IFE A;  2AFS A;  4UWI A;  5C82 A;  4NGP A;  1ZG7 A;  2EO8 A;  4KSA A;  4C7H A;  1YX0 A;  1XF8 A;  4X8I A;  2YGW A;  4KOV A;  2O4H A;  2JEW A;  3V38 A;  1JQG A;  1Y7R A;  5D29 A;  2PVW A;  3BHX A;  3K9T A;  2Z0Z A;  5CPA A;  2D4P A;  4KOX A;  3D2M A;  4RI1 A;  4YWY A;  3WC7 A;  2Q7B A;  2WSA A;  1VHE A;  4KSI A;  4MCQ A;  2PJ4 A;  4U9Y A;  1XBU A;  4BBH A;  3BI1 A;  4KSF A;  3KHZ A;  2REF A;  2AFM A;  4OC2 A;  4B5O A;  2RFH A;  2V8H A;  1LAM A;  3LD2 A;  4Y49 C;  5EC4 A;  3ZJ0 A;  4MHY A;  2J9A A;  4UFV A;  4EME A;  1QSR A;  2PRB A;  4LUA A;  5DS0 A;  5HVH A;  4YFJ A;  2B5G A;  4KVM E;  2QYV A;  4R9M A;  4GS4 A;  2F8H A;  1CPX A;  3S9L A;  4A37 A;  1S7N A;  1XEB A;  3CPX A;  3D7G A;  3PBE A;  4YGO A;  4IF5 A;  3B8G A;  5DWN A;  3VAR A;  4C2Y A;  1PU9 A;  4KLV A;  3B2Y A;  4B14 A;  3SJX A;  4DUK A;  2ZEF A;  2G3A A;  2ZEN A;  3FXT A;  4QBJ A;  1KZF A;  1Z8T A;  3GYA A;  2PJB A;  4PSW A;  5AG5 A;  3H5Z A;  4K3N A;  4OME A;  4UBR A;  1XMT A;  2GE3 A;  5K8P A;  4MJ8 A;  5F46 A;  4MY3 A;  1F2O A;  5LYL A;  1F57 A;  2C27 A;  2B58 A;  3FMC A;  3CDX A;  2Z11 A;  2DXQ A;  2R1I A;  3KR5 A;  4B12 A;  2Z3P A;  2JBK A;  4CGO A;  2R98 A;  3KKW A;  2I79 A;  3PGP A;  2O28 A;  2R7H A;  4MHN A;  3W91 A;  2GLJ A;  4R3L A;  4CYP A;  2P6G A;  1F2P A;  2DF5 A;  2YNC A;  2EK8 A;  3F5B A;  4P4D A;  5C88 A;  2GAN A;  1Q7L A;  4OAE A;  4CGM A;  3D2P A;  4DYO A;  2NSM A;  4H89 A;  1R57 A;  1ARL A;  1Z5R A;  4B5P B;  1YVK A;  4FD6 A;  3B3T A;  4KOY A;  3SJF A;  3SXO A;  3D7F A;  4LQG A;  1BLL E;  4UEE A;  2F5I A;  3S9N A;  3R95 A;  4GM5 A;  1RXT A;  1J4J A;  1S60 A;  2PRQ A;  4UWJ A;  3TO6 A;  3FED A;  3LWU A;  2QVP A;  2PC1 A;  3WT4 A;  2P6E A;  2Q4V A;  5I4M A;  4P10 A;  5A27 A;  2PJ2 A;  2ANP A;  4CS0 B;  3JUW A;  1YW6 A;  4M3S A;  4NGT A;  3TTH A;  3E0K A;  2ODF A;  3RAM A;  4OC1 A;  4R8F A;  2GIV A;  3QAH A;  2OU2 A;  4F8Z A;  4X3R A;  1QST A;  4JWP A;  5KTD A;  4EVY A;  4YU9 A;  3B3C A;  4OLL A;  5EBV A;  3H4Q A;  3GKR A;  5LYF A;  1TF8 A;  3FEE A;  4A38 A;  4A2Z A;  4P4F A;  2Q4Z A;  3SI0 A;  4B13 A;  1QMU A;  2HQY A;  1CBX A;  2C1C A;  3PB6 X;  1OZP A;  4R57 A;  3FX6 A;  4IHM A;  4MY0 A;  1IOI A;  3KL9 A;  4Q36 A;  5KTA A;  2PJ7 A;  4G1P A;  3KQX A;  4NGM A;  4QB9 A;  4F0Y A;  2OH1 A;  1VHS A;  4PXB A;  2Z3L A;  4MHP A;  1LAN A;  4U9Z A;  1XMB A;  4P6Y A;  5AGE A;  3CXP A;  2FCK A;  1ZO0 A;  3FIX A;  4X2T A;  3CZX A;  2C6C A;  3FJU A;  2JDD A;  4CAV A;  1LFW A;  1KUX A;  2I00 A;  2PCU A;  4ONW A;  2P0W A;  5JH9 A;  2B4D A;  2XEG A;  4R7M A;  3SXN A;  1Y0R A;  4MFJ A;  5ISV A;  2JLM A;  2P6F A;  4OC0 A;  3FF3 A;  4TNU A;  3JRU A;  2V8D A;  2CNM A;  4F9V A;  3LOD A;  2PJ6 A;  2G0B A;  2ZXV A;  2V77 A;  1XRY A;  4HKF A;  4PXD A;  5ELY A;  1V0C A;  3FBU A;  1WWZ A;  2PIZ A;  1BOB A;  2CTC A;  2ZEH A;  4KUB A;  3N5F A;  4L8A A;  4CYN A;  4A94 A;  4AVB A;  3C26 A;  2FS5 A;  1MK4 A;  4CAE A;  1TF9 A;  2PIY A;  1XJO A;  3W6S A;  5LYI A;  3EFA A;  4MCP A;  4PV6 A;  4AB7 A;  2FIA A;  2NYQ A;  3PB4 X;  1ARM A;  4E8O A;  5CBM A;  2YND A;  4M6G A;  4NFR A;  1M4G A;  2IQ6 A;  3DLJ A;  1A2Z A;  1HDU A;  4LX9 A;  4PPZ A;  4Q7A A;  3RYO A;  2BL1 A;  2JBJ A;  3IEH A;  2WPW A;  2D4O A;  2XEI A;  2QEC A;  5LRJ A;  2PJA A;  3R9E A;  4NGQ A;  4AG7 A;  5J1Q A;  2OR4 A;  2FT0 A;  1M1D A;  2BO9 A;  3MGD A;  3TT2 A;  2Q04 A;  3EO4 A;  1HEE A;  1LRZ A;  2YNC C;  2PJ5 A;  4MI4 A;  4ZBG A;  5HVF A;  3EY5 A;  3RO0 A;  4EFD A;  4OIW A;  2ZEL A;  4W9Y A;  2IMO A;  4KVX A;  2Q4Y A;  1ZG8 A;  5AG7 A;  5K8N A;  4UCP A;  4BMH A;  1RO5 A;  2AFX A;  2CTB A;  2KCW A;  2WUU A;  1JWQ A;  1UFH A;  2ZW6 A;  4KOW A;  5AG4 A;  1GYT A;  1N71 A;  3FEC A;  1PYT B;  2B5G B;  2ZEP A;  4PQA A;  5HVG A;  3DNS A;  4CGL A;  2XEF A;  5IB0 A;  1ZLI A;  2B3V A;  3DSB A;  4GXH A;  3VH9 A;  1CP7 A;  1IY7 A;  2JDC A;  2FIW A;  1IYK A;  1Y0Y A;  3DGV A;  4JXQ A;  3R96 A;  2Z3M A;  4CRY B;  3D66 A;  3OWC A;  5LRK A;  1VHO A;  4MHD A;  3PZJ A;  1ELL P;  3H8F A;  1KWM A;  1WK4 A;  2AJ6 A;  4FUU A;  4HPS A;  4JJX A;  5JGF A;  4C2X A;  1AYE A;  2CNT A;  3MN8 A;  5EMI A;  1TIQ A;  5G1Z A;  1VGY A;  5IV0 A;  1BPN A;  3PB9 X;  3TC8 A;  4PXE A;  3KGQ A;  3D7H A;  2QIR A;  3IU1 A;  2H5M A;  1VIX A;  4F0X A;  1YLE A;  2ARH A;  4P4J A;  4XPD C;  4ZI6 A;  3N7Z A;  4AG9 A;  4J3G A;  4QUS A;  3WC6 A;  4C68 A;  1DTD A;  2PJ0 A;  3V7Z A;  4FAI A;  3GLJ A;  3NH5 A;  5AG6 A;  3QAY A;  2AFW A;  4Y49 B;  8CPA A;  3CXS A;  1CPS A;  1Y7E A;  1YGH A;  2Q0Y A;  2VXK A;  1S7L A;  3BLN A;  3FYN A;  2Q43 A;  3IWE A;  2AE6 A;  4MRI A;  1P4N A;  4XNH C;  4YRH A;  4HNY B;  4P4B A;  1IOF A;  3H8G A;  4RN7 A;  4UEF A;  3D3S A;  3CXQ A;  1CP6 A;  2CNS A;  2ATR A;  5E96 A;  2JEV A;  3S9M A;  1RTQ A;  1MJB A;  4IUS A;  4ONU A;  1ON0 A;  1FNO A;  3D68 A;  4CGP A;  2GLF A;  1YR0 A;  1Q2Y A;  4JD6 A;  2PJ8 A;  4JZ0 A;  4NJQ A;  2PSW A;  1YME A;  3FH4 A;  4KS9 A;  1YLO A;  1Z9U A;  4KOT A;  5G21 A;  5K8O A;  1TKF A;  4B11 A;  3ZZI A;  2B4B A;  3NA6 A;  3VWD A;  4U5Y A;  2BEI A;  1M4D A;  4P4E A;  4MCS A;  4JXR A;  4ORF A;  1M44 A;  4CAW A;  2PJC A;  4XPD B;  4HNW B;  1R3N A;  1S7K A;  1Z4E A;  1UWY A;  2FVG A;  3KR4 A;  3PFO A;  5H86 A;  4AXV A;  2OZU A;  2FE7 A;  2PQ8 A;  2EWB A;  2BOA A;  2HUZ A;  2V8G A;  4UF4 A;  3IGR A;  4MFP A;  3SJE A;  3PEI A;  3KQZ A;  3SJG A;  3TE4 A;  4XNH B;  5IX3 A;  1B6B A;  5K8M A;  1X10 A;  3DDD A;  3R9G A;  3EXN A;  2HC9 A;  5F49 A;  1LCP A;  4M85 A;  1EE3 P;  3VWE A;  3IC1 A;  3RNZ A;  1QSM A;  1U6M A;  3NH4 A;  5HH1 A;  3S6K A;  4P4I A;  3TFY A;  4A33 A;  2PVV A;  4ZYQ A;  3WAB A;  3JVN A;  2OZH A;  3EC4 A;  3KI9 A;  2PJ1 A;  4A32 A;  2ZW4 A;  2B4D B;  4R3K A;  4UFX A;  4BIN A;  4PSX A;  4H2K A;  2IL4 A;  3IJ3 A;  2ZEM A;  2B3U A;  1XFO A;  2Z10 A;  3TOA A;  3K2K A;  2ZW5 A;  2J8N A;  3IIB A;  4NF1 A;  1BAV A;  1YQE A;  4OC4 A;  2Z3K A;  4F6A A;  3T8W A;  4LQ6 A;  1XIX A;  3W6X A;  3S6H A;  1S3Z A;  1I21 A;  1DE4 C;  1Q2C A;  4H6U A;  1P0H A;  3BJ8 A;  4RS2 A;  1XE4 A;  4DJL A;  1Z2L A;  4NCZ A;  4F9U A;  3NH8 A;  4CRZ B;  3KHX A;  1Z4R A;  4QVT A;  1QSN A;  4Q38 A;  4MXU A;  4MFZ A;  3JTK A;  3I3G A;  4R76 A;  2VQY A;  1CM0 A;  3P2H A;  5JQ4 A;  3QB8 A;  4A30 A;  4ZY1 A;  3D7D A;  4OC3 A;  3PBB A;  4NSQ A;  3HLP A;  5D8N A;  1NSA A;  4CYO A;  1H8L A;  3G3S A;  5FVJ A;  5H84 A;  1AUG A;  4KVO E;  4KUA A;  4JYW A;  3T90 A;  2DPT A;  4M6H A;  4R87 A;  3RZA A;  3TOB A;  1BPM A;  2DPS A;  2ABZ A;  1TKH A;  2FXF A;  3BI0 A;  2OZG A;  3HUV A;  1NE9 A;  4HNX B;  2GU2 A;  1IID A;  4UIA A;  4EWT A;  5BWA B;  2ZED A;  1ELM P;  4KOS A;  4X5K A;  1PUA A;  4OID A;  1IGB A;  3RBU A;  2ZEO A;  7CPA A;  1FY7 A;  4FD7 A;  2IJZ A;  3FRM A;  1MJA A;  1MJ9 A;  3B3V A;  3BJ7 A;  1S5K A;  3QNV A;  4MMO A;  3WC5 A;  2EUI A;  2VL1 A;  5F48 A;  1YK3 A;  2J8R A;  3PP9 A;  4NGR A;  4OC5 A;  4ZX9 A;  3KAS A;  6CPA A;  2G9D A;  2DEA A;  2R8V A;  2AFU A;  3PRT A;  4A39 A;  2PJ9 A;  1B87 A;  1Y9K A;  4C7I A;  4CYQ A;  2PE3 A;  1I12 A;  5JM6 A;  1YSJ A;  4CGN A;  4UIB A;  2WYR A;  4FD5 A;  4R6T A;  1M4I A;  4MHZ A;  1GHE A;  3DR6 A;  4OKO A;  3B35 A;  3SHP A;  3LMS A;  1I1D A;  3PB7 X;  4PK2 A;  3S6G A;  4AVA A;  3TO9 A;  2C6P A;  3B3S A;  4FBE A;  4ZY0 A;  2FSR A;  1IIC A;  2Z3O A;  2PDO A;  2F7V A;  3D8P A;  4P44 A;  5G20 A;  5G22 A;  5LRG A;  1NSL A;  2K5T A;  4IAV A;  3FVL A;  4CAX A;  3S6F A;  3MRU A;  1SQH A;  1Q2D A;  2GFQ A; 
#chains in the Genus database with same CATH homology
 3FNC A;  3TO7 A;  3V8I A;  4K30 A;  4B5P A;  1KUV A;  4MBU A;  4E0A A;  4A95 A;  2BUE A;  4MFL A;  2VBQ A;  4I49 A;  1Y9W A;  5JPH A;  2Z3N A;  4E2A A;  2NMT A;  2WPX A;  5J8F A;  5KTC A;  2Y0M A;  4KLW A;  2G3T A;  1NMT A;  4UA3 A;  2OB0 A;  3G8W A;  2CY2 A;  4UCM A;  2EVN A;  4KOR A;  3P2F A;  4OAD A;  4AVC A;  2RC4 A;  2Q44 A;  2ZW7 A;  3A9L A;  4QC6 A;  2VI7 A;  5F47 A;  4CAF A;  4XPL A;  1QSO A;  2FL4 A;  3GY9 A;  2A4N A;  2VEZ A;  4A31 A;  4UCN A;  1KUY A;  3K9U A;  4XPK A;  4L89 A;  1K4J A;  2VZZ A;  3R1K A;  2BSW A;  4H6Z A;  1S7F A;  1YRE A;  3T9Y A;  4C2Z A;  4NXY A;  3NE7 A;  2HV2 A;  2PR8 A;  2REE A;  4ZGY B;  4FD4 A;  5A28 A;  5DWM A;  5J8C A;  4II9 A;  4NEX A;  2QML A;  2J8M A;  4UFW A;  4KZT A;  5I0C A;  1IB1 E;  3FB3 A;  4JLY A;  1YVO A;  3DR8 A;  4PK3 A;  1L0C A;  2YNE A;  2PR1 A;  2VZY A;  4MFQ A;  3IWG A;  1IYL A;  1CJW A;  3I9S A;  4DNC A;  4MFK A;  3F8K A;  2ZPA A;  5GCN A;  3WR7 A;  3TCV A;  3F0A A;  1BO4 A;  5CNP A;  4B10 A;  4KOU A;  5HMN A;  3IU2 A;  1VKC A;  2X7B A;  2CXA A;  3R9F A;  3UY5 A;  4UWI A;  5C82 A;  4KSA A;  4C7H A;  1YX0 A;  1XF8 A;  2YGW A;  4KOV A;  1Y7R A;  2Z0Z A;  2D4P A;  4KOX A;  3D2M A;  4RI1 A;  2Q7B A;  2WSA A;  4U9Y A;  4KSF A;  2REF A;  4B5O A;  4Y49 C;  3LD2 A;  3ZJ0 A;  5EC4 A;  4UFV A;  1QSR A;  2PRB A;  4LUA A;  4YFJ A;  2B5G A;  4KVM E;  4R9M A;  4GS4 A;  1S7N A;  1XEB A;  4YGO A;  5DWN A;  4IF5 A;  3B8G A;  4C2Y A;  1PU9 A;  4KLV A;  4B14 A;  2G3A A;  3FXT A;  4QBJ A;  1KZF A;  3GYA A;  4PSW A;  5AG5 A;  3H5Z A;  4UBR A;  1XMT A;  2GE3 A;  4MJ8 A;  5F46 A;  4MY3 A;  2C27 A;  2B58 A;  2Z11 A;  2DXQ A;  2R1I A;  4B12 A;  2Z3P A;  4CGO A;  2R98 A;  3KKW A;  2I79 A;  3PGP A;  2O28 A;  2R7H A;  3W91 A;  4R3L A;  4CYP A;  2P6G A;  2YNC A;  3F5B A;  5C88 A;  2GAN A;  4OAE A;  4CGM A;  3D2P A;  4H89 A;  1R57 A;  4B5P B;  4FD6 A;  1YVK A;  4KOY A;  3SXO A;  2F5I A;  3R95 A;  1RXT A;  1J4J A;  1S60 A;  4UWJ A;  3TO6 A;  2PC1 A;  2P6E A;  2Q4V A;  5A27 A;  4CS0 B;  3JUW A;  4M3S A;  3TTH A;  3E0K A;  2GIV A;  3QAH A;  2OU2 A;  1QST A;  4JWP A;  5KTD A;  4EVY A;  4OLL A;  5EBV A;  3H4Q A;  3GKR A;  4A2Z A;  4B13 A;  2HQY A;  1OZP A;  4R57 A;  4MY0 A;  4Q36 A;  5KTA A;  4QB9 A;  4F0Y A;  2OH1 A;  1VHS A;  2Z3L A;  4U9Z A;  5AGE A;  3CXP A;  2FCK A;  1ZO0 A;  3FIX A;  4CAV A;  2JDD A;  1KUX A;  2I00 A;  2P0W A;  2B4D A;  3SXN A;  4MFJ A;  5ISV A;  2JLM A;  2P6F A;  2CNM A;  3LOD A;  2G0B A;  2ZXV A;  4HKF A;  1V0C A;  3FBU A;  1WWZ A;  1BOB A;  4KUB A;  4L8A A;  4CYN A;  4AVB A;  3C26 A;  2FS5 A;  1MK4 A;  4CAE A;  3W6S A;  3EFA A;  4PV6 A;  4AB7 A;  2FIA A;  4E8O A;  2YND A;  1M4G A;  4LX9 A;  3RYO A;  2BL1 A;  2WPW A;  2D4O A;  2QEC A;  3R9E A;  2FT0 A;  1M1D A;  3MGD A;  3TT2 A;  2Q04 A;  3EO4 A;  1LRZ A;  2YNC C;  4MI4 A;  4ZBG A;  3EY5 A;  4KVX A;  2Q4Y A;  5AG7 A;  4UCP A;  4BMH A;  1RO5 A;  2KCW A;  2WUU A;  1UFH A;  2ZW6 A;  5AG4 A;  4KOW A;  1N71 A;  2B5G B;  5IB0 A;  3DNS A;  4CGL A;  2B3V A;  3DSB A;  2JDC A;  2FIW A;  1IYK A;  4JXQ A;  3R96 A;  2Z3M A;  4CRY B;  3OWC A;  4MHD A;  3PZJ A;  2AJ6 A;  1WK4 A;  4JJX A;  4C2X A;  2CNT A;  1TIQ A;  5G1Z A;  5IV0 A;  2QIR A;  3IU1 A;  2H5M A;  4F0X A;  1YLE A;  2ARH A;  4XPD C;  3N7Z A;  4AG9 A;  4J3G A;  4QUS A;  4C68 A;  5AG6 A;  4Y49 B;  3CXS A;  1YGH A;  2Q0Y A;  2VXK A;  1S7L A;  3BLN A;  3FYN A;  3IWE A;  4XNH C;  2AE6 A;  1P4N A;  4YRH A;  4HNY B;  3D3S A;  3CXQ A;  2CNS A;  2ATR A;  5E96 A;  2JEV A;  1MJB A;  4IUS A;  4ONU A;  1ON0 A;  4CGP A;  1YR0 A;  1Q2Y A;  4JD6 A;  2PSW A;  4KS9 A;  1Z9U A;  5G21 A;  4KOT A;  4B11 A;  3ZZI A;  2B4B A;  3VWD A;  4U5Y A;  2BEI A;  1M4D A;  4JXR A;  4ORF A;  1M44 A;  4CAW A;  4XPD B;  4HNW B;  1S7K A;  1Z4E A;  5H86 A;  5IX3 A;  2OZU A;  2FE7 A;  2PQ8 A;  2HUZ A;  3IGR A;  4MFP A;  3TE4 A;  4XNH B;  1B6B A;  3DDD A;  3R9G A;  3EXN A;  5F49 A;  4M85 A;  3VWE A;  1QSM A;  1U6M A;  5HH1 A;  3S6K A;  3TFY A;  4A33 A;  3JVN A;  2OZH A;  3EC4 A;  4A32 A;  2ZW4 A;  2B4D B;  4R3K A;  4UFX A;  4PSX A;  2IL4 A;  2B3U A;  2Z10 A;  3TOA A;  2ZW5 A;  2J8N A;  4NF1 A;  2Z3K A;  4F6A A;  1XIX A;  3W6X A;  3S6H A;  1S3Z A;  1I21 A;  1Q2C A;  4H6U A;  1P0H A;  3BJ8 A;  4RS2 A;  1XE4 A;  4NCZ A;  4CRZ B;  4QVT A;  1Z4R A;  1QSN A;  4Q38 A;  4MFZ A;  3JTK A;  3I3G A;  2VQY A;  1CM0 A;  3P2H A;  5JQ4 A;  3QB8 A;  4A30 A;  4NSQ A;  4CYO A;  3G3S A;  5FVJ A;  5H84 A;  4KVO E;  4KUA A;  3T90 A;  2DPT A;  3TOB A;  4R87 A;  2DPS A;  2FXF A;  2OZG A;  1NE9 A;  4HNX B;  1IID A;  5BWA B;  4KOS A;  4X5K A;  1PUA A;  1FY7 A;  4FD7 A;  3FRM A;  1MJA A;  1MJ9 A;  3BJ7 A;  1S5K A;  4AG7 A;  2EUI A;  5F48 A;  1YK3 A;  2J8R A;  3PP9 A;  2R8V A;  1B87 A;  1Y9K A;  4C7I A;  4CYQ A;  1I12 A;  4CGN A;  4FD5 A;  1M4I A;  1GHE A;  3DR6 A;  3SHP A;  4AVA A;  1I1D A;  4PK2 A;  3S6G A;  3TO9 A;  2FSR A;  1IIC A;  2Z3O A;  2PDO A;  3D8P A;  5G20 A;  5G22 A;  1NSL A;  2K5T A;  4CAX A;  3S6F A;  1SQH A;  1Q2D A;  4BBH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...