2H5XA

Ruva from mycobacterium tuberculosis
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
195
structure length
183
Chain Sequence
MIASVRGEVLEVALDHVVIEAAGVGYRVNATPATLATLRQGTEARLITAMIVREDSMTLYGFPDGETRDLFLTLLSVSGVGPRLAMAALAVHDAPALRQVLADGNVAALTRVPGIGKRGAERMVLELRDKVGVAVRSPVVEALVGLGFAAKQAEEATDTVLAANHDATTSSALRSALSLLGKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Holliday junction ATP-dependent DNA helicase ruvA
publication title Structure of Mycobacterium tuberculosis RuvA, a protein involved in recombination.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Dna binding protein
total genus 43
structure length 183
sequence length 195
chains with identical sequence B, C, D
ec nomenclature ec 3.6.4.12: DNA helicase.
pdb deposition date 2006-05-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01330 RuvA_N RuvA N terminal domain
A PF07499 RuvA_C RuvA, C-terminal domain
A PF14520 HHH_5 Helix-hairpin-helix domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.10 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 DNA helicase RuvA subunit, C-terminal domain 2h5xA03
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 2h5xA02
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 2h5xA01
3F1ZA 3KOJA 7ICPA 3KYHC 1CUKA 4POFA 2HHUA 1S3OA 2IHNA 2JEBI 4RPYA 1ZQCA 1LV5A 8ICWA 1NJWA 4A3KG 1X3FA 7ICMA 4DR4L 4GXIA 2WFWA 4JC0A 4LWCA 4O3PA 1PFSA 3LGJA 2MR9A 4RPXA 3GTJH 1ZMUA 2LTUA 1Q8KA 2ALZA 4A3GG 5BPCA 2HHWA 3S24A 4GLVB 1COOA 1JXEA 4R66A 4DV0L 2PI5A 2PNHA 1MJEA 4YCXA 1QVFA 3N4MB 1IZ6A 3AUOA 8ICAA 5JJIA 2HAKA 1G51A 1Z47A 4RQ6A 4P2HA 2VQEQ 1GO3E 1WCMH 1QZGA 3S15H 4WP2A 2K52A 2DAMA 7ICGA 5DKWA 3LDAA 3S1MH 2OCEA 2YV5A 4KLIA 4ECVA 4A3EH 1BGXT 1UT5A 3ULLA 4PGYA 3Q8PB 5DBCA 4EBCA 4GKKQ 1XNRL 4M6WB 4RT3A 3GD7A 1NV8A 1YIJA 3TAPA 4R4QA 1NK6A 4DR5L 2C2DA 2R92G 4J15A 1U45A 4C8KA 5J2JA 1PH9A 3KF6B 2HT1A 2N49A 5DG9A 1T6OA 3PO3G 2ZJQA 4O9MA 3H8JA 1TVAA 4UP8A 5KT4A 4RNMA 5C0XI 1VQCA 3M8SA 1PA6A 4A3JG 4F4XA 2EXDA 4JI0Q 4A3GH 2PQAB 1TV9A 4DQIA 1B43A 1HNWL 5KG4A 1BPZA 3K9OA 2ZJ5A 3QE9Y 2UUCL 1ZQEA 5L1IA 4B3TL 2JEFA 1J5EQ 3GTLH 1X9NA 4XQ8A 1OTCA 4QL5A 4UP7A 3A5ZB 3BQ1A 5GAEC 3FYHA 4LFCL 4I28A 5HHHA 2QHOB 1M90C 3MFHA 5IIIA 3GLGE 4OWTB 3U58A 2NVXH 4PHEA 4YP3A 8ICSA 2W9BB 1JB7A 2LBCA 1HJPA 5KFKA 1WFQA 4QJFA 1VQ8A 4JI4Q 4M9NA 1S0OA 2IT1A 2HHXA 4LFAL 4BA2I 1S10A 2R92H 3G6VA 2BKEA 3C1YA 1SL1A 3HOWG 2VA2A 2KN7A 3PR4A 4F93B 3PO3H 4EYHB 3JAMi 4BXOA 2MJ5B 3MR5A 4ED3A 1UEBA 3GDXA 5J29A 1UA1A 1KYIA 4JV1A 2PMZE 4A3JH 2VUMG 4K4GA 2ZTCA 4DLEA 4QWAA 4IFDG 5KFTA 2BH2A 5CR0A 2R8JA 1S9FA 2UUAL 4L5TA 3LCUA 2OTJA 2I5LX 3RH5A 3EZ5A 3JPRA 2NRWA 4LF5Q 2AHOB 4JWMA 4PG3A 2EIFA 4B9VA 2Q2TA 1XMQQ 1LUZA 3CD6A 3ICEA 4RQ1A 4DQSA 3S1QH 5C4XG 4TQSA 1DOQA 2JP7A 3BJUA 2A8VA 4B3ML 4DV4Q 4IO9A 4JI3Q 4PGQA 2ZJ8A 4ECSA 3C1ZA 2JA7G 5J2FA 4O0IA 1IYJB 3OSPA 4PHAA 4LF4L 5KFEA 1NK9A 4JBKA 3M4PA 3K8AA 3J80i 3HOWH 3RR8A 3M9OB 3CCUA 4I2BA 1IXSA 4IPCA 3UDXA 2PI4A 1K1SA 2DNAA 1Q1EA 1VQGA 3JPNA 5IE8A 2VUMH 4IPGA 5EAYA 3PIPA 3E9HA 5JEAG 4LW1A 4NLGA 1ZQHA 2LVNC 2LSSA 4DV5Q 4EX5A 3H7IA 4UAWA 4YHHL 4YN4A 1AH9A 4ED7A 3C23A 5AJ3Q 4AH6A 5GQOA 2ASJA 8ICYA 3H0GG 4IFDI 1GM5A 1T3NA 3S14H 4LUVA 1YBYA 3Q8RB 4IPDA 1JX4A 4MTNA 5C4XH 4IPHA 1IM4A 1Z3EB 1ZQBA 5DQHA 2JUJA 4ME3A 4Y52H 5LMNL 2HQLA 4QGUA 3CC4A 4ALPA 4G3IA 2JA7H 1KHIA 5DQGA 2R7ZG 1GKHA 1VQAA 2W9CB 4NY8A 1RZTA 3MGIA 3NGDA 4KHZA 4F4ZA 3ZDEA 4DV7L 4JI8L 3ZDAA 1ZQZA 2KNZA 1OXSC 5ELOA 4ECZA 2XGPA 5DB8A 1IBLQ 3T1HL 5J0UA 3GTKH 4DUZQ 3STBD 3RLNA 2JA5G 5KFJA 1NK0A 5KG0A 4B3RL 4NXZA 4J9SA 3RJEA 3HOYG 4HJ8A 2CWBA 1Q7YC 3AFQA 1WGLA 3L0OA 3HW8A 2OOBA 3PX6A 2HIXA 4DO9A 2DPIA 4QY7A 3SZ2A 5BR8L 1TK0A 3H0GH 3EPIA 2A1JB 2NZOA 4R4TA 5KFLA 2GVAA 4DR3L 3UDGA 3H8WA 2IA6A 5HNKA 5KFCA 3TS2A 1HNZQ 1RXVA 1I94L 4DSLA 8ICHA 4DLGA 2VA8A 3I56A 3CCEA 1T4GA 2R8GA 3BQ2A 4X64Q 1TFRA 1RIPA 1X3GA 2R7ZH 2VL6A 3Q8LA 3ZD8A 2F3IA 4I2AA 2F1JA 4DR2Q 1VQ5A 2NRTA 4DL6A 3CAMA 1E24A 2JZBA 3PSIA 2A19A 3J7A5 3I4OA 4BY1G 3U4VA 2CQOA 1PGYA 4RT2A 1HT1E 4YCVA 4XUSA 5GADC 1G291 1BPDA 2NRXA 3B89A 3T1YQ 3S16H 2XC9A 2BCQA 1CEZA 2I9GA 3MXNB 2JA5H 2DAKA 4JV2A 3HOYH 4X66L 2BPGA 4JI1Q 1QUQB 5KG7A 3MDCA 1ZQTA 8ICLA 4F4YA 4DV1Q 4DR1L 3UQ0A 9ICEA 4UP9A 2C22A 2DI0A 4I2HA 9ICXA 1HH2P 1N33Q 1X65A 3KHHA 1I5FA 3M4QA 1WJJA 1C9OA 2J6SA 1N36L 5HY6A 9ICNA 2AGQA 5FJ8G 4LF7Q 7ICQA 4AIMA 2DAGA 3QZ7A 1VQDA 2XCPA 3T5KA 1ZQOA 4NM1A 5IWAQ 1EOVA 3BZKA 3AEVA 3Q8MA 1VQEA 5J2EA 3C2LA 2F4VQ 1HNXL 2HWJA 1R9TH 4KLJA 2JY8A 4R71A 4LUZA 4JV5Q 4JBMA 2UXBQ 4GLAC 4BY1H 1ZQPA 1CKOA 4DWIA 4JBWA 2JA8G 1IBML 1YLAA 2JA9A 1IL2A 3MR3A 4KLDA 3H4JA 3KDFA 4UBCA 3CCLA 5J2HA 1L3VA 3RBEA 2PFQA 5F9NA 1K83H 1TWFH 4K0KQ 2XY6A 1K9MC 4TUPA 4RG1A 1SFOH 4JI6L 5IIJA 3RR5A 2BWBA 2D0OA 3TARA 4KLHA 1R4GA 3HX0A 4KN7A 5KFXA 2CWPA 5KFSA 4B9TA 9ICTA 4JCVE 5EWGA 5IY0A 3C5GA 4XA5A 2WAQE 5KFWA 1P16A 2RDJA 5IILA 2BGWA 5IP7G 3K7AH 3RJGA 4JI2L 8ICBA 5CWRA 9ICKA 4J9PA 5FJ8H 1Q1BA 4NXNL 1E1OA 1VEKA 1L2FA 4XTCS 1VQ9A 2UVRA 3BU2A 2BCRA 4F2RA 3H8SA 4R4CA 4RMFA 1UE1A 2ID0A 1XNRQ 8ICMA 1HUOA 3OTOQ 4GNXA 1VQNA 1ZMWA 3UXNA 1VQOA 2JA8H 1VEJA 2XY7A 2XCAA 1PH8A 2BPCA 2R8IA 4ECYA 3HKZG 4F8RA 4M47A 2V1CC 2LVOC 5IINA 1VQJA 3E0EA 4YWLA 4A4IA 3FKIG 4DL5A 3Q8DA 4F3OA 5FLMG 4POGA 1VQHA 4ED2A 2UVVA 2DENA 2MAXA 4GXJA 1ZJMA 4DEZA 5IP9G 1RL2A 1TWGH 7ICOA 4UAZA 4NLNA 1HNWQ 4GOPB 3B6YA 4PZ8A 2ZTEA 4M9HA 2E8GA 5IP7H 3W5OA 1ZQNA 1Z9FA 2MUTB 3JC66 4F5RA 4QZIA 2NN6G 2K5NA 1VCIA 4UB3A 4EZ9A 2VW9A 3PW5A 9ICIA 2DHYA 3LWLA 2CWAA 1XC9A 2GVBA 2DKLA 4YMOA 4GOPC 1V9PA 4O3SA 4QZFA 2M9NA 8ICGA 1AE3A 1ZQVA 1K3RA 3HKSA 1IBKL 4LFBL 3NELA 7ICIA 4MEYA 4K4IA 3DLLA 4DV2L 3RRHA 1BBWA 2AJQA 4B9SA 4UBBA 4P71A 2R0IA 4KHPQ 3EN2A 4DSIA 1ZQKA 4LF6Q 3FKIH 3TRZA 4Z6FA 4M6WA 4F5NA 5FLMH 3RZOH 1ZQXA 3E9IA 5C3EG 3PR5B 2VQFQ 3KF6A 5GAGC 2GN5A 5IP9H 3NENA 3C2KA 1EWIA 3PVXA 3CCQA 4I2JA 1XU4A 3S1RH 4OONA 4ED8A 1ZQRA 3JPSA 2WAQG 3PNCA 8ICKA 3A5UA 4FDBA 3GV5B 7ICVA 8ICOA 3I7FA 2Y1IA 2N78A 3PW7A 2V4RA 4ED0A 3OSNA 1ZQWA 3C21A 2XGQA 5DB6A 3QEBZ 4YXJA 5D49A 4LVSA 4UB2A 2JEGA 5L1LA 1L1OC 3PY8A 2VNUD 1D8YA 2DGYA 4TQUS 4A75A 2FPKA 5C0XG 2NN6I 3PO2G 1EIYB 3S2HH 4PZ7A 5C5JA 4A3MG 4DR6L 3KFUA 1GO5A 4EEYA 1NMGA 2DAEA 2BCUA 4DBGB 5KG5A 1QLNA 4KLMA 1LYLA 3FRHA 3W1BA 3HT3A 1TAUA 1WOCA 4X62Q 3MR6A 4F1IA 2Y1JA 4DSEA 2W9BA 3GIIA 4QW8A 9ICWA 4JI5L 4UB5A 4KITB 3RJIA 1MQ3A 1L3SA 1ZV1A 5LMUL 5KFBA 5C3EH 1Q12A 2YYZA 3G6XA 4C3JH 4QZDA 4ELVA 1ZJNA 1X55A 1QVCA 2MFIA 2HHSA 3CC2A 2LVPC 1KD1C 1KLNA 4YHHQ 3PW0A 1N56A 4BWJA 4ECUA 1PH4A 1D8LA 3V6HA 2HVIA 2UU9L 2YU9H 4EBDA 2JY5A 5J0YA 5GROA 1N32L 1KFTA 3RR7A 4NB3A 1RYRA 4A3KH 3CCJA 4OX9L 9ICGA 2WTFA 3FDSA 5LMNQ 5CA7A 3PO2H 2BA1A 4A3MH 3CC7A 3ZDCA 4BWMA 4IRKA 4UPAA 1CKMA 5J0TA 1HR0L 3H40A 2W8LA 1YITA 1JR3E 1JJGA 3RZDH 1YHQA 1B22A 1CKNB 4JUZA 3EIVA 1KL9A 1YZ6A 9ICAA 4BXXG 2MQHA 1SKRA 5J2DA 1VQIA 3M85A 1T43A 1VS0A 3PW2A 4KMUA 5TZVA 3RAQA 1WCLA 4BGDA 1NTGA 2JNHA 3AFPA 3ISBA 2OO9A 8ICUA 3M9BA 1MN3A 5J2AA 1H95A 3IHQB 2IHMA 3CXCA 5BR8Q 1XPUA 4RNOA 4TURA 2JE6I 5KFGA 2JZ1A 4IR9A 2JK8A 3CPWA 1K1QA 3PF5A 1XS9D 3QEAZ 1P3QQ 4KLGA 4QZ9A 2XTIA 3CMEA 3J81c 4KLEA 1A0IA 1CSQA 1ZQGA 2IX0A 5JUMA 1QTMA 5M5XH 4X65L 9ICPA 4YD2A 1VQFA 1XSLA 1KDHA 3TQYA 1VQMA 1PZNA 2AMCB 7ICEA 4ZH4A 3M9MB 4FS1A 9ICOA 4J9RA 1V92A 4HJ9A 8ICXA 4RQ5A 1X9MA 3LCVB 3DM3A 3IHPA 4C8OA 4BXXH 5J2IA 1ZETA 2L4FA 4IOCA 1PH2A 3OGUA 2NVYH 1NK8A 2W9CA 4PGXA 1FJGL 5EOZA 1KFSA 4P4MA 1EUJA 3ZDDA 1MSWD 2C2RA 4G3OA 4P4OA 2UXCL 4JG2A 3J81j 1O7IA 5K36G 2RRUA 4YMNA 5J0RA 9ICJA 3TEHB 2AQ4A 1N34L 2C35B 5E7NA 2GWSA 4QWCA 3PX4A 4DR1Q 4P74A 3OW2A 3OHAA 2HHHQ 1XNQQ 2Q2UA 1ZQQA 4F4WA 2LXKA 5KT7A 5HGQA 5IYDG 1NKEA 4RQ4A 7ICRA 3I55A 5DQIA 2ZJRA 2OOAA 3AYHB 5DB9A 2KFNA 2JEAI 1U0LA 1KSPA 4F50A 2A1JA 1DGSA 3RJKA 1X6OA 5L1KA 4IQWA 3E46A 2B3TA 4GXKA 4L5QA 1TWHH 3SV3A 1Q82C 2YTXA 5D4BA 2MO1A 1UT8A 3PMLA 7ICSA 4B3SQ 1IBMQ 4YD1A 2IBKA 4DSFA 2A1AA 3KLWA 5C4JH 4PHPA 1I6HH 2VQEL 1XO1A 1IM2A 5M3FG 4XRHA 3ZDBA 5J0QA 4I2CA 8ICVA 1PVOA 4JI6Q 4KN4A 3FE3A 2BPFA 1U4BA 8ICZA 4BXOB 5J0PA 2FLNA 3SI8A 1UE5A 4GKKL 4KLOA 5DGBA 4M0AA 7ICUA 1V1QA 3JPQA 2LVQD 4F92B 5IYDH 2ZUBA 2UXDL 2KHIA 1E7ZA 4JI7Q 2YTVA 3K0XA 4NXNQ 4C3HH 1U47A 9ICBA 5JJKA 1A77A 2KCTA 3CCMA 2WZJA 1S77D 1SL2A 3CMAA 3HFZB 2OQKA 1KAWA 4JI0L 1SROA 4DUYQ 7ICFA 4HJAA 4QZGA 4EQ5A 4DR7Q 4AQYL 2DAIA 1RXWA 1KQSA 1WYDA 4I2IA 3L2PA 2AWNA 2R6GA 1J5EL 3B0XA 2Q0ZX 4EYIB 2F1IA 1NJZA 4PMWA 1AE2A 5IIKA 1E94E 1JIHA 5M3FH 5JJLA 4LF8Q 4R8UB 2FXQA 3W1GA 3THVA 1VQ4A 4LNQA 4X5VA 1JJ2A 2XY5A 4I2DA 2D62A 4GN4B 1WR1B 2HW3A 1K73C 5IT9c 1OKSA 1D9DA 1Z00B 1PH1A 5KT3A 1EYGA 1QSYA 4HJ5A 3RJHA 4Z6EA 3PV8A 3GDEA 4YVZA 3CP0A 1SKWA 2RHQB 3E2EA 5BOLA 5BOMA 5JEAJ 4OXPA 4DV6Q 1EIFA 1QSSA 3K81C 3VDYA 4IR1A 4AYBE 3V6KA 4R63A 3GTMH 4IJHA 3GIJA 2F1HA 4Q43A 1OXVA 3HKZE 3I4MG 1N8RC 2EQSA 1SR3A 5IIMA 1KEJA 4I2FA 4KLQA 4PZ6A 3K9PA 2B3GA 1TWCH 4DK3C 4A3LG 4O3QA 1IBKQ 2PFNA 5KTQA 4I29A 1ZQMA 5CJ7A 1HZ9A 5KFZA 1HQYE 4LF5L 4FBUA 8ICRA 4HIKA 2MNAA 1NK7A 3STBC 3H3VH 4KLKA 2B21A 1X9WA 4MF2A 2FPLA 4QIWE 5J2KA 2Z6KA 4LF9Q 3JPOA 4CCHA 1SKSA 4RU9A 1KTQA 1SRUA 4JV0A 2J6TA 3H3VI 4RUAA 4OWXB 5L9XA 4JI3L 1PH3A 3A0JA 1GD7A 5H1SE 3GFKB 2D0PA 1DO0A 3QZ8A 1PYSB 4DSJA 5KG3A 1LM0A 5KFPA 1BKBA 1QVGA 3PUWA 1AROP 1F4IA 4JOIA 3ULPA 4P73A 3HP6A 3J81i 4DR4Q 1J6QA 1Y1WG 2PFOA 3K80C 2MO0A 3I4MH 2KNVA 1IFYA 3AU2A 3K7UC 4P75A 1ZQFA 2P66A 2Q2IA 4F5PA 4A3LH 3OJSA 1MKHA 3UE0A 4DQRA 4A3FG 2JQOA 3PIOA 1UA0A 1VQLA 3RN5A 1OAIA 3FP9A 8ICQA 4DL2A 1A63A 4DV0Q 4MFAA 5AJ3L 2NRVA 2BCSA 4BDPA 3UE1A 2RF4A 4DNIA 1T9HA 4Q7JA 1JN3A 1JMCA 2NVTH 8ICJA 3UPQA 1KRTA 3J7ZC 3CQZH 2MGWA 4KLTA 1S0VA 2G3QA 3HPOA 1BPEA 4QZCA 3KHRA 2HHTA 2WB1E 4JYAL 4DKAC 1U5KA 5J0WA 3EW9A 4DR5Q 1HT2E 1A76A 4L5SA 4AYBG 3TANA 4A93G 2B63G 4B9MA 4A3DG 3FHWA 3JAMc 1I50H 2QGQA 1IBLL 4FO6A 4QZBA 1Y1WH 1XMOL 4DUZL 3G6YA 9ICSA 3HOUG 4QZHA 4HYKA 1K8AC 4JWNA 1UFZA 5J0OA 1UWVA 1XTDA 4A3FH 3N97B 5EWEA 3RLOA 4BY7G 2B29A 1D7QA 3Q8SB 1UE6A 1HZCA 4RNNA 3KHGA 4FS2A 1KC8C 1V43A 2JA6G 2UUCQ 1S0MA 4B3TQ 4GEWA 4YCUA 4IQVA 3G48A 3K75D 4HJ7A 3BBZA 4KLLA 3PCOB 4A3BG 3RH6A 5GAHC 4ECTA 4LFCQ 1HNZL 1JXLA 4UN2B 2FMPA 4O5CA 3OYYA 3G4SA 2NZHA 3BDPA 2W9MA 1G6PA 3GO5A 1VQPA 4DR2L 4UAYA 4DV3L 1L3UA 4BBSG 4LFAQ 1WHCA 2ISOA 1XJVA 3J80c 4F2LA 3F92A 1FL0A 1VEGA 3NEMA 2CCZA 5DDMA 4A93H 2B63H 2ZTDA 1ZQUA 4A3DH 2JJQA 4M9GA 1ZYQA 3MBYA 3T1YL 1PHJA 2Y0SG 3NBHB 4MFCA 2ISPA 3HOUH 3RRGA 2FPMA 4M2YA 3LK9A 4JI1L 4DS4A 4BY7H 1L1OB 1NJXA 2BA0A 3KF8B 1BPBA 4YFKA 2N3SA 5KFFA 1W3SA 3OHBA 3KJPA 3RNUA 2JA6H 2UUAQ 1EQQA 4YY3L 1N33L 4A3IG 3V7LA 4Q44A 1XSPA 3D0FA 5J3BA 1FJGQ 1L5UA 3TFRA 1E3PA 3GLIE 2PQAA 4A3BH 4DFPA 1G41A 4DL3A 1CKNA 4GN3B 2RDIA 5ELNA 1KIXA 3E21A 3B0YA 3V7KA 4B3MQ 3PUYA 7ICKA 2WB1G 5KFIA 4DL7A 1KRSA 5IWAL 1SLJA 2IMWP 1EFWA 2LVAA 1ASZA 1C7YA 3S1NH 4GC6A 3PX0A 4WJ3M 4PH5A 1BPXA 2F4VL 4O3RA 4DQPA 5HMLA 4BBSH 3PGZA 4JV5L 8ICEA 2UXBL 4LF4Q 4YG2A 4DOCA 5HMMA 4GNXC 1BVSA 3ISDA 5KFYA 4ELUA 3AQQA 2BDPA 5J0SA 9ICUA 3PW4A 2O25A 3EPGA 4MZ9A 2FLLA 3RLFA 4K0KL 2AQ0A 2K75A 2JZ0A 3ISCA 4IJLA 4A76A 4GKJL 5KFDA 2JY7A 4TQRA 4O5KA 4NLKA 5M3MG 1PH5A 2UUBL 1PYBA 3V72A 4BBRG 2IX1A 2K14A 1JJCB 1TK8A 4A3IH 1Q86C 2I1QA 4ECXA 4KLSA 4HIOA 3GIKA 4DQQA 1VDLA 3S17H 2R8KA 3RB6A 2YTYA 2DFLA 3EBEA 4BA1I 4KI0A 7ICNA 3IRBA 1KXLA 2XO7A 1NY4A 1SMXA 1B7YB 3IECA 1VQ1A 2BR0A 4C8LA 1NKCA 4YQWA 1OQYA 3RJFA 5KG1A 4UB1A 5HP4A 3OTOL 4RQ7A 3T5JA 4IOAA 4UY8C 4DV7Q 4GS3A 4JI8Q 4IRDA 5KFHA 2UXDQ 5LMNW 2K50A 4O0AA 2AU0A 1A8VA 1KRPA 1XPRA 4GLXA 3T1HQ 3I2ZA 2FMSA 1EQRA 5KG6A 2ATWA 3PMNA 3GLHE 4B3RQ 1VQKA 4R4OA 3PUXA 3RH4A 1TTEA 1S76D 3Q8KA 2P6UA 1QZHA 1PH7A 4AQYQ 4NXML 5M3MH 2ATLA 1E22A 4BBRH 2PI2E 4QZ8A 1NJIC 3RAXA 5C0XJ 3MDAA 5F9LA 1Q02A 1YJWA 4J9LA 3H15A 2HHVA 1MIUA 4IQUA 2Q2HA 2BQ3A 4QWBA 1ZQDA 4DR3Q 2FLPA 2EJSA 2IHEA 4F5QA 3H4DA 1BPYA 5DLGA 1SE8A 1CSPA 1I94Q 1NMFA 4HIDA 2ZM6L 1VQBA 2AGPA 3ULJA 2H5XA 4DF8A 1X54A 3BJYA 1Y8GA 4KHPL 2IY5B 5KFUA 3G71A 1A5TA 3GIMA 4ECQA 4LF6L 3GTGH 3CCSA 4ECRA 2N8NA 1FGUA 5KFAA 4YR0A 3CCVA 2RHSB 1Y1VG 2VQFL 3T5LA 2DZLA 4XIGS 1T8EA 2E5LL 1OXTA 1OXUA 2BQUA 4X66Q 1U9LA 2HHQA 9ICLA 2K4KA 3UXOA 2AKWB 3V7JA 2AWOA 5KG2A 4I2EA 7ICTA 9ICQA 1Y88A 3M3YH 2BQRA 1NV9A 2QA4A 4IQTA 4ED1A 4HIMA 1N36Q 3M9NB 4C8MA 4M9JA 3C2MA 5DLFA 3JPTA 3CCRA 1YNXA 5DFLA 9ICVA 1EFUB 3V6JA 3GLFE 4B9UA 3MMPA 2BWEA 1RPLA 2AGOA 1X3EA 4LZGA 4OO1G 4TUQA 3GQCA 4LZDA 1JMSA 5DB7A 3GTPH 4R8UA 1HNXQ 4F2SA 5CHGA 3I4NG 5CP2A 2JY6B 4X62L 2KZZA 1Z00A 4PHDA 5M5YH 1D9FA 5KFNA 4DSKA 3A74A 2JEIA 1Q81C 3UXPA 1Y1VH 4J9QA 1TKDA 3L7ZC 4RPZA 1ZQIA 1MQ2A 4DPGA 3PUVA 1XSNA 3KTQA 1IXRA 1VQ6A 1S72A 2V9WA 1OTRA 5JI2E 1JE5A 1ZQJA 1L3TA 4YXMA 2VANA 5KT2A 3RB4A 2MROB 4NPSA 1UE7A 4RQ0A 1YI2A 3G6EA 3TS0A 1L0WA 1KFDA 3F2BA 1WIVA 1MC8A 1S0NA 4JI2Q 1QUQA 2E2HH 5J2BA 2ASDA 4QQBX 2I0QA 1W2BA 3F2DA 4IFDJ 4YMMA 5L1JA 2QEXA 4JK1A 2OTLA 5J2CA 2VZAA 1I3QH 3SGIA 4L5RC 4Z6CA 2LYHA 2DUDA 4JYAQ 4C2MH 3ZJYC 1WGNA 1SZPA 3CW2C 2ZJPA 4OWWB 3I4NH 4OO1I 2DPJA 3ER0A 5KT5A 1DV0A 4RQ8A 4F5OA 2RCNA 3GTOH 2K9DA 1XMOQ 1K8GA 2ES2A 3TFSA 4YWKA 4EBEA 2EKKA 4HEOA 2PI2A 3WWVA 4J9KA 4MFFA 2KHJA 4J9OA 4TVAB 4QWEA 1DO2A 4Q8EA 4YCWA 2CP8A 4QW9A 4JI4L 1PV4A 3T3FA 4DOBA 9ICMA 4DS5A 2HIVA 5DBAA 3KHLA 3HOZG 4UQGA 3NTUA 2E2IH 1VG5A 3MEFA 1WI5A 2I5HA 1A62A 3HOVG 2C28A 3TREA 1NOMA 2PFPA 2KBNA 1TK5A 8ICIA 1U48A 3U50C 2L4EA 4ECWA 5KFOA 3BQTA 1U49A 4DV3Q 4ED6A 2K0BX 4LFBQ 8ICCA 3BZCA 7ICLA 2ASLA 4DV2Q 2W9AA 4O5EA 4C8NA 1YHAA 2F52A 3D31A 3KJOA 3MFIA 2L2DA 1NK5A 4Q45A 4Y7NH 4J9NA 1XPOA 4R4IA 5KT6A 4YWMA 4R65A 5DG7A 2XGTA 1HZAA 2Z0SA 1XMQL 1YJNA 2ZUDA 3PF4A 4DF4A 1SG9A 1XXHE 3GV7B 3S2DH 4F91B 5DDYA 4DV4L 1ZQAA 5C44G 4O3OA 1C0AA 4P4PA 4YY3Q 3M8RA 8ICFA 1NE3A 2R93G 4GC7A 4K4HA 1K0RA 1YVCA 4GN5A 2HHHL 1XNQL 3OJUA 3HOZH 5KFRA 2K5HA 1FVIA 1LTLA 4IRCA 1YEZA 2OWOA 4APVA 7ICHA 4GOPA 3HOVH 4M9LA 3LWMA 2R8HA 3C5FA 3ERSX 3PO5A 1RYSA 2MUTA 4DR6Q 1E1TA 1X56A 4RZRA 8ICNA 1BBUA 4DK6C 2E2JH 2Y0SE 5KFQA 2KZMA 3IM1A 2PXIA 8ICPA 4DV5L 1SL0A 4B9LA 4ELTA 4Z6DA 4B3SL 5EWFA 4QZAA 4Q8FA 4DFJA 1OXXK 3RJJA 3SV4A 5M5WH 3ZD9A 4H02A 2ASBA 7ICJA 5D46A 5DLQE 1S40A 3MR2A 1B70B 4C3IH 4JI5Q 3M4OH 4RUCA 4MNOA 4MEXA 1TWAH 4J9MA 5IIOA 4DOAA 5LMUQ 3RN2A 4KTQA 5KFVA 3UDFA 4GKJQ 9ICFA 2JZBB 5IYCG 2BCVA 3HOXG 4DAMA 2C2EA 3H4BA 5C44H 2NRZA 1N9WA 3ETLA 3TQ1A 2UUBQ 3EYZA 2ALYB 2R93H 2W8KA 2KTQA 2ZJAA 3CF5A 4R1JA 4M04A 3PO4A 2HVHA 4A3CG 4P72A 3T5HA 1N48A 1SN8A 4TUSA 1NJYA 1L1OA 2L15A 2UU9Q 2R7FA 3T6PA 4O3NA 4JI7L 1HZBA 1N32Q 3BQ0A 5IYBG 9ICRA 2UVUA 4OX9Q 4DFMA 2KNAA 2I5MX 1X9SA 1LB2B 4DL4A 5J0XA 1TR8A 4QZEA 3RBDA 4UB4A 1M1KC 3U4ZA 5FLXc 1NKBA 3Q8QB 3JPPA 4DUYL 2KHHA 2BH8A 3K4GA 1HR0Q 3GTQH 4DR7L 1TXYA 1P8LA 1QSLA 2KFZA 5KFMA 4O2DA 1TAQA 4DFKA 2NVQH 5CB1A 3SYZA 1VQ7A 2J6UA 2ZUCA 1HR0W 4LF8L 5DBBA 2P6RA 2JEJA 4RQ2A 5IYCH 3HOXH 1G4AE 1NK4A 2FMQA 2Z6KC 3TI0A 4X64L 4NXMQ 1ZMVA 1G3IA 1PH6A 5J2GA 9ICHA 1YJ9A 4E0DA 2VY3A 3KDFB 2IHFA 4A3CH 4NLZA 4PPXA 3UDIA 1HUZA 1MJCA 3RTVA 4KLUA 1ASYA 1AIPC 2OQ0A 9ICCA 2VS1A 1XWLA 4LUOA 3FRIA 5IYBH 4QWDA 4DV6L 4KLFA 4R64A 1ZQYA 4JOIC 4YR3A 4X65Q 4I27A 4X6AH 4DAYB 4F4KA 2BHNA 3MABA 4JBJA 1WJ7A 2ZM6Q 1T7PA 1GVPA 1YHBA 1NBWA 2KZ3A 2KENA 2WP8J 2CKZB 3GILA 3MGHA 1WCNA 5DG8A 5HHIA 3ORYA 4MF8A 4DV1L 2KCMA 3RB0A 1X2IA 1JT8A 3TAQA 3F8TA 1B8AA 1QZEA 3PUZA 3M7NA 2V4QA 2QSFX 2CFMA 3UQ2A 3EWAA 3RB3A 2EKFA 1EXNA 4YR2A 1Y14B 2LXJA 1WCMG 8ICTA 2QNJA 5DGAA 1Q46A 3PV0A 4LF7L 4LF9L 3AU6A 4GNXB 2VA3A 2R7DA 2UVWA 4NM2A 2E5LQ 2UXCQ 4RQ3A 4WJ4A 2K5VA 4B9NA 1S97A 1ZQLA 1XB2B 1H38A 3F2CA 3GV8B 1N34Q 4FBTA 1ZQSA 4A3EG 4I2GA 3CPFA 3HWTA 4EZ6A
chains in the Genus database with same CATH superfamily
4K5XA 3KOJA 3C46A 2JEBI 4RPYA 1CHQD 4QOZC 2Q8RE 1K5OA 3AOEA 1HNZM 4A3KG 3I4VA 2WFWA 2KP7A 1HEKA 1PFSA 3LGJA 5KAIU 2MR9A 3I51A 1ED1A 1NZBA 3S24A 2J7ZA 3C1FA 2G5IB 2K03A 3WDNA 8ICAA 2VQEQ 1GO3E 1WCMH 5JVG3 5DKWA 2B63B 4A93B 5AKXA 1ENAA 2KA6B 2YV5A 3FTCA 3JR4A 2KECA 5KPTA 1YIJA 4R4QA 1NK6A 4DR5L 2R92G 1U45A 1FEZA 3UM9A 2N49A 5DG9A 1ZKOA 3K92A 3H8JA 1TVAA 2KW0A 1EU4A 1Z6HA 1PA6A 4NLCA 3FEWX 4A3JG 4F4XA 4JI0Q 3CRXA 4JV5M 2UXBM 3NVWA 3AOGA 4KJOA 1QH9A 2ZJ5A 1PRTD 3E4RA 2UUCL 1ZQEA 1H9MA 1CI4A 1TY0A 5ALHA 2JEFA 4B3TL 1X3PA 2APLA 1OTCA 2LWXA 2XNAC 3IN5A 1QDRA 4D80A 2QHOB 1M90C 2ICEC 4GKJM 2IOFK 4PHEA 2NBFA 3DFZA 4NRWA 2UUBM 2F0NA 5DNFA 2W9BB 2LBCA 2KIWA 1HJPA 4QJFA 1GUWA 2EY6A 1S0OA 5IOCA 2HHXA 4BA2I 2I46A 3KBBA 4OJOA 2LMRA 3PO3H 4BXOA 1XYIA 1UEBA 1A6SA 4ID6A 2Y0SC 5J29A 2PMZE 2ZTCA 5KFTA 2BH2A 1S9FA 4CKBA 3DV9A 4L5TA 3O13A 3EZ5A 5AM3A 3I90A 3M6AA 3J7AS 4RQ1A 3S1QH 5C4XG 3M4YA 2JP7A 5AI9A 3H94A 3BJUA 1JB0F 5ALRA 2MPMA 4ECSA 3RUZA 5J2FA 4O0IA 2BDNA 4PHAA 4LF4L 4JBKA 2I6XA 2XRQD 3FDTA 3K8AA 1KTKA 3RR8A 3FTFA 4BBRB 5TSSA 1L7MA 2YMQA 2DNAA 3JPNA 2ZM6M 2K7VA 4IPGA 4IFDH 2ZG6A 1LTID 1WD1A 1ZQHA 3H7IA 4F87A 1DOLA 1SYBA 4YN4A 5J8YC 1TH3A 3C23A 1NI3A 2ASJA 3H0GG 4IFDI 1GM5A 1B0XA 4WRDA 4LUVA 2OT2A 2JYOA 2VQFM 1IM4A 2E5LM 2UXCM 5DQHA 4ME3A 1D5ZC 1Q8IA 3BVGA 2HQLA 4QGUA 1VMPA 3EQLC 1QVRA 2W9CB 4NY8A 1RZTA 3MGIA 4MTKA 3ZDEA 3WK9A 3R93A 1QUTA 1GUSA 3Q24A 5I6WA 3T1HL 1BDOA 1LTTD 3STBD 1Y8PB 1B9MA 3RLNA 2W3SA 5KFJA 4NXZA 2CHGA 2SNSA 2CWBA 1STAA 4H7BA 2J0TD 4FF1A 2OPFA 4UARA 2G8LA 1GUGA 4DR3L 5G5GA 1MA7A 1HNZQ 1RXVA 3CCEA 1T4GA 2R8GA 3BQ2A 5KNCA 5M5YB 1TFRA 1X3GA 2R7ZH 2VL6A 3ZD8A 4I2AA 3MC0B 3I4OA 2KKPA 3R8BA 4AKGA 2F0MA 4RT2A 5J22A 3FUUA 5GADC 1G291 1YT3A 2FJ6A 2BCQA 3MXNB 2B39A 2JA5H 4QMGA 5C4HA 1OAOC 1HTLD 1ZQTA 1PXUA 4DV1Q 3KOXE 2QBYB 4DR1L 9ICEA 1IXRC 1I3QB 2XSCA 1NR4A 3NPPA 1A15A 3FYCA 1PUZA 2N35A 9ICNA 5FJ8G 3I4NB 2FE9A 2DAGA 1VQDA 2Y0QA 2XCPA 5ALTA 1J2MA 1IN7A 4JI4M 2CHVA 5J2EA 2HWJA 2MGSA 4JV5Q 1U4MA 2UXBQ 4K6LA 4GLAC 4EX7A 1ZQPA 4DWIA 1C8CA 2JA8G 3H4JA 4UBCA 5J2HA 4IZ8A 3VR6A 4RWSC 3RBEA 5F9NA 2XY6A 1K9MC 4TUPA 5FLXE 2D0OA 2F0GA 4PDGA 1R4GA 5KFXA 3NBHA 9ICTA 4LF5M 3C5GA 3K7AH 3RJGA 5CWRA 2D7GA 4O1NA 1Q1BA 1Z4NA 3SR6A 4HCSA 4RMFA 1UE1A 3NQTA 4OD0A 4GNXA 2JR5A 3UXNA 1PH8A 2R8IA 1PZID 3HKZG 2V1CC 4BLCA 5IINA 4YWLA 3E0EA 1STNA 4F3OA 2MAXA 5IP9G 1H9RA 1TWGH 3HOVB 7ICOA 4UAZA 1R2ZA 3W5OA 3SHLA 4GFJA 5EPLA 3BOSA 1R4QB 1VCIA 4UB3A 4OVZA 2JGAA 4G6ZA 3EIHA 4GOPC 4O3SA 4QZFA 1ZQVA 2EZVA 2O5IC 1TWAB 3TPZA 1IBKL 3SC3A 4KHPQ 2KKVA 5C44B 4RGNA 3EN2A 4DSIA 3SMSA 4KHVA 4LF6Q 3TRZA 2R93B 4M6WA 4F5NA 5FLMH 2EH9A 2VQFQ 2LYBA 3PR5B 3L3FX 4HL4A 3JPSA 5HR6A 2RKSA 8ICKA 3GV5B 1JQYD 7ICVA 8ICOA 1D0KA 2V4RA 1GHKA 1IYVA 4JPBW 2XH9A 2WHEA 3SHFA 3QEBZ 1I4GA 3PY8A 4CGZA 2P5ZX 4A75A 2NVQB 3M1YA 3KFUA 3T38A 2IWHA 3CYMA 1GO5A 3DHQA 1NMGA 2DAEA 2BCUA 3FRHA 2EPBA 3W1BA 3HT3A 1TAUA 4X62Q 2RDHA 2L1BA 2X69A 1QILA 4JI5L 3WOFA 2E1FA 1D8BA 1ZV1A 5KFBA 5C3EH 1H9KA 1Q12A 1XX8A 4M1UB 4A3DB 3AKZA 1KD1C 3AL0B 4V0BA 1PH4A 3CRLC 4IBCA 2KHVA 4EBDA 2JY5A 1ONLA 1PJTA 3TDQA 4A3KH 9ICGA 2BA1A 1XXHB 4C1NI 2Z4IA 4IRKA 4BWMA 1HR0L 3SR1A 2DZNB 4NLBA 3ND8A 3X3MA 2KOBA 1YHQA 3QO2A 4JUZA 9ICAA 3N7PD 1VQIA 1T43A 4KMUA 5AFWA 1SZHA 2YY6A 5EJWA 3AFPA 3OPOA 2OO9A 3ZYYX 1OO9B 1KN5A 1E0BA 3K8ZA 4ZUIA 3CXCA 2CFOA 5BR8Q 1XPUA 4IR9A 1F0MA 4KLGA 4QZ9A 5E6JA 2ZXHA 5ALSA 1CSQA 3SHGB 1VQFA 4QB4A 1XSLA 2L5TA 1WCMB 1L0XB 3D8GA 4NV0A 1LTGD 3DWPA 2F5OA 4DR5M 3M9MB 4OIJA 2K01A 4FS1A 2XZFA 3DM3A 3IHPA 3HS0C 1NK8A 3E3XA 1KDCA 4ZYSA 2C2RA 1I4RA 4AYBF 5J0RA 4MHVA 5E7NA 3CF6E 2F3VA 4P74A 2UUCM 2KVMA 4B3TM 2HKJA 1DONA 3VR2A 1F9RA 1U4LA 5ITYA 4RQ4A 2ZJRA 5DQIA 2KFNA 4XT1B 2KK0A 3ICXA 2A1JA 1X6OA 4IQWA 4GXKA 2ZANA 1VLBA 2ZXOA 1ZRMA 5COYA 1Q82C 2QARA 1UT8A 7ICSA 4ZKBB 3VA7A 1IBMQ 4DSFA 5C4JH 4UAUA 1I6HH 2XICA 4Y2VA 3OSOA 1HQMC 2HCBA 5ALOA 3TWMA 4LY6A 4XRHA 1S5BD 1J7KA 3PO3B 8ICZA 1NCVA 1EE8A 2FDRA 1GUOA 4KD4A 1YNJC 3A98B 7ICUA 3JPQA 4F92B 3ONNA 3C2PA 1STGA 2ZUBA 4AI6A 2YTVA 1RM6C 3LQQA 2A3VA 2XVSA 2KCTA 3CCMA 4ZAIA 1Y8OB 2KV2A 1SROA 4M8AA 4QZGA 4OJPA 4DR7Q 4AQYL 1WYDA 2HMXA 3RF9A 3E0FA 4FD2A 4EYIB 2Z4RA 2F1IA 2M0NA 1NJZA 1JIHA 5M3FH 5JJLA 5ALQA 3MHBA 1ZQ9A 4GN4B 1HA5A 2XI9A 3MA2B 1PH1A 5KT3A 4HJ5A 1BOSA 3TBIB 1TKWB 3VDUA 2F0LA 3VDYA 5G3LF 2CW0C 4PCZA 3GTMH 2F0KA 3I4MG 1SR3A 1OJLA 4DK3C 2FMCA 4KY5A 5KFZA 1HQYE 4II7A 2VIIA 4HIKA 1JRPA 3T1HM 1NK7A 1II3A 2B21A 3IG8A 4MF2A 2FPLA 3OTQA 3JPOA 1KTQA 2J6TA 1QQ7A 5L9XA 4JI3L 1GD7A 5CBEE 2I07B 3GTOB 4PT5A 1LM0A 2A6HD 1BKBA 2JXMB 4JOIA 4NL9A 3HP6A 3FPPA 1PTOH 1PJIA 2MO0A 1LKYA 3W0FA 3AU2A 3C9PA 3U6PA 1QG7A 3OJSA 3PIOA 1V97A 1UA0A 1VQLA 2F5PA 2XWJB 5KL8B 4MFAA 2K6BA 2NRVA 1K8OA 1F9QA 4DNIA 5C6AA 3LVVA 4Y28F 3VLFB 2R7ZB 2B2WA 2DBYA 3I70A 1KRTA 3J7ZC 4ITQA 3CQZH 4KLTA 4DR1M 4QZCA 2WB1E 4X3TA 2PZTA 5E4XA 4DKAC 2JA5B 1SJHD 5J0WA 3WKDA 4DR5Q 4I4LA 1N5WA 2J7OA 3TANA 2A69C 4B9MA 1I50H 3C3EA 4WW0A 3ND9A 1IBLL 4FO6A 4QZBA 1EEID 2EANA 2LM1A 1XMOL 3G6YA 2EVBA 3HOUG 4HYKA 4A3FH 2B29A 1UNSA 5IGDA 5DEHA 2JA6G 4HR7B 2UUCQ 4KY6A 4B3TQ 4YCUA 3G48A 4HJ7A 3BBZA 3D2NA 3H3VC 4R7GA 2FMPA 3KD3A 1F77A 4NWIA 5KIXA 1G6PA 4DR2L 2XFSA 4UAYA 4FVMA 2W3RA 4DV3L 1O7ZA 1ORYB 1RKNA 1L3UA 2ISOA 1XJVA 5DDMA 2RA4A 4M9GA 5IGBA 2QCPX 3MBYA 1PHJA 2Y0SG 1EY0A 5EPJA 1G6ZA 2ISPA 3RRGA 2N1RA 4M2YA 3K7AB 4IURA 4DS4A 1NJXA 3KF8B 1BPBA 5KFFA 3OHBA 1L2CA 1STYA 3PIO3 5ALKA 3VYUA 2WF8A 3TADC 3TFRA 1E3PA 4A3BH 1G41A 1CKNA 4IUTA 2E1EA 3E21A 4CE6A 1GXDC 2WB1G 1WWUA 5AKKA 5KFIA 1WTHA 1F44A 2IMWP 1HXYD 1WD0A 4QCLA 3T53B 5HMLA 4BWGB 4BBSH 3CRKC 8ICEA 4LF4Q 4S12A 1TWGB 3U5ZA 5ALLA 1CM9A 3FUWA 1GOZA 4G4RA 9ICUA 3NK9A 4MZ9A 3SQIA 4K0KL 4LMQD 2BCOA 2JZ0A 1IBKM 3OIQA 2JY7A 4TQRA 2MA1A 1H9SB 1B53A 2O5JC 4O5KA 5M3MG 1PYBA 1CK1A 3V72A 1JJCB 1RTOA 1Q86C 5CBAE 1S4ZA 4HIOA 4K8IA 2WSCF 2LHCA 3D6JA 1IL8A 4BA1I 2K6AA 3KSXA 1NY4A 1B7YB 4F72A 2R62A 3IECA 1VQ1A 2BR0A 1NKCA 1FFVA 4YQWA 1OQYA 2F0EA 3DWQA 4F88A 5L1MA 2A74C 5EKLA 3DDHA 2K50A 4AYBC 3FM9A 3DA1A 1JI7A 4DR4M 3T1HQ 2FMSA 3EA6A 1S3SA 2JSOA 3GLHE 3I8ZA 1PMRA 5J8YA 3Q8KA 1QZHA 4NXML 2ZIXA 2E8MA 1TS4A 2CQAA 4GIPA 4DR3Q 2FLPA 2NZ1D 1R4PB 3NE5B 1UQVA 2W55A 2AGPA 5C3EB 2H5XA 1X54A 3W68A 1PRTB 1Y8GA 4ICAA 2IY5B 5KFUA 2KXEA 2WAQB 3G71A 1A5TA 3GTGH 3CCSA 4ECRA 2RCFA 3H4MA 1HTPA 3T5LA 4XIGS 1OXTA 1HR0M 1CQVA 5JRTA 4A3KB 5KG2A 4I2EA 4K8JA 2F2AB 2BQRA 2KEEA 2QA4A 5EP4A 3M9NB 1MHWC 4NW2A 5ALMA 1G59A 3CCRA 4JN6A 9ICVA 4B9UA 3IKJA 4LZDA 3TWLA 4UB8U 5DB7A 5CHGA 2KZZA 5KYLA 3AM9A 4RF1A 3BXWA 4CHTB 5KFNA 1IYUA 1Q81C 5EXSA 4Z6YA 1Y1VH 1SNDA 3L7ZC 2R92B 3ALRA 5CC4A 3QB3A 4MN3A 1RHPA 1IXRA 5JI2E 1G2TA 5IZ7D 2RBMA 4NPSA 1UE7A 2F0SA 1L0WA 5HURA 1NSFA 1R2YA 2G06A 1WIVA 1S0NA 3U6DA 5FO9B 2ASDA 1W2BA 2D3DA 3F2DA 2KD1A 5C3XA 4IFDJ 2OTLA 3SGIA 2O4XA 4JYAQ 3CU7A 3ZJYC 4M0WA 2XFTA 1MN8A 5FK9C 2C98A 4G7OC 1W5TA 2LHTA 5KT5A 5EQTA 4F5OA 4XT3B 1K8GA 1VF5C 1RQLA 2LHGA 2RSOA 2C5CA 2KHJA 4J9OA 3MFYA 1WTQA 4QW9A 3T3FA 1DOKA 5DBAA 3KHLA 3HOZG 4UQGA 1K3BC 1VG5A 5C5LA 4CJ0B 2I5HA 1W5SA 4H0LC 5CMDA 5KYIA 1TK5A 5C4JB 8ICIA 3FKEA 2L4EA 2LBOA 1U49A 8ICCA 7ICLA 2V1CA 2W9AA 2F52A 2J4XA 4MGKE 1XPOA 1V38A 4R4IA 1TF0B 4C3IG 5DG7A 1XMQL 1AP0A 1SG9A 4F91B 1L2BA 4AQYM 4O3OA 1NE3A 1BBXC 2HHHL 3P20A 2WSEF 1LTLA 2X8AA 4GOPA 1AN8A 1MBYA 1UM8A 3UK6A 1RYSA 5I2YA 2MUTA 1E1TA 1NJGA 1BBUA 4O3MA 3IM1A 2PXIA 1PJSA 2EYHA 5M3FB 3UMGA 4MB7A 4B3SL 4Q8FA 3RJJA 5M5WH 1S40A 5EP3A 1L1TA 4JI5Q 4IBIA 4J9MA 5F2DA 4DOAA 2XGNA 3DZDA 3VR4A 2VJ4A 2QZ4A 3UDFA 2WKCA 2NRZA 1JALA 3TQ1A 3EYZA 2W8KA 5L37A 3GTMB 4R1JA 2HVHA 5TISU 3T5HA 1SN8A 1NJYA 2KCCA 2RSNA 4O3NA 1JC7A 1HZBA 5AM2A 5JOBA 2I5MX 1LB2B 4DL4A 3RBDA 4UB4A 1B3QA 1NKBA 2EYJA 3JPPA 2WIIB 1EIGA 4DUYL 1HNXM 1HR0Q 3GTQH 5KFMA 1TAQA 1V85A 4DFKA 3D8BA 4LJZC 2A5YB 5CV4A 4OEMB 2J6UA 3UZUA 4LF8L 1NK4A 2Z6KC 1PTOB 4X64L 5ITQA 2ICIA 1PH6A 4A3CH 1ASYA 2OQ0A 2DJGC 2VS1A 4LUOA 4QWDA 1PFMA 4DV6L 4KLFA 4X6AH 2F0DA 3MABA 1K28A 3NS1A 2WP8J 2CKZB 3GILA 1WCNA 5HHIA 3ORYA 3CQZB 3M7NA 2V4QA 3J81S 2CFMA 1XMOM 1L8OA 4CBVA 3RB3A 2EKFA 2LI6A 4LF7L 4GNXB 1Z4OA 3L2AA 1HIWA 1IIPA 1I50B 2PMZF 4EQPA 4I2GA 3EJIA 2AQ3B 7ICPA 3KYHC 1CUKA 4POFA 1X42A 1S3OA 4A3FB 1ZQCA 5A2QS 1X3FA 4LWCA 3R2IA 3GTJH 1SNOA 5AM4A 1SXTA 5AI6A 1RJTA 4DV3M 1ZYRC 2LTUA 3HZJA 3NUQA 4F7XA 2ALZA 4RAUC 3IRUA 4GLVB 4OVZB 4R66A 2JXNA 4LRTA 2KJXA 2PNHA 1IZ6A 3KDSE 4RQ6A 2XVTA 4LZZA 1ENFA 1DJRD 2K52A 2DAMA 7ICGA 3B7ZA 3FUTA 3HKZB 4KT0F 4QHTA 4A3EH 1BGXT 3HHYA 4EBCA 1XNRL 4M6WB 1NV8A 3GZFA 2ZT9C 2ENBA 2F0QA 1PH9A 2B2UC 2QDBA 3T13A 1T6OA 2G09A 4O9MA 1BO0A 4QIWB 5ALXA 5J1ZA 5C0XI 4A3BB 4ABNA 4A3GH 2PQAB 3KW6A 4DQIA 1KLUD 1B43A 1HNWL 2MHVA 3AJIB 3QE9Y 2H4OA 1I4PA 2CH4W 1JQJC 1EEFD 1HFNA 3TKAA 4P0PA 4QL5A 5GAEC 5LMUM 3FYHA 2KE7A 3GLGE 1L6NA 4YP3A 4AKHA 3D2SA 5KFKA 5FO7B 4M9NA 3D6WA 4NC6A 1S10A 3I04M 1QB5D 2BKEA 3C1YA 1N32M 4HN7A 3PR4A 4F93B 4OX9M 4EYHB 3JAMi 1KYIA 1X6IA 3AMUA 2VUMG 4KTAA 1BUVT 4QWAA 5CR0A 2UUAL 2OTJA 3RH5A 3NWLA 1PFNA 1HHVA 1N60A 4JWMA 2KRKA 4PG3A 2EIFA 2MRLA 1URJA 1IW7D 4B7GA 1LUZA 5AK4A 4TQSA 3HKZF 2A8VA 4B3ML 4DV4Q 4JI3Q 4NXMM 4PGQA 2K05A 2FS1A 3BS5A 2B2YA 5GKNA 4E6IA 4G4QA 5KFEA 3M4PA 3BG3A 3WHLA 4L16A 3L28A 3HOWH 5C0YA 4IPCA 3TZDA 4RQNA 3A42A 2DXIA 4RA8A 3VK8A 5IE8A 2D6FC 4RHSA 3K0YA 2RRDA 5JEAG 4LW1A 4DV5Q 4EX5A 2K4HA 2OHFA 4I7AA 1T3NA 1YBYA 4L15A 3Q8RB 1JX4A 4IPHA 1Z3EB 2JUJA 2EYOA 3ZI4A 4ALPA 4G3IA 1I4QA 2CW0D 3EROA 3GTGB 2JA7H 1KHIA 2DKXA 1GKHA 1VQAA 2NTSA 1WVLA 3DM1A 4DV7L 3ZDAA 1OXSC 2LYAA 4KODA 3MFGA 4IC9A 1IBLQ 2XZUA 5T1GA 3GTKH 1B44D 2M60A 1QJOA 4RKBA 2HIXA 4DO9A 4J8QA 3MC1A 1VDVA 1AZQA 3LWUA 3JAMS 1HQCA 3EPIA 2A1JB 2GVAA 3UMCA 1KDBA 3H8WA 3QXGA 8ICHA 4NJ8A 4DLGA 2QARB 3UJNA 1EFID 1GUNA 4GKKM 2L9HA 2F1JA 4DR2Q 1Y1VB 3A46A 1NZPA 2NRTA 1SGGA 2JZBA 4DXFA 2F0OA 2DGZA 1BCPF 5AKIA 2Z6BA 2OQ4A 1BPDA 2DAKA 4JV2A 4DAPA 3HOYH 3I28A 1A3VA 2BPGA 2QKQA 5KG7A 3MDCA 8ICLA 3FPUB 3UQ0A 5EQ0A 1D0LA 4UP9A 9ICXA 4NMZA 5EE0A 1X65A 1I5FA 1LTAD 2KG5A 4JXJA 1N36L 5HY6A 5ITUA 2DKZA 1RODA 4AKIA 1QWYA 3BZKA 4RH6A 2VB2X 1R9TH 1RG6A 3VYSA 4FF3A 4KLJA 4R71A 4BY1H 4JBWA 5KL1B 3I72A 2JA9A 2AQ2B 3MR3A 4KLDA 5ALNA 1GJTA 4V190 1UAPA 2CUZA 3J7AV 1S5CD 2PFQA 1Z5CA 1K83H 4K0KQ 3GQBA 2W7PA 4GHAA 7CATA 2CWPA 5KFSA 3TADA 3LVWA 1P16A 2BGWA 4DU9A 1XMQM 9ICKA 4J9PA 4NXNL 3GPXA 1VEKA 3WK5A 4XTCS 1NNUC 2BCRA 4R4CA 1SE4A 1VQNA 4O42A 1ZMWA 5EJCA 2XY7A 2XCAA 2LVOC 1VQJA 3FKIG 2PMZC 3K1ZA 3KOOA 4POGA 1ZJMA 4DEZA 4L63B 1RL2A 2FI1A 1DGHA 2FHTA 2Z8LA 5G5HA 4RKUF 3MVVA 4G4OA 2FINB 4PZ8A 1OXJA 5IP7H 1X37A 3JC66 1IXZA 2K5NA 2VW9A 3PW5A 2DHYA 4JVZA 1VF7A 2GVBA 5L8RF 5M5WB 4YMOA 3VK7A 1XWEA 1AE3A 8ICGA 1K3RA 3QU9A 4IN3A 3HKSA 4US9A 3NELA 4DV2L 2OYYA 3QUCA 3RRHA 2OM6A 4PZNA 4UBBA 2R0IA 4CKCA 3RZOH 1TS5A 3KF6A 5GAGC 1T94A 1SBBB 1XU4A 3CCQA 4ED8A 1EOTA 1TQOA 1Y8NB 3PNCA 3BS1A 2Y1IA 3KLRA 3FMCA 3K5MA 4RFBA 3NVZA 4RGTA 2NN6H 3GTQB 2PW5A 4LVSA 5L1LA 1L1OC 3L26A 2DGYA 4TQUS 1G91A 2FPKA 5C0XG 2NN6I 3PO2G 4X64M 1EIYB 4A3MG 3LX0A 2ZIWA 4EEYA 4DBGB 3WU2U 4IUQA 1TGUA 3E5SA 5AKEA 3MR6A 3GIIA 4QW8A 9ICWA 4GC9A 4UB5A 3T1YM 1MQ3A 2YFQA 1L3SA 3RGSA 3L3OC 4C3JH 4JI1M 4ELVA 1X55A 3W3AA 2MFIA 2LVPC 2DY7A 2M00A 4YHHQ 1N56A 4BWJA 4ECUA 4G4KA 4L8JA 2YU9H 3VYTA 1IN4A 4LF7M 5EKKA 2L0CA 3CCJA 3QU5A 1IKLA 5LMNQ 4GZYC 5IWAM 2RHFA 3AL0C 2OXOA 3HRDD 3ZDCA 3GQ4A 3CF0A 3H40A 1JR3E 4R8IA 1GHJA 2QB1A 1B22A 1CKNB 2F0HA 2XRSD 1Z5AA 5J2DA 3WKBA 3M85A 2ERCA 1VS0A 3PW2A 1KKXA 2EA0A 4OELB 1SXJE 1QAQA 4IL6U 4EQNA 4WJWA 3ISBA 3U5ZB 2O6KA 5J2AA 2K89A 2Y0SB 4MIUA 2XSZA 1J09A 4TURA 3GTJB 3PF5A 2WF7A 3PFIA 1P3QQ 4XQJA 3GPUA 3GPYA 3M6ZA 4KX3A 3J81c 2IX0A 1ZQGA 2CRUA 2CEAA 2WV6D 5M5XH 9ICPA 4YD2A 2VKQA 2Z9HA 1PZNA 2AMCB 3A45A 1XNRM 3OTOM 3SAFA 1DGGA 1B50A 2L4NA 9ICOA 4J9RA 4XBOA 3OW7A 3QUBA 3LCVB 4BXXH 4D82A 4PGXA 5EOZA 1KFSA 3ZDDA 1EUJA 4EQOA 4G3OA 2XSZD 2ESEA 5IGFA 4JG2A 2UXCL 5K36G 1TDZA 2PPBC 2OF1A 2AQ4A 1N34L 4Q0FA 5AIBA 1HNWM 3GLIA 1UHUA 2DVWB 2HHHQ 4CIZA 2CV2A 2Q2UA 4F4WA 5IT9L 2KOLA 4A3GB 4HMJA 3AYHB 4C3HG 3KOZE 1V1PA 2SOBA 2ZIXB 1DGSA 3E46A 1TWHH 2RKOA 3PZPA 1KNEA 2YTXA 5D4BA 1E9RA 3A8IE 4B3SQ 3D4RA 4YD1A 2A1AA 1HFGA 4R9WA 2AH5A 4ZQ3A 5J0QA 4I2CA 8ICVA 1PVOA 1AEXA 4JI6Q 4KN4A 3FE3A 2BPFA 2Y0SF 2UUAM 2K04A 3CHBD 2FLNA 4FE3A 4M0AA 1BCPC 5IYDH 1BF4A 4BB9A 2UXDL 1E7ZA 3K0XA 1Q3VA 4B3MM 1U47A 5JJKA 4GHLA 1A77A 3H0RB 3P1HA 1SL2A 4ME5A 2K60A 1E2VA 3HJEA 2OQKA 4DUYQ 4XK8F 3U61B 2WB1F 1ZD4A 2AWNA 4NDXA 1J5EL 3B0XA 4PMWA 3FAHA 1E94E 3GTPB 4LF8Q 2L6OA 3RFAA 3W1GA 1VQ4A 3HOWB 4LNQA 1WR1B 5IT9c 3DUZA 1M6YA 1EYGA 1QSYA 3RJHA 4Z6EA 3W67A 4YVZA 3CP0A 4L6V6 2LFNA 4DF7A 1E9SA 5ITXE 5DYIA 5ALVA 1SNMA 1LV9A 5JEAJ 4DV6Q 4RF0A 1LTBD 3K81C 4IR1A 3V6KA 3WK4A 5IIMA 4KLQA 2DWNA 3K9PA 2B3GA 3RGPA 5KTQA 4I29A 1JORA 3WK6A 3P75A 3J80S 2LPEA 1GVNA 4LF5L 4FBUA 8ICRA 2JA7B 3LQRA 3HGIA 3H3VH 1X9WA 1N5XA 1HA6A 5J2KA 4EX6A 2Z6KA 4CCHA 4RU9A 1GKIA 1SRUA 4JV0A 3H3VI 3U6EA 2D0PA 1DO0A 3K59A 1PYSB 3GTKB 3L5KA 4CJ6A 5DNYA 3GLFA 3PUWA 1F4IA 1TVXA 4ZK9B 4TKOB 1J6QA 2PFOA 2KNVA 1IFYA 3K7UC 4P75A 2B8GA 4X3UA 4A3LH 3Q8GA 2QKIC 4ZPXA 1SE3A 2JQOA 4A3VB 1WTWA 1ZOLA 4DN4M 2KZSA 5AJ3L 2BCSA 4BDPA 1C4QA 1FD7D 1JN3A 3HHZA 3D4WA 2NVTH 8ICJA 1Z59A 2K32A 4B6JA 5AM5A 1BPEA 3GRRA 4G9BA 3SDZA 1OIPA 2HDOA 1U5KA 3K6OA 3HOYB 1QZMA 3EW9A 2DWZB 1N36M 1HT2E 4L5SA 2W82A 4A93G 2B63G 1ZXTA 3JAMc 4XQQA 1Y1WH 1U4RA 4QZHA 1K8AC 5EXTA 4JWNA 1UFZA 5J0OA 1UWVA 1XTDA 3MXUA 4AZFA 3KOYE 4IBKA 2K8CB 4U68A 3Q8SB 3KBGA 1HZCA 3HJQA 1ML0D 3TSSA 4PV1C 4GEWA 2DWMA 2KJ9A 3K75D 1R9TB 2YMPA 1J8IA 3B9PA 2XLJA 2YQEA 4BY1B 1JXLA 4UN2B 4O5CA 2NO5A 2HL7A 1VQPA 3GO5A 2B2UA 1K83B 3F92A 3VKGA 2CCZA 1ZQUA 4A3DH 4JI7M 4NXNM 3QX7A 2FJ2A 3Q0AA 1STBA 1ICFB 3KBXA 2FPMA 3SAUA 3LK9A 5JAVA 1N63A 3ZCBB 5KNIA 4BY7H 2BA0A 3T4AC 2F0IA 1W3SA 4UASA 2UUAQ 1EQQA 3OWFA 4YY3L 1K82A 3V7LA 2ODGA 4KN7C 1CI3M 5J3BA 1M8AA 1FJGQ 1L5UA 1B2TA 1M4VA 4CDDC 4LJ7A 2RDIA 1E2WA 1KIXA 3V7KA 4B3MQ 3PUYA 7ICKA 4HTHA 1SLJA 1EFWA 1HPCA 1ASZA 1C7YA 3Q22A 3PX0A 4WJ3M 5C5MA 2F4VL 1DGBA 4RGMA 3ZQJA 4FZNA 2W7OA 5EKIA 4DOCA 1BVSA 5CEHA 3ISDA 5CYUA 5J0SA 3PW4A 1QDTA 4XDXA 2Y9UA 5FTLA 3ISCA 4C4RA 4DV2M 5NUCA 1SWWA 4NLKA 3U6SA 4BBRG 2CE7A 4A3IH 4ECXA 1SSOA 3GIKA 1VDLA 3S17H 3FTDA 2R8KA 4LF9M 2DFLA 5AI5A 2RGHA 1N61A 1X3QA 1SMXA 3R9XB 4C8LA 2BDUA 4UB1A 5HP4A 3RZOB 4RQ7A 1AUAA 4IOAA 4DV7Q 4G7ZC 5KFHA 3RFWA 3IV6A 1OFIA 1N62A 1KRPA 1XPRA 5CV6A 2TSSA 5KG6A 1TS2A 2W03A 2ATWA 3PMNA 1W6KA 3QU7A 3PUXA 2EZZA 2P6UA 2ATLA 1E22A 4QZ8A 4DV0M 3D8LA 3RAXA 5C0XJ 1YJWA 3ZC7B 1G71A 3VYRA 4QWBA 4W5WA 5A2QE 3H4DA 2F8KA 1VJ5A 3J7AF 1VQBA 1PZJD 3AN1A 3ULJA 4F71A 4C3JB 2XIDA 1N78A 2FOIC 3Q23A 3RE8A 3GIMA 4ECQA 5EBCA 2M5ZA 1FGUA 4YR0A 2GOLA 2KEBA 5ELBA 2YU9B 1T8EA 5FTMA 3V96A 3V7JA 2AWOA 7ICTA 3SATA 4KJNA 2F76X 1TE2A 5KAFU 1LT3D 4IQTA 2CPRA 3BZDB 4HIMA 1DD2A 4OJ5A 1N36Q 4U6PA 3C2MA 5DLFA 2O01F 5DFLA 1EFUB 3MMPA 2JMGA 1QYRA 2AGOA 2WB1C 2B2TC 4LZGA 3ETRA 4OO1G 3HJSA 3QYEA 3GV3A 4R8UA 4P0PB 4F2SA 1SXDA 3I4NG 5CP2A 2JY6B 2F5NA 5E3FA 1SV0C 1ZRNA 1Z00A 1JWUD 3E0JA 4QUFA 1QCBD 3UXPA 1I6VC 4GMQA 4OJ6A 1ZQIA 2K8BB 3PUVA 1XSNA 1O7LA 1S72A 1JE5A 1QQWA 1SAPA 3RB4A 4I81A 5M5XB 5ALYA 4RQ0A 3G6EA 1KFDA 2HD3A 4QF4A 3F2BA 1K0SA 4QQBX 4IBGA 3EUB2 2QBYA 3SENA 3HU3A 5L1JA 4IJFA 1N34M 5J2CA 2VZAA 4KKTA 5IT9E 2DUDA 1G8ZD 1PJJA 4C2MH 1SZPA 2ZJPA 4OWWB 2DPJA 1B4FA 2HI0A 4TUWA 1EY6A 1DV0A 4RQ8A 2R4JA 3GTOH 2K9DA 3BS5B 2E8OA 3TFSA 1HUNA 4EBEA 1B3AA 3WWVA 4J9KA 5FLXS 4WJ3B 4TVAB 5ALWA 2F3WA 4CKEA 9ICMA 2KICA 3KP0E 1QCKA 2HOIA 3NTUA 2KJ5A 5F3WA 1TWHB 2E2IH 4RNAA 1WI5A 2Y9TA 5KO3A 3HOVG 4UDUC 3TREA 4C7YA 2PFPA 3OWEB 3URYA 4XYOA 2F0UA 4ECWA 3U6OA 2K0BX 1LTMA 1SNCA 3WOEA 3BZCA 2ASLA 4DV2Q 4O5EA 2UXDM 2QQ8A 1YHAA 4QNLA 3KJOA 1NK5A 1G8PA 3M0EA 4YWMA 1PZKD 1FFUA 2NYZD 2Z0SA 1YJNA 3PF4A 1XXHE 5EPKA 4B3RM 3GV7B 3S2DH 5DDYA 5FKAC 5C44G 4QHSA 2F44A 1C0AA 2R93G 8ICFA 4RQMA 4GC7A 1J5EM 1XNQL 2CN1A 5KFRA 2K5HA 1FVIA 4IRCA 2OWOA 4APVA 3WK8A 3CTWB 3LWMA 1YUBA 3K5OA 4RHRA 3NSWA 5JVH3 1UCVA 2G08A 3H91A 1SL0A 4B9LA 1Q39A 5EWFA 1OXXK 2GQFA 3ZD9A 2ASBA 5B5EU 3JAME 1XO0A 2HUGA 4LJXA 4MH0E 1PDQA 2Q8TA 3RN2A 4NSOB 4EGVA 4CDGA 5KFVA 4GKJQ 2JZBB 2IOHA 3A0BU 1MSGA 5IYCG 2C2EA 2UUBQ 3H09A 2KTQA 1VDDA 2ZJAA 3CF5A 3PO4A 4P72A 1L1OA 5IYBG 4CJ1B 1EWCA 2V1UA 1TR8A 3FC4A 3U4ZA 1IY2A 3QR8A 2KHHA 2BH8A 1DXSA 2KIVA 1TXYA 2D2CC 1X9XA 4O2DA 2RQ5A 3D4DA 1VQ7A 2Y0TA 2PZWA 5AIAA 3WKAA 2BE5C 2P6RA 3HOXH 1G4AE 2FMQA 9ICHA 1YJ9A 3A54A 2VY3A 3UMMA 4N9TA 4PPXA 5CV9A 3ZH9B 3SEBA 5AI4A 4JI2M 1XWLA 4UAVA 4PQXA 1SFOB 1LVHA 2Z4SA 1ZQYA 1PTOC 3NTIA 4JBJA 2NVTB 2ZM6Q 1T7PA 1GVPA 1YHBA 4K2LA 1NBWA 2VDBB 1LT6D 3MGHA 5DG8A 4DV1L 2FNAA 1JT8A 3TAQA 3F8TA 1QZEA 3VKHA 3UQ2A 2Z3XA 1Z1BA 2GA4B 4YR2A 3NWSA 2LXJA 1WCMG 1Q46A 5DGAA 3PV0A 3AU6A 2VA3A 2R7DA 5J39A 4NM2A 2E5LQ 2UXCQ 2K5VA 1HRJA 4B9NA 1S97A 3OOCA 1H38A 3GV8B 1N34Q 4R3DA 3TP7A 1Y1WB 4EZ6A 2K4IA 3F1ZA 4L4UA 1K3WA 2Q2EB 1LV5A 8ICWA 5ALJA 4ZKCB 7ICMA 4DR4L 4GXIA 1DGHB 3DXJC 4K5VA 4CNQA 1TS3A 1Q8KA 5BPCA 1Q3LA 1ZEQX 2B8FA 1LTRD 1MX0A 2PI5A 1MJEA 4RCOA 1D6EC 1QVFA 3N4MB 5JJIA 5M9OA 2HAKA 1G51A 1Z47A 4FWGA 4P2HA 2CHBD 2G9DA 2XWBB 3S15H 4PDIA 4AYBB 5KQDA 3S1MH 4KLIA 4ECVA 5LHY1 4YY3M 4PGYA 3GD7A 5J2JA 4BY7B 3KF6B 2C5RA 3PNYA 1JWMD 4B9WA 4GH9A 2KUMA 3PO3G 5AKJA 2ZJQA 2CRXA 4UP8A 5KT4A 4DR6M 2F5QA 4RNMA 5IGCA 2F4VM 3M8SA 4OCZA 1SEBD 3ONAB 3K9OA 3PMFA 4EELA 3VFDA 2RGOA 1FNUA 2W54A 2X6GA 1J5EQ 3GTLH 1X9NA 2K5QA 1RD9D 3D3RA 3A5ZB 3BQ1A 1DM0B 2ZIWB 3VC8A 4LFCL 2EJMA 5IIIA 2NVXH 5IIFA 4Y2SA 8ICSA 1JB7A 3BDCA 3TWKA 1WFQA 1VQ8A 4JI4Q 2IT1A 4WURA 2R92H 3G6VA 2UU9M 2K33A 2BNKA 2ZXPA 2VA2A 1FIQA 2R65A 2MJ5B 4ED3A 4A3IB 1GL7A 2QPAA 4ACOA 3GDXA 4UHVA 1UA1A 3LNNA 4OJLA 2KRUA 5DAUA 3S17B 4A3JH 4DLEA 4IFDG 5FTNA 3AQFA 2R8JA 5ALDA 3LCUA 1IG6A 4A3MB 3QOLA 4LF5Q 2AHOB 3OMCA 2P5TA 1SIJA 1BCPD 4B9VA 3CD6A 1L2DA 4I8OA 4IO9A 2ZJ8A 3C1ZA 1JOOA 3OHXC 1IYJB 3GO8A 3FUXA 4PMCA 3Q6SA 4ZRZA 3NBIA 3CCUA 4I2BA 1IXSA 2LM4A 3UDXA 2PI4A 4AG5A 1K1SA 1Q1EA 3U60A 1LT4D 1VQGA 2Z8YM 5EAYA 3PIPA 4NLGA 2LSSA 5ALFA 5BN5A 5DM63 1AH9A 5AJ3Q 8ICYA 2H3QA 3SK6A 1NO1A 4MTNA 1CHPD 5C4XH 4G7HC 1ZQBA 2DHRA 3UI2A 2R7ZG 4DXGA 3NGDA 1IW7C 4F4ZA 1ZQZA 2KA7A 1EWHA 4ECZA 1XTCD 5DB8A 3MTSA 5J0UA 3GLIB 2QB0A 2JA5G 3TMEA 1NK0A 5KG0A 4J9SA 3RJEA 1BR9A 4HJ8A 3AFQA 3L0OA 1Q3BA 3HW8A 3PX6A 3MZ5A 4QY7A 5BR8L 1TK0A 3H0GH 1V1PB 4L6TB 4OO1J 4BBAA 1TY2A 1V1OA 1DZ1A 5KFLA 3N28A 5HGTA 2EXZA 5KFCA 4FCWA 1BXTA 1JWSD 4IUVA 2C99A 4AW4A 1RIPA 1X6JA 3Q8LA 3SVMA 2B2YC 4DL6A 1E24A 1LACA 2A19A 4IQZA 1NY6A 2CQOA 3KK7A 4XUSA 3B89A 1CTMA 2XC9A 1CEZA 1ZXIA 4X66L 1Z1VA 1QUQB 1I4WA 2DUYA 4F4YA 1Z5BA 3U6LA 5KNBA 2C22A 3NQIA 3PIP3 3KHHA 5C4ZA 3M4QA 5EXPA 1C9OA 2J6SA 2VF7A 2D5DA 4C2MB 2F1MA 2KEDA 4AIMA 4Y2QA 2PNRC 1ZQOA 1EOVA 1R6BX 3AEVA 3Q8MA 4JK1C 2F4VQ 1HNXL 2JY8A 3FTEA 4LUZA 2KJ8A 3BQ7A 1IBML 1ILPA 3RD4A 3HGBA 1L3VA 2YN4A 3QYPA 1I4HA 1TWFH 2BJVA 2E2IB 4LJ4A 4RG1A 3RR5A 2BWBA 3TARA 4KN7A 4B9TA 4JCVE 5IY0A 1LABA 4XA5A 2WAQE 5KFWA 5AI8A 1IY1A 2IW3A 2DL0A 5FJ8H 2EAOA 2FFJA 4XYQA 4XXEA 1E1OA 1L2FA 3KZIU 3SASA 2UVRA 2KVCA 2ID0A 1XNQM 8ICMA 1HUOA 3H6MA 1SYCA 4G4NA 2O5RA 3S2DB 4M0DA 2JA8H 1VEJA 2BPCA 4MM3B 2KNJA 1OFHA 4B7HA 5FLMG 1AQ6A 4GXJA 1NSNS 3GLFB 5FSWA 3A0HU 4FZMA 2E8GA 1Z9FA 5KNDA 4F5RA 1L1ZA 4QZIA 4EZ9A 1H9SA 3BVMA 1XC9A 2L09A 3V2TA 2M9NA 4MEYA 4K4IA 3GQ3A 2AJQA 3U6CA 2EE1A 2NQ8C 3S9WA 4DFAA 2ZXRA 2E2DC 4Z6FA 5ELDA 5C3EG 1PK1B 1ZD2P 2GN5A 5IP9H 3C2KA 3QAUA 3PVXA 4OONA 1ZQRA 3TP5A 2WAQG 1JOQA 2KHQA 4FDBA 3L25A 3I7FA 2N78A 2HDMA 3PW7A 4ED0A 2EY5A 3OSNA 3R3OA 3N6RA 3C21A 5DB6A 4YXJA 3T15A 3E6ZX 4UB2A 2F0PA 2JEGA 4IUNA 4Y2PA 1D8YA 3PSPA 1OUQA 3NVVA 3S2HH 4PZ7A 3MAQA 1F9SA 5KG5A 3X3NA 4KLMA 3HHWA 3FRPB 4F1IA 3H0LB 4MGIE 3HOXB 4DSEA 3IG5A 1IN5A 5AICA 4KITB 3BDOA 3RJIA 5LMUL 3A56A 4MGYE 2YYZA 1F5SA 5CGKA 4QZDA 2KVSA 1ZJNA 2G5GX 4AP9A 5CRXA 4DV1M 1L7PA 1KLNA 3PW0A 3AV0A 1D8LA 3ITPA 3V6HA 2OEHA 1PK3A 1KDAA 2D8CA 3SE0A 5GROA 1N32L 1RYRA 2B2TA 2R61A 4CDEC 4OX9L 3FDSA 4RCNA 2YTUA 5CA7A 1QE6A 1COKA 3CC7A 1KW4A 4H44C 1CKMA 5ELEA 3J2PB 2W8LA 1SV0A 2EYLA 1YITA 3IFTA 3RZDH 2F4IA 1TAMA 1KL9A 5FO8B 1SKRA 3TE6A 3TN2A 5TZVA 1WCLA 4K14A 1NTGA 8ICUA 1KBUA 4RNOA 2JE6I 2JZ1A 5CORA 1KNAA 5IODA 1K1QA 2LNHC 1XS9D 3QEAZ 4REZA 1JB3A 4KLEA 1E2ZA 5H2FU 1A0IA 4FWHA 1QTMA 2JH1A 1R7RA 1KDHA 3FUVA 4ZH4A 3S15B 1RU3A 2EAMA 4HJ9A 8ICXA 4RQ5A 1X9MA 1IY0A 2LKYA 2L4FA 4IOCA 3S1MB 2NVYH 1DCZA 1ZD3A 1MSWD 2DWLA 1O7IA 3NBXX 4YMNA 9ICJA 2YMMA 5EP2A 4QWCA 1L8LA 1N77A 2KEYA 3PX4A 4DR1Q 1NJFA 3OHAA 1XNQQ 1BNZA 1ZQQA 2WF5A 2LXKA 5KT7A 5HGQA 4LFCM 1JICA 3I55A 1YE9A 2JEAI 2K28A 1U0LA 3GTLB 3RJKA 3K5LA 5L1KA 1QNUA 3ERQA 2B3TA 4FNFA 1CZGA 3KS8A 2YNMD 1SJED 2F0JA 1RQNA 2MO1A 3PMLA 4KHPM 2NVXB 2IBKA 1PM5A 4B7FA 4LF6M 4KMOB 4PHPA 4QJFB 5M3FG 3ZDBA 3SMVA 3N52A 3TP8A 4HAEA 2OEOA 4KX5A 1U4BA 4BXOB 5J0PA 4GKKL 2NYVA 1Z19A 1GUTA 5DGBA 1V1QA 2LVQD 4A3JB 1TU2B 2G5HB 4LJAA 5FP0A 1PYWD 3U26A 3SXHA 1S77D 5D14A 3CMAA 3HFZB 1KAWA 4EQ5A 2WINB 4DAVA 2DAIA 4X62M 3AB9A 1UPHA 4I2IA 3L2PA 3GLHA 2R6GA 5BN3A 2E8PA 2MP1A 4IUPA 2Q0ZX 5IIKA 5JJZA 5FTKA 4NOOB 4R8UB 2QF7A 1T5EA 4CF5A 8CATA 2XY5A 4I2DA 2D62A 1K73C 2HW3A 1OKSA 1D9DA 1Z00B 5E1FA 3K57A 3QNMA 2SDFA 1SKWA 2CHQA 3E2EA 5BOMA 2C96A 3QWNA 4IJHA 3GIJA 2F1HA 3HKZE 1OXVA 3CGWA 1N8RC 4PZ6A 3A7LA 1TWCH 1IBKQ 5C4XB 2H3FA 3HZXA 5CJ7A 1HZ9A 3WKEA 3BVZA 1CA5A 2MNAA 2HQEA 2F0TA 4QIWE 3DEOA 4GIBA 5KPRA 1EU3A 1NNJA 4LZJA 2K47A 4RUAA 4OWXB 3A0JA 5H1SE 3GFKB 4KN4C 4DSJA 5KG3A 5BR8M 1VMCA 1QAOA 3SD7A 3PSTA 1QVGA 4P73A 1SMYC 4ULLA 2HCIA 3J81i 1O03A 4DR4Q 3I4MH 3H0GB 1Y69U 1D1KA 3VA5A 1ZQFA 2P66A 4CGYB 2RP5A 2BE5D 2Q2IA 1MKHA 3HY5A 4A3FG 3I4YA 3C1EA 3EFXD 1YSYA 3FP9A 1T9HA 1GJSA 4Q7JA 3B7NA 1SXJC 1LT5D 3UPQA 4X66M 2MGWA 1U9RA 5EP1A 2G3QA 4Y7NB 1F2MA 1PTOD 2PMZB 5FTJA 3GU3A 4JYAL 3K1JA 5AM0A 1YZ7A 2J5YA 3FHWA 2QGQA 1GO3F 4DUZL 2E5SA 4XQNA 5FOBB 2KHSA 4NL4H 3N97B 5EWEA 3RLOA 1UE6A 3QWLA 3EVQA 2X4AA 3KHGA 4FS2A 1WTRA 1IBMM 1S0MA 5KRUA 1S5LU 4LG2A 2PZUA 3BYTB 5KQ8A 2FH0A 1C48A 4KLLA 4A3BG 3QOJA 4LFCQ 1YNNC 1FR3A 2HCFA 1RDFA 3G4SA 2NZHA 3BDPA 2W9MA 1W6JA 1UUPA 3NUCA 3KFUG 4BBSG 4MGZE 3MEHA 1TWFB 1VEGA 3MXGA 2LY7A 3NEMA 5JI3E 2ZTDA 2JJQA 4FYDA 3T1YL 3NBHB 4MFCA 2B2VC 2ES6A 3HOUH 4LRSA 5CV8A 5AK3A 4JI1L 1L1OB 3THGA 4YFKA 2N3SA 4DR7M 1AW7A 3D6CA 3RNUA 3RMHA 2JA6H 1N33L 4Q44A 3D0FA 4GRIA 2PQAA 3GRUA 4GN3B 3C58A 5ELNA 2D9UA 2JA8B 3IP4B 1A2UA 2ZIVA 5IWAL 3I1YA 2LVAA 3S1NH 3NVYA 2G07A 1BPXA 2E3TA 2EDUA 5KGUA 3PGZA 2H3ZA 4YG2A 1AFPA 5HMMA 5I4DA 1NHWC 5KFYA 3AQQA 2BDPA 3J27B 3PXGA 3R9KA 2O25A 2L5YA 3EPGA 3I73A 3DOAA 5KFDA 1TK8A 4KV6A 4AG6A 4LJ9A 4KLSA 4C0ZA 4DQQA 3SAWA 3RB6A 1IHZA 3IRBA 2X49A 1F2ZA 1EY7A 3RJFA 3A55A 3OTOL 4S3SA 3T5JA 4CISA 2JP1A 4GS3A 1MJGM 4IRDA 5LMNW 2PYKA 2HSZA 4O0AA 2LKVA 1A8VA 4DGZA 1SB3C 2H3IA 1FO4A 2Q8IB 1EQRA 1JE4A 2F77X 3HJ8A 1VQKA 1QQ6A 3RH4A 1TTEA 2DJFC 2CV1A 1PH7A 4AQYQ 5M3MH 3T16A 2PI2E 1CZWA 1NJIC 5F9LA 3S2HB 1SNPA 4J9LA 2HHVA 3F53A 4IQUA 2Q2HA 3M7DA 4IBJA 1ZQDA 4HLQA 4F5QA 4HSPA 5DLGA 4I5SA 3K5NA 1NMFA 1HUMA 4HIDA 4I7ZC 3K1RB 4DF8A 3BJYA 2DF4B 4N9PA 3U6MA 1KAAA 1Z7TA 4Y2XA 3NWTA 1Y1VG 2LXEA 1S5DD 2DZLA 1SE2A 2YB4A 1OXUA 2BQUA 4X66Q 1U9LA 2K4KA 3UXOA 3AQEA 2HOFA 1Y88A 1QUSA 3M3YH 4CF4A 1NV9A 4OIKA 4ED1A 1EY5A 5AKGA 1IN6A 4C8MA 3RZDB 4M9JA 3JPTA 4BX9C 1YNXA 3C28A 1CRXA 1RPLA 1VDZA 4NSRA 1FGBD 3GTPH 1HNXQ 4KD3A 4PHDA 3A74A 1BCPB 2JEIA 5T1IA 2QLTA 1TKDA 4RPZA 4Y2YA 1D5MC 4DPGA 3KTQA 4PL1A 1TDHA 1OTRA 1L3TA 2DQNB 5KT2A 4ANRA 1MC8A 2E2HH 2I0QA 2JWSA 1V33A 1TH2A 2QEXA 4JK1A 1GLNA 4P0QA 2E76C 5F3XB 2NVYB 2VXWA 3GP7A 4Z6CA 2LYHA 4Y2TA 2RQXA 1WGNA 4LF4M 3S1QB 4HCEA 3ER0A 2PCFB 1XMOQ 2ES2A 2EUCA 2PI2A 4MFFA 2RDFA 2RDGA 4DNTB 1DO2A 2EYPA 4YCWA 2CP8A 1IXSB 2ZAOA 2ZIUA 3S6JA 1PV4A 3KZXA 1DGJA 4DOBA 2B0CA 1BNPA 4DS5A 3U60B 3GLGA 4DCCA 5BPVA 1QNKA 2C28A 1G2SA 3OMGA 2WF6A 2KBNA 1U48A 5KFOA 3BQTA 4DV3Q 4ED6A 4C8NA 3D31A 3MFIA 5KT6A 2A73B 4Q5VA 2KSOA 3V05A 1HZAA 4IIWA 4DF4A 2R46A 1RCVD 4KY7A 4DV4L 5AI0A 4P4PA 2JH7A 4NRVA 4K4HA 4GN5A 3OJUA 3HOZH 2QB0B 4DR3M 2EJFC 7ICHA 4U7CA 2N88A 2IOFA 5CR3A 4M9LA 3C5FA 4J03A 3JR5A 5C3WA 5E79U 1X56A 8ICNA 2E2JH 2Y0SE 2KZMA 4DV5L 2EQYA 4Z6DA 4DFJA 1ECWA 7ICJA 5DLQE 3HX3A 4FF2A 1B70B 4C3IH 3LW5F 3M4OH 4RUCA 4MNOA 3KKAC 1XXGA 2MU2A 5IIOA 2LS01 5LMUQ 5D65A 3SFZA 3GQ5A 3KLSA 4KTQA 9ICFA 4DAMA 3H4BA 1N9WA 4M04A 5EGTA 4A3CG 1N48A 4TUSA 2L15A 1TWCB 2R7FA 4JI7L 1N32Q 4D81A 3BQ0A 4JMUA 4OX9Q 4DFMA 2K8AA 1GJXA 5J0XA 1SNQA 5IREB 3Q8QB 4NKLA 4QNMA 3HU1A 1DRGA 3N7RC 1L7OA 1ILQA 1QSLA 4HEDA 3FVQA 2A6EC 2XEPA 2F03A 5CB1A 3SYZA 2QP9X 1TR5A 3FYDA 5HR7A 4N8X1 5EXXA 2EY1A 4RQ2A 4QOSA 4NXMQ 1ZMVA 1G3IA 2NV3A 3HG9A 4BS9A 3I4MB 4NLZA 3U6QA 5ISRA 3OIPA 1LKYB 3UDIA 1MJCA 4KLUA 1CFMA 1AIPC 9ICCA 4I27A 3SMPA 4F4KA 4LJ6A 2BHNA 1WJ7A 2A68C 4JYAM 2KENA 4UATA 1ICWA 2IPKD 4JB3A 5LL6S 2WFAA 1B8AA 2K5WA 2QSFX 4DUZM 3EWAA 1XHBA 1B9NA 3L4PA 4LF9L 2QNJA 4WJ4A 2UVWA 1XB2B 3F2CA 4EVOA 4FBTA 4A3EG 3CPFA 1L8QA 2CXYA 2HHUA 3IAYA 1KLGD 4RKLA 2IHNA 1NJWA 1EY8A 5KEEA 4JC0A 4O3PA 1J9OA 1MSHA 3OPXA 4RPXA 3J81L 1ZMUA 1D2NA 4Y2UA 4A3GG 4USAA 2HHWA 1COOA 1JXEA 4DV0L 5JTIA 4YCXA 5ALUA 3AUOA 1EIJA 2C9CA 1ET6A 1QZGA 2QDLA 3HKPA 4WP2A 1NR2A 5C18A 5A2QL 3LDAA 3I76A 2OCEA 1UT5A 3ULLA 3Q8PB 5DBCA 1N33M 4GKKQ 5T14A 5BN4A 3HOUB 4RT3A 1NVMA 3TAPA 2C2DA 4J15A 4C8KA 1DK3A 2HT1A 1X32A 2JA6B 4H13C 1EIHA 3DEEA 2KCNA 3MK6A 3GV6A 2E75C 1VQCA 2EXDA 1TV9A 1S5FD 5KG4A 1BPZA 5L1IA 3SAHA 3S1NB 4XQ8A 4JI5M 4IS7A 4UP7A 4I28A 5HHHA 3MFHA 4OWTB 3U58A 2OH2A 5D3IB 1CT1D 3H8MA 3NXWA 4U673 4LFAL 3P7JA 1SL1A 3HOWG 2KN7A 3F5EA 1T3QA 1NAPA 3MR5A 4JV1A 4K4GA 3PSFA 2YQZA 3A7AB 2WB1B 2HDLA 4UW9A 2I5LX 3JPRA 2NRWA 2FMMA 1TIID 1WTPA 1PJQA 2YR0A 2BOSA 3AFHA 3SK