2H5PA

Crystal structure of mstrawberry at ph 9.5
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
223
structure length
222
Chain Sequence
AIIKEFMRFKVRMEGSVNGHEFEIEGEGEGRPYEGTQTAKLKVTKGGPLPFAWDILTPNFSKAYVKHPADIPDYLKLSFPEGFKWERVMNFEDGGVVTVTQDSSLQDGEFIYKVKLRGTMFPSDGPVMQKKTMGWEASSERMYPEDGALKGEIKMRLKLKDGGHYDAEVKTTYKAKKPVQLPGAYIVGIKLDITSHNEDYTIVELYERAEGRHSTGGMDELY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords mStrawberry
publication title Novel Chromophores and Buried Charges Control Color in mFruits
pubmed doi rcsb
source organism Discosoma sp.
molecule tags Luminescent protein
total genus 61
structure length 222
sequence length 223
ec nomenclature
pdb deposition date 2006-05-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01353 GFP Green fluorescent protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.155.10 Mainly Beta Beta Barrel Green Fluorescent Protein Green fluorescent protein 2h5pA00
3DQJA 4ZB1A 2AHAA 4W6UA 4Q9XA 2A50B 3GL4A 3E5WA 3EVUA 4HQ9A 4IK4A 1JC0A 2H8QA 2DUFA 2Q57A 3SG7A 3ST0A 3EVVA 2HQZA 1YJ2A 3SSYA 3WCKA 2ZMUA 4XL5A 3SV5A 3SG6A 4Q7TA 1QXTA 4J89A 4KEXA 4JRBA 3CFAA 3E5VA 2G16B 4JF9A 2A47A 4LQTA 3GEXA 3BXCA 1ZGQA 3DQKA 3E5TA 3AI5A 2QLHA 1YHIA 2EMOA 4HVFA 1EMMA 4TZAA 1MOUA 4W7XA 3SVOA 1QYFA 3O77A 4KA9A 4W7EA 1JC1A 5BTTA 3EK7A 3SSLA 5DPGA 3SVEA 3VICA 2H5QA 3CGLA 4Q7RA 3NEZA 3U8AA 5EJUA 3W1DA 2HJOA 3U8CA 4W74A 2HFCA 3LF4B 1RMPA 5EHUA 1KYSA 3P8UA 3DQ8A 3UG0A 4ZIOA 3TMTA 1YJFA 1W7SA 3OSQA 5F9GA 4LJDA 4DXIA 2B3QA 3GJ2A 4IK8A 3SG2A 5H88A 3A8SA 1BFPA 1XMZA 4DKNA 2QU1A 1RMOA 3PJ5A 2ZO7A 4P1QA 2OKYA 1Q73A 3DQCA 3AKOA 2DD9A 2IB5A 1YHHA 4J88A 4HE4A 2VVIA 1OXDA 2DUGA 3DQIA 3CD9A 3H1RA 3DQ5A 3CFFA 4XGYA 3EKHA 3U0NA 2OTEA 2OGRA 5EB7A 2PXSA 3DPZA 4JEOA 3LVAA 4KF4A 2QRFA 4XOWA 5T3IA 4RTCA 2DD7A 5HZOA 3SSPA 4DXQA 2V4EA 1HCJA 3OGOA 2BTJA 3SVRA 3LSAA 4W6IA 4U2VA 5DU0A 2YE1A 5DPHA 5DTZA 4B30B 3EKJA 3AI4A 3DQ4A 3G9AA 3SS0A 3WLDA 4W7AA 4RYWA 4ZINA 1YFPA 2A56B 5DTYA 1S6ZA 2QLIA 3ZUJA 3S05A 3DQNA 2H5RA 3IP2A 4DXOA 4H3MA 2AWKA 2VAEA 4IK9A 4JC2A 1ZGPA 2G3OA 2P4MA 2EMNA 3DQ2A 3DQ9A 1KYRA 2AWJA 3M24A 4LJCA 3DQMA 4AS8A 4L13A 4I2YA 3SVCA 4OQWA 5HGEA 5EXCI 3TMRA 1YZWA 3W1CA 3U0MA 4JGEA 1EMBA 5DPJA 1ZGOA 1RM9A 3VHTB 3DQ1A 4XOVA 5FVFA 1B9CA 3BXAA 4KPIA 3LF3A 4PPKA 2Z6YA 2PXWA 4ZFSA 3ZTFA 4W72A 2O2BA 4AR7A 2QZ0A 2AWMA 2WIQA 3NT3A 2POXA 5LTQA 3EVRA 5KTGA 3SG4A 4P76A 1H4UA 3WLCA 1UISA 5FVIA 2A52B 3MGFA 2HPWA 3EVPA 3UFZA 1XAEA 1JBZA 3SVDA 4IK1A 2B3PA 4KF5C 3K1KA 3GB3A 1MOVA 4W6RA 4DXNA 3U0KA 4OGSA 1W7UA 4W7RA 4KW4A 1XA9A 4W6LA 4JFGA 1EMGA 5DRFA 5BTTB 4W6SA 1GFLA 5HW9A 2QLGB 3OSRA 5EB6A 3P28A 5BT0A 3M22A 1QYQA 3BXBA 5HZUA 2YFPA 3DQHA 4W77A 2EMDA 3U8PA 3SG3A 2QLEA 1EMAA 4W7CA 4DXMA 2GX2A 3LVDA 4W6NA 3DPXA 5DTLA 2DDDA 4W6GA 4LJDC 4IZNA 2C9JA 1Q4AA 3NEDA 4W75A 5LK4A 4L12A 3O78A 3RWAA 2A54B 2JADA 1QYOA 4W6MA 1MYWA 4W6KA 2OTBA 4GESB 4EDOA 2AWLA 3SVUA 2A53B 5DQMA 4PFEA 1Q4CA 2G6XA 4KAGA 4W73A 5HBDA 4ZF5A 4BDUA 4W6OA 2GX0A 2H9WA 4B30A 4L1IA 3RWTA 1OXFA 3NF0A 2YDZA 3H1OA 3DQLA 4LJBA 1Q4DA 5H89A 2WSNA 3PIBA 2WHTA 3PJBA 1RRXA 2V4EC 5HZTA 2V4EB 1EMFA 3BX9A 4OY4A 2HRSA 3SVSA 2Z6ZA 2Z1OA 4LW5A 4Z4MA 2Y0GA 3ST4A 3NT9A 4ANJA 2O24A 1F0BA 4W6CA 4W69A 2DUIA 2A46A 2H6VA 3ED8A 3SRYA 5DTXA 4Q7UA 3VHTA 3LA1A 4EULA 2Q6PA 5BQLA 3DQ7A 2FWQA 4XVPA 2OKWA 2ICRA 2G3DB 2FL1A 4B5YA 2ZO6A 4EDSA 1CV7A 2DDCA 2RH7A 2WSOA 4ZF3A 5EBJA 1GL4A 5FVGA 2ZMWA 3VK1A 1Q4BA 3U0LA 2A48A 4ORNA 5J2OA 2IE2A 4DKMA 3I19A 5DPIA 3SVNA 2VVHA 3DQUA 3DQEA 4W6BA 5LTRA 3SSTA 1KP5A 4H3LA 4GOBA 3DQDA 2G5ZB 4N3DA 4OJ0A 4W7FA 4Z4KA 1C4FA 2HGDA 4KF5A 1RMMA 4DXPA 3SSKA 3SSVA 4UTSA 1OXEA 1YHGA 2AH8A 3CBEA 1GGXA 2WISA 2WHSA 4RYSA 3SVBA 2QLGA 4LQUA 3GJ1A 4OHSA 3LVCA 4R6DA 3DPWA 5DY6A 3DQ3A 3EK8A 5AQBB 4W6JA 4W6TA 3ST3A 3V3DA 4Q9WA 2H5OA 1Z1QA 1KYPA 4W6PA 1G7KA 3KCTA 4R6BA 2G2SB 3DQFA 4H47A 3LS3A 3DQOA 2QT2A 2GW3A 1XQMA 4PPJA 3CD1A 5LTPA 4W6AA 4KGFA 4NWSA 4PPLA 1XSSA 1F09A 2C9IA 5FHVA 1EMCA 3EK4A 1ZUXA 3CFHA 2HCGA 3IR8A 2VZXA 2HGYA 4J8AA 1HUYA 4HQ8A 4W76A 4KGEA 3DQ6A 3SG5A 2VADA 2WHUA 5DQBA 2YE0A 2DUHA 2FZUA 1W7TA 3KCSA 5H87A 2H5PA 2Z6XA 3PJ7A 2G6EA 5DRGA 5EXUA 3ZULA 5HZSA 2IB6A 4KW9A 1QY3A 5EXBA 4W6DA 3ST2A 1Z1PA 4W6HA 4W6FA 1H6RA 4H3NA 2WURA 4H48A 3CB9A 4ZBLA 4EMQA 4GF6B 4W7DA 2HQKA 4TZGA 1EMLA 1Q4EA 3ZUFA 2O29A 2ARLA 2OJKA 1EMKA 4IK3A 4KW8A 3SSHA 3DQAA 3ADFA 4HQCA 4EN1A 2G6YA 2GW4B 2DUEA 2IOVA 2VVJA 1EMEA 1JBYA 4IK5A 4ZF4A
chains in the Genus database with same CATH superfamily
3DQJA 4ZB1A 2AHAA 4W6UA 4Q9XA 2A50B 3GL4A 3E5WA 3EVUA 4HQ9A 4IK4A 1JC0A 2H8QA 2DUFA 2Q57A 3SG7A 3ST0A 3EVVA 2HQZA 1YJ2A 3SSYA 3WCKA 2ZMUA 4XL5A 3SV5A 3SG6A 4Q7TA 1QXTA 4J89A 4KEXA 4JRBA 3CFAA 3E5VA 2G16B 4JF9A 2A47A 4LQTA 3GEXA 3BXCA 1ZGQA 3DQKA 3E5TA 3AI5A 2QLHA 1YHIA 2EMOA 4HVFA 1EMMA 4TZAA 1MOUA 4W7XA 3SVOA 1QYFA 3O77A 4KA9A 4W7EA 1JC1A 5BTTA 3EK7A 3SSLA 5DPGA 3SVEA 3VICA 2H5QA 3CGLA 4Q7RA 3NEZA 3U8AA 5EJUA 3W1DA 2HJOA 3U8CA 4W74A 2HFCA 3LF4B 1RMPA 5EHUA 1KYSA 3P8UA 3DQ8A 3UG0A 4ZIOA 3TMTA 1YJFA 1W7SA 3OSQA 5F9GA 4LJDA 4DXIA 2B3QA 3GJ2A 4IK8A 3SG2A 5H88A 3A8SA 1BFPA 1XMZA 4DKNA 2QU1A 1RMOA 3PJ5A 2ZO7A 4P1QA 2OKYA 1Q73A 3DQCA 3AKOA 2DD9A 2IB5A 1YHHA 4J88A 4HE4A 2VVIA 1OXDA 2DUGA 3DQIA 3CD9A 3H1RA 3DQ5A 3CFFA 4XGYA 3EKHA 3U0NA 2OTEA 2OGRA 5EB7A 2PXSA 3DPZA 4JEOA 3LVAA 4KF4A 2QRFA 4XOWA 5T3IA 4RTCA 2DD7A 5HZOA 3SSPA 4DXQA 2V4EA 1HCJA 3OGOA 2BTJA 3SVRA 3LSAA 4W6IA 4U2VA 5DU0A 2YE1A 5DPHA 5DTZA 4B30B 3EKJA 3AI4A 3DQ4A 3G9AA 3SS0A 3WLDA 4W7AA 4RYWA 4ZINA 1YFPA 2A56B 5DTYA 1S6ZA 2QLIA 3ZUJA 3S05A 3DQNA 2H5RA 3IP2A 4DXOA 4H3MA 2AWKA 2VAEA 4IK9A 4JC2A 1ZGPA 2G3OA 2P4MA 2EMNA 3DQ2A 3DQ9A 1KYRA 2AWJA 3M24A 4LJCA 3DQMA 4AS8A 4L13A 4I2YA 3SVCA 4OQWA 5HGEA 5EXCI 3TMRA 1YZWA 3W1CA 3U0MA 4JGEA 1EMBA 5DPJA 1ZGOA 1RM9A 3VHTB 3DQ1A 4XOVA 5FVFA 1B9CA 3BXAA 4KPIA 3LF3A 4PPKA 2Z6YA 2PXWA 4ZFSA 3ZTFA 4W72A 2O2BA 4AR7A 2QZ0A 2AWMA 2WIQA 3NT3A 2POXA 5LTQA 3EVRA 5KTGA 3SG4A 4P76A 1H4UA 3WLCA 1UISA 5FVIA 2A52B 3MGFA 2HPWA 3EVPA 3UFZA 1XAEA 1JBZA 3SVDA 4IK1A 2B3PA 4KF5C 3K1KA 3GB3A 1MOVA 4W6RA 4DXNA 3U0KA 4OGSA 1W7UA 4W7RA 4KW4A 1XA9A 4W6LA 4JFGA 1EMGA 5DRFA 5BTTB 4W6SA 1GFLA 5HW9A 2QLGB 3OSRA 5EB6A 3P28A 5BT0A 3M22A 1QYQA 3BXBA 5HZUA 2YFPA 3DQHA 4W77A 2EMDA 3U8PA 3SG3A 2QLEA 1EMAA 4W7CA 4DXMA 2GX2A 3LVDA 4W6NA 3DPXA 5DTLA 2DDDA 4W6GA 4LJDC 4IZNA 2C9JA 1Q4AA 3NEDA 4W75A 5LK4A 4L12A 3O78A 3RWAA 2A54B 2JADA 1QYOA 4W6MA 1MYWA 4W6KA 2OTBA 4GESB 4EDOA 2AWLA 3SVUA 2A53B 5DQMA 4PFEA 1Q4CA 2G6XA 4KAGA 4W73A 5HBDA 4ZF5A 4BDUA 4W6OA 2GX0A 2H9WA 4B30A 4L1IA 3RWTA 1OXFA 3NF0A 2YDZA 3H1OA 3DQLA 4LJBA 1Q4DA 5H89A 2WSNA 3PIBA 2WHTA 3PJBA 1RRXA 2V4EC 5HZTA 2V4EB 1EMFA 3BX9A 4OY4A 2HRSA 3SVSA 2Z6ZA 2Z1OA 4LW5A 4Z4MA 2Y0GA 3ST4A 3NT9A 4ANJA 2O24A 1F0BA 4W6CA 4W69A 2DUIA 2A46A 2H6VA 3ED8A 3SRYA 5DTXA 4Q7UA 3VHTA 3LA1A 4EULA 2Q6PA 5BQLA 3DQ7A 2FWQA 4XVPA 2OKWA 2ICRA 2G3DB 2FL1A 4B5YA 2ZO6A 4EDSA 1CV7A 2DDCA 2RH7A 2WSOA 4ZF3A 5EBJA 1GL4A 5FVGA 2ZMWA 3VK1A 1Q4BA 3U0LA 2A48A 4ORNA 5J2OA 2IE2A 4DKMA 3I19A 5DPIA 3SVNA 2VVHA 3DQUA 3DQEA 4W6BA 5LTRA 3SSTA 1KP5A 4H3LA 4GOBA 3DQDA 2G5ZB 4N3DA 4OJ0A 4W7FA 4Z4KA 1C4FA 2HGDA 4KF5A 1RMMA 4DXPA 3SSKA 3SSVA 4UTSA 1OXEA 1YHGA 2AH8A 3CBEA 1GGXA 2WISA 2WHSA 4RYSA 3SVBA 2QLGA 4LQUA 3GJ1A 4OHSA 3LVCA 4R6DA 3DPWA 5DY6A 3DQ3A 3EK8A 5AQBB 4W6JA 4W6TA 3ST3A 3V3DA 4Q9WA 2H5OA 1Z1QA 1KYPA 4W6PA 1G7KA 3KCTA 4R6BA 2G2SB 3DQFA 4H47A 3LS3A 3DQOA 2QT2A 2GW3A 1XQMA 4PPJA 3CD1A 5LTPA 4W6AA 4KGFA 4NWSA 4PPLA 1XSSA 1F09A 2C9IA 5FHVA 1EMCA 3EK4A 1ZUXA 3CFHA 2HCGA 3IR8A 2VZXA 2HGYA 4J8AA 1HUYA 4HQ8A 4W76A 4KGEA 3DQ6A 3SG5A 2VADA 2WHUA 5DQBA 2YE0A 2DUHA 2FZUA 1W7TA 3KCSA 5H87A 2H5PA 2Z6XA 3PJ7A 2G6EA 5DRGA 5EXUA 3ZULA 5HZSA 2IB6A 4KW9A 1QY3A 5EXBA 4W6DA 3ST2A 1Z1PA 4W6HA 4W6FA 1H6RA 4H3NA 2WURA 4H48A 3CB9A 4ZBLA 4EMQA 4GF6B 4W7DA 2HQKA 4TZGA 1EMLA 1Q4EA 3ZUFA 2O29A 2ARLA 2OJKA 1EMKA 4IK3A 4KW8A 3SSHA 3DQAA 3ADFA 4HQCA 4EN1A 2G6YA 2GW4B 2DUEA 2IOVA 2VVJA 1EMEA 1JBYA 4IK5A 4ZF4A
chains in the Genus database with same CATH topology
3DQJA 4ZB1A 2AHAA 4W6UA 4Q9XA 2A50B 3GL4A 3E5WA 3EVUA 4HQ9A 4IK4A 1JC0A 2H8QA 2DUFA 2Q57A 3SG7A 3ST0A 3EVVA 2HQZA 1YJ2A 3SSYA 3WCKA 2ZMUA 4XL5A 3SV5A 3SG6A 4Q7TA 1QXTA 4J89A 4KEXA 4JRBA 3CFAA 3E5VA 2G16B 4JF9A 2A47A 4LQTA 3GEXA 3BXCA 1ZGQA 3DQKA 3E5TA 3AI5A 2QLHA 1YHIA 2EMOA 4HVFA 1EMMA 4TZAA 1MOUA 4W7XA 3SVOA 1QYFA 3O77A 4KA9A 4W7EA 1JC1A 5BTTA 3EK7A 3SSLA 5DPGA 3SVEA 3VICA 2H5QA 3CGLA 4Q7RA 3NEZA 3U8AA 5EJUA 3W1DA 2HJOA 3U8CA 4W74A 2HFCA 3LF4B 1RMPA 5EHUA 1KYSA 3P8UA 3DQ8A 3UG0A 4ZIOA 3TMTA 1YJFA 1W7SA 3OSQA 5F9GA 4LJDA 4DXIA 2B3QA 3GJ2A 4IK8A 3SG2A 5H88A 3A8SA 1BFPA 1XMZA 4DKNA 2QU1A 1RMOA 3PJ5A 2ZO7A 4P1QA 2OKYA 1Q73A 3DQCA 3AKOA 2DD9A 2IB5A 1YHHA 4J88A 4HE4A 2VVIA 1OXDA 2DUGA 3DQIA 3CD9A 3H1RA 3DQ5A 3CFFA 4XGYA 3EKHA 3U0NA 2OTEA 2OGRA 5EB7A 2PXSA 3DPZA 4JEOA 3LVAA 4KF4A 2QRFA 4XOWA 5T3IA 4RTCA 2DD7A 5HZOA 3SSPA 4DXQA 2V4EA 1HCJA 3OGOA 2BTJA 3SVRA 3LSAA 4W6IA 4U2VA 5DU0A 2YE1A 5DPHA 5DTZA 4B30B 3EKJA 3AI4A 3DQ4A 3G9AA 3SS0A 3WLDA 4W7AA 4RYWA 4ZINA 1YFPA 2A56B 5DTYA 1S6ZA 2QLIA 3ZUJA 3S05A 3DQNA 2H5RA 3IP2A 4DXOA 4H3MA 2AWKA 2VAEA 4IK9A 4JC2A 1ZGPA 2G3OA 2P4MA 2EMNA 3DQ2A 3DQ9A 1KYRA 2AWJA 3M24A 4LJCA 3DQMA 4AS8A 4L13A 4I2YA 3SVCA 4OQWA 5HGEA 5EXCI 3TMRA 1YZWA 3W1CA 3U0MA 4JGEA 1EMBA 5DPJA 1ZGOA 1RM9A 3VHTB 3DQ1A 4XOVA 5FVFA 1B9CA 3BXAA 4KPIA 3LF3A 4PPKA 2Z6YA 2PXWA 4ZFSA 3ZTFA 4W72A 2O2BA 4AR7A 2QZ0A 2AWMA 2WIQA 3NT3A 2POXA 5LTQA 3EVRA 5KTGA 3SG4A 4P76A 1H4UA 3WLCA 1UISA 5FVIA 2A52B 3MGFA 2HPWA 3EVPA 3UFZA 1XAEA 1JBZA 3SVDA 4IK1A 2B3PA 4KF5C 3K1KA 3GB3A 1MOVA 4W6RA 4DXNA 3U0KA 4OGSA 1W7UA 4W7RA 4KW4A 1XA9A 4W6LA 4JFGA 1EMGA 5DRFA 5BTTB 4W6SA 1GFLA 5HW9A 2QLGB 3OSRA 5EB6A 3P28A 5BT0A 3M22A 1QYQA 3BXBA 5HZUA 2YFPA 3DQHA 4W77A 2EMDA 3U8PA 3SG3A 2QLEA 1EMAA 4W7CA 4DXMA 2GX2A 3LVDA 4W6NA 3DPXA 5DTLA 2DDDA 4W6GA 4LJDC 4IZNA 2C9JA 1Q4AA 3NEDA 4W75A 5LK4A 4L12A 3O78A 3RWAA 2A54B 2JADA 1QYOA 4W6MA 1MYWA 4W6KA 2OTBA 4GESB 4EDOA 2AWLA 3SVUA 2A53B 5DQMA 4PFEA 1Q4CA 2G6XA 4KAGA 4W73A 5HBDA 4ZF5A 4BDUA 4W6OA 2GX0A 2H9WA 4B30A 4L1IA 3RWTA 1OXFA 3NF0A 2YDZA 3H1OA 3DQLA 4LJBA 1Q4DA 5H89A 2WSNA 3PIBA 2WHTA 3PJBA 1RRXA 2V4EC 5HZTA 2V4EB 1EMFA 3BX9A 4OY4A 2HRSA 3SVSA 2Z6ZA 2Z1OA 4LW5A 4Z4MA 2Y0GA 3ST4A 3NT9A 4ANJA 2O24A 1F0BA 4W6CA 4W69A 2DUIA 2A46A 2H6VA 3ED8A 3SRYA 5DTXA 4Q7UA 3VHTA 3LA1A 4EULA 2Q6PA 5BQLA 3DQ7A 2FWQA 4XVPA 2OKWA 2ICRA 2G3DB 2FL1A 4B5YA 2ZO6A 4EDSA 1CV7A 2DDCA 2RH7A 2WSOA 4ZF3A 5EBJA 1GL4A 5FVGA 2ZMWA 3VK1A 1Q4BA 3U0LA 2A48A 4ORNA 5J2OA 2IE2A 4DKMA 3I19A 5DPIA 3SVNA 2VVHA 3DQUA 3DQEA 4W6BA 5LTRA 3SSTA 1KP5A 4H3LA 4GOBA 3DQDA 2G5ZB 4N3DA 4OJ0A 4W7FA 4Z4KA 1C4FA 2HGDA 4KF5A 1RMMA 4DXPA 3SSKA 3SSVA 4UTSA 1OXEA 1YHGA 2AH8A 3CBEA 1GGXA 2WISA 2WHSA 4RYSA 3SVBA 2QLGA 4LQUA 3GJ1A 4OHSA 3LVCA 4R6DA 3DPWA 5DY6A 3DQ3A 3EK8A 5AQBB 4W6JA 4W6TA 3ST3A 3V3DA 4Q9WA 2H5OA 1Z1QA 1KYPA 4W6PA 1G7KA 3KCTA 4R6BA 2G2SB 3DQFA 4H47A 3LS3A 3DQOA 2QT2A 2GW3A 1XQMA 4PPJA 3CD1A 5LTPA 4W6AA 4KGFA 4NWSA 4PPLA 1XSSA 1F09A 2C9IA 5FHVA 1EMCA 3EK4A 1ZUXA 3CFHA 2HCGA 3IR8A 2VZXA 2HGYA 4J8AA 1HUYA 4HQ8A 4W76A 4KGEA 3DQ6A 3SG5A 2VADA 2WHUA 5DQBA 2YE0A 2DUHA 2FZUA 1W7TA 3KCSA 5H87A 2H5PA 2Z6XA 3PJ7A 2G6EA 5DRGA 5EXUA 3ZULA 5HZSA 2IB6A 4KW9A 1QY3A 5EXBA 4W6DA 3ST2A 1Z1PA 4W6HA 4W6FA 1H6RA 4H3NA 2WURA 4H48A 3CB9A 4ZBLA 4EMQA 4GF6B 4W7DA 2HQKA 4TZGA 1EMLA 1Q4EA 3ZUFA 2O29A 2ARLA 2OJKA 1EMKA 4IK3A 4KW8A 3SSHA 3DQAA 3ADFA 4HQCA 4EN1A 2G6YA 2GW4B 2DUEA 2IOVA 2VVJA 1EMEA 1JBYA 4IK5A 4ZF4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3DQJ A;  4ZB1 A;  2AHA A;  4W6U A;  4Q9X A;  2A50 B;  3GL4 A;  3E5W A;  3EVU A;  4HQ9 A;  4IK4 A;  1JC0 A;  2H8Q A;  2DUF A;  2Q57 A;  3SG7 A;  3ST0 A;  3EVV A;  2HQZ A;  1YJ2 A;  3SSY A;  3WCK A;  2ZMU A;  4XL5 A;  3SV5 A;  3SG6 A;  4Q7T A;  1QXT A;  4J89 A;  4KEX A;  4JRB A;  3CFA A;  3E5V A;  2G16 B;  4JF9 A;  2A47 A;  4LQT A;  3GEX A;  3BXC A;  1ZGQ A;  3DQK A;  3E5T A;  3AI5 A;  2QLH A;  1YHI A;  2EMO A;  4HVF A;  1EMM A;  4TZA A;  1MOU A;  4W7X A;  3SVO A;  1QYF A;  3O77 A;  4KA9 A;  4W7E A;  1JC1 A;  5BTT A;  3EK7 A;  3SSL A;  5DPG A;  3SVE A;  3VIC A;  2H5Q A;  3CGL A;  4Q7R A;  3NEZ A;  3U8A A;  5EJU A;  3W1D A;  2HJO A;  3U8C A;  4W74 A;  2HFC A;  3LF4 B;  1RMP A;  5EHU A;  1KYS A;  3P8U A;  3DQ8 A;  3UG0 A;  4ZIO A;  3TMT A;  1YJF A;  1W7S A;  3OSQ A;  5F9G A;  4LJD A;  4DXI A;  2B3Q A;  3GJ2 A;  4IK8 A;  3SG2 A;  5H88 A;  3A8S A;  1BFP A;  1XMZ A;  4DKN A;  2QU1 A;  1RMO A;  3PJ5 A;  2ZO7 A;  4P1Q A;  2OKY A;  1Q73 A;  3DQC A;  3AKO A;  2DD9 A;  2IB5 A;  1YHH A;  4J88 A;  4HE4 A;  2VVI A;  1OXD A;  2DUG A;  3DQI A;  3CD9 A;  3H1R A;  3DQ5 A;  3CFF A;  4XGY A;  3EKH A;  3U0N A;  2OTE A;  2OGR A;  5EB7 A;  2PXS A;  3DPZ A;  4JEO A;  3LVA A;  4KF4 A;  2QRF A;  4XOW A;  5T3I A;  4RTC A;  2DD7 A;  5HZO A;  3SSP A;  4DXQ A;  2V4E A;  1HCJ A;  3OGO A;  2BTJ A;  3SVR A;  3LSA A;  4W6I A;  4U2V A;  5DU0 A;  2YE1 A;  5DPH A;  5DTZ A;  4B30 B;  3EKJ A;  3AI4 A;  3DQ4 A;  3G9A A;  3SS0 A;  3WLD A;  4W7A A;  4RYW A;  4ZIN A;  1YFP A;  2A56 B;  5DTY A;  1S6Z A;  2QLI A;  3ZUJ A;  3S05 A;  3DQN A;  2H5R A;  3IP2 A;  4DXO A;  4H3M A;  2AWK A;  2VAE A;  4IK9 A;  4JC2 A;  1ZGP A;  2G3O A;  2P4M A;  2EMN A;  3DQ2 A;  3DQ9 A;  1KYR A;  2AWJ A;  3M24 A;  4LJC A;  3DQM A;  4AS8 A;  4L13 A;  4I2Y A;  3SVC A;  4OQW A;  5HGE A;  5EXC I;  3TMR A;  1YZW A;  3W1C A;  3U0M A;  4JGE A;  1EMB A;  5DPJ A;  1ZGO A;  1RM9 A;  3VHT B;  3DQ1 A;  4XOV A;  5FVF A;  1B9C A;  3BXA A;  4KPI A;  3LF3 A;  4PPK A;  2Z6Y A;  2PXW A;  4ZFS A;  3ZTF A;  4W72 A;  2O2B A;  4AR7 A;  2QZ0 A;  2AWM A;  2WIQ A;  3NT3 A;  2POX A;  5LTQ A;  3EVR A;  5KTG A;  3SG4 A;  4P76 A;  1H4U A;  3WLC A;  1UIS A;  5FVI A;  2A52 B;  3MGF A;  2HPW A;  3EVP A;  3UFZ A;  1XAE A;  1JBZ A;  3SVD A;  4IK1 A;  2B3P A;  4KF5 C;  3K1K A;  3GB3 A;  1MOV A;  4W6R A;  4DXN A;  3U0K A;  4OGS A;  1W7U A;  4W7R A;  4KW4 A;  1XA9 A;  4W6L A;  4JFG A;  1EMG A;  5DRF A;  5BTT B;  4W6S A;  1GFL A;  5HW9 A;  2QLG B;  3OSR A;  5EB6 A;  3P28 A;  5BT0 A;  3M22 A;  1QYQ A;  3BXB A;  5HZU A;  2YFP A;  3DQH A;  4W77 A;  2EMD A;  3U8P A;  3SG3 A;  2QLE A;  1EMA A;  4W7C A;  4DXM A;  2GX2 A;  3LVD A;  4W6N A;  3DPX A;  5DTL A;  2DDD A;  4W6G A;  4LJD C;  4IZN A;  2C9J A;  1Q4A A;  3NED A;  4W75 A;  5LK4 A;  4L12 A;  3O78 A;  3RWA A;  2A54 B;  2JAD A;  1QYO A;  4W6M A;  1MYW A;  4W6K A;  2OTB A;  4GES B;  4EDO A;  2AWL A;  3SVU A;  2A53 B;  5DQM A;  4PFE A;  1Q4C A;  2G6X A;  4KAG A;  4W73 A;  5HBD A;  4ZF5 A;  4BDU A;  4W6O A;  2GX0 A;  2H9W A;  4B30 A;  4L1I A;  3RWT A;  1OXF A;  3NF0 A;  2YDZ A;  3H1O A;  3DQL A;  4LJB A;  1Q4D A;  5H89 A;  2WSN A;  3PIB A;  2WHT A;  3PJB A;  1RRX A;  2V4E C;  5HZT A;  2V4E B;  1EMF A;  3BX9 A;  4OY4 A;  2HRS A;  3SVS A;  2Z6Z A;  2Z1O A;  4LW5 A;  4Z4M A;  2Y0G A;  3ST4 A;  3NT9 A;  4ANJ A;  2O24 A;  1F0B A;  4W6C A;  4W69 A;  2DUI A;  2A46 A;  2H6V A;  3ED8 A;  3SRY A;  5DTX A;  4Q7U A;  3VHT A;  3LA1 A;  4EUL A;  2Q6P A;  5BQL A;  3DQ7 A;  2FWQ A;  4XVP A;  2OKW A;  2ICR A;  2G3D B;  2FL1 A;  4B5Y A;  2ZO6 A;  4EDS A;  1CV7 A;  2DDC A;  2RH7 A;  2WSO A;  4ZF3 A;  5EBJ A;  1GL4 A;  5FVG A;  2ZMW A;  3VK1 A;  1Q4B A;  3U0L A;  2A48 A;  4ORN A;  5J2O A;  2IE2 A;  4DKM A;  3I19 A;  5DPI A;  3SVN A;  2VVH A;  3DQU A;  3DQE A;  4W6B A;  5LTR A;  3SST A;  1KP5 A;  4H3L A;  4GOB A;  3DQD A;  2G5Z B;  4N3D A;  4OJ0 A;  4W7F A;  4Z4K A;  1C4F A;  2HGD A;  4KF5 A;  1RMM A;  4DXP A;  3SSK A;  3SSV A;  4UTS A;  1OXE A;  1YHG A;  2AH8 A;  3CBE A;  1GGX A;  2WIS A;  2WHS A;  4RYS A;  3SVB A;  2QLG A;  4LQU A;  3GJ1 A;  4OHS A;  3LVC A;  4R6D A;  3DPW A;  5DY6 A;  3DQ3 A;  3EK8 A;  5AQB B;  4W6J A;  4W6T A;  3ST3 A;  3V3D A;  4Q9W A;  2H5O A;  1Z1Q A;  1KYP A;  4W6P A;  1G7K A;  3KCT A;  4R6B A;  2G2S B;  3DQF A;  4H47 A;  3LS3 A;  3DQO A;  2QT2 A;  2GW3 A;  1XQM A;  4PPJ A;  3CD1 A;  5LTP A;  4W6A A;  4KGF A;  4NWS A;  4PPL A;  1XSS A;  1F09 A;  2C9I A;  5FHV A;  1EMC A;  3EK4 A;  1ZUX A;  3CFH A;  2HCG A;  3IR8 A;  2VZX A;  2HGY A;  4J8A A;  1HUY A;  4HQ8 A;  4W76 A;  4KGE A;  3DQ6 A;  3SG5 A;  2VAD A;  2WHU A;  5DQB A;  2YE0 A;  2DUH A;  2FZU A;  1W7T A;  3KCS A;  5H87 A;  2H5P A;  2Z6X A;  3PJ7 A;  2G6E A;  5DRG A;  5EXU A;  3ZUL A;  5HZS A;  2IB6 A;  4KW9 A;  1QY3 A;  5EXB A;  4W6D A;  3ST2 A;  1Z1P A;  4W6H A;  4W6F A;  1H6R A;  4H3N A;  2WUR A;  4H48 A;  3CB9 A;  4ZBL A;  4EMQ A;  4GF6 B;  4W7D A;  2HQK A;  4TZG A;  1EML A;  1Q4E A;  3ZUF A;  2O29 A;  2ARL A;  2OJK A;  1EMK A;  4IK3 A;  4KW8 A;  3SSH A;  3DQA A;  3ADF A;  4HQC A;  4EN1 A;  2G6Y A;  2GW4 B;  2DUE A;  2IOV A;  2VVJ A;  1EME A;  1JBY A;  4IK5 A;  4ZF4 A; 
#chains in the Genus database with same CATH topology
 3DQJ A;  4ZB1 A;  2AHA A;  4W6U A;  4Q9X A;  2A50 B;  3GL4 A;  3E5W A;  3EVU A;  4HQ9 A;  4IK4 A;  1JC0 A;  2H8Q A;  2DUF A;  2Q57 A;  3SG7 A;  3ST0 A;  3EVV A;  2HQZ A;  1YJ2 A;  3SSY A;  3WCK A;  2ZMU A;  4XL5 A;  3SV5 A;  3SG6 A;  4Q7T A;  1QXT A;  4J89 A;  4KEX A;  4JRB A;  3CFA A;  3E5V A;  2G16 B;  4JF9 A;  2A47 A;  4LQT A;  3GEX A;  3BXC A;  1ZGQ A;  3DQK A;  3E5T A;  3AI5 A;  2QLH A;  1YHI A;  2EMO A;  4HVF A;  1EMM A;  4TZA A;  1MOU A;  4W7X A;  3SVO A;  1QYF A;  3O77 A;  4KA9 A;  4W7E A;  1JC1 A;  5BTT A;  3EK7 A;  3SSL A;  5DPG A;  3SVE A;  3VIC A;  2H5Q A;  3CGL A;  4Q7R A;  3NEZ A;  3U8A A;  5EJU A;  3W1D A;  2HJO A;  3U8C A;  4W74 A;  2HFC A;  3LF4 B;  1RMP A;  5EHU A;  1KYS A;  3P8U A;  3DQ8 A;  3UG0 A;  4ZIO A;  3TMT A;  1YJF A;  1W7S A;  3OSQ A;  5F9G A;  4LJD A;  4DXI A;  2B3Q A;  3GJ2 A;  4IK8 A;  3SG2 A;  5H88 A;  3A8S A;  1BFP A;  1XMZ A;  4DKN A;  2QU1 A;  1RMO A;  3PJ5 A;  2ZO7 A;  4P1Q A;  2OKY A;  1Q73 A;  3DQC A;  3AKO A;  2DD9 A;  2IB5 A;  1YHH A;  4J88 A;  4HE4 A;  2VVI A;  1OXD A;  2DUG A;  3DQI A;  3CD9 A;  3H1R A;  3DQ5 A;  3CFF A;  4XGY A;  3EKH A;  3U0N A;  2OTE A;  2OGR A;  5EB7 A;  2PXS A;  3DPZ A;  4JEO A;  3LVA A;  4KF4 A;  2QRF A;  4XOW A;  5T3I A;  4RTC A;  2DD7 A;  5HZO A;  3SSP A;  4DXQ A;  2V4E A;  1HCJ A;  3OGO A;  2BTJ A;  3SVR A;  3LSA A;  4W6I A;  4U2V A;  5DU0 A;  2YE1 A;  5DPH A;  5DTZ A;  4B30 B;  3EKJ A;  3AI4 A;  3DQ4 A;  3G9A A;  3SS0 A;  3WLD A;  4W7A A;  4RYW A;  4ZIN A;  1YFP A;  2A56 B;  5DTY A;  1S6Z A;  2QLI A;  3ZUJ A;  3S05 A;  3DQN A;  2H5R A;  3IP2 A;  4DXO A;  4H3M A;  2AWK A;  2VAE A;  4IK9 A;  4JC2 A;  1ZGP A;  2G3O A;  2P4M A;  2EMN A;  3DQ2 A;  3DQ9 A;  1KYR A;  2AWJ A;  3M24 A;  4LJC A;  3DQM A;  4AS8 A;  4L13 A;  4I2Y A;  3SVC A;  4OQW A;  5HGE A;  5EXC I;  3TMR A;  1YZW A;  3W1C A;  3U0M A;  4JGE A;  1EMB A;  5DPJ A;  1ZGO A;  1RM9 A;  3VHT B;  3DQ1 A;  4XOV A;  5FVF A;  1B9C A;  3BXA A;  4KPI A;  3LF3 A;  4PPK A;  2Z6Y A;  2PXW A;  4ZFS A;  3ZTF A;  4W72 A;  2O2B A;  4AR7 A;  2QZ0 A;  2AWM A;  2WIQ A;  3NT3 A;  2POX A;  5LTQ A;  3EVR A;  5KTG A;  3SG4 A;  4P76 A;  1H4U A;  3WLC A;  1UIS A;  5FVI A;  2A52 B;  3MGF A;  2HPW A;  3EVP A;  3UFZ A;  1XAE A;  1JBZ A;  3SVD A;  4IK1 A;  2B3P A;  4KF5 C;  3K1K A;  3GB3 A;  1MOV A;  4W6R A;  4DXN A;  3U0K A;  4OGS A;  1W7U A;  4W7R A;  4KW4 A;  1XA9 A;  4W6L A;  4JFG A;  1EMG A;  5DRF A;  5BTT B;  4W6S A;  1GFL A;  5HW9 A;  2QLG B;  3OSR A;  5EB6 A;  3P28 A;  5BT0 A;  3M22 A;  1QYQ A;  3BXB A;  5HZU A;  2YFP A;  3DQH A;  4W77 A;  2EMD A;  3U8P A;  3SG3 A;  2QLE A;  1EMA A;  4W7C A;  4DXM A;  2GX2 A;  3LVD A;  4W6N A;  3DPX A;  5DTL A;  2DDD A;  4W6G A;  4LJD C;  4IZN A;  2C9J A;  1Q4A A;  3NED A;  4W75 A;  5LK4 A;  4L12 A;  3O78 A;  3RWA A;  2A54 B;  2JAD A;  1QYO A;  4W6M A;  1MYW A;  4W6K A;  2OTB A;  4GES B;  4EDO A;  2AWL A;  3SVU A;  2A53 B;  5DQM A;  4PFE A;  1Q4C A;  2G6X A;  4KAG A;  4W73 A;  5HBD A;  4ZF5 A;  4BDU A;  4W6O A;  2GX0 A;  2H9W A;  4B30 A;  4L1I A;  3RWT A;  1OXF A;  3NF0 A;  2YDZ A;  3H1O A;  3DQL A;  4LJB A;  1Q4D A;  5H89 A;  2WSN A;  3PIB A;  2WHT A;  3PJB A;  1RRX A;  2V4E C;  5HZT A;  2V4E B;  1EMF A;  3BX9 A;  4OY4 A;  2HRS A;  3SVS A;  2Z6Z A;  2Z1O A;  4LW5 A;  4Z4M A;  2Y0G A;  3ST4 A;  3NT9 A;  4ANJ A;  2O24 A;  1F0B A;  4W6C A;  4W69 A;  2DUI A;  2A46 A;  2H6V A;  3ED8 A;  3SRY A;  5DTX A;  4Q7U A;  3VHT A;  3LA1 A;  4EUL A;  2Q6P A;  5BQL A;  3DQ7 A;  2FWQ A;  4XVP A;  2OKW A;  2ICR A;  2G3D B;  2FL1 A;  4B5Y A;  2ZO6 A;  4EDS A;  1CV7 A;  2DDC A;  2RH7 A;  2WSO A;  4ZF3 A;  5EBJ A;  1GL4 A;  5FVG A;  2ZMW A;  3VK1 A;  1Q4B A;  3U0L A;  2A48 A;  4ORN A;  5J2O A;  2IE2 A;  4DKM A;  3I19 A;  5DPI A;  3SVN A;  2VVH A;  3DQU A;  3DQE A;  4W6B A;  5LTR A;  3SST A;  1KP5 A;  4H3L A;  4GOB A;  3DQD A;  2G5Z B;  4N3D A;  4OJ0 A;  4W7F A;  4Z4K A;  1C4F A;  2HGD A;  4KF5 A;  1RMM A;  4DXP A;  3SSK A;  3SSV A;  4UTS A;  1OXE A;  1YHG A;  2AH8 A;  3CBE A;  1GGX A;  2WIS A;  2WHS A;  4RYS A;  3SVB A;  2QLG A;  4LQU A;  3GJ1 A;  4OHS A;  3LVC A;  4R6D A;  3DPW A;  5DY6 A;  3DQ3 A;  3EK8 A;  5AQB B;  4W6J A;  4W6T A;  3ST3 A;  3V3D A;  4Q9W A;  2H5O A;  1Z1Q A;  1KYP A;  4W6P A;  1G7K A;  3KCT A;  4R6B A;  2G2S B;  3DQF A;  4H47 A;  3LS3 A;  3DQO A;  2QT2 A;  2GW3 A;  1XQM A;  4PPJ A;  3CD1 A;  5LTP A;  4W6A A;  4KGF A;  4NWS A;  4PPL A;  1XSS A;  1F09 A;  2C9I A;  5FHV A;  1EMC A;  3EK4 A;  1ZUX A;  3CFH A;  2HCG A;  3IR8 A;  2VZX A;  2HGY A;  4J8A A;  1HUY A;  4HQ8 A;  4W76 A;  4KGE A;  3DQ6 A;  3SG5 A;  2VAD A;  2WHU A;  5DQB A;  2YE0 A;  2DUH A;  2FZU A;  1W7T A;  3KCS A;  5H87 A;  2H5P A;  2Z6X A;  3PJ7 A;  2G6E A;  5DRG A;  5EXU A;  3ZUL A;  5HZS A;  2IB6 A;  4KW9 A;  1QY3 A;  5EXB A;  4W6D A;  3ST2 A;  1Z1P A;  4W6H A;  4W6F A;  1H6R A;  4H3N A;  2WUR A;  4H48 A;  3CB9 A;  4ZBL A;  4EMQ A;  4GF6 B;  4W7D A;  2HQK A;  4TZG A;  1EML A;  1Q4E A;  3ZUF A;  2O29 A;  2ARL A;  2OJK A;  1EMK A;  4IK3 A;  4KW8 A;  3SSH A;  3DQA A;  3ADF A;  4HQC A;  4EN1 A;  2G6Y A;  2GW4 B;  2DUE A;  2IOV A;  2VVJ A;  1EME A;  1JBY A;  4IK5 A;  4ZF4 A; 
#chains in the Genus database with same CATH homology
 3DQJ A;  4ZB1 A;  2AHA A;  4W6U A;  4Q9X A;  2A50 B;  3GL4 A;  3E5W A;  3EVU A;  4HQ9 A;  4IK4 A;  1JC0 A;  2H8Q A;  2DUF A;  2Q57 A;  3SG7 A;  3ST0 A;  3EVV A;  2HQZ A;  1YJ2 A;  3SSY A;  3WCK A;  2ZMU A;  4XL5 A;  3SV5 A;  3SG6 A;  4Q7T A;  1QXT A;  4J89 A;  4KEX A;  4JRB A;  3CFA A;  3E5V A;  2G16 B;  4JF9 A;  2A47 A;  4LQT A;  3GEX A;  3BXC A;  1ZGQ A;  3DQK A;  3E5T A;  3AI5 A;  2QLH A;  1YHI A;  2EMO A;  4HVF A;  1EMM A;  4TZA A;  1MOU A;  4W7X A;  3SVO A;  1QYF A;  3O77 A;  4KA9 A;  4W7E A;  1JC1 A;  5BTT A;  3EK7 A;  3SSL A;  5DPG A;  3SVE A;  3VIC A;  2H5Q A;  3CGL A;  4Q7R A;  3NEZ A;  3U8A A;  5EJU A;  3W1D A;  2HJO A;  3U8C A;  4W74 A;  2HFC A;  3LF4 B;  1RMP A;  5EHU A;  1KYS A;  3P8U A;  3DQ8 A;  3UG0 A;  4ZIO A;  3TMT A;  1YJF A;  1W7S A;  3OSQ A;  5F9G A;  4LJD A;  4DXI A;  2B3Q A;  3GJ2 A;  4IK8 A;  3SG2 A;  5H88 A;  3A8S A;  1BFP A;  1XMZ A;  4DKN A;  2QU1 A;  1RMO A;  3PJ5 A;  2ZO7 A;  4P1Q A;  2OKY A;  1Q73 A;  3DQC A;  3AKO A;  2DD9 A;  2IB5 A;  1YHH A;  4J88 A;  4HE4 A;  2VVI A;  1OXD A;  2DUG A;  3DQI A;  3CD9 A;  3H1R A;  3DQ5 A;  3CFF A;  4XGY A;  3EKH A;  3U0N A;  2OTE A;  2OGR A;  5EB7 A;  2PXS A;  3DPZ A;  4JEO A;  3LVA A;  4KF4 A;  2QRF A;  4XOW A;  5T3I A;  4RTC A;  2DD7 A;  5HZO A;  3SSP A;  4DXQ A;  2V4E A;  1HCJ A;  3OGO A;  2BTJ A;  3SVR A;  3LSA A;  4W6I A;  4U2V A;  5DU0 A;  2YE1 A;  5DPH A;  5DTZ A;  4B30 B;  3EKJ A;  3AI4 A;  3DQ4 A;  3G9A A;  3SS0 A;  3WLD A;  4W7A A;  4RYW A;  4ZIN A;  1YFP A;  2A56 B;  5DTY A;  1S6Z A;  2QLI A;  3ZUJ A;  3S05 A;  3DQN A;  2H5R A;  3IP2 A;  4DXO A;  4H3M A;  2AWK A;  2VAE A;  4IK9 A;  4JC2 A;  1ZGP A;  2G3O A;  2P4M A;  2EMN A;  3DQ2 A;  3DQ9 A;  1KYR A;  2AWJ A;  3M24 A;  4LJC A;  3DQM A;  4AS8 A;  4L13 A;  4I2Y A;  3SVC A;  4OQW A;  5HGE A;  5EXC I;  3TMR A;  1YZW A;  3W1C A;  3U0M A;  4JGE A;  1EMB A;  5DPJ A;  1ZGO A;  1RM9 A;  3VHT B;  3DQ1 A;  4XOV A;  5FVF A;  1B9C A;  3BXA A;  4KPI A;  3LF3 A;  4PPK A;  2Z6Y A;  2PXW A;  4ZFS A;  3ZTF A;  4W72 A;  2O2B A;  4AR7 A;  2QZ0 A;  2AWM A;  2WIQ A;  3NT3 A;  2POX A;  5LTQ A;  3EVR A;  5KTG A;  3SG4 A;  4P76 A;  1H4U A;  3WLC A;  1UIS A;  5FVI A;  2A52 B;  3MGF A;  2HPW A;  3EVP A;  3UFZ A;  1XAE A;  1JBZ A;  3SVD A;  4IK1 A;  2B3P A;  4KF5 C;  3K1K A;  3GB3 A;  1MOV A;  4W6R A;  4DXN A;  3U0K A;  4OGS A;  1W7U A;  4W7R A;  4KW4 A;  1XA9 A;  4W6L A;  4JFG A;  1EMG A;  5DRF A;  5BTT B;  4W6S A;  1GFL A;  5HW9 A;  2QLG B;  3OSR A;  5EB6 A;  3P28 A;  5BT0 A;  3M22 A;  1QYQ A;  3BXB A;  5HZU A;  2YFP A;  3DQH A;  4W77 A;  2EMD A;  3U8P A;  3SG3 A;  2QLE A;  1EMA A;  4W7C A;  4DXM A;  2GX2 A;  3LVD A;  4W6N A;  3DPX A;  5DTL A;  2DDD A;  4W6G A;  4LJD C;  4IZN A;  2C9J A;  1Q4A A;  3NED A;  4W75 A;  5LK4 A;  4L12 A;  3O78 A;  3RWA A;  2A54 B;  2JAD A;  1QYO A;  4W6M A;  1MYW A;  4W6K A;  2OTB A;  4GES B;  4EDO A;  2AWL A;  3SVU A;  2A53 B;  5DQM A;  4PFE A;  1Q4C A;  2G6X A;  4KAG A;  4W73 A;  5HBD A;  4ZF5 A;  4BDU A;  4W6O A;  2GX0 A;  2H9W A;  4B30 A;  4L1I A;  3RWT A;  1OXF A;  3NF0 A;  2YDZ A;  3H1O A;  3DQL A;  4LJB A;  1Q4D A;  5H89 A;  2WSN A;  3PIB A;  2WHT A;  3PJB A;  1RRX A;  2V4E C;  5HZT A;  2V4E B;  1EMF A;  3BX9 A;  4OY4 A;  2HRS A;  3SVS A;  2Z6Z A;  2Z1O A;  4LW5 A;  4Z4M A;  2Y0G A;  3ST4 A;  3NT9 A;  4ANJ A;  2O24 A;  1F0B A;  4W6C A;  4W69 A;  2DUI A;  2A46 A;  2H6V A;  3ED8 A;  3SRY A;  5DTX A;  4Q7U A;  3VHT A;  3LA1 A;  4EUL A;  2Q6P A;  5BQL A;  3DQ7 A;  2FWQ A;  4XVP A;  2OKW A;  2ICR A;  2G3D B;  2FL1 A;  4B5Y A;  2ZO6 A;  4EDS A;  1CV7 A;  2DDC A;  2RH7 A;  2WSO A;  4ZF3 A;  5EBJ A;  1GL4 A;  5FVG A;  2ZMW A;  3VK1 A;  1Q4B A;  3U0L A;  2A48 A;  4ORN A;  5J2O A;  2IE2 A;  4DKM A;  3I19 A;  5DPI A;  3SVN A;  2VVH A;  3DQU A;  3DQE A;  4W6B A;  5LTR A;  3SST A;  1KP5 A;  4H3L A;  4GOB A;  3DQD A;  2G5Z B;  4N3D A;  4OJ0 A;  4W7F A;  4Z4K A;  1C4F A;  2HGD A;  4KF5 A;  1RMM A;  4DXP A;  3SSK A;  3SSV A;  4UTS A;  1OXE A;  1YHG A;  2AH8 A;  3CBE A;  1GGX A;  2WIS A;  2WHS A;  4RYS A;  3SVB A;  2QLG A;  4LQU A;  3GJ1 A;  4OHS A;  3LVC A;  4R6D A;  3DPW A;  5DY6 A;  3DQ3 A;  3EK8 A;  5AQB B;  4W6J A;  4W6T A;  3ST3 A;  3V3D A;  4Q9W A;  2H5O A;  1Z1Q A;  1KYP A;  4W6P A;  1G7K A;  3KCT A;  4R6B A;  2G2S B;  3DQF A;  4H47 A;  3LS3 A;  3DQO A;  2QT2 A;  2GW3 A;  1XQM A;  4PPJ A;  3CD1 A;  5LTP A;  4W6A A;  4KGF A;  4NWS A;  4PPL A;  1XSS A;  1F09 A;  2C9I A;  5FHV A;  1EMC A;  3EK4 A;  1ZUX A;  3CFH A;  2HCG A;  3IR8 A;  2VZX A;  2HGY A;  4J8A A;  1HUY A;  4HQ8 A;  4W76 A;  4KGE A;  3DQ6 A;  3SG5 A;  2VAD A;  2WHU A;  5DQB A;  2YE0 A;  2DUH A;  2FZU A;  1W7T A;  3KCS A;  5H87 A;  2H5P A;  2Z6X A;  3PJ7 A;  2G6E A;  5DRG A;  5EXU A;  3ZUL A;  5HZS A;  2IB6 A;  4KW9 A;  1QY3 A;  5EXB A;  4W6D A;  3ST2 A;  1Z1P A;  4W6H A;  4W6F A;  1H6R A;  4H3N A;  2WUR A;  4H48 A;  3CB9 A;  4ZBL A;  4EMQ A;  4GF6 B;  4W7D A;  2HQK A;  4TZG A;  1EML A;  1Q4E A;  3ZUF A;  2O29 A;  2ARL A;  2OJK A;  1EMK A;  4IK3 A;  4KW8 A;  3SSH A;  3DQA A;  3ADF A;  4HQC A;  4EN1 A;  2G6Y A;  2GW4 B;  2DUE A;  2IOV A;  2VVJ A;  1EME A;  1JBY A;  4IK5 A;  4ZF4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...