2H5XA

Ruva from mycobacterium tuberculosis
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
195
structure length
183
Chain Sequence
MIASVRGEVLEVALDHVVIEAAGVGYRVNATPATLATLRQGTEARLITAMIVREDSMTLYGFPDGETRDLFLTLLSVSGVGPRLAMAALAVHDAPALRQVLADGNVAALTRVPGIGKRGAERMVLELRDKVGVAVRSPVVEALVGLGFAAKQAEEATDTVLAANHDATTSSALRSALSLLGKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of Mycobacterium tuberculosis RuvA, a protein involved in recombination.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Dna binding protein
molecule keywords Holliday junction ATP-dependent DNA helicase ruvA
total genus 43
structure length 183
sequence length 195
chains with identical sequence B, C, D
ec nomenclature ec 3.6.4.12: DNA helicase.
pdb deposition date 2006-05-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01330 RuvA_N RuvA N terminal domain
A PF07499 RuvA_C RuvA, C-terminal domain
A PF14520 HHH_5 Helix-hairpin-helix domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.10 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 DNA helicase RuvA subunit, C-terminal domain 2h5xA03
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 2h5xA02
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 2h5xA01
1ZQOA 3UDXA 3OSNA 3MDAA 1ZV1A 2HWJA 1N32L 1Q86C 3T3FA 1YBYA 2VQFQ 2V1CC 2MROB 1EQQA 1YNXA 3BQ2A 3MFHA 1VQMA 1K8AC 2VUMH 3KHHA 4YXMA 1SE8A 4DV6L 2PI2A 4MFCA 4POFA 1TK8A 1S0MA 4DOCA 9ICLA 3CW2C 4G3IA 3I56A 3T1YL 1NJIC 5CWRA 4BXOB 1X3GA 8ICEA 4C8NA 4YWKA 1JT8A 1T8EA 4J9PA 4J9NA 1ZQNA 8ICLA 2CWAA 3HOUH 1SG9A 1IXSA 4QW8A 4C3HH 5DB9A 5DGAA 1A77A 1ZQMA 1N32Q 3PSIA 3KF8B 1MSWD 2JE6I 3BBZA 2DAMA 4KN4A 4IRDA 3S1QH 4RQ0A 4DFJA 1ZQSA 1TWHH 3JAMi 3F2CA 1KFTA 4DV3L 2HHSA 1WGNA 5J0OA 8ICCA 4XIGS 1JXLA 2DPIA 4UB5A 4DV2Q 3FYHA 1ZYQA 2FLLA 3RN5A 3GIIA 1JR3E 5KFBA 5KG3A 2XGTA 4QJFA 3S1RH 3N4MB 2FMPA 2ASDA 8ICMA 1KXLA 1LB2B 2LXJA 2CWPA 1D9FA 1VQPA 7ICFA 1ZJMA 2KHJA 1NOMA 3RBEA 1NKBA 1OXTA 2HQLA 3IRBA 3HOZH 2D0PA 8ICBA 8ICYA 5KG7A 2F4VQ 1EFWA 1JN3A 2VL6A 3AFQA 1HNZQ 4EBCA 3Q8KA 3RJJA 4PHPA 4BY7H 1NJXA 4A3MH 1VQAA 4EYHB 5HMMA 2DNAA 7ICKA 4DR6L 2PQAA 9ICJA 2IHFA 4DWIA 1LV5A 4KLFA 2F3IA 1G51A 3RNUA 3EPGA 3SZ2A 5D46A 4R65A 4HIMA 2LTUA 2JQOA 2Z0SA 3E2EA 1QLNA 4ECWA 3CCLA 2JY6B 4BBRG 1V92A 3OW2A 4YR0A 1N9WA 3H8JA 5EOZA 3S15H 3GV5B 5KG1A 3BJYA 2CKZB 3QEBZ 3PF4A 1HNZL 4JYAQ 3MDCA 3GTKH 3C1ZA 1NK4A 4P4OA 3I4MG 4PMWA 5KT7A 1MJEA 3BJUA 2MUTA 4JI6L 4LFBL 4DQPA 4C8KA 3ZDAA 1NKEA 4RQ5A 5C4JH 4KTQA 1HT2E 4RT3A 2BQRA 3ICEA 4GNXB 1ZQRA 2HHHL 1E7ZA 4I2EA 9ICWA 2MNAA 3G71A 1CEZA 4A3KH 1S9FA 3UE0A 5J2FA 3H3VI 1NK5A 4GNXA 4BY7G 1KDHA 4O3NA 2UXDL 5DLQE 5J2CA 3MGIA 4MFAA 1ZQQA 1KLNA 4B3TQ 4AYBE 1PH4A 4QWCA 2B3TA 5L1IA 4TURA 8ICJA 2CFMA 4OONA 4F50A 2BWBA 3RH6A 1PVOA 4YG2A 1SMXA 4M6WB 4WJ3M 1VQ6A 1VQFA 4QZCA 3HOZG 3NELA 3CMAA 3QZ7A 3EZ5A 4XQ8A 1HNXL 5CR0A 5KG6A 1BKBA 2BQ3A 5KFQA 3PGZA 3M8RA 1NK8A 3MR6A 4ALPA 5KFAA 1TVAA 5KFWA 4JI5L 1QTMA 1Q8KA 3NEMA 2PQAB 1B22A 3RJGA 2AU0A 1ASZA 4LWCA 1QSYA 4I2AA 4BY1G 4FBUA 4ED8A 3PO4A 4BA2I 5KFRA 3RJIA 1R4GA 2XY6A 3AEVA 2LVPC 2H5XA 2BPFA 1QUQA 5L1LA 2VANA 3DM3A 2ZJ8A 4GKKQ 3KDFA 2R8JA 1I6HH 3I4MH 4J9LA 2ZUBA 1NJWA 5E7NA 1E1OA 3I7FA 1K1SA 4BWJA 1OKSA 2LYHA 3GTOH 1Z47A 2JA7G 1Q81C 1Z00B 3GFKB 4JOIC 2Q2TA 3EYZA 2OWOA 4Q45A 4JV2A 2N49A 3TQ1A 1TTEA 2OCEA 4HIDA 2OOBA 1GKHA 4YD2A 4DV4L 1UE7A 2KNZA 4IOCA 3JPQA 4R71A 2QSFX 4M2YA 2FPMA 1WIVA 9ICAA 2W9BA 1S72A 4UAWA 3G6VA 1N34L 1Y88A 1TWCH 4KLJA 8ICFA 1IFYA 4F5RA 2L4EA 3B6YA 4BXOA 2GWSA 4DO9A 4J15A 1EIFA 4KLLA 4LFCQ 2JZ0A 4ELVA 9ICKA 5HY6A 4RNMA 4YP3A 4DF8A 2I5HA 2WTFA 3QEAZ 3A5ZB 4KHPL 3PX6A 4JBJA 3PW0A 2UVWA 4DV7L 1PH6A 2AGQA 2FMSA 1L3UA 1U0LA 4X66L 2O25A 1XNRQ 2IA6A 2ID0A 5IILA 1Z00A 3STBC 7ICOA 2DZLA 5KG0A 1VS0A 2ZTEA 5EAYA 1ZQVA 1VQIA 1SKWA 1UT5A 1G3IA 4DOBA 1Y14B 1NK9A 3UXPA 1KQSA 4ED2A 3CP0A 3HKZE 2NVTH 4GKKL 4DSKA 5L9XA 4BWMA 2GVAA 3PIPA 4NXML 3S1NH 3KDFB 4J9SA 3ZDDA 3Q8RB 3M9NB 4F4KA 4FS1A 4JI3L 7ICUA 3PO2H 1NKCA 1VQOA 4BXXH 4F3OA 2W9CA 3CCSA 4P4MA 2WB1E 2E5LL 4KN7A 3ETLA 3UQ0A 9ICHA 5J0SA 4Y7NH 2KFNA 3H8SA 2HHTA 4GLAC 3HOUG 3KFUA 2JEFA 4P73A 3ERSX 2N8NA 4RNNA 3IHPA 5AJ3Q 2A1JA 1EIYB 3HPOA 3J81i 3EW9A 2DENA 5DB8A 4DS5A 1K3RA 1EUJA 2NN6I 4APVA 4RG1A 2A1AA 1QVGA 1N56A 8ICGA 1AIPC 1ZQWA 1OTRA 7ICNA 4JV5L 2PI5A 2R8HA 1UFZA 3GTQH 1L3VA 1IBLQ 4M6WA 1QZHA 3LK9A 2ALZA 5KT2A 1S0VA 2DHYA 3Q8QB 3E0EA 3JAMc 4J9MA 2R92G 5F9LA 2ISPA 3RJFA 9ICXA 3J80i 1VQNA 4R66A 1G6PA 2JJQA 1YVCA 1BVSA 2ASJA 5BOLA 1QUQB 5IIOA 5IIIA 2WP8J 1U47A 1YIJA 4QZ8A 1N48A 4R4OA 3KJOA 1WOCA 2B3GA 1T6OA 4X6AH 2XY5A 2Y1IA 4UB2A 1XMOL 1KD1C 2QNJA 2MUTB 3GO5A 1MKHA 4J9QA 3GLIE 1EWIA 3FKIG 1UEBA 1Q7YC 1L3SA 1KFSA 2IHMA 5J2BA 1Q82C 4A3DG 3ISCA 4J9RA 4A3FG 3F2BA 4JWMA 1G4AE 4UAZA 4LUZA 3M4OH 1GVPA 4I2HA 4GLXA 1U4BA 3KLWA 3MMPA 1P8LA 1BPXA 1WCLA 2AGPA 5IP7H 2ZJPA 2NRZA 5C0XJ 2VQEL 4DR1Q 4K0KQ 4YD1A 3RBDA 4F5NA 4F2RA 4C8MA 4KLUA 4GKJQ 2JZ1A 4G3OA 1UA1A 3VDYA 4K4IA 1H95A 5DGBA 4L5SA 1RXVA 3B0XA 2KFZA 3PF5A 1HQYE 4NPSA 4JI8L 3IECA 3I4NG 1B43A 4A93G 4UAYA 4DL5A 1GO3E 4AQYL 2OTLA 2JA8G 3TS2A 4JG2A 2PFOA 2NVQH 3CQZH 9ICBA 3U50C 3H8WA 3CD6A 2BPCA 1E24A 1X3FA 1SR3A 2KZZA 4DUYQ 2R8KA 4KLTA 1NTGA 3GIMA 3ULLA 5KFGA 2R92H 2RDIA 2Q2UA 2JUJA 9ICMA 3K9PA 1K1QA 2W9MA 4RUAA 8ICRA 1ZMWA 4RQ8A 1JJ2A 1HUOA 3RR5A 4GOPC 3ULPA 4IFDJ 3T6PA 2NN6G 4JI4Q 1BBWA 1ZQTA 3I2ZA 4YVZA 1ZJNA 4RU9A 1I50H 9ICGA 3PNCA 2N3SA 3H0GG 1A5TA 1XO1A 3RR8A 4QW9A 4LZGA 4LF6Q 2P6UA 5M3FH 3KHRA 7ICIA 3CAMA 3GLGE 4EQ5A 1KHIA 3CPFA 3LGJA 4L5QA 3T5JA 2DGYA 1OXVA 3G6YA 4JI2Q 4P2HA 4OO1G 2K14A 1WGLA 1VDLA 1Z9FA 4C8LA 1I94L 1M90C 4QZIA 2IY5B 4O0AA 1AE3A 3TI0A 5IYDG 1JXEA 3U4VA 2AHOB 4DV6Q 2KZMA 4QZEA 2WAQE 2FXQA 2YTYA 1C0AA 5KFZA 2EXDA 4YCXA 4HJ5A 8ICWA 3J81c 4BY1H 1BPEA 4LF6L 5TZVA 2BCUA 3MR2A 3F8TA 1J5EQ 1L1OA 4ECSA 4B9NA 4Q43A 2WZJA 2IBKA 5KFTA 5FLXc 4Z6CA 4X64L 2PI4A 4YMMA 2VA8A 4KITB 2BA0A 2FPLA 4EBDA 3TAPA 1K83H 1EFUB 2MO1A 2DPJA 1N36L 2EIFA 4BBSH 3K75D 1IXRA 1QSSA 1CKNA 4ECTA 3F2DA 3OYYA 2E2IH 3FE3A 3Q8MA 1BPBA 1JIHA 2Q2IA 1HNXQ 1MN3A 1UE5A 3GV8B 2UUBL 4A3EH 4QZAA 2R8IA 4LVSA 1RL2A 1OXXK 4M9HA 1XU4A 4KLDA 2C35B 4B9UA 4OWTB 4X65Q 5JI2E 4AH6A 1ZQCA 4KHZA 5KFVA 1XMOQ 4DF4A 4LF8L 1Y1VG 3SV4A 1E1TA 3NGDA 1S0OA 4KLIA 2C22A 4RZRA 4PGQA 4JCVE 1TKDA 3C2LA 1K9MC 5J0XA 4JBMA 3OHBA 4ED1A 4GXJA 2BCQA 2BKEA 1GO5A 4YY3Q 1S97A 3PVXA 1XMQL 1VQBA 3NTUA 8ICQA 5J2EA 1TK5A 4MTNA 4JI0L 5EWFA 3CC2A 1VQDA 1D9DA 1I5FA 4HYKA 1ZQEA 3JPNA 2PFNA 1MC8A 5JUMA 4ME3A 1PHJA 3J7A5 1V9PA 1KSPA 9ICEA 1WI5A 2L2DA 1F4IA 4LW1A 5FLMH 2NRTA 1JX4A 1BPDA 2NVXH 1S77D 1I94Q 4F8RA 4AQYQ 3W1GA 2FPKA 1ZQPA 1TWAH 1X55A 1DV0A 2AKWB 4RT2A 8ICHA 5LMUL 2UVVA 1Q12A 4QGUA 7ICPA 1WYDA 4LFAL 3FRIA 4IOAA 4B3SL 2CQOA 1A8VA 2AGOA 3EWAA 4FBTA 1JE5A 2XCAA 2HW3A 9ICVA 4P72A 3E9HA 1TV9A 2BH2A 5KFXA 5KFYA 5M3FG 3UDGA 4UBBA 3HOVG 4YQWA 2Y1JA 1KIXA 1VCIA 3RZDH 2BQUA 3F92A 3E46A 1CSPA 4LF9Q 4LFCL 5M5WH 8ICTA 1MQ2A 3A74A 1JJGA 2WB1G 4PH5A 3CF5A 1EYGA 4Q7JA 4K0KL 4IPGA 4DQIA 5FJ8G 4NM2A 1HH2P 4A3KG 1U9LA 3RN2A 1RYSA 2VW9A 2GN5A 3HOYG 3Q8SB 3N97B 4X66Q 4R4QA 1ZQYA 5GQOA 1PA6A 4F92B 1Y1WH 4DS4A 1KC8C 3TFSA 4O9MA 4QZFA 4JOIA 3I55A 2HHXA 5HGQA 1PH1A 2VA3A 4O5KA 3M9OB 2NZOA 8ICUA 5KT6A 4A3IG 2KCMA 1XSPA 4QZDA 1SL2A 1GD7A 5IYBG 5EWEA 1WFQA 1VG5A 4HEOA 4DR2L 2P6RA 1KL9A 4UQGA 4GN5A 3LCUA 3MGHA 3QE9Y 1HR0Q 2CCZA 1Q02A 2YTVA 2HIVA 1ZQGA 3HOWH 3GLHE 4DFPA 2MQHA 3J7ZC 2YV5A 5KFLA 1QZGA 2NRXA 4CCHA 1SL1A 3KTQA 5LMUQ 1RXWA 2ALYB 2W9AA 1PH5A 5KFNA 3TS0A 5AJ3L 2UU9Q 3V7JA 3RRHA 4RQ4A 3H40A 4E0DA 1K73C 2DAIA 2UUBQ 2ZJRA 1ZQLA 5CJ7A 2J6UA 2I9GA 3H3VH 1T7PA 1UWVA 3M8SA 7ICHA 1X9NA 4EEYA 5DB6A 3KHLA 3CCJA 5KFSA 2EQSA 1XPRA 2KCTA 4MFFA 1X3EA 4R1JA 3HT3A 5GAGC 2ZTDA 3V72A 3MBYA 2JEGA 5J0TA 4ECYA 3WWVA 4UB1A 4X62Q 3FDSA 1MQ3A 4BDPA 2IX0A 5C4XG 1OAIA 5J0PA 1NK6A 5J0WA 5LMNQ 2ZM6Q 4B3RL 4YCVA 3CPWA 2UXCQ 4DAYB 1EQRA 3JPTA 4YY3L 5GADC 1U45A 4XTCS 3HOXG 4JI5Q 3OTOQ 4JV0A 4IFDG 5J2IA 4YXJA 4F1IA 3BU2A 2E5LQ 1X56A 3M85A 2YU9H 4I2CA 2C2EA 8ICOA 1XPOA 4I28A 3PO3H 4F91B 1TR8A 1XS9D 5IYCG 1VQCA 1ZQZA 4R8UB 4O3PA 2BCVA 4B9VA 2K5HA 4RMFA 4TQUS 4BXXG 1XXHE 1TWFH 4IFDI 5KFCA 3SGIA 1ZQFA 2JA7H 3NBHB 2UUCQ 3RR7A 2K52A 4MF2A 1PGYA 2J6SA 1KAWA 4KHPQ 3B89A 4DUZL 5DQIA 3HOVH 1YLAA 4DL7A 3RB6A 4IQWA 5CA7A 4ECRA 1VQ5A 2V4QA 3PCOB 2FLNA 4O0IA 3ZJYC 2I1QA 1ASYA 3C5FA 2OOAA 3A5UA 5KT4A 4UP9A 2RHQB 4IJLA 3TARA 3W5OA 4A3CH 3LWLA 3L7ZC 4F5OA 2BA1A 1BBUA 5IY0A 2LVOC 3T5LA 2P66A 1E3PA 4M9LA 8ICXA 3CC4A 4M0AA 2K75A 3LCVB 2NRWA 3E9IA 2RRUA 3U4ZA 3HOYH 1PZNA 1HZBA 4AYBG 4DV1Q 4I2FA 5GAEC 3G4SA 4KLEA 1QVCA 3ZD9A 2JEJA 4A3IH 5KFKA 2OQKA 4RPZA 3K7UC 1JJCB 2VNUD 2ASLA 2B63H 2IT1A 1YHQA 3MABA 2Y0SE 1N33Q 4I2IA 3CXCA 3EN2A 1CSQA 4BBSG 4LFBQ 5JJIA 4JUZA 3MR3A 3OTOL 3AUOA 5HMLA 1WHCA 9ICNA 2FLPA 4DV5L 1EXNA 1ZMVA 3GV7B 3S17H 2K9DA 2UXCL 3H4JA 4JWNA 1OXUA 2JEAI 4NLNA 1IL2A 4LF5L 1OQYA 2AQ0A 4RQ7A 3CCVA 4PHAA 1C7YA 3Q8PB 4JV5Q 3M4QA 2MJ5B 2QA4A 2BPGA 3PW5A 2ZUCA 4JC0A 2K50A 1IZ6A 2ATWA 4O5CA 3HFZB 4P71A 4DV3Q 2DKLA 4IPDA 4RQ6A 4HJAA 2JY5A 2DAKA 2VZAA 4QWBA 3I4NH 3JPPA 1S40A 2JZBA 4F2LA 3PR4A 1VQ9A 3GTMH 3UXNA 2A1JB 4O3OA 1VQJA 4OWXB 2K5VA 1XC9A 3ULJA 1SLJA 3PMLA 4JI7Q 5IIMA 1KFDA 2YYZA 4YR3A 1E22A 1VQ7A 2KN7A 1JMSA 3GLFE 1YI2A 5GROA 8ICKA 1PFSA 4YWLA 2OTJA 5IE8A 5DG8A 2R7ZH 2MR9A 1C9OA 1VQEA 4DR3L 1P16A 4MZ9A 4NLKA 5IP9H 2QHOB 3FP9A 3CCEA 4RQ2A 1B7YB 4QQBX 5CB1A 4KLSA 2XTIA 2LVNC 4YMNA 2HHVA 3CMEA 1JMCA 4X65L 3TRZA 4DFMA 4EBEA 5DBBA 3SV3A 5C5JA 3QZ8A 5DG9A 3D31A 1G41A 4JI1L 4RPYA 3BQ1A 4GC6A 5ELNA 2UXBQ 1WCNA 3RAQA 5J29A 1IM2A 4A75A 4Q8FA 3M4PA 4IQUA 4NXMQ 1LUZA 3I4OA 4A3LG 3S24A 1HJPA 2HT1A 4A3FH 3B0YA 1N8RC 9ICQA 4UPAA 3K81C 2VY3A 2UVUA 3S1MH 2RCNA 5KFIA 1BPYA 4PHDA 3F1ZA 2KHIA 4YHHL 5ELOA 2C2RA 7ICQA 1PH2A 1ZQBA 1M1KC 7ICLA 1WJJA 4NM1A 3TREA 2W9BB 5LMNL 4B3RQ 4DL3A 2KTQA 1PH9A 1TXYA 1OTCA 1B8AA 4C2MH 1A76A 4KLGA 1Y1WG 2EKKA 3PUZA 2PI2E 7ICVA 2R6GA 2DFLA 5JEAG 4K4GA 4GN4B 1UE1A 2XY7A 4NLZA 2ATLA 4KMUA 3KF6B 1VQHA 3ER0A 1D7QA 1YHAA 3M7NA 4YFKA 1VQ4A 1HR0W 2E2HH 3LDAA 3PX4A 1Y8GA 4AIMA 1CKNB 4QWDA 1ZETA 2L4FA 4F4YA 4DSJA 4A3LH 2B21A 2V4RA 3C5GA 4PZ8A 3FHWA 4F5PA 1TK0A 4IJHA 4IRKA 5KFDA 4FS2A 1GM5A 2AMCB 1N33L 4A76A 3CC7A 1S76D 8ICNA 4DPGA 4DR6Q 2UUCL 2IMWP 5L1JA 3EBEA 1BGXT 3RJHA 5BPCA 4J9KA 4DQQA 4DV4Q 2QEXA 1WCMH 4DV5Q 3L0OA 4DR7L 4TUQA 3S16H 3J81j 3SYZA 1VEKA 3C1YA 4PG3A 3FRHA 1LM0A 1AH9A 5J2DA 1Q1EA 7ICGA 2ES2A 1VQ1A 3BQ0A 4ED7A 1ZQDA 9ICRA 5KT5A 3UDFA 4A3BH 1N36Q 2ZJAA 2BCRA 4M9NA 3TAQA 4IPHA 2HHUA 1RPLA 1NV9A 4LF7L 4L5TA 4I2GA 3RH5A 3PUWA 2FMQA 2UXDQ 4DL4A 4IR1A 3AQQA 4DV1L 4KLQA 1SKSA 4WP2A 1OXSC 2OQ0A 2XCPA 5KFOA 7ICRA 4DR5Q 2ZJ5A 4R8UA 4IQTA 4JV1A 4DV7Q 8ICAA 2JA6H 4A3GG 2IHNA 2BR0A 4ED0A 3V6JA 4GNXC 4I27A 1IBMQ 5KG4A 1UA0A 4MNOA 2JY7A 4QWAA 5C0XG 5KFJA 4K4HA 2R93H 2E2JH 4HJ7A 1L2FA 1Y1VH 4JI0Q 5JEAJ 1PH7A 3V6HA 1SZPA 2F52A 5D49A 1NK7A 3HW8A 1IBKL 3GILA 4DR5L 4O3RA 3RTVA 2C2DA 4Y52H 1N34Q 2DUDA 1YJNA 9ICFA 4QZBA 8ICVA 3ISBA 1I3QH 2Q0ZX 4B3ML 1VQLA 4Q8EA 2Q2HA 4UP7A 4Q44A 3E21A 1WCMG 5M5YH 3S14H 1NBWA 1ZQHA 4X62L 2BWEA 2UUAL 3K7AH 1HZAA 4F93B 4GOPB 2JK8A 2K5NA 3NENA 3PIOA 2D0OA 3AFPA 4RQ3A 4F4XA 4DV0Q 5DLGA 2KENA 2VQEQ 3T1YQ 1KRPA 2RDJA 4B3SQ 4DK3C 2AWNA 4DSFA 2JA8H 5BR8L 4IO9A 1XTDA 3RB0A 1A0IA 3J80c 4DR4Q 4LF9L 3V7LA 4Z6DA 3C2KA 4LNQA 3THVA 4X5VA 4ECZA 1XB2B 1X65A 4R63A 5HHIA 5KG5A 3CCRA 4A3GH 3MEFA 3Q8LA 2LBCA 3M3YH 2E8GA 4DLGA 4M9GA 2MFIA 1SKRA 5HP4A 2ZJQA 4GXIA 1J6QA 1COOA 2GVBA 3UPQA 1W2BA 3PW4A 5M3MG 4GEWA 1X9SA 4OWWB 4TQRA 3RZOH 3MXNB 4IR9A 3UDIA 4PZ6A 4IQVA 4DQRA 1X9WA 3UXOA 1ZQUA 3KJPA 4UP8A 1X54A 5IWAQ 3C21A 3CCUA 4GXKA 2HHHQ 4EYIB 2XGPA 3G6EA 4DR2Q 4BGDA 1TAUA 3STBD 4DFKA 2NRVA 2JA5G 1Z3EB 4UY8C 2A8VA 5C0XI 1XNRL 2WFWA 5C4XH 3Q8DA 4HJ9A 3AYHB 5C44H 5IYBH 1RZTA 3L2PA 4B9SA 1VQKA 4C8OA 1NY4A 3T1HL 4KLMA 4LF4L 4B9LA 2ZTCA 3H7IA 2EJSA 4JI2L 2R7FA 4HIOA 1HZ9A 1O7IA 3HOXH 1VEJA 5H1SE 5K36G 4GC7A 2W9CB 3ZDEA 4I2BA 4BBRH 4PHEA 4UN2B 1YZ6A 1T9HA 5M5XH 1J5EL 3V6KA 2KHHA 1DO2A 2N78A 5IT9c 4RQ1A 5F9NA 1CKOA 5KTQA 2LSSA 3BZKA 7ICEA 2R93G 3H4BA 4JK1A 3D0FA 7ICTA 4DV0L 4LF4Q 4ECUA 2JNHA 1U48A 2RHSB 4DR4L 4ECQA 5J0RA 3A0JA 8ICZA 3GQCA 2R7DA 3RH4A 1TFRA 4DSLA 4IPCA 2W8LA 2F1IA 2BCSA 3JPRA 1XSLA 1FL0A 1RYRA 1DOQA 3BQTA 2JZBB 5JJLA 4QWEA 2YTXA 4OXPA 4LFAQ 1T3NA 1FJGQ 4GS3A 1ZQAA 5HHHA 4P74A 1SFOH 4YN4A 2A19A 1XNQL 5BOMA 2EKFA 4LF8Q 4UBCA 3JPSA 3OJUA 1KYIA 1QVFA 4H02A 2OO9A 3GTGH 4JI8Q 3RB3A 1Q1BA 4WJ4A 4ECVA 2JY8A 4MEYA 4B3MQ 4TQSA 3GIJA 3M9MB 2JA5H 4FO6A 4YWMA 2IX1A 3K4GA 9ICUA 1PV4A 1X2IA 1ZQKA 4F2SA 1XMQQ 3HKZG 1SN8A 4ELUA 2I0QA 3MR5A 4DOAA 3UQ2A 4NXNQ 5IYCH 1HNWL 3RLNA 1P3QQ 2I5MX 2PXIA 1TWGH 4DL6A 3JPOA 1LYLA 2ISOA 4R4CA 8ICPA 1XSNA 2HAKA 3CCQA 4PGXA 4YCWA 4DBGB 4KLKA 9ICSA 2B29A 5J0QA 5BR8Q 4O5EA 1NE3A 3ZDCA 3PX0A 1D8LA 4A3JG 4F5QA 4JI1Q 1S3OA 2MAXA 2F1JA 4UB4A 4KI0A 4XUSA 2UXBL 5LMNW 2VA2A 3FKIH 2LXKA 4A3CG 4MEXA 2ZM6L 3T5KA 5M3MH 1XWLA 3RB4A 2VQFL 1L1OB 1NJYA 3RJKA 2Y0SG 4NXNL 4F4WA 4EX5A 5J3BA 1QZEA 5IIKA 4LZDA 4TVAB 4GLVB 3BDPA 2ZUDA 5DB7A 4UB3A 4JI7L 3PR5B 1PYBA 3JC66 1ZQXA 2LVQD 3AU2A 1IBLL 7ICMA 2PMZE 4YHHQ 1PH8A 4M9JA 2R8GA 4RNOA 3OJSA 1UT8A 3V7KA 4QZGA 3HP6A 1ZQJA 1V1QA 5CP2A 3K80C 2R0IA 1AROP 3EPIA 4DNIA 4I2JA 4DR3Q 1LTLA 3KOJA 1FJGL 3KHGA 2BDPA 2Z6KC 1K0RA 3GDEA 4QIWE 4A3JH 2KNAA 4O3QA 4Z6FA 2XC9A 1HUZA 1D8YA 4JBWA 4DV2L 1DGSA 2R7ZG 1NV8A 1L5UA 3T1HQ 2CP8A 4LF5Q 1FGUA 4TUSA 9ICPA 2XGQA 2XO7A 5IINA 2NVYH 5D4BA 4R4TA 3PO2G 1S10A 4JI4L 2MO0A 3ORYA 4XA5A 4GOPA 5GAHC 3GTLH 5KFUA 2PNHA 4ED6A 2W8KA 1L0WA 3HOWG 4KLHA 1AE2A 3LWMA 5KFEA 4DR1L 4J9OA 2WAQG 2AJQA 2VS1A 3PUYA 1HT1E 5DDMA 3PV8A 2Z6KA 1CUKA 1WJ7A 3OHAA 1KEJA 1B70B 3PUVA 3PUXA 4M04A 1DO0A 1W3SA 4F4ZA 5DLFA 3K9OA 3K8AA 3MFIA 7ICSA 3G48A 3RAXA 4M47A 5EWGA 4PPXA 1Q46A 1NK0A 2C28A 4GN3B 5J0YA 2UUAQ 3RLOA 4X64Q 3H15A 3KYHC 3C2MA 1A62A 2AWOA 4DL2A 5JJKA 4DQSA 4LUOA 4LUVA 4I29A 1RIPA 4A4IA 4PGYA 5DQHA 2PFPA 4DAMA 5IP9G 3IM1A 3RJEA 4JI6Q 4NY8A 1X9MA 1K8GA 1VQ8A 4OX9L 1L1OC 4KLOA 3TANA 2HIXA 4C3IH 1XPUA 4JYAL 4ED3A 2HVHA 5DG7A 5KFHA 1VEGA 4TUPA 3GTPH 1T43A 5KFMA 1V43A 1YJ9A 4DR7Q 3HX0A 1R9TH 4A3DH 1NJZA 5C3EG 9ICCA 1H38A 2F4VL 1S0NA 1JB7A 8ICSA 3PO3G 1IBKQ 5KG2A 4A3EG 2JEBI 4YR2A 4PZ7A 2BHNA 4P4PA 1MIUA 3TEHB 2V9WA 3PW7A 4BA1I 1XJVA 3OGUA 2K0BX 5IP7G 4OX9Q 5IWAL 2QGQA 3UE1A 3ZDBA 1IYJB 4P75A 3G6XA 1MJCA 2M9NA 1ZMUA 1EOVA 2UVRA 4DKAC 4Z6EA 4R64A 9ICTA 3ZD8A 5J0UA 4DSEA 3H4DA 2JP7A 1FVIA 1YJWA 2LVAA 2D62A 1SRUA 5CHGA 4XRHA 3PY8A 4A3BG 4JI3Q 4QZHA 4RPXA 1ZQIA 1PH3A 4O3SA 1E94E 2DI0A 4JBKA 1U49A 2KNVA 2MGWA 1QSLA 4YMOA 9ICOA 4NLGA 4O2DA 2KZ3A 4IRCA 3GIKA 5IIJA 1YITA 1TAQA 2IHEA 2G3QA 3KF6A 1T4GA 3U58A 5C44G 1BPZA 1HZCA 1SL0A 4YCUA 2DAEA 2J6TA 4FDBA 2KBNA 1VQGA 5J2KA 5FLMG 4GKJL 9ICIA 1SROA 2F1HA 4DK6C 3GDXA 4NXZA 1PYSB 2RF4A 4I2DA 3TFRA 4A93H 4DSIA 2CWBA 2K4KA 4QZ9A 1NMGA 2B63G 1L3TA 1A63A 5KFFA 1NMFA 5J2JA 3CCMA 3K0XA 4ECXA 2ASBA 4B9MA 4B9TA 2HHQA 5HNKA 4RUCA 3AU6A 4QL5A 4L5RC 3T5HA 4LF7Q 5DFLA 1KTQA 5C3EH 4C3JH 1UE6A 4ELTA 2I5LX 2UU9L 3GD7A 4DLEA 4NB3A 1YEZA 5J2AA 4DUYL 3S2DH 3PV0A 3TQYA 1G291 2AQ4A 1XNQQ 5DKWA 4A3MG 5DDYA 4MF8A 3PO5A 4DUZQ 4R4IA 4HJ8A 4EZ6A 4POGA 5IYDH 3S2HH 5J2GA 2NZHA 1IM4A 4EZ9A 2L15A 2VUMG 1KRSA 4HIKA 1WR1B 3H0GH 2PFQA 3EIVA 2JEIA 4QY7A 5FJ8H 5KFPA 1KRTA 3RLFA 3SI8A 1IBML 3DLLA 3M9BA 3HKSA 2JA6G 7ICJA 3PMNA 1HNWQ 3PW2A 2DAGA 5J2HA 1CKMA 5DBAA 2JA9A 3BZCA 5L1KA 5DBCA 3C23A 4DEZA 2HVIA 2HHWA 1HR0L 1U5KA 3W1BA 1YHBA 5KT3A 3RRGA 4ZH4A 3GTJH 4B3TL 3HWTA 1X6OA 5DQGA 2BH8A 3OSPA 3IHQB 3ISDA 8ICIA 4OO1I 2BGWA
chains in the Genus database with same CATH superfamily
4Y2UA 1GHKA 1XMOM 1ZQOA 3UDXA 3AQEA 3OSNA 2ICEC 5BR8M 1ZV1A 3MDAA 4G6ZA 2HWJA 3ETRA 1RQNA 5JU5A 1N32L 1Q86C 3T3FA 2MGSA 1YBYA 2VQFQ 4G4OA 2V1CC 2MROB 3A0HU 2LS01 2X6LA 1L2CA 3KLSX 1EQQA 2XRQD 1YNXA 4BB9A 1N2XA 3BQ2A 3MFHA 5KQDA 1VQMA 1K8AC 2VB2X 2VUMH 3VYRA 1KNEA 3KHHA 3OWFA 2Y9TA 3L25A 3PMFA 4KK7A 5EPJA 4YXMA 3HOWB 3MXGA 1SE8A 4UB6U 2J7ZA 2PI2A 4MFCA 4DV6L 4PZNA 5M5WB 4POFA 1TK8A 1B3AA 3FD9A 5AKHA 1S0MA 4DOCA 9ICLA 3CW2C 4G3IA 3I56A 3T1YL 1NJIC 5CWRA 4BXOB 1X3GA 1BNZA 4PT5A 8ICEA 1GUNA 3CKIB 4C8NA 1EIGA 4YWKA 1JT8A 2EY1A 1PTOD 1T8EA 4J9PA 4J9NA 1ZQNA 3EROA 3T51B 8ICLA 2CWAA 3HOUH 1SG9A 1DD2A 1IXSA 4QW8A 3HKPA 1TS3A 2NYZD 2I6XA 4C3HH 2BDOA 3E9IA 5DB9A 5DGAA 1QWYA 1A77A 1ZQMA 5KYLA 1MD2D 1N32Q 2O5JC 1RDPD 3PSIA 4DR2M 3HZXA 3ND9A 1EIHA 2WKDA 3KF8B 1MSWD 1QE6A 1DGBA 4FYDA 1DRGA 5LL6S 1U4RA 1LABA 2JE6I 3BBZA 2WB1B 2AUJD 2DAMA 4KN4A 1L8LA 4IRDA 1NNXA 3S1QH 2Y20A 4RQ0A 3H94A 4DFJA 1ZQSA 1TWHH 3BVGA 1C20A 2G9DA 3FRPB 3F2CA 4N9PA 3JAMi 1KFTA 4DV3L 2HHSA 4CJ1B 1WGNA 3K5OA 5J0OA 3HKZF 3T16A 8ICCA 4XIGS 1JXLA 2DPIA 4UB5A 1XWIA 3NRZA 2EY6A 2OM6A 2KECA 1A2UA 4X3KA 4DV2Q 3FYHA 3I3CA 1ZYQA 1GXDC 2FLLA 1LT4D 3M7GA 3RN5A 3KVWA 3GIIA 5M9OA 3K1ZA 1JR3E 5KFBA 4BX9C 2WAQF 4QCLA 5KG3A 1N63A 2CV1A 2XGTA 1IBLM 4QJFA 3S1RH 2LHTA 1SNMA 2CFOA 3N4MB 5GTHU 3L9AX 2FMPA 2ASDA 8ICMA 3T1HM 3KS4A 1EFID 3OWEB 4PQXA 1KXLA 1LB2B 3CF2A 2LXJA 3SAWA 2CWPA 2XN9C 2ES6A 4FE3A 3J80L 1D9FA 1VQPA 1ENAA 5ITYA 7ICFA 1ZJMA 2CHBD 2KHJA 2F0JA 2ZIXB 4L5RC 1R5LA 2BDUA 1NOMA 3RBEA 2L5TA 2XVSA 1HNWM 2EDGA 2D7HA 1NKBA 1ET9A 1OXTA 3V96A 1X9XA 4PD2A 3GU3A 2RHFA 1HUNA 2HQLA 1HQRD 3IRBA 2OPFA 1J5EM 3ICXA 8ICBA 2D0PA 3GTLB 3HOZH 4BUGA 8ICYA 5DYGA 1W5TA 5KG7A 1SEBD 1DGHA 2B2UC 1EFWA 2F4VQ 5KEEA 1XX8A 2YN4A 2VDBB 5IWAM 3FDTA 3GLGB 1JN3A 2PW7A 1IXZA 1IXRC 5KL8B 2VL6A 3J81S 3AFQA 3P1HA 2QBYB 4LF8M 1O7ZA 1HNZQ 1T3QA 1PM5A 1B9NA 4EBCA 1WWUA 3Q8KA 1QNUA 3H0GB 3RJJA 5T1GA 4DV4M 3KP0E 4PHPA 3I72A 4BY7H 3WK6A 2UXBM 1NJXA 2J0TD 4A3MH 1VQAA 4EYHB 5HMMA 2DNAA 7ICKA 3L2AA 4DR6L 1DJRD 2EYMA 2PQAA 1WTWA 9ICJA 2IHFA 2NVXB 1GLNA 1PK1A 4CF5A 4DWIA 3A42A 1LV5A 4OIJA 4KLFA 2G0AA 1PVRA 2F3IA 1N78A 1G51A 2P35A 2QDBA 2F5OA 1STNA 3RNUA 1TKWB 1CI3M 3EPGA 2EYJA 4KD3A 3KOYE 5D46A 3SZ2A 1V97A 3K5NA 4IUUA 4R65A 4HIMA 2LTUA 1R2YA 2JQOA 2JA5B 2Z0SA 2ENBA 4IURA 4B9XA 4LJ6A 1SV4A 3E2EA 1QLNA 3EUB2 4ECWA 4CHTB 4DR1M 2EYHA 2NUCA 4NXNM 4J6HA 2JY6B 1CHPD 1H9JA 4BBRG 1V92A 2EZVA 3CCLA 3K2LA 3OW2A 4YR0A 1N9WA 3K0YA 4BBAA 3H8JA 5EOZA 3S15H 3GV5B 5AM2A 2E2IB 2K8CB 5KG1A 2KEYA 3BJYA 2B2UA 3C29A 3QEBZ 2E1EA 2CKZB 1HNZL 3PF4A 4JYAQ 3MDCA 2K01A 3GTKH 4EQOA 3C1ZA 1HXYD 1NK4A 4P4OA 4ICAA 3NSWA 4RCNA 4PMWA 3I4MG 2JH7A 3SEIA 3VR6A 1IV8A 2G06A 2MJ8A 1SFOB 4UASA 5KT7A 3MK6A 1MJEA 3BJUA 4LRTA 2MUTA 2CRXA 4JI6L 4DQPA 4C8KA 3ZDAA 4H7BA 4LFBL 1NKEA 3E5SA 2QKIC 4RQ5A 5C4JH 3U6QA 4KTQA 4CKCA 1HT2E 1ZQ1C 4RT3A 2BQRA 3VC8A 2GA4B 3ICEA 5LMUM 3PO2B 5KAIU 4CJ2C 1W5SA 1ZQRA 1I6VC 2SEBD 4L4UA 1YE9A 1E7ZA 3FTDA 1WTRA 4I2EA 9ICWA 2HHHL 5JRTA 2MNAA 1CEZA 3G71A 1S9FA 4RQNA 5KYIA 4A3KH 3UE0A 3H4MA 3UK6A 5ALQA 5J2FA 3H3VI 1NK5A 4GNXA 4BY7G 2YB1A 3VDPA 1Y8OB 4MGIE 5AKJA 1KDHA 4O3NA 1BR9A 1YNJC 2WACA 4KKTA 5DLQE 5J2CA 4FF2A 2UXDL 3L3OC 1SB3C 3MGIA 2OQ4A 4OVZB 2XZUA 2FJ6A 4PL1A 4MFAA 1ZQQA 1KLNA 4B3TQ 4JXJA 4AYBE 1WTXA 5G5GA 5C3WA 1PH4A 3S6JA 2KVSA 2B3TA 3SENA 4QWCA 5L1IA 2WAQB 3TZUA 4TURA 3WOFA 3URYA 8ICJA 2CFMA 4OONA 4F50A 4H13C 2BWBA 3RH6A 4EVOA 1PVOA 4YG2A 1SMXA 3M4YA 4M6WB 4WJ3M 4DK0A 2CE7A 4CDEC 3ALRA 1VQFA 4QZCA 3VCBA 4K2LA 1VQ6A 3HOZG 1I94M 5ALGA 3NELA 3CMAA 3QZ7A 3EZ5A 4XQ8A 1HNXL 5CR0A 2F0GA 3TKAA 1AP0A 3K92A 5KG6A 1LLRD 2D9UA 3QR8A 4XT3B 1BO0A 2JXNA 4M9ZA 1BKBA 4UAIA 1GJXA 2BQ3A 4UHVA 5KFQA 3PGZA 3PNVA 3M8RA 2K60A 1NK8A 5JOBA 3MR6A 2QARA 2WHEA 5KFAA 4ALPA 1TVAA 1F0MA 2RKOA 5KFWA 4JI5L 2KW0A 2R65A 4GRIA 1QAQA 2QZ4A 5DNYA 5ALXA 2A6EC 3JR5A 2IL8A 2E76C 3QUCA 1QTMA 2L1BA 1PK1B 1Q8KA 3NEMA 3LW5F 2HD3A 2CV2A 2PQAB 4XYOA 3H09A 5AI5A 1DK2A 2F0IA 3SBJA 2Z7JA 1B22A 3MXPA 1PRTB 3U61A 1JWUD 3RJGA 2PCFB 2RGOA 1ZYRC 2AU0A 1WTQA 1ASZA 3KOXE 4LWCA 1QSYA 4I2AA 3AOEA 2V4DA 4BY1G 4MHEA 4FBUA 4R8IA 3D6JA 4ED8A 3PO4A 3GLGA 4CISA 4TKOB 4F88A 5JVH3 5KFRA 5CBAE 4BA2I 4B7HA 4DV0M 3RJIA 1R4GA 1BOSA 2B2TA 2XY6A 1LV7A 3QWNA 3AEVA 2LVPC 4BBRB 2H5XA 2BPFA 3NP8A 1QUQA 1U4LA 5AM3A 4ZLTF 5L1LA 1R9TB 4A3DB 3WHLA 1UAPA 1Q3BA 1L8OA 2VANA 1QILA 3DM3A 4MTKA 2CHQA 2ZJ8A 2RP5A 1O7YA 2R8JA 2LFNA 3GV6A 3KDFA 3C1FA 1WTVA 4GKKQ 1I6HH 3I4MH 4J9LA 2QCPX 2ZIXA 2ZUBA 1NJWA 3C3DA 4XBOA 5E7NA 1E1OA 3I7FA 2G8LA 4FVMA 4LJ7A 1K1SA 4BWJA 5GKNA 2OH2A 2HDMA 1PXUA 3A7LA 4K5VA 5AI0A 1STGA 1D1IA 1Z19A 5CV8A 1OKSA 2LYHA 2K4PA 2K4IA 3GTOH 1NY6A 1Z47A 2JA7G 1Q81C 1Z00B 3GFKB 1PFBA 4Y2XA 4JOIC 4A3JB 2Q2TA 1D6EC 3QXGA 3EYZA 2OWOA 4KD4A 4WW0A 4RCOA 3S14B 2F0MA 3DXJC 3M3YB 5H37D 4Q45A 4JV2A 2N49A 1G2TA 4L8RC 1PRBA 3TQ1A 3PSPA 2F0SA 4NL9C 1TTEA 1ZAEA 2OCEA 2HCBA 4HIDA 2OOBA 1GKHA 4IBJA 3QU5A 2Y0QA 2BJVA 5IOCA 1RTOA 4YD2A 2B2VC 1NUCA 1SNCA 3AU7A 3BDCA 5EQ0A 2A5HA 4DV4L 1UE7A 2KNZA 4UATA 1EEFD 4IZ8A 3WOEA 4IOCA 3B7ZA 2F4VM 3JPQA 4XXEA 4R71A 2R92B 2QSFX 3NBIA 4D80A 4M2YA 2Y0SB 2FPMA 5M3FB 4AYBB 1WIVA 3HKZB 3FYDA 2L4NA 2D5DA 3KF8A 4LAAA 4NMZA 2N35A 4CDGA 9ICAA 1TVXA 5ALYA 4FD2A 2W9BA 1B53A 3HEJA 1ONLA 1S72A 1KDBA 4K5WA 2BZFA 4UAWA 3G6VA 1N34L 4CGZA 1Y88A 1HEKA 1Z1BA 1TWCH 2E8OA 2B2YC 4KLJA 3U60B 3BVMA 8ICFA 4FCTA 2F2AB 4DA2A 1IFYA 4F5RA 3VR2A 5ALHA 2L4EA 3DOAA 3B6YA 3I76A 1SYGA 5M3MB 4BXOA 3LVWA 1YT3A 2GWSA 1DXMA 2CH4W 3FKIB 2O6KA 1CM9A 1UCVA 4DO9A 4J15A 1EIFA 4F72A 4KLLA 1CT1D 3A46A 4LFCQ 1Z4NA 3TACB 4IBGA 4YY3M 1SNQA 2JZ0A 1KBUA 5ISRA 5E26A 1O08A 4FF3A 4ELVA 1A3VA 9ICKA 3OSOA 4RNMA 1PJQA 4YP3A 5HY6A 5LHY1 2R46A 4JI6M 2A68C 1KDAA 5LMNW 3LX0A 4DF8A 2I5HA 2WTFA 1A15A 3QEAZ 2EZZA 2LKYA 4D81A 2I7PA 2XSZA 1BNPA 2PQEA 3SFZA 1UM8A 4AQYM 3PX6A 4JBJA 5EBCA 3J2PB 3PW0A 2UVWA 2F0HA 4DV7L 2AGQA 1PH6A 4LJ4A 1L3UA 2FMSA 1U0LA 3SR6A 1V1PA 4FW9A 4TSSA 2O25A 3MFYA 4X66L 1XNRQ 1L2DA 1BNOA 2IA6A 2ID0A 4NL4H 3GPUA 5IILA 5EE0A 4ZOHC 3SEBA 1Z00A 1Z4OA 7ICOA 2CV0A 3STBC 2DZLA 5KG0A 1Q7YC 1VS0A 2ZTEA 1N60A 4KTAA 1ZQVA 1TDZA 3U6OA 3NASA 3SC3A 1SKWA 1UT5A 1G3IA 1VQIA 2F44A 4DOBA 1Y14B 3TSSA 5A2QL 1NK9A 1N62A 3UXPA 4ED2A 1RTNA 3CP0A 3HKZE 1ZEQX 4KJNA 1KQSA 1DOKA 2HL7A 2NVTH 4GKKL 4DSKA 3ZC7B 2CUZA 1EEID 5L9XA 4BWMA 4JK1C 2GVAA 3PIPA 2KICA 4NXML 3S1NH 4KV6A 3KDFB 4HCSA 2HDLA 4J9SA 2BDNA 3ZDDA 1SJED 5EP1A 3Q8RB 3M9NB 2OEOA 2RDGA 4F4KA 3WDNA 4FS1A 4F7XA 4CF3A 4JI3L 7ICUA 2PYKA 3A0BU 1EYCA 2EPBA 2KHVA 1NKCA 3PO2H 2F3VA 1VQOA 1L7NA 2IJ0A 1E32A 4BXXH 4J03A 4F3OA 1Q8IA 2W9CA 2I07B 3U60A 3AL0C 3CCSA 4P4MA 2WB1E 2A69D 2E5LL 4KN7A 3BG3A 3DUZA 1OW5A 2YQEA 2JRZA 3ETLA 3UQ0A 5C0YA 1ZD2P 3KLRA 9ICHA 3IKJA 1A2TA 1D2BA 2D3DA 1GUOA 3IDWA 1U4PA 5J0SA 4Y7NH 2KFNA 2IX3A 3H8SA 2HHTA 1LT6D 1KN5A 4GLAC 3HOUG 3KFUA 2JEFA 4P73A 4FXDA 3ERSX 1GL7A 3WKDA 2B6GA 2G08A 4RNNA 2LKVA 2N8NA 2HI0A 3IHPA 2R45A 2A1JA 4FNFA 3T53B 5AJ3Q 3RZDB 1S5ED 3SDZA 4DV6M 1EIYB 3HPOA 3J81i 4II7A 1VDZA 2YMLA 3EW9A 2DENA 5AICA 5DB8A 4DS5A 1RU3A 1EUJA 1J2NA 1K3RA 2FFKB 2NN6I 4RG1A 2MP1A 3ZYYX 3GO8A 2A1AA 4APVA 4DR7Q 3NPPA 2KIVA 1HFNA 1QVGA 1N56A 8ICGA 1ZQWA 1AIPC 1OTRA 3V76A 3T4AC 1XMQM 7ICNA 4IUNA 4JV5L 2PI5A 2R8HA 1UFZA 5FO8B 3GTQH 4RKUF 1NR4A 1W6JA 1L3VA 2MU2A 4A3MB 1N75A 4IBBA 1XWEA 4M6WA 1IBLQ 2R93B 1QZHA 2KP7A 3LK9A 2ALZA 5KT2A 1S0VA 2DHYA 3HU2A 4L78A 3Q8QB 2RDHA 3ERQA 4RGNA 4FFDA 2F0EA 4OCZA 3E0EA 2F76X 1DZ1A 5C6AA 3JAMc 1SXJE 4J9MA 2R92G 1EU3A 2OXPA 4DN4M 3AJIB 2JH1A 5M5XB 4EIWA 4P0QB 5F9LA 1Q3LA 2F0PA 4QIWF 2ISPA 2KIWA 1XHBA 3RJFA 4Y7NB 2XI9A 9ICXA 2XGNA 1J09A 2NTTA 3J80i 1D0MA 1VQNA 4Y2VA 4R66A 1G6PA 2JJQA 2ZXPA 1YVCA 3WK9A 3M4OB 2MRLA 1BVSA 2YU9B 1CRXA 2ASJA 4DFAA 2BOSA 3TMEA 5BOLA 1IHZA 3VR3A 3R2TA 1IW7D 1QUQB 1AZPA 2K6AA 5IIOA 3J80S 5IIIA 1TY2A 5FLXc 2WP8J 1U47A 2DZOB 2W3SA 1YIJA 2FE9A 2E8MA 2K89A 3LYSA 4QZ8A 1N48A 4R4OA 3CHBD 1WOCA 2B3GA 1T6OA 5J22A 2XY5A 2Y1IA 4UB2A 5ALFA 5ALVA 1X32A 3K58A 4LG2A 4OU7A 5EE9A 4QMGA 1XMOL 1KD1C 2QNJA 3O13A 4EQNA 1OFIA 1B4FA 2MUTB 1B3QA 1EY4A 2EAOA 3GLIE 1HNXM 4J9QA 1EWIA 1MKHA 1UEBA 1L3SA 1NCVA 4R3DA 4EQPA 1KFSA 1FNWA 2IHMA 4RF0A 3U6CA 3F2UA 3B7NA 1TH2A 5J2BA 2Q8TA 3ISCA 1Q82C 4J9RA 1FGBD 4A3DG 2K8AA 4A3FG 3PQIA 2JA6B 3F2BA 2WINB 4JWMA 4GIBA 2E8NA 3KZXA 1G4AE 1NNLA 3D2QA 2B0CA 4UAZA 4LUZA 3M4OH 4OO1H 1GVPA 5AKYA 4OX9M 4Y2PA 3W67A 4OJLA 4I2HA 5AM4A 3ILKA 3ONNA 4GLXA 1U4BA 3KLWA 4ZKBB 4C7YA 5BN3A 3MMPA 3H0MB 3TWMA 1WCLA 1BPXA 1P8LA 2AGPA 5IP7H 1UQVA 2QB1A 4DU9A 2ZJPA 2NRZA 5C0XJ 3CF6E 3E9SA 2VQEL 2QB0A 4DR1Q 2Z3XA 4YD1A 4K0KQ 4OJ6A 2VKQA 3GQ5A 1PK3A 3RBDA 3SK4A 2KKVA 4F5NA 4F2RA 4C8MA 4KLUA 2Q4TA 3NQTA 4GKJQ 1ZQ9A 2JZ1A 3T1YM 3M6AA 1X40A 4G3OA 1UA1A 3SHFA 2LYAA 3NWSA 3VDYA 2DXIA 4K4IA 1H95A 5DGBA 4L5SA 1RXVA 4LZJA 1OFHA 3B0XA 2KFZA 2HUGA 5J8YA 3PF5A 1HQYE 1KDCA 4NPSA 1LVHA 3UMBA 4JI8L 4GNXB 1I4XA 3TADA 3IECA 3I4NG 1B43A 4Y28F 3L3FX 3SATA 4A93G 4HN7A 2JV3A 4C4TA 5EKLA 4UAYA 4DL5A 3H6MA 4N8X1 1GO3E 4PMCA 4C2MB 1IYVA 1IKMA 4A8EA 4AQYL 2OTLA 2NTSA 2KG5A 2JA8G 2O5RA 2B63B 3TS2A 2VXWA 4JG2A 2PFOA 2NVQH 4G57A 3CQZH 9ICBA 1DGHB 3HU1A 3N7RC 2A3VA 2AQ2B 3U50C 1JOOA 5FLXL 2YR0A 4M9SA 3V2TA 3H8WA 4L16A 5ITXA 5AI6A 2BPCA 3S9WA 3CD6A 4AZFA 3SE0A 4FXGC 1E24A 3U6MA 1X3FA 2VIXA 1SR3A 2L12A 2ZANA 3DFZA 4CF4A 2KZZA 1PYWD 3HS0C 3VR5A 3E0JA 3F53A 3UMMA 2DNCA 4AKHA 2R8KA 4DUYQ 1I4QA 2VB3X 2XNAC 4X65M 1K83B 4KLTA 1NTGA 1JUDA 3GIMA 3ULLA 5KFGA 2R92H 2RDIA 1JCKB 5FTKA 2Q2UA 2JUJA 1NR2A 3HJSA 9ICMA 3K9PA 1K1QA 2W9MA 2LY7A 4RUAA 1FO4A 8ICRA 3E3XA 1ZMWA 4RQ8A 2XF3A 4QIWB 1JJ2A 1HUOA 5ALPA 3RR5A 4GOPC 1LTGD 3ULPA 3J7AV 1JB0F 4IFDJ 3T6PA 2NN6G 4WORA 3MHVC 4JI4Q 1BBWA 1V38A 1K8OA 1ZQTA 3FVQA 3I2ZA 4BY1B 3JAML 4YVZA 2F4VL 3UZUA 2F5NA 3C28A 1ZJNA 5AKKA 4RU9A 1I50H 9ICGA 3PNCA 2N3SA 3EA6A 3P20A 1EL0A 3H0GG 1A5TA 3WU2U 1XO1A 3RR8A 1ILPA 2EOTA 1KLUD 2FHTA 1HA6A 4QW9A 4LZGA 4EX6A 2HQEA 4LF6Q 3GQ3A 2P6UA 1LO5D 3T15A 1UNSA 4DAYA 4FWHA 5M3FH 3K8ZA 3KHRA 7ICIA 4WFN3 4TRDA 2QDLA 1B50A 3CAMA 3D6CA 1OIZA 2KKPA 3GLGE 4EQ5A 1KHIA 4GC5A 1O78A 3CPFA 1YNJD 4HAIA 2B8FA 3DHQA 3LGJA 4L5QA 3T5JA 2DGYA 1OXVA 1R4PB 3G6YA 1L2BA 3TWKA 2EY2A 4JI2Q 2DWZB 4P2HA 4HAEA 4F71A 4NRWA 4OO1G 3QUQA 5ALMA 2K14A 2NV3A 1WGLA 3ITPA 1J2MA 4ABNA 1VDLA 2QBYA 1Z9FA 5ALOA 4C8LA 1I94L 1M90C 3AMZA 3C3EA 2NO4A 3DDHA 2G5IB 4QZIA 4K0KM 2XVTA 2IY5B 3I4NB 1OAOC 4O0AA 4ZK9B 1LT5D 1AE3A 3TI0A 5IYDG 1JXEA 3U4VA 2LM4A 2PZUA 2AHOB 4DV6Q 4OD0A 2KZMA 4QZEA 2WAQE 2FXQA 2YTYA 1C0AA 3MJ5A 5KFZA 4C80A 4YCXA 4Z8XA 2EXDA 8ICWA 2CPRA 3J81c 1GOZA 2D7EA 4HJ5A 2F0LA 4BY1H 1BPEA 4LF6L 4AI6A 1YUBA 4DR5M 1JWSD 3ZCBB 2QQ8A 5TZVA 4HL4A 2LMRA 4DV7M 1X6JA 2BCUA 2Q8RE 3MR2A 3F8TA 3S2DB 5K36H 2NN6H 1J5EQ 1L1OA 4ECSA 3VR4A 4B9NA 4Q43A 1STBA 2QEJC 3FPUB 2WZJA 2IBKA 5ALZA 1RG6A 5KFTA 4Z6CA 4C56C 2PI4A 1GJTA 4X64L 3KJOA 2LNHC 3HHWA 4YMMA 4G7ZC 2VA8A 4KITB 2BA0A 2FPLA 4EBDA 3TAPA 1PMRA 1K83H 2DZNB 1SNPA 1EFUB 2MO1A 2DPJA 4IUQA 5FO9B 1N36L 2EIFA 4K8IA 4OGQC 1ECWA 2WB1C 2WF5A 1IXRA 3K75D 4QJFB 1HNZM 1QSSA 2ZAOA 1CKNA 2RSOA 4BBSH 1K3WA 4GKKM 3SD7A 3F2DA 4ECTA 1KAAA 3OYYA 4RGOS 2YTUA 2E2IH 2LXEA 3FE3A 3Q8MA 3KD3A 1BPBA 1JIHA 2D8CA 2Q2IA 2K03A 1HNXQ 1L1ZA 2M0NA 3I90A 4DXGA 1MN3A 1LTTD 1UE5A 3GV8B 2KEEA 2KHSA 3ONAB 2WF7A 4A3EH 4I5SA 4QZAA 2UUBL 1K82A 4LF4M 2AQ1B 4G4NA 2G5HB 1VDVA 1Z5AA 2VJ5A 3CF0A 2JHDA 5A0LA 2R8IA 1BXTA 4C4RA 4KKSA 3VA5A 3VK7A 4LVSA 4KMUC 1RL2A 2L11A 3AN1A 1OXXK 2FOIC 4M9HA 1XU4A 3FKIG 1R2ZA 3W3AA 3U26A 2WF6A 2GOLA 3OTQA 4KLDA 2C35B 4B9UA 1CK1A 3CCQA 3K1RB 4OWTB 4AW4A 4X65Q 5JI2E 2EY5A 2PO4A 4AH6A 1ZQCA 2VS1A 4KHZA 5KFVA 5IZ7D 1K28A 2FE8A 1I3QB 2K28A 3QU2A 3I91A 5G3LF 1XMOQ 4DF4A 2KA7A 4Q5VA 4LF9M 2KJ8A 4LF8L 4QNRA 4CNQA 1IXSB 3FUWA 1Y1VG 4GKJM 2KA6B 3IG8A 2GH1A 3SV4A 1E1TA 4IUVA 1VF5C 1I6HB 3SHLA 3NGDA 2EJGC 1S0OA 4KLIA 2C22A 2DN8A 4RZRA 4PGQA 3QO2A 4JCVE 1TKDA 3C2LA 3HOYB 3L4PA 1K9MC 5J0XA 4M0DA 3DWPA 3BXWA 4JBMA 3OHBA 4ED1A 4GXJA 2H4OA 3GV3A 2KD1A 2G09A 1O7LA 2BCQA 2BKEA 1GO5A 2A6HD 4YY3Q 1S97A 3N6RA 3PVXA 1XMQL 1VQBA 1HHVA 2W04A 1C4QA 3NTUA 2E2JB 3ZH9B 8ICQA 5J2EA 1TK5A 1BCPD 4GHLA 2IPKD 3IFDA 1A6SA 4MTNA 1B44D 1BCPF 2A73B 4JI0L 3QUTA 5EWFA 3OMCA 2N1RA 2WFAA 4H0LC 2E1FA 2CQAA 2EANA 3HWSA 1VQDA 5EGTA 1D9DA 3CC2A 2W82A 1I5FA 4HYKA 1ZQEA 1XNRL 3DEOA 1KSFX 3JPNA 4FWDA 1AEXA 2PFNA 1MC8A 5JUMA 2F0DA 5EP4A 4ME3A 3BDOA 4PNYA 1PHJA 1GJSA 3QX7A 1V9PA 1LV9A 2XIWA 4C3JB 3J7A5 1QAMA 1KSPA 9ICEA 2L2DA 1F4IA 1WI5A 4LW1A 5FLMH 2NRTA 5B5EU 1JX4A 1BPDA 2Z6BA 1S77D 1D5ZC 2NVXH 5KO3A 3SASA 2G07A 4IFDH 1I94Q 2YMMA 4F8RA 2JA7B 4AQYQ 4RH6A 2VJ4A 3W1GA 2FPKA 1ZQPA 1TWAH 1X55A 1DV0A 2AKWB 3K5MA 2GNOA 2KOBA 4RT2A 8ICHA 2B2WA 5LMUL 4EELA 5FOBB 1EY9A 2UVVA 1XNRM 1Q12A 3MWYW 5IREB 1QVRA 4DAPA 1SYCA 2B39A 7ICPA 4CGYB 1WYDA 4QGUA 3FRIA 2XWBB 4LFAL 1IN7A 1QQ5A 4B3SL 4IOAA 2OEHA 2CQOA 1A8VA 3N52A 2R61A 3DEPA 3Q6SA 4A3BB 2MSNA 3EWAA 2AGOA 1NZBA 4FBTA 4NV0A 1JE5A 1X3PA 2XCAA 2HW3A 9ICVA 1H9SB 2BJWA 4LJ5A 4P72A 2Y0TA 3E9HA 1IKLA 1I4PA 4C3HB 3D4DA 1TV9A 2BH2A 5KFXA 5KFYA 2IW3A 2W55A 4UARA 4V0BA 3KZIU 4QOZC 4UBBA 4IBIA 2D6FC 1EQTA 1EZ6A 4XYQA 5M3FG 3UDGA 3HOVG 4X62M 5TSSA 3TE6A 4LF7M 3AQFA 2UU9Q 4YQWA 1TAMA 2Y1JA 1KIXA 1VCIA 3C1EA 4L6TB 3RZDH 1SV0C 2BQUA 4CDCC 3F92A 1IW7C 3T38A 3E46A 1CSPA 2NO5A 3FEWX 4WRDA 2Y21A 2NVYB 3PXGA 3NQIA 3BS5A 4LFCL 5M5WH 8ICTA 5C4JB 1MQ2A 1GL6A 3A74A 4E6IA 2F0TA 1JJGA 1XC8A 2KSOA 4PH5A 2WB1G 3CF5A 1EYGA 4Q7JA 4RWSC 3B9PA 2IOHA 1ZRMA 3D2SA 1SMYC 4K0KL 4IPGA 5ITRA 3QJYA 4DQIA 4KX3A 2F8KA 3ZI4A 5FJ8G 1ZYRD 1YZ7A 2GLEA 4NM2A 1X42A 5F3XB 1Z5CA 5AK6A 1HH2P 4A3KG 2M00A 1IN5A 3GLFB 1S5LU 1U9LA 3RN2A 1KABA 1RYSA 2VW9A 5A2QE 4IUPA 3S15B 2GN5A 3HOYG 3Q8SB 5ALNA 3N97B 3MXNA 5KQ8A 4X66Q 4R4QA 1ZQYA 5GQOA 1PA6A 1TWHB 4F92B 1Y1WH 4DS4A 2Z8YM 3PSFA 3JAME 1KC8C 3GPYA 2WF8A 3TFSA 4O9MA 5KAFU 3KOWE 4KLNA 2ZIUB 3UMGA 4QZFA 1EE8A 4JOIA 5C4ZA 3I55A 2L7HA 2HHXA 3MZ5A 5HGQA 4P2CB 1PH1A 2KEBA 2VA3A 3M9OB 4O5KA 5E3FA 2AUKA 2NZOA 1Z59A 4L6V6 5KT6A 2R6FA 8ICUA 1QJOA 1PVPA 1RHPA 1SNDA 1SYDA 1Z6HA 2KCMA 3QIAA 2K4HA 1XSPA 4HMIA 3MAQA 4QZDA 1SL2A 1GD7A 1MSGA 1PLFA 3MEHA 2ZIWA 5IYBG 1NO1A 3K6OA 1FFUA 2PMZB 2Z1CA 4OJ5A 1WTHA 5EWEA 2F4IA 1URJA 1WFQA 1VG5A 4HEOA 4DR2L 2P6RA 4EGVA 1KL9A 1MHWC 1U4MA 4UQGA 1CI4A 3LCUA 3MGHA 4GN5A 3TP7A 3QE9Y 3S16B 5CR3A 1HR0Q 1E9RA 2CCZA 1Q02A 2FI1A 1WCMB 2YTVA 1ZD3A 2HIVA 2JWSA 1ZQGA 1ZXTA 2EE1A 3HOWH 3GLHE 3OTOM 4DFPA 4WJ3B 2MQHA 4I65A 1ZXIA 1ENCA 1GHJA 2F0OA 4K8JA 3GLHB 4GHAA 1F44A 5FK9C 2YV5A 5KFLA 3VYSA 3J7ZC 1GUWA 1QZGA 2C5RA 2NRXA 1WWVA 5ALLA 4CCHA 1SL1A 1X6IA 1RD9D 3KTQA 5LMUQ 3S2HB 1RXWA 2H3VA 2ZXIA 4D82A 4C3IB 2KZUA 2ZG6A 2ALYB 3GP1A 2W9AA 5CEHA 1PH5A 5KFNA 4BLCA 3TS0A 3LWEA 1C1KA 4NC6A 2E75C 3V7JA 3RRHA 4RQ4A 3H40A 3NUCA 4E0DA 3J7AS 1K73C 2DAIA 2UUBQ 4M1UB 1ZQLA 1PRTC 5FKAC 4MGZE 5J8YC 5CJ7A 4XDXA 2ZJRA 2J6UA 2I9GA 1N5WA 1T7PA 1UWVA 3H3VH 4OJOA 3M8SA 7ICHA 1X9NA 4EEYA 4C3HG 3R8BA 5DB6A 5CBEE 4IBCA 4PJ0U 3KHLA 1SSOA 3R2IA 5C3EB 2CXYA 5KFSA 3CCJA 3SAVA 2EQSA 1XPRA 1K3BC 2KCTA 1FNUA 4MFFA 1II3A 4JI3M 1X3EA 4KN4C 3HT3A 5EP3A 3HJEA 4R1JA 5GAGC 2H3IA 2ZTDA 2F5SA 1IN6A 2UXDM 3V72A 3I70A 4DNTB 2W3RA 2BNKA 2PMZF 5AKIA 3MBYA 2JEGA 5J0TA 1KTKA 4LF4L 3HX3A 1BQQT 4RNAA 4ECYA 4IJFA 3WWVA 1NJFA 4UB1A 3KKAA 5I6WA 1KFVA 3FDSA 5K4LA 1Q39A 5ALUA 1VJ5A 1MQ3A 4BDPA 1B9MA 1OAIA 2F0QA 5J0PA 1NK6A 3E6ZX 1N61A 1KLGD 5C4XG 2KVCA 5J0WA 4LZZA 2ZM6Q 5LMNQ 2H3FA 4YCVA 1MGSA 5DM73 2F03A 4B3RL 1SYFA 3CPWA 2A5YB 4C3IG 1CA6A 2UXCQ 4DAYB 4ZYSA 1EQRA 2BE5D 3GTJB 2ZBKB 3JPTA 4YY3L 5GADC 1U45A 2E3TA 2XSZD 4XTCS 5KPTA 3HOXG 1HUMA 4JI5Q 3OTOQ 3GZFA 3NBHA 3S1MB 4JW0A 5FP0A 3QOLA 3C58A 4GZYC 4JV0A 4CKBA 4IFDG 5J2IA 3Q22A 4YXJA 1XTCD 4F1IA 3BU2A 4AP9A 2DL0A 2E5LQ 1X56A 1K3XA 3M85A 2YU9H 4I2CA 2RQ5A 2C2EA 8ICOA 4ZKCB 4X66M 5ALRA 1XPOA 3Q8GA 4I28A 5C5LA 3PO3H 4F91B 1UUPA 4IJHA 3BZDB 5IGEA 4A93H 1TR8A 1XS9D 4LJZC 5IYCG 1FNVA 1VQCA 1ZQZA 1M4VA 3KDSE 4RGTA 1KQQA 4R8UB 4O3PA 2BCVA 4BJQA 4B9VA 2K5HA 4XGIA 4RMFA 3Q23A 2V6ZM 4TQUS 4BXXG 1XXHE 1TWFH 4IFDI 5KFCA 4KMOB 3KKAC 3SGIA 2JR5A 1ZQFA 5ALTA 3LWUA 3NBHB 1VQ5A 2UUCQ 2JA7H 3KBXA 3RR7A 3GTQB 2NYVA 1MBYA 4MF2A 2K52A 1PGYA 4NLBA 2MH8A 2J6SA 1KAWA 3B89A 2Y9UA 5EE1A 4BBRH 4DUZL 5DQIA 3HOVH 1YLAA 4JI1M 4DL7A 4Y2QA 1K0SA 3RB6A 1SNOA 4IQWA 5CA7A 3B74A 4PDIA 4ECRA 1EY0A 2N55A 2V4QA 2KMDA 3U6EA 3A54A 3PCOB 5CV4A 2FLNA 4O0IA 3ZJYC 2I1QA 4REZA 1B0XA 2OOAA 3L29A 3C5FA 3A5UA 1AQ6A 1T94A 1ASYA 5KT4A 4UP9A 1G8ZD 2ZAMA 2RHQB 4IJLA 4IL6U 2H3ZA 3B9JA 5KL1B 4LFCM 3TARA 3W5OA 4A3CH 5ELEA 3BOSA 3FUUA 3LWLA 1M8AA 2WB1F 2K7VA 2R7ZB 2M2LA 1DK3A 3L7ZC 5KIXA 4F5OA 1Q3UA 4QUFA 4NSRA 2BA1A 3TP6A 1BBUA 1X3QA 4CBVA 5IY0A 2LVOC 3T5LA 4JPBW 2P66A 1E3PA 4M9LA 8ICXA 1JRPA 5BPVA 4GFJA 4HR7B 3CC4A 1ILQA 4M0AA 2FS1A 2FFJA 3LCVB 2NRWA 4JN6A 2RRUA 3HJ8A 2WAQC 2YMPA 2K75A 3MVVA 3SAHA 3U4ZA 2HOQA 2KXEA 1IIPA 1PZNA 3HOYH 3BYYB 4TUWA 3HOXB 4M9XA 3GTPB 1HZBA 4AYBG 4DV1Q 4I2FA 3THGA 5GAEC 3NTHA 5DM63 3G4SA 4KLEA 1DGJA 2O2LD 1QVCA 1QDRA 3OPOA 2IX0A 2VQEM 3NS1A 2HOIA 1VDDA 3ZD9A 3U58A 2JEJA 4A3IH 3CP8A 3SMSA 4C0ZA 5KFKA 3X3NA 2OQKA 5F2DA 3C3LA 2KCCA 3GLHA 4RPZA 4UB8U 4NW2A 1E0BA 3BVZA 3K7UC 4JI5M 1JJCB 2VNUD 2ASLA 1I4GA 2B63H 2IT1A 1YHQA 4EEKA 3MABA 4CIZA 2Y0SE 1N33Q 2A6HC 3J7YW 4I2IA 3CXCA 1PZKD 2VQFM 1KW4A 3EN2A 1CSQA 4BBSG 5DNFA 4LFBQ 5JJIA 4QOSA 3UMCA 4JUZA 4RQMA 3MR3A 3OTOL 3AUOA 2DUYA 5IIFA 5HMLA 5FTJA 4OO1J 2LHCA 1WHCA 9ICNA 2FLPA 4DV5L 1X37A 1JALA 1EXNA 1ZMVA 3RF9A 4AG6A 3FM9A 3GV7B 2RVLA 3VYTA 3S17H 4HTHA 2C98A 2K9DA 2HCCA 2UXCL 4CE6A 3I4LA 2NB0A 3H4JA 4G4QA 4JWNA 1OXUA 2XLJA 4NLNA 3R8FA 1IL2A 4RAUC 2C99A 2JEAI 4KHPQ 3LNNA 4LF5L 4P0QA 3SYLA 1OQYA 2AQ0A 4RQ7A 5E6JA 3CCVA 4PHAA 1C7YA 2UUCM 4IBFA 2PMZC 3SAUA 1I50B 4A93B 3Q8PB 4PV1C 4PDGA 4JV5Q 1SE2A 2PZTA 4P17A 1LTAD 3E58A 2MJ5B 3M4QA 3HHYA 2QA4A 1F2LA 5KPZA 2BPGA 3PW5A 2ZUCA 1F2ZA 2K50A 4JC0A 5T14A 1XYIA 1IZ6A 3OMGA 3TZDA 2ATWA 3NTIA 1R4QB 3N7PD 4O5CA 3HP3A 1H9KA 2WSFF 3L28A 3HFZB 4P71A 1ZD4A 3N28A 4DV3Q 2DKLA 4IPDA 3PVSA 1ZOLA 4RQ6A 3F5EA 4DCCA 4CJ6A 2C5CA 4HJAA 4OIKA 2JY5A 1QCKA 3RMHA 2DAKA 2VZAA 5AI9A 4QWBA 2DJGC 4K6LA 3J7BA 3LQRA 3JPPA 2JN4A 2XH9A 1S40A 3I4NH 2JZBA 4KODA 4F2LA 1RQLA 3PR4A 1VQ9A 3H3VC 1D1KA 3GTMH 4AKGA 3UXNA 2A1JB 2LPEA 2O01F 4O3OA 4WURA 1JQYD 1Q90A 1VQJA 4OWXB 2J4XA 2K5VA 1XC9A 3ULJA 1SLJA 4B3RM 3PMLA 2FNAA 4Z6YA 4JI7Q 4QB4A 5IIMA 2Y0SC 2E74C 3CQZB 4K5XA 3V05A 4LRSA 3SHGB 1NI3A 3C2PA 1KFDA 4UW9A 2YYZA 4YR3A 2DWLA 4L15A 1E22A 2F3WA 3R93A 1VQ7A 2KN7A 1JMSA 4DV2L 1QNKA 3GLFE 1YI2A 2X8AA 3VKGA 2D2CC 2E5LM 5GROA 8ICKA 1PFSA 1FEZA 3VYUA 2ZM6M 3D4RA 3N7SC 4YWLA 4JI4M 4HCEA 2WSEF 2OTJA 5IE8A 1CTMA 2QPAA 2RGHA 1SXEA 5DG8A 2BE5C 4DF7A 2YMQA 2R7ZH 2MR9A 1C9OA 4JMUA 1VQEA 1P16A 4R7GA 4MZ9A 1SXJA 4DR3L 3K1JA 4MGHA 1EU4A 4R9WA 3J27B 4NLKA 1TT2A 5FO7B 4IJEA 2SDFA 3KS8A 5IP9H 2QHOB 3FP9A 3CCEA 2L0CA 1RODA 4RQ2A 1FIQA 2K04A 4A3EB 5FTMA 1NVMA 1SXJB 4LF6M 3D2NA 2LBOA 1B7YB 4JI0M 1T5XD 3KOZE 5CB1A 4KLSA 2LVNC 4YMNA 1TY0A 2K5WA 2XTIA 1IBMM 4RHRA 1BF4A 1PJSA 2HHVA 4ZAIA 3CMEA 1B2TA 1SGGA 1JMCA 4X65L 4LJ9A 1JI7A 3QNMA 3EFXD 3SR1A 3SXHA 3TRZA 2G9HD 4DFMA 3W2DA 1SV0A 5DBBA 4EBEA 3SV3A 5JTIA 5C5JA 1XO0A 3X3MA 2EUCA 1BCPC 2B2VA 2VF8A 3QZ8A 3VKHA 5DG9A 3A98B 1ICFB 3D31A 1G41A 4K6DA 1HPCA 3HKZC 1F9QA 3A56A 2P5TA 2VF7A 1I4WA 4RPYA 3BQ1A 4GC6A 5ELNA 4JI1L 1Y1VB 1CA5A 2UXBQ 1WCNA 3RAQA 4F8MA 5J29A 1IM2A 1SYBA 4WJWA 2AHMA 1LT3D 3FTCA 2PNRC 4A75A 4A3LH 4LJXA 5AKGA 4Q8FA 4DK1A 4ZUIA 3M4PA 4IQUA 4NXMQ 4UAVA 5D65A 5ITUA 3IG5A 1QUSA 2RCFA 4I7AA 1B1ZA 1LUZA 3I4OA 2ZIVA 1FJGM 3S24A 4A3LG 4Q0FA 1HJPA 2HT1A 1N32M 3B0YA 1NAPA 3J81E 9ICQA 5G3LD 1TS2A 3UGJA 4B3MM 4UPAA 1N8RC 4B7GA 4PL2A 2K5QA 2VY3A 3K81C 2UVUA 2CH4A 1HTLD 4RF1A 4OL7A 3T56B 3S1MH 3FAHA 2RCNA 5KFIA 2UUAM 1TH3A 3H0LB 2F0NA 1BPYA 3KSJA 4PHDA 2C96A 2EZYA 1LKYA 2DVWB 4XT1B 3B7QA 3F1ZA 4L8JA 3NVYA 2KHIA 5C4HA 3U5ZB 5ELOA 4YHHL 4KJOA 2JYOA 2E8PA 2C2RA 7ICQA 1DOMA 1PH2A 5ALDA 1ZQBA 2Z8LA 3UDFA 1NSFA 4B7FA 1M1KC 5F3WA 4DUYM 7ICLA 1FD7D 1WJJA 1QDTA 3I1YA 2EYPA 4NM1A 5AIBA 3TREA 2W9BB 2QKQA 3QOJA 5I2XA 1F5SA 5LMNL 4B3RQ 3DWAA 4DL3A 2KTQA 2W43A 1ESFA 1PH9A 1TXYA 4FZNA 1OTCA 1B8AA 4C2MH 1A76A 4KLGA 3FYCA 5AKXA 5ALWA 5KNBA 1Y1WG 2EKKA 3PUZA 2N88A 2PI2E 7ICVA 3M1YA 2R6GA 2DFLA 3H0RB 5JEAG 4K4GA 3KBGA 3EVQA 4GN4B 4R8NA 1UE1A 4ZUJA 1EQVA 1IN4A 2XY7A 4NLZA 2KJXA 2ATLA 4KMUA 3KF6B 5L37A 1VQHA 3ER0A 4NP5A 3C46A 1D7QA 3UJNA 2KZSA 3NTKA 1YHAA 2EJMA 3M7NA 4FCVA 4JI7M 1SIJA 4YFKA 2IOFK 2W54A 1VQ4A 1HR0W 4U6PA 2QILA 3D6WA 2E2HH 3LDAA 3PX4A 2J7NA 1Y8GA 4AIMA 5TISU 4QWDA 1ZETA 1CKNB 2L4FA 5ITQA 3GLIB 1PUZA 3WK4A 4F4YA 2L09A 4DSJA 2L5YA 1F77A 2B21A 2V4RA 1LTID 3KUPA 3AM9A 1MX0A 3C5GA 3FHWA 4ILWA 4PZ8A 2JMGA 4F5PA 1TK0A 4RKBA 1E2WA 4FWGA 2LM1A 2YX8A 4IRKA 5FSWA 5KFDA 1NNJA 5DYIA 1L7PA 4FS2A 2L9HA 1NZPA 2EAMA 2R3ZA 4CDFC 3AB9A 2EH9A 1GM5A 2AMCB 1C8CA 4A76A 1HR0M 3I8ZA 1S76D 4DUZM 8ICNA 3MHBA 4DPGA 3CC7A 4DR6Q 2UUCL 2EAPA 4OHJA 2IMWP 5L1JA 1HFGA 3EBEA 1A3UA 1BGXT 2UUBM 1QAOA 5BPCA 4J9KA 4DQQA 3RJHA 1STYA 1WCMH 5FTNA 2EYOA 2QEXA 2D7GA 4DV4Q 4DV5Q 3L0OA 4DR7L 2NQ8C 4TUQA 3S16H 3S17B 5C0XH 3PIO3 1RKNA 2Q2EB 4NJ8A 4EENA 2H3QA 3J81j 3CRXA 3SYZA 1VEKA 5HR6A 1LTMA 3C1YA 4PG3A 4X3TA 1QYRA 3FRHA 1LM0A 3HGIA 1AH9A 1F9PA 1YSYA 1PTOB 2KJ5A 5KNIA 5J2DA 3VDUA 4GC9A 1E2ZA 1Q1EA 5ELFA 2EO2A 3SYKA 3WKBA 7ICGA 2ES2A 2NVTB 1JROA 1VQ1A 4GMQA 2KJ9A 2M9VA 3EQLC 4MIUA 1BBXC 3BQ0A 3R3OA 2EYFA 5KNDA 3GRVA 2X49A 4ED7A 1ZQDA 4I81A 5AI4A 5KT5A 3U61B 5GTIU 9ICRA 2KCNA 1GABA 4NDXA 2ZJAA 1N36Q 4A3BH 3KP1E 2BCRA 4M9NA 5I9OA 3TAQA 4IPHA 1EY6A 3K5LA 2HHUA 4HEDA 1RPLA 1NV9A 2KK0A 3TEHB 4L5TA 4I2GA 3RH5A 1KKXA 4LF7L 3PUWA 1D0KA 2FMQA 5JI3E 2HBKA 3LVVA 2UXDQ 4DL4A 4IR1A 1G2SA 5I4DA 2TSSA 3AQQA 4DV1L 2QARB 3NHHA 3GO5A 3SK6A 4XK8F 3OW7A 3R9XB 2B2WC 4BS9A 5B66U 5CC4A 4MGKE 1SKSA 4KLQA 3SK5A 3FMCA 4WP2A 1OXSC 2H1RA 2OQ0A 2XCPA 2E2DC 5KFOA 2ODGA 7ICRA 3FUTA 4KY7A 2ZJ5A 4US8A 2AXTU 4R8UA 1Y8NB 4IQTA 4DR5Q 3D8LA 4JV1A 3PUYA 4FZLA 3Q0AA 8ICAA 1UHUA 2F0WA 4DV7Q 3QAUA 2JA6H 1TH4A 2IHNA 2BR0A 4ED0A 4A3GG 1L0YB 4PMBA 4A3IG 3V6JA 4MGYE 4I27A 4Z9CB 4GNXC 1IBMQ 5KGUA 5KG4A 4J8QA 1UA0A 4MNOA 2E2HB 2JY7A 4QWAA 1F9SA 2K6BA 4QNLA 5JAVA 3SK8A 2JXMB 5C0XG 4DFDA 1WTPA 4PZOA 2V1UA 5KFJA 4K4HA 4X62Q 4DV5M 4KY5A 5AK4A 2R93H 4OVZA 2IWHA 2E2JH 1XXGA 1COKA 4HJ7A 1JB3A 1L2FA 1Y1VH 4MHVA 5J1ZA 1N33L 1SWVA 4JI0Q 4DR4M 5KRUA 5JEAJ 1PH7A 2WV6D 4BWGB 4C1NK 1ORYB 1SZPA 3V6HA 2F52A 2FMMA 2ERCA 5D49A 1NK7A 3HW8A 1IBKL 3GILA 1QCBD 4DR5L 4GITA 5C5MA 1DGFA 4ANRA 4O3RA 3RTVA 2C2DA 4Y52H 4U7CA 1J8IA 3M7DA 2K33A 3L26A 4J1MA 2DUDA 5AM5A 3RFAA 4PZ7A 1YJNA 1N34Q 9ICFA 4QZBA 1FFVA 5IGCA 5D14A 8ICVA 3ISBA 4X64M 1C48A 1TWAB 1YJ9A 3S1QB 2X4AA 2Q0ZX 1I3QH 3TQSA 5CV5A 2L6OA 4B3ML 5JPNC 1VQLA 4Q8EA 2DHRA 3HRDD 2Q2HA 4UP7A 4Q44A 3E21A 1WCMG 5I9PA 5M5YH 2YFQA 3BQ7A 3S14H 1ZQHA 1NBWA 1PDQA 2JP1A 5AKZA 4QIWC 4X62L 4B9WA 2BWEA 4MH0E 1F2YA 2UUAL 1U9RA 3I4VA 2HCFA 5D3IB 3K7AH 1HZAA 1ET6A 5AFWA 2EDUA 4NOOB 4F93B 4RHSA 4GOPB 2HBMA 4I8OA 1BDOA 4A3FB 2JK8A 5L8RF 2K5NA 1PTOH 3NENA 2D0OA 3AFPA 3HU3A 1NNUC 5C44B 2OT2A 1UPHA 3PIOA 4RQ3A 5C4XB 3I4MB 2QP9X 4F4XA 4DV0Q 1TF0B 1MU5A 4ZPXA 5DLGA 3GTGB 2KNJA 1OUQA 2KENA 1MSHA 2VQEQ 1KRPA 3T1YQ 2RDJA 4B3SQ 4DK3C 2LHGA 2YY6A 2AWNA 3K59A 4DSFA 2JA8H 2VUMB 3IL8A 1QG7A 1IYUA 5BR8L 3GLIA 2KRUA 5L1MA 1JICA 4IO9A 1XXHB 1XTDA 3RB0A 1ZKOA 1A0IA 1H6UA 3KFUG 5JEAH 1Z1VA 4DV2M 3J80c 1CZGA 4X3UA 3QYPA 1ICWA 5EAYA 1MA7A 2FINB 4LF9L 3V7LA 4DR4Q 4Z6DA 3KFUF 3H91A 4LGMA 1D5MC 2K47A 5BN5A 3C2KA 1D5XC 2J7OA 4LNQA 3THVA 3RZOB 4X5VA 4G4KA 3WKEA 2B8GA 3IV6A 4ECZA 1XB2B 4Y2RA 1X65A 2UU9M 4R63A 5CMDA 5HHIA 3C9PA 5KG5A 4S12A 3E4RA 3CCRA 3MEFA 4YIJA 4A3GH 3Q8LA 3K7AB 1SWWA 2LBCA 3WK7A 4NL9A 5AM1A 1AW7A 3FTFA 2E8GA 2F0KA 2P5ZX 5E4WC 3M3YH 4DLGA 4M9GA 2MFIA 1EIJA 1SKRA 4HSPA 4M8AA 5HP4A 1IY2A 4OW0A 3W68A 2PKEA 4GXIA 1N33M 1COOA 1J6QA 2GVBA 1V8QA 4RKLA 2ZJQA 4FF4A 3UPQA 1W2BA 1JR3D 5E79U 1GUTA 5EQTA 3PW4A 3KXEC 4LY6A 2Y0SF 5M3MG 4GEWA 1X9SA 4OWWB 1AFPA 4TQRA 3RZOH 5AI8A 7CATA 2EXZA 1TGUA 2ICIA 4ID6A 1PZID 2V1CA 4ZCKA 4Y2TA 1E2VA 5AK3A 3MXNB 4IR9A 3UDIA 4PZ6A 4IQVA 4DQRA 1X9WA 1O80A 2LYBA 2JGAA 3UXOA 1ZQUA 4ODGA 3KJPA 4UP8A 1X54A 5IWAQ 3BS1A 2Q8IB 3C21A 3CCUA 2K1BA 4GXKA 2HHHQ 3GTMB 4EYIB 5EBDA 2DWNA 2XGPA 3G6EA 3KSXA 4BGDA 4DR2Q 3U6SA 1TAUA 3DZDA 4DFKA 2NWGA 3STBD 3RGSA 3NBXX 5EJWA 3T13A 5K5PA 4Y2SA 3BDLA 2NRVA 2Z4SA 3BS5B 4HSVA 1DXSA 5AK5A 4UAUA 2JA5G 4IBEA 1Z3EB 4UY8C 2A8VA 5AJ3L 5C0XI 2DGZA 1WUDA 2ZXHA 1L7MA 2WF9A 1EYAA 4YHHM 3IP4B 1B4OA 5ALIA 2WFWA 1LTRD 3Q8DA 5C4XH 4HJ9A 2JA2A 4P16A 1DOLA 2FMCA 3I01M 3AYHB 4ULLA 5C44H 5IYBH 1RZTA 2YNMD 2F5PA 4B9SA 1K5OA 3L2PA 4C8OA 1NY4A 3T1HL 2KEDA 1VQKA 3GPXA 4O42A 1WD0A 3QYEA 4KLMA 1HA5A 1TWCB 4B9LA 4MN3A 5LMNM 2ZTCA 3TBIB 3PIP3 1TQOA 3WK8A 2HSZA 3H7IA 1GUSA 1YNND 4NWIA 2EJSA 4JI2L 2R7FA 4HIOA 1HZ9A 1O7IA 2KVMA 1RYUA 3HOXH 1H9SA 1VEJA 4C1NI 5H1SE 2DF4B 3SAFA 3QWLA 5EXSA 5K36G 4GC7A 2DY7A 2EVBA 2W9CB 2K4EA 3ZDEA 4I2BA 2X6GA 1IN8A 4PHEA 4UN2B 5AIAA 2AJQA 1YZ6A 1SJHD 1T9HA 2XIDA 1H9MA 4B08A 5EPKA 4JYAM 2HMXA 3TN2A 1F2MA 1D8BA 3U9OA 3SARA 1DGGA 5IGFA 5KNCA 5M5XH 2FJ2A 1J5EL 3V6KA 2ZIWB 2HOFA 2KHHA 2MHVA 1P7DA 1DO2A 5EXPA 1WXQA 1JQJC 2N78A 3G6JB 5IT9c 1IY1A 4W5WA 4RQ1A 3DWQA 2EYLA 1PRTF 4FCWA 5F9NA 3TWLA 1CKOA 5KTQA 4V190 1E9SA 2LSSA 2AQ3B 3BZKA 7ICEA 2I46A 2R93G 1GVNA 1JOQA 4X6AH 2L7IA 1CQFA 3U6LA 3H4BA 2ZXRA 4JK1A 3AOGA 1DYQA 7ICTA 3D0FA 4DV0L 3U5ZA 3H8MA 1EY7A 3NVZA 4LF4Q 4ECUA 2JNHA 1U48A 2RHSB 1LKYB 4KY6A 5ITXE 2AH5A 2JA8B 4DR4L 4ECQA 5J0RA 1PFNA 2BCOA 3GLFA 5M5YB 1G59A 3A0JA 4AYBC 8ICZA 3GTOB 2XFTA 4MB7A 3GQCA 4A3IB 1HQCA 4LJAA 2R7DA 3RH4A 1D0LA 4KHPM 1TFRA 1HTPA 2EQYA 2QCUA 4DR3M 1DCZA 2PPBC 1MI2A <