2H5XA

Ruva from mycobacterium tuberculosis
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
195
structure length
183
Chain Sequence
b'MIASVRGEVLEVALDHVVIEAAGVGYRVNATPATLATLRQGTEARLITAMIVREDSMTLYGFPDGETRDLFLTLLSVSGVGPRLAMAALAVHDAPALRQVLADGNVAALTRVPGIGKRGAERMVLELRDKVGVAVRSPVVEALVGLGFAAKQAEEATDTVLAANHDATTSSALRSALSLLGKA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Holliday junction ATP-dependent DNA helicase ruvA
publication title Structure of Mycobacterium tuberculosis RuvA, a protein involved in recombination.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Dna binding protein
total genus 43
structure length 183
sequence length 195
chains with identical sequence B, C, D
ec nomenclature ec 3.6.4.12: DNA helicase.
pdb deposition date 2006-05-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01330 RuvA_N RuvA N terminal domain
A PF07499 RuvA_C RuvA, C-terminal domain
A PF14520 HHH_5 Helix-hairpin-helix domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.10 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 DNA helicase RuvA subunit, C-terminal domain 2h5xA03
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 2h5xA02
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 2h5xA01
4DSKA 1AE2A 2PFOA 1ZQIA 1PGYA 7ICPA 4GLVB 3J7ZC 2VUMH 1PH3A 4DR6L 1ZQQA 2GWSA 4Y52H 2PFQA 4HJ5A 1VQMA 2V4QA 1SL2A 5J2EA 4UAWA 3KHRA 4IOCA 1JX4A 1HNWQ 2IY5B 3NELA 4BXOB 2RDIA 3V7LA 3RR8A 3ORYA 3NBHB 5CJ7A 3AU6A 3UE0A 2R8IA 2R92H 8ICAA 2JEFA 5IT9c 4FBTA 8ICVA 8ICOA 3S1RH 2A1JA 2E2JH 8ICUA 2MO0A 4C8MA 4GC6A 2I5HA 4B9SA 1VQ5A 4JWMA 2BGWA 1O7IA 1NK6A 1F4IA 4J9MA 9ICVA 4YWLA 3H0GG 2CFMA 1RYRA 4F2LA 3RR5A 1N34L 1DGSA 4QWDA 3T1HL 2B63G 2R93H 3K75D 2KHHA 2MNAA 1GM5A 1L1OB 3C1ZA 5IIOA 4DV0Q 4RQ7A 3GLGE 4X5VA 5KFRA 2VS1A 5DDMA 4DR2L 2NVTH 3KHLA 2FXQA 3BDPA 4PPXA 1ZQSA 4JYAL 2IHNA 1R9TH 2E5LQ 1N56A 3ZJYC 1PH2A 4J9NA 2AQ4A 4EZ6A 4OWWB 4GXIA 4A93G 4LF7Q 1Q8KA 8ICSA 3I4NH 4GKKQ 2VNUD 3HFZB 3K80C 4LUVA 4IO9A 4B3TQ 2KZMA 4F5OA 4ECYA 1ZQBA 2CWBA 2ES2A 2BQ3A 2ZUCA 2ZUBA 1COOA 1UE5A 2JK8A 2VANA 4X62L 2KN7A 2CWPA 1WI5A 3GTLH 3BQTA 3RAQA 3FKIH 1WGLA 3SI8A 3GDEA 4UBBA 1Y1WG 2LSSA 2W9CA 4A3JG 1HQYE 4I2IA 5KFGA 3GFKB 4NLZA 2Z6KC 2EJSA 3KDFA 3S2HH 4KLQA 3MXNB 4QGUA 1EUJA 5C0XG 2DAMA 2VQFQ 1KYIA 4Q43A 3RZDH 8ICCA 2HHSA 3H8SA 2I5MX 3I2ZA 4QZBA 3PO3G 1UE1A 3RB4A 2UUBQ 3GV7B 5DG7A 4YR0A 3HOYH 3GD7A 3MEFA 1E1OA 7ICHA 3H3VH 1J5EQ 2D0PA 4IPDA 4A3CG 5J0TA 4WJ4A 4F92B 2OO9A 3ZD9A 3L7ZC 1SG9A 1G6PA 5J2KA 1NJIC 1X9SA 1K8AC 3J81i 3RLNA 1YI2A 5J2JA 4RNOA 1CKMA 1KL9A 2EXDA 4QIWE 5CHGA 4PGXA 1NK7A 3HOVH 1ZYQA 4F2SA 2F52A 4PMWA 3L2PA 2R7ZG 5FLXc 1N33L 4DR3L 4B3RL 5KFMA 2VA8A 1XWLA 4TQUS 2PI4A 2DZLA 4A3MG 1M1KC 4R4TA 1PFSA 2HHHL 1S3OA 5BR8Q 4X64Q 4A75A 5C0XI 4UQGA 4I2GA 2I5LX 4DV3Q 3I4OA 1EQQA 3K7AH 4YD2A 5CB1A 1PV4A 3G6XA 4KLFA 2B3GA 4QWAA 3SZ2A 9ICUA 4DL3A 4ELUA 9ICFA 5KG7A 4A3EH 4NXNL 1FJGL 5KFIA 5FJ8G 2MO1A 1PYBA 4PHEA 4DV7L 1IBML 1HUZA 3GTKH 1K3RA 3AU2A 1SRUA 4J9SA 1N8RC 1YVCA 5KFWA 4NLNA 4LF9L 1VQCA 5H1SE 3ZDDA 2Q2UA 1CKNB 4XTCS 2JY8A 4M2YA 4C8NA 3CCQA 4I2DA 5KG0A 2CWAA 4ECVA 3LGJA 4DSLA 3ZDCA 4BGDA 4LFAQ 4JI8L 1GO5A 5EWEA 3CP0A 2ZJRA 2R0IA 2HHUA 1FVIA 4IJLA 4JC0A 2DAGA 4PH5A 4DFPA 3I4MH 5J0WA 3PUXA 1CSQA 2IX0A 2XY6A 4LFBL 1VQDA 2HQLA 2JA8G 1KQSA 3L0OA 3J81c 5IE8A 3T5LA 1P3QQ 4YCWA 4KLMA 1MC8A 8ICNA 4RPZA 2MAXA 1JJ2A 3RR7A 5HMMA 5IYCH 1W3SA 2PNHA 4MFAA 3OJUA 4DFMA 4O5CA 3EN2A 3PX0A 3ISDA 2ZTCA 4K0KL 4JI1L 2Y0SG 3M85A 3ZDAA 5IP7H 1OQYA 5GAGC 1MKHA 2DAKA 4OX9Q 5HMLA 5KT7A 4Q45A 3CPFA 4YVZA 1X65A 5IINA 3RB6A 3RLFA 2MQHA 3NTUA 3UXPA 4DQPA 4ECQA 2RF4A 5KG6A 3PY8A 4RT2A 3OHBA 4IPCA 5KFVA 5JJIA 1YLAA 4M9HA 1BBWA 3RB0A 3S1QH 1JJGA 1HT2E 5KT4A 2HW3A 4JI4Q 7ICJA 5L1KA 2OTJA 4YCXA 1N36L 3HPOA 4DLGA 2BQRA 4QZFA 1QZHA 3PNCA 4BBRH 4RG1A 4RNMA 4MTNA 4WP2A 1WHCA 4UB3A 3BQ1A 1EWIA 3MR3A 4DFJA 1VQLA 4KI0A 2XO7A 2NRWA 4I27A 4B9MA 2E2IH 1S9FA 4XQ8A 1ZQVA 4DLEA 4C3JH 5LMNQ 4QZ9A 4UB4A 2PFPA 1EYGA 5LMUL 2A1JB 3LCVB 1NK0A 4YCVA 4DUYL 4MEYA 4JI3Q 4NLGA 5IYBH 1HR0W 4QZHA 4R4IA 4BY1H 3QZ7A 1BPBA 1YHAA 2I0QA 4F5RA 4AIMA 1S72A 4UY8C 5DBCA 4PG3A 1B70B 4C2MH 1XPUA 2BCRA 1JT8A 2VUMG 5DBAA 1LYLA 3W1GA 5DB8A 5FLMG 1GVPA 1T4GA 2JE6I 4Z6DA 4TQSA 4DR6Q 1BBUA 1KAWA 2A8VA 4LFCQ 4K4HA 1TK0A 4F1IA 1SN8A 1AIPC 4OWTB 1PH1A 2R92G 1VQAA 2NZHA 3MGIA 1G4AE 3RZOH 4I29A 3QEAZ 4JV5Q 4O0AA 2DAIA 2JEAI 4R65A 8ICIA 3E0EA 3PF5A 2XC9A 3TREA 2QNJA 2R93G 3C21A 9ICIA 1VEGA 4DV5L 3K9OA 1PH6A 1N34Q 5JJLA 2C2EA 8ICZA 1PH8A 4RPYA 2BKEA 5J2IA 1BKBA 1KEJA 1D9FA 1D8YA 2JA6H 4DOCA 4DR2Q 2UXDL 2FPMA 4YMMA 1G51A 4FDBA 3K7UC 1S97A 4A3DG 4LF4Q 4JYAQ 1XXHE 4UAYA 1TAQA 3TQ1A 2NN6I 3I4NG 3MR2A 3GLFE 4A4IA 2VZAA 1QVFA 4PGYA 1X9NA 2JA5H 4DL4A 4RQ4A 5DDYA 5KFJA 4DOBA 1S77D 4EYHB 1TAUA 4J9QA 3RJFA 4IFDG 4AYBG 4KLEA 3PX4A 1SFOH 2E2HH 4I2EA 1QSSA 1NJWA 2KCMA 4IQUA 4JBMA 4NPSA 2PXIA 3F1ZA 3ERSX 4KLTA 1UWVA 4A3GH 1TWGH 3DM3A 4X62Q 5KTQA 4DF8A 1NK4A 1CUKA 3RJHA 2G3QA 1T43A 1XNRL 3NEMA 1UT5A 2FMSA 2BWEA 2I1QA 1TFRA 5KT2A 4O3PA 1L3UA 1YZ6A 5IP9H 1UE6A 2P66A 4KITB 1XTDA 3RJKA 5C44H 2FMQA 1VQ1A 5KG5A 2NRXA 2K50A 2ZM6Q 5M3MG 1K8GA 5GADC 8ICRA 3V7KA 3ISCA 1LM0A 3JPNA 5KFYA 1S0NA 7ICSA 2WB1G 4HJ9A 5ELOA 4YHHQ 3PV8A 2EKFA 4IQTA 2MGWA 1RXVA 7ICQA 3SV3A 4A3BG 1U0LA 1XMOL 3PW2A 4NLKA 2Z0SA 1SMXA 4GKJQ 3GTGH 1CKNA 4DR4L 1EFUB 2K75A 1UEBA 1IXSA 1OXTA 1EOVA 2JA7H 9ICTA 4C3IH 2DUDA 1KRPA 1WCNA 7ICEA 3GV5B 4GS3A 2A1AA 3T3FA 5E7NA 2UXBL 4DL6A 4FS1A 3B0YA 4IQWA 9ICNA 2M9NA 3H4BA 2CCZA 1N48A 1G41A 2AGQA 1JXEA 3K81C 3EZ5A 4DR3Q 4B3RQ 1I5FA 1WJ7A 3MR5A 1VQFA 3UQ2A 3JPTA 2DPIA 2ISOA 4MFFA 2YV5A 4IR9A 4NXML 1T7PA 1AE3A 2AGOA 2HHHQ 5DKWA 3HOZH 2KBNA 3PO2H 4O0IA 1XSPA 1GD7A 2ID0A 2WB1E 4QWEA 4DFKA 4DWIA 4A3EG 5D4BA 2A19A 5J2CA 4QQBX 3FYHA 4AH6A 5M3FH 2UUAL 2JY5A 1K1SA 3KF6A 4CCHA 4HJ8A 3U58A 4DQQA 3PIOA 3HOUG 1VG5A 2V4RA 1BPYA 2NZOA 3C23A 1YBYA 4BBSH 3M9OB 1NKBA 5J0UA 3U4VA 4M9LA 2BCSA 3OW2A 1RL2A 2N49A 2R8KA 4YP3A 5DG8A 3RAXA 2PI2A 4O3SA 4R66A 4IRCA 1ASZA 9ICCA 4PZ6A 1XPRA 2DENA 4BXXH 2HWJA 4GN4B 3H8WA 1JMSA 3H8JA 4RQ2A 4YR3A 4I2BA 2NVXH 2F1HA 3QEBZ 3ER0A 1PH5A 1EXNA 2L2DA 4A3FG 5CWRA 4XIGS 1YJWA 1NKCA 2UVUA 1KIXA 3CCRA 4GOPC 4QWCA 3CMAA 3MDCA 1TWCH 1HNXL 3G6EA 3LDAA 3K8AA 3TS2A 4A3LG 5TZVA 1ZQCA 1PH4A 1HNZL 1ZQXA 5L1LA 4BWJA 4KTQA 4JI2L 1ZQAA 4F5NA 2FMPA 5IYCG 4DR1Q 5J0PA 9ICEA 3BQ0A 2GVAA 2KNAA 4PZ7A 1JJCB 1TWAH 5DLGA 5CP2A 1RZTA 9ICQA 1ZQPA 4GC7A 3EBEA 1HH2P 4C8KA 3T5JA 4YY3Q 1C9OA 2LXJA 1ZQFA 3N4MB 1E24A 4IJHA 4DV1Q 3RN2A 1JIHA 1G3IA 3EIVA 4QWBA 4JI1Q 3CCVA 4DV6L 1VQ4A 4RUCA 1NJYA 1IM4A 5AJ3L 4ED6A 4YFKA 3MMPA 2C35B 3AUOA 4ED0A 3T1YL 1S0MA 1ZQZA 5JEAG 4UBCA 3PIPA 3CCSA 4P75A 1WCLA 4O5EA 4YG2A 2NVQH 4YXMA 2HHQA 4DSEA 2WFWA 1HZBA 1A5TA 5LMNW 1X3FA 2CQOA 3UPQA 3M3YH 3A5ZB 3LCUA 3ZDEA 2GVBA 4IRKA 2OWOA 4LZGA 4DPGA 1TWHH 3PR4A 1TR8A 1I94Q 4LF8L 2KNVA 5HNKA 5IIJA 4APVA 4M9NA 5DB9A 2HVIA 5HY6A 2ZJQA 3RTVA 1MSWD 4MF2A 2UUCL 2UU9L 4X65Q 1IBLQ 1RXWA 1NMGA 4R8UB 1KTQA 4JI7L 4NM1A 1NJZA 4KLDA 2QGQA 5J3BA 3TRZA 4YR2A 5CR0A 2JEGA 2XGPA 4A3KG 4O9MA 1IM2A 1VQOA 4DR5L 1U45A 1E22A 5BOMA 2NRTA 1MJCA 5IYBG 1LV5A 3M7NA 3FE3A 4DK6C 4Z6EA 4DUYQ 3U4ZA 5DB6A 3HOWG 1S0OA 8ICQA 4RQ0A 5L1JA 1C7YA 2UVRA 3CAMA 1TXYA 4EYIB 9ICXA 2Z6KA 4J15A 5C4XH 1KXLA 1QZEA 2R6GA 7ICKA 2WAQG 3GTPH 1VEKA 3EPIA 9ICLA 2VY3A 3FP9A 1RPLA 4UP7A 4JI5L 5J2AA 1I3QH 4F4YA 3JPOA 4RQ1A 4HEOA 4IPGA 2BWBA 2OOAA 4LF5L 2QEXA 2LYHA 4BY7H 5DGAA 1IZ6A 4JCVE 2Y1JA 4DUZL 4DO9A 4QJFA 1A0IA 2EKKA 5KG2A 2CKZB 5C3EG 3JPSA 4R64A 3E46A 3B0XA 7ICIA 2W9BB 4JBKA 2C2RA 4OO1G 4DQSA 4YXJA 2HIVA 1ZQMA 1IYJB 2VL6A 2LVOC 3RNUA 3RRGA 1KRTA 2VQEL 4MEXA 1ZQHA 1D9DA 1SE8A 2Q2HA 3KHGA 1ZQTA 1C0AA 2WAQE 3MR6A 2UXDQ 4KLUA 3U50C 1QLNA 5KG3A 2KENA 1WCMG 3KLWA 2J6UA 1QVGA 3HX0A 4R1JA 2BPGA 3CXCA 2QHOB 3Q8PB 1SR3A 1SZPA 3MABA 5CA7A 1A63A 1VQPA 3HKSA 2QSFX 2FLNA 1ZMWA 3S2DH 1ZQLA 4K4GA 2AWOA 1SL0A 1K1QA 3H4DA 4R4CA 2KFZA 4B9UA 4KN7A 1X9WA 3KF8B 4JI0L 5IYDG 1BPEA 1OXVA 3J81j 4RNNA 4B3SQ 4DF4A 1NY4A 4XA5A 4GEWA 1VQHA 4O3OA 2BA1A 5IP9G 3H15A 1Q12A 4B3MQ 4KHPL 3M9MB 3F92A 2F4VQ 4EQ5A 2R8HA 1ZQKA 1V9PA 1ZQOA 4DOAA 2J6SA 3JPRA 3TI0A 5KT5A 3ZD8A 1KC8C 1NV8A 4UPAA 1A76A 3MGHA 5J2GA 5DLFA 5KFNA 1NK5A 2Q2IA 4R71A 3JAMi 1XMOQ 2ALZA 1WYDA 3GLHE 3BQ2A 3KF6B 3S17H 4YWMA 1X3GA 4DR4Q 1CKOA 1R4GA 2JNHA 4RT3A 5KFLA 4KHZA 4LF6L 2DFLA 2LVQD 4ZH4A 4DNIA 3RJEA 2ZUDA 3M9NB 4POFA 1HR0L 1U5KA 4O3QA 2PQAA 2H5XA 1XMQQ 1Z00A 8ICBA 1HT1E 1V43A 1J6QA 1MQ3A 2ALYB 3HOZG 5EOZA 3PO2G 3GTJH 1VQKA 4JBJA 1XC9A 4DV2Q 4C8LA 5KFAA 1VQ7A 4O3NA 1TK8A 4LWCA 4Q8EA 3LWLA 4ECZA 5M3FG 2DGYA 3UXOA 1VQNA 2AKWB 3H0GH 9ICHA 2UUAQ 3LWMA 4BBSG 2B63H 4GOPB 1WJJA 2YTYA 1LB2B 9ICJA 2IHMA 1XNQL 2DKLA 1SKSA 2F1IA 2K5VA 2JY7A 4HIOA 9ICSA 3RLOA 5IIMA 4UP8A 2Y0SE 4LF7L 5BPCA 5J0XA 2ASDA 4P73A 1SKRA 1KFSA 3CF5A 3C1YA 2HHWA 3KJPA 4A93H 1IXRA 1TK5A 2IT1A 3KOJA 5C0XJ 3Q8QB 4Y7NH 2ZJ5A 3OJSA 3PO4A 3TANA 2JZ1A 3TFRA 2LBCA 1PH7A 4J9RA 2LVNC 3BJUA 3CCJA 3V6KA 1EIYB 2XY7A 3T5KA 1E1TA 3HOXH 1NMFA 1A62A 1XSNA 4QZEA 4M9GA 5HP4A 3STBD 1MQ2A 4GNXC 2K9DA 1JB7A 4A3IH 4YMNA 3F2BA 3Q8SB 8ICYA 1Y1WH 3V72A 2IA6A 2PFNA 2B21A 1ZJMA 5J0YA 2VQFL 2MR9A 4R8UA 4B9TA 2W9AA 1SLJA 2PMZE 3A0JA 1Z47A 4ECUA 7ICUA 1OXXK 3BZCA 4DEZA 1ZMUA 4M04A 2HAKA 3IECA 1TVAA 4JV1A 4B9VA 1JXLA 3W5OA 1L2FA 1VQBA 2Q0ZX 5BOLA 1J5EL 1D8LA 2I9GA 4KLSA 1A77A 1KLNA 4TUSA 3T1HQ 4UAZA 2HHTA 3BJYA 1ZQEA 4O2DA 3T1YQ 3MBYA 3H7IA 3UDFA 1VQJA 4TVAB 4MFCA 4J9OA 1UE7A 3D31A 4F8RA 1AROP 1SKWA 3ULPA 1Z3EB 1L5UA 3TARA 4QZGA 2ASBA 3N97B 1MJEA 7ICFA 2R7ZH 1XU4A 4LF8Q 2O25A 2AWNA 1S40A 4F5PA 2VW9A 2JEBI 4X64L 2D62A 1B43A 3UDIA 4Z6FA 3GIIA 1ZQUA 4DV3L 1PHJA 2W9BA 2ATLA 1CSPA 2LVPC 3M9BA 1XSLA 2UUCQ 1TV9A 2UU9Q 5KT6A 5KFXA 9ICGA 3GTMH 4F4ZA 4QZDA 8ICPA 1VQ9A 3C5GA 4EEYA 1Y1VH 5J29A 1YHQA 1NBWA 4KMUA 3GLIE 4DR5Q 3FKIG 3GIJA 1Y8GA 4DAYB 5FJ8H 3DLLA 5J2HA 3JC66 2OQKA 5D49A 4M9JA 4YCUA 4HJAA 8ICXA 5KT3A 4GLAC 4JI6L 3G48A 4F50A 2HHVA 1NV9A 4EZ9A 4PHAA 4JBWA 5HHIA 4LFAL 2YTXA 3HOYG 4RQ3A 4HJ7A 1W2BA 2QA4A 4F5QA 2EIFA 5JJKA 2AGPA 2PI2E 1S10A 4JV2A 2WP8J 3EW9A 5KFSA 4AYBE 4BY7G 1IBKL 4LF5Q 2UVVA 1ZETA 1RIPA 4KLKA 4EBDA 4IFDI 3OGUA 4R4OA 5C4JH 3CCMA 4IR1A 4DUZQ 1EQRA 3HW8A 3CC2A 4K4IA 1VQ8A 2IX1A 3HOVG 4DR7L 3WWVA 4AQYL 3OTOL 4P74A 2JZ0A 1TWFH 2JA8H 2FPKA 1S0VA 1N32L 3TQYA 4A76A 4EX5A 2K14A 3W1BA 4KLLA 1N33Q 4JWNA 9ICKA 2K5HA 1V1QA 5ELNA 4Q44A 2JJQA 9ICMA 3M4PA 1Q02A 3QZ8A 3NENA 2L15A 4DV4L 3H40A 2RDJA 4ECSA 7ICNA 3I55A 2AQ0A 3CD6A 4OONA 1XO1A 5GROA 4RMFA 2JZBA 3NGDA 4NXNQ 1FJGQ 5DQHA 1SL1A 5M5WH 4UB2A 5KFZA 4DV7Q 1IBMQ 2VA2A 2XGTA 1HZCA 1NKEA 1VS0A 3OYYA 2MROB 5GQOA 1DO2A 2JUJA 5DQGA 3T5HA 3TS0A 4H02A 5C5JA 3RH4A 3KYHC 7ICRA 2XTIA 3PCOB 4DQIA 4LF9Q 2IMWP 3V6HA 4O3RA 1N9WA 5EWFA 3GTQH 3D0FA 8ICHA 4X66L 4RU9A 4F3OA 1D7QA 4ECRA 2AMCB 1I50H 4IOAA 3UQ0A 4JI8Q 3GV8B 2PQAB 4UP9A 9ICBA 1T3NA 3I4MG 3J7A5 4TURA 3M4QA 1Z00B 5F9NA 4BWMA 2KNZA 5KFPA 1KDHA 1X55A 1WIVA 3PUVA 1KD1C 2LTUA 4GLXA 8ICTA 2R7FA 4GXKA 4JI3L 4GOPA 4J9LA 1YJNA 4ME3A 1DOQA 4LFBQ 3GIMA 3HT3A 1BVSA 9ICRA 3M8SA 4FO6A 7ICOA 1YITA 2C28A 3HKZG 5K36G 3MDAA 3EYZA 1E3PA 5KFCA 1U49A 4OWXB 4L5QA 4G3OA 4P4PA 2ASLA 4DL5A 1QUQB 1B22A 2FLLA 3GDXA 3KTQA 1P16A 2K0BX 1SROA 2OOBA 4ECWA 1FGUA 3F8TA 5IWAL 4LF6Q 3S16H 3THVA 4XRHA 5FLMH 1ASYA 4LFCL 5IP7G 4K0KQ 3K4GA 1HR0Q 3LK9A 1WFQA 2XGQA 1E94E 4ED2A 4JV5L 4Q7JA 3RJGA 1P8LA 1UA0A 4I28A 3S14H 4C3HH 3CQZH 2MUTA 3K0XA 2DNAA 4ED1A 1Z9FA 3PX6A 5DGBA 1VQGA 3UE1A 3RN5A 4IFDJ 1Q7YC 3HKZE 2C2DA 4BBRG 4QZAA 1N36Q 3PUYA 4RUAA 4L5TA 1XNQQ 3PO5A 4P71A 2MJ5B 2W8LA 1X56A 1WGNA 4LF4L 2C22A 4GNXB 1K9MC 3G6VA 2R7DA 1X2IA 1V92A 4A3DH 4DL2A 1PVOA 3C2KA 1EIFA 1CEZA 5LMUQ 5KFHA 2JP7A 4FBUA 4OXPA 1ZQJA 2BPCA 4BY1G 4BA2I 2RCNA 3TAPA 2DAEA 7ICVA 3HOXG 2YYZA 3CW2C 2RHQB 3H4JA 3PVXA 1KFTA 2HIXA 2W9MA 4HIDA 2JY6B 4TUPA 5J2BA 1VQEA 4A3IG 4E0DA 3I7FA 1YNXA 3Q8LA 3OSPA 3GILA 4MZ9A 1X54A 3F2CA 5J2FA 4BDPA 4Q8FA 2D0OA 4I2AA 2NRVA 1OKSA 1PYSB 2NVYH 3BU2A 2ZM6L 3EWAA 1ZV1A 5KFUA 8ICFA 1KSPA 1NTGA 5M3MH 4YHHL 4DSJA 1T6OA 3Q8KA 2DPJA 3OSNA 1TTEA 4QL5A 1B8AA 5EAYA 4DSIA 1OXSC 4GKJL 4A3BH 3I56A 3S1MH 2KFNA 3S1NH 4DV5Q 1WOCA 5IILA 4NM2A 5KFOA 9ICOA 4GN5A 5KFFA 1KHIA 4KLGA 2JA6G 2CP8A 2F1JA 1NK9A 3CC4A 2PI5A 5L1IA 4KLOA 9ICPA 4BA1I 3RRHA 5JI2E 7ICMA 4I2JA 1NJXA 2KHJA 4DBGB 5F9LA 2UXCL 1Q86C 1RYSA 2JA5G 1UA1A 5GAHC 3FRHA 2DI0A 1HZ9A 1BPZA 5HHHA 4X6AH 3AQQA 3A74A 1LTLA 2AU0A 1NK8A 2KZZA 5L9XA 1PZNA 1X3EA 4LUOA 4A3GG 3AFPA 4F4XA 1Y1VG 4DS5A 5JUMA 4I2FA 2YTVA 3STBC 2KCTA 1ZQDA 5IY0A 5DBBA 4L5RC 4OO1I 4G3IA 2L4FA 3HWTA 1T8EA 3RJJA 4JUZA 1XNRQ 1VQIA 3HOUH 4LZDA 3E2EA 3K9PA 3T6PA 5C44G 4JV0A 2LXKA 1U47A 1WR1B 2ASJA 4JI6Q 1Q81C 1U4BA 2N78A 3UDGA 3RH5A 3RBDA 1HUOA 5M5XH 1YEZA 4F4KA 4QW8A 4LNQA 1A8VA 1JE5A 3FHWA 2Y1IA 3CPWA 4HYKA 3MFIA 3IHQB 4RQ6A 4A3FH 1EFWA 2ZJ8A 1IBKQ 3PW4A 2JZBB 2JA7G 3OHAA 7ICTA 1K73C 2IHEA 4POGA 1Y88A 4QZIA 3CCEA 3Q8MA 4YWKA 4A3LH 4JK1A 4DR7Q 2OQ0A 4AQYQ 3OTOQ 2UXBQ 5JEAJ 1B7YB 1HNWL 4DR1L 5KFTA 3ULLA 3ULJA 1N32Q 3Q8RB 2FLPA 2ZJPA 1GKHA 4JG2A 3GO5A 3SGIA 4YY3L 4DL7A 4NXMQ 2V9WA 2BDPA 4DV1L 3M8RA 4QZ8A 2BR0A 4M6WB 3SV4A 4DV4Q 1NE3A 3V6JA 3G4SA 4HIKA 3PV0A 4J9KA 4PHDA 2E8GA 5KFBA 2XCAA 4DV0L 5M5YH 2XY5A 3RB3A 3J80i 1QUQA 4DAMA 8ICWA 3ICEA 4I2HA 3PSIA 3TAQA 2E5LL 4B9NA 1S76D 1Y14B 3PF4A 3QE9Y 3F2DA 5KFEA 2R8GA 1Q1EA 4BXOA 4ECXA 1I94L 4BXXG 1H95A 1I6HH 5KFKA 2V1CC 2N8NA 2VA3A 1YJ9A 4GKKL 1VCIA 5J0OA 4X66Q 4DK3C 1Q1BA 4WJ3M 5KFQA 8ICJA 2UVWA 4YQWA 4B3TL 3EPGA 3TEHB 3VDYA 4L5SA 4X65L 1IBLL 3G71A 5DLQE 4J9PA 1UFZA 1YIJA 4PHPA 8ICEA 1L1OC 3CCUA 5KG4A 3BZKA 2BCUA 2Q2TA 1QVCA 4MNOA 3IM1A 4A3KH 2ZTEA 3JAMc 4RPXA 1HNXQ 1L1OA 1X6OA 1H38A 5KG1A 2R8JA 2MUTB 1HNZQ 3PW7A 1HJPA 3G6YA 1VDLA 3CCLA 3HOWH 4A3JH 1MN3A 1AH9A 1KRSA 4KLIA 5J0SA 4JI2Q 4GNXA 3AEVA 3JPQA 1XPOA 3PGZA 3UDXA 4KN4A 5EWGA 1XJVA 2RRUA 2HVHA 2JEIA 3GQCA 2KHIA 1QSLA 2NN6G 2UUBL 2P6RA 5DFLA 2AJQA 3PO3H 4UB1A 3RBEA 4TQRA 5IWAQ 2K4KA 4PGQA 2XCPA 4DV6Q 1NOMA 3B89A 2BHNA 4QW9A 1JR3E 3S15H 5AJ3Q 4UB5A 3CMEA 4QZCA 3M4OH 3ETLA 4F4WA 3IRBA 4A3CH 1BPXA 3TFSA 1K0RA 4IPHA 9ICAA 4MF8A 4B9LA 2YU9H 1Q46A 1IL2A 4LW1A 3KFUA 4ELVA 1JMCA 3BBZA 8ICLA 1E7ZA 5C3EH 2WZJA 3J80c 3SYZA 4LVSA 4ALPA 3RH6A 1U48A 3CC7A 3PUWA 1LUZA 1IFYA 1OTCA 2KZ3A 1YHBA 5BR8L 4GN3B 4RQ5A 1XB2B 4A3MH 1VQ6A 2W9CB 2HHXA 4EBEA 4YMOA 1L3SA 3KDFB 1L3VA 3KJOA 4NB3A 2HT1A 4RQ8A 4M47A 1K83H 2ZTDA 2F3IA 4JI7Q 2BH2A 1JN3A 4HIMA 4UN2B 1OTRA 2NRZA 1WCMH 1QZGA 3GTOH 3FDSA 8ICKA 1Q82C 4C8OA 1QSYA 4NXZA 1BGXT 4R4QA 2BCVA 1G291 3A5UA 1L0WA 4DS4A 1HZAA 2WTFA 4IRDA 4F2RA 5C4XG 2MFIA 3RJIA 2LVAA 2FPLA 4I2CA 3E21A 4NY8A 4ED7A 4B3SL 1KFDA 1PH9A 5IYDH 4DQRA 1ZQNA 1ZQWA 3JPPA 4DSFA 2BPFA 3PW5A 5IIIA 4JI5Q 2J6TA 3PUZA 4EBCA 3ISBA 1U9LA 3C2LA 3E9HA 4B3ML 2F4VL 4XUSA 1QTMA 2IBKA 2W8KA 8ICGA 1BPDA 4YD1A 4RZRA 2P6UA 4YN4A 3PMLA 4ED3A 3E9IA 4LUZA 7ICGA 4R63A 9ICWA 3AFQA 1ZQGA 4IQVA 3C5FA 3V7JA 4DKAC 4QY7A 4P4MA 1GO3E 2RHSB 1X9MA 1DO0A 2BA0A 3C2MA 1ZJNA 5IIKA 2DHYA 1L3TA 4P72A 2VQEQ 3MFHA 3ZDBA 2BCQA 2L4EA 5HGQA 2B3TA 5DQIA 4Z6CA 1T9HA 1XMQL 1OXUA 4OX9L 7ICLA 2ATWA 2UXCQ 2BQUA 2JEJA 5DG9A 3KHHA 4GXJA 3H3VI 3FRIA 2K5NA 4JOIC 5GAEC 4DV2L 5J0RA 3PMNA 4JOIA 3PR5B 3AYHB 4ELTA 2KTQA 4JI4L 5J2DA 3S24A 1TKDA 4F93B 2K52A 1ZMVA 1UT8A 2N3SA 4JI0Q 4KLHA 2B29A 2ZJAA 4M0AA 2OCEA 1MIUA 1FL0A 2EQSA 4M6WA 5LMNL 1PA6A 1ZQRA 5DB7A 4KHPQ 1ZQYA 2ISPA 1M90C 3HP6A 4P4OA 3GIKA 4FS2A 1DV0A 1VEJA 1OAIA 4P2HA 2BH8A 3IHPA 8ICMA 3PW0A 2IHFA 5D46A 4ED8A 4O5KA 1XS9D 4TUQA 4ECTA 2JQOA 4PZ8A 4F91B 2JA9A 2OTLA 3UXNA 2GN5A 5KFDA 5J0QA 4KLJA 2AHOB 3Q8DA 3B6YA
chains in the Genus database with same CATH superfamily
4DSKA 3IDWA 1PGYA 4GLVB 4X3UA 4N9PA 1ZQQA 3N7PD 4HJ5A 2I6XA 5AI5A 4UAWA 3NELA 3ORYA 5CJ7A 1JR3D 2R92H 2JEFA 2KHQA 8ICUA 4RF1A 4B9SA 1H9MA 2L5YA 4JWMA 1NK6A 9ICVA 4C4SA 2CFMA 2RGHA 2PZTA 2R93H 1D1IA 1Z5AA 4DV0Q 2MA1A 4X5VA 5KFRA 2VS1A 1G6ZA 3KHLA 2ZXOA 4JYAL 4C7YA 2IHNA 1R9TH 2E5LQ 4QOZC 1QCKA 3ZJYC 2G9HD 4AG6A 4LF7Q 2DWLA 4DNRB 4C80A 3SAFA 1CHQD 3K80C 4IO9A 4F5OA 4CF3A 2CWBA 1VMCA 3VR5A 4XDXA 2ES2A 4LCBA 1L6NA 1UE5A 4HSPA 2CWPA 1WI5A 4RGOS 5C0YA 3FKIH 1WGLA 4LG2A 1Y1WG 2LSSA 3VR4A 1X6JA 1HQYE 4DV5M 1UQVA 3KDFA 2BCOA 4MM3B 4QGUA 1T5XD 2SEBD 3QWNA 4Q43A 5ALPA 8ICCA 3H8SA 3I2ZA 1UE1A 5A35A 2HDMA 1PRBA 1SNCA 4N8X1 1GUNA 3HOYH 7ICHA 4IPDA 4A3CG 5J0TA 5BN5A 3X3MA 5J2KA 1NJIC 2B2VC 1S5ED 3RLNA 1YI2A 2EXDA 2NVXB 4QIWE 4J1MA 4PGXA 1NK7A 1I50B 2F03A 4PMWA 5KFMA 1XWLA 3FUTA 4CGZA 4A3MG 2KKVA 4R4TA 4RWSC 5BR8Q 4X64Q 4DV3Q 5IIFA 3A0BU 4YD2A 5CB1A 3H0LB 1CZGA 2B3GA 2A6HC 3SZ2A 2OM6A 4NXNL 5KFIA 5EBCA 1PYBA 1HUZA 3GTKH 1IBKM 4X3TA 4NLNA 1M4VA 1XXHB 1VQCA 5H1SE 2EYLA 2Q2UA 4XTCS 1SYGA 2F0MA 4M2YA 3CCQA 3GLFB 3LGJA 4DR7M 4QIWC 3OTOM 2UXBM 3ZDCA 4BGDA 3S14B 1EEFD 2HHUA 2E1FA 4C3HB 2IJ0A 2ZT9C 2NO4A 4J6HA 1PVPA 3DXJC 2WAQC 4DV4M 1HIWA 2K4IA 1Y8OB 3J81c 4YCWA 4KLMA 2QENA 8ICNA 2KP7A 3RR7A 3MJ5A 5EQTA 2R45A 4A3DB 2PNHA 2F5QA 3PX0A 2ZTCA 2LPEA 2RDGA 4X66M 3TP8A 1SSOA 2FMCA 2ZXRA 1JR0D 4YVZA 4FFDA 2OHFA 5TSSA 1D5ZC 2K1BA 1WTOA 3RLFA 3A98B 4RT2A 3OHBA 5JJIA 1BBWA 2CW0C 3S1QH 4JI4Q 7ICJA 2BQRA 5GTHU 4RG1A 4RNMA 1N77A 2H3FA 5M3MB 4DFJA 1LTMA 2CHGA 3FKEA 3U9OA 3R8FA 4I27A 4B9MA 1IXRC 4DLEA 4QHTA 4LZJA 5IWAM 1NK0A 4LK1C 4DUYL 4LFCM 5IYBH 3BYYB 4ICAA 4IALA 4NWIA 4JV5M 5DBCA 4KD4A 1B70B 1XPUA 1JT8A 1AUAA 2Z3XA 1O03A 5DBAA 1IKMA 1NSNS 3W1GA 4Z6DA 1BBUA 4KY5A 1TK0A 4AP9A 3EJIA 1AIPC 4OWTB 2NZHA 4WURA 1G4AE 3DWQA 5CC4A 4P0PA 4I29A 2EY6A 3QEAZ 1BF4A 4R65A 3OIPA 2VXWA 2XC9A 3TREA 2QNJA 2KK0A 9ICIA 4CKEA 3NWLA 2J7OA 5EE0A 3D4WA 5M5XB 4ITQA 4DR2Q 1IW7D 4YMMA 4FDBA 3EA6A 4I7AA 3K7UC 2EAOA 1XXHE 5CBAE 2ZG6A 3GLFE 1QVFA 5ITRA 4PGYA 4DOBA 1S77D 1QJOA 1KFVA 1V1PA 3J7AF 2KXEA 3RJFA 2QKQA 2G07A 4K5WA 4IQUA 3F1ZA 4A3GH 2DWMA 3DM3A 4DF8A 1CUKA 3RJHA 2FHTA 1UT5A 2MJ8A 1OFHA 3PZPA 3K5MA 5E26A 3SMPA 4G7HC 1YZ6A 1UE6A 1XTDA 3RJKA 1S5DD 2K50A 5GADC 3KXEC 2NZ1D 2JV3A 3CYMA 4YHHQ 2ZIVA 4KD3A 1SMXA 3GTGH 1CKNA 1O78A 3ND9A 4MN3A 2KUMA 3RE8A 2DUDA 2AHMA 4X3SA 5IGCA 3KP1E 3E0JA 2R4JA 3KKAC 3ZYYX 5E7NA 4IQWA 3H4BA 1E32A 4JI0M 3VK8A 1JXEA 3SAGA 1NSFA 4DR3Q 3UZUA 3GLIA 1Z7TA 1DGFA 1GL6A 3M6KA 4MFFA 1AE3A 2OXOA 2AGOA 5EP3A 4QWEA 3SK6A 3W0LB 5E4XA 4GZYC 5J2CA 4QQBX 5M3FH 2JY5A 3KF6A 4CCHA 4HJ8A 3U58A 3PIOA 4AG5A 3HOUG 1VG5A 2NTSA 3C23A 1QAOA 5J0UA 1KLGD 3TQSA 3OW2A 3TZDA 2N49A 4BWGB 1ZKOA 1EY0A 1G2SA 3RAXA 2EYJA 4O3SA 4R66A 2MPMA 3CRLC 9ICCA 4PQXA 2KA7A 4BXXH 2HWJA 4GN4B 3OPXA 3SARA 3GQ3A 1WG8A 2QARB 2KZSA 2NVXH 2F1HA 3ONNA 5ALSA 1PJSA 2L2DA 5I4DA 4A3FG 4V190 1TH2A 1QH9A 4XIGS 1YJWA 4FNFA 3CCRA 3CMAA 1SE2A 5JJZA 4A3LG 2D8CA 4A3MB 1ZQXA 2AUKA 2I46A 4KTQA 1ZQAA 5IYCG 4DR1Q 4BJQA 4DV0M 2GVAA 1JJCB 1RZTA 3HJ8A 4NOOB 1HH2P 4C8KA 4YY3Q 2E5LM 4GITA 2NN6H 1NR4A 4IJHA 3RN2A 1DGHB 1G3IA 4LF7M 3EIVA 4JI1Q 1NJYA 1JQJC 1ZEQX 1Y8PB 4UBCA 2QQ8A 3AJIB 2JP1A 2WFWA 1HZBA 1A5TA 2PZWA 2CQOA 2KHSA 3T79A 1OO9B 3A5ZB 4IRKA 4S3SA 4AYBF 1I94Q 1TR8A 1EY6A 5DB9A 1ZXTA 5HY6A 4EQNA 3KBXA 4DK0A 4JI7L 3RMHA 3TRZA 4YR2A 3L4PA 5CR0A 4A3KG 3FE3A 2CXYA 2B2WC 3OOCA 1DK2A 1C7YA 2EVBA 3OWEB 1WVLA 3TSSA 1D0LA 4J15A 1QZEA 7ICKA 2WAQG 3ITPA 5KPZA 1TKWB 2VY3A 4FF4A 1EIGA 4IPGA 3UGJA 2OOAA 4IJEA 3Q8GA 5BR8M 4X64M 4BY7H 1IZ6A 4DV3M 3T51B 4DAYA 2F0WA 1H9SB 2EKKA 2CKZB 3JPSA 1NCVA 7ICIA 2W9BB 4JBKA 2C2RA 4OO1G 4YXJA 4CDFC 2EYHA 2VL6A 1IYJB 2R46A 2YFQA 2L1BA 4DXFA 3T15A 2EH9A 3Q22A 1F77A 2H4OA 2LVOC 3TWMA 3RNUA 1TIID 2XICA 2VQEL 1Z4NA 1ZQHA 1SE8A 1KDBA 4M9ZA 1NO1A 4C56C 4B7HA 5KG3A 1WCMG 1QVGA 3HX0A 2BPGA 1FGBD 2QHOB 1SZPA 3MABA 2KEDA 2QBYB 2F4VM 5B5EU 2QSFX 2FLNA 1WD0A 3S2DH 4K4GA 1K1QA 3H4DA 3TKAA 4KN7A 3KF8B 3HJEA 1FO4A 1OAOC 5ALOA 4B3SQ 4DF4A 1NY4A 1VQHA 4DF7A 1RYUA 3F92A 3UMMA 3HG9A 2R8HA 4KJNA 1V9PA 1ZQOA 2HCCA 2J6SA 4DFAA 2YQZA 3KS8A 4Q0FA 1NV8A 4MGYE 2Q2IA 3JAMi 2ALZA 1F9PA 5K36H 3BQ2A 4YWMA 1L0YB 2CRUA 5KRUA 4LF6L 1FYCA 3UI2A 2LVQD 4JI4M 3A8JE 1WWUA 3M9NB 2PQAA 1WD1A 2H5XA 1XMQQ 4PCZA 3HOZG 3PO2G 4NP5A 4C8LA 5KFAA 3SVMA 1TDHA 3TMEA 4Q8EA 2LI6A 3PXGA 3S2HB 2AKWB 2IX3A 4GOPB 4AW4A 2XNAC 2CV2A 2K5VA 3HWSA 2JY7A 9ICSA 1A15A 3RLOA 5IIMA 4UP8A 2LYAA 4P73A 3CF5A 3S1MB 5ALLA 1OIZA 2E8MA 2NQ8C 1TK5A 3BS5B 1IYUA 4Y7NH 5IZ7D 3BJUA 1PRTC 1EIYB 1E1TA 1QAQA 1FD7D 1A62A 1QWYA 4M9GA 4RAUC 1EE8A 1Y1WH 8ICYA 2JRZA 3V72A 2IA6A 2VQFL 4GIPA 2W9AA 2VB2X 4DR2M 1OXXK 5J8YA 5FSWA 2MP1A 3ERQA 2K7VA 3HOUB 2Z7JA 1VQBA 5BOLA 3LVWA 3I8ZA 1J5EL 1QZMA 1N61A 4U7CA 1KLNA 1U4LA 2EYOA 2HHTA 2C99A 1ZQEA 3KZIU 2RBMA 3OWFA 1VQJA 2EA0A 2GO7A 1UE7A 3D31A 3K8ZA 3ULPA 1YSYA 3ZH9B 2XGNA 3TARA 4A3FB 2ASBA 1XU4A 4LF8Q 2AWNA 1S40A 3K57A 4DK1A 2JEBI 1K3BC 3GIIA 3KOYE 1EZ8A 2EPBA 1CSPA 1PTOF 1XSLA 4KMUC 3DOAA 2D2CC 5CEHA 5I6YA 3HKZB 1YHQA 1A0PA 2W3RA 2DJFC 2HQEA 3AKZA 1EU3A 1N2XA 5CR3A 5NUCA 3QU4A 4JI6L 2B2YA 2B2TA 2ZIWB 4EZ9A 4J03A 2KIWA 4LFAL 4P2CB 4UAIA 2D7HA 4LJ9A 4DR3M 4JV2A 1G8PA 2F0SA 2Y0SF 4IR1A 2DKZA 2F76X 4OU7A 3WWVA 1DGGA 2FPKA 1N32L 5B66U 3C58A 1ENFA 3SC3A 1RG6A 5F3XB 4JWNA 9ICKA 2K5HA 5ELNA 4A3KB 9ICMA 3QZ8A 3NENA 3M4YA 1ML0D 2C96A 4DAPA 7ICNA 3I55A 5DNFA 4LRSA 2EYPA 2B6GA 1XO1A 5GROA 1PZJD 5AM3A 4NXNQ 4IUPA 4JI8M 5KFZA 5ALVA 1B3QA 1NKEA 1HZCA 1BOSA 4I81A 4ZYSA 1SIJA 2Z4RA 3D8LA 4JVZA 2JUJA 3E4RA 2X4AA 4H02A 5HR6A 4F88A 7ICRA 1D2NA 2XTIA 3PCOB 4KLNA 2IMWP 2EY1A 2M00A 5EWFA 5D3IB 4RU9A 3UQ0A 3NE5B 2EO2A 2I7NA 1ZXIA 1H9JA 4UP9A 9ICBA 4OJ5A 3I4MG 3J7A5 4TURA 5F9NA 4YY3M 1XXGA 3J80S 1KDHA 1BCPF 4JI1M 1YJNA 3SENA 3Q23A 7ICOA 2HCBA 2C28A 2X49A 5CMDA 3DV9A 1II3A 1E3PA 1CZWA 1A3VA 4O1NA 2F0GA 3NS1A 5AIBA 4XK8F 2ASLA 1B22A 3GDXA 1WCMB 3NTHA 3NQTA 3F8TA 4I65A 4C4TA 2AQ3B 1J7KA 1HR0Q 2JHDA 1WFQA 2EAMA 3RJGA 1UA0A 4K5XA 1R6BX 3E3XA 3QB3A 2MUTA 2DNAA 4ED1A 3H09A 1VQGA 1Q7YC 2B0CA 3HKZE 5AKLA 2W03A 1X56A 3DDHA 4C3JG 2C22A 4LF4L 1K9MC 2R7DA 4DCCA 3A56A 1RQNA 1GO3F 5KFHA 2YN4A 2BPCA 2KNJA 2RCNA 1CK1A 3BOSA 3HOXG 2RHQB 1KFTA 3SYLA 4HIDA 2W9MA 4OIJA 2M9VA 3AN1A 4A3IG 5KL1B 1NHWC 5C18A 4BDPA 3HOZB 3J80L 3PO2B 4CKBA 1IY2A 1OKSA 3JR5A 4ZK9B 2ZM6L 2KVSA 2GQFA 1ET9A 5IGGA 5EPJA 5EAYA 3KUPA 3S1MH 2KFNA 2LHCA 3S1NH 5IILA 4NM2A 9ICOA 2SDFA 4KLGA 2JA6G 3K92A 1NK9A 4FYDA 2PI5A 3MC1A 3T13A 1RU3A 5F9LA 1N78A 2UXCL 1Q86C 2JA5G 4ZPXA 5IGBA 1E9SA 4EX7A 3GRYA 1MI2A 2VIXA 2DI0A 2KZZA 1AZQA 4EENA 3K6OA 5LHY1 1Y1VG 4NJ8A 5IY0A 4G3IA 3RJJA 3S1RB 3HOUH 3E2EA 5IGEA 3WKAA 1EQVA 1KAAA 2LFNA 3K9PA 3K2LA 3HZXA 1C48A 3LQRA 3RGSA 1PK3A 3UDGA 2Z1CA 3RH5A 2KIVA 3I51A 3RBDA 3OSOA 1GL7A 1TY0A 1XMQM 3CPWA 2L9HA 1QB5D 2LS01 4IBFA 4A3FH 2JZBB 4QUCA 4C3IG 7ICTA 2QCUA 1K73C 1V8QA 5A2QS 3VK7A 2R61A 4A3LH 4JK1A 1DZ1A 1JOQA 2OQ0A 5FO9B 1B7YB 1NZPA 4BS9A 4B08A 2FLPA 5FO8B 2PKEA 4JG2A 1ZYRD 1STYA 4IUQA 4OL7A 1AFPA 3LW5F 1BQQT 4DV1L 5FTLA 4HIKA 4NV0A 3PV0A 3GRUA 2NBFA 5C4XB 3RB3A 4DAMA 3MGVA 3WOEA 3ICEA 3TAQA 5ALQA 1S76D 1SBBB 2SNMA 3F2DA 4BXOA 4ECXA 1L1ZA 2V1CC 1LT4D 5KFQA 4JI2M 4B3TL 3EPGA 4DU9A 4L5SA 3BS7A 4X65L 5DLQE 3B9JA 5FP0A 4LJ6A 4PHPA 4UDUC 1L1OC 5D65A 3IG5A 2O5JC 5CV6A 2Q2TA 5E3FA 5EGTA 4A3KH 3JAMc 1LTTD 4JPBW 1X6OA 2R44A 2G5GX 4WJWA 1HFGA 5KG1A 4CIZA 2ICEC 2A74C 2ICIA 3HY5A 3G6YA 3CCLA 4A3JH 4GNXA 1TH4A 5J0SA 3AEVA 1XPOA 2EXZA 3UDXA 2W43A 4KN4A 4OO1J 4FZNA 1DJRD 1X42A 1B53A 1XHBA 4HAEA 2KHIA 4FF3A 2UUBL 5DFLA 4TQRA 3I90A 4LF8M 2XCPA 2JYOA 1JR3E 3PIO3 1SWWA 4QZCA 4F4WA 3FRPB 1VDVA 4ELVA 4KX3A 1E7ZA 2PW5A 1OJLA 2WZJA 3SYZA 3KOXE 2MSNA 4ALPA 2KE7A 3MXNA 1U48A 2PYKA 2L7IA 3I4MB 2KZ3A 2X8AA 2W9CB 4MGIE 3EIEA 4CJ0B 3SEBA 2HT1A 5IT9E 3AL0B 1Q3LA 4JI7Q 1WTPA 2NRZA 1WCMH 1X37A 1QSYA 3MHVC 1G291 3A5UA 4FCWA 3R2IA 5ALMA 1PH9A 4DQRA 1F9RA 1PK1A 1ZQWA 5K5PA 2J6TA 4EBCA 2CUZA 4B3ML 3E9HA 1JB3A 1N62A 1BPDA 4P0QA 5E1FA 2KEBA 3NK9A 4YD1A 2B63B 3D6CA 2P6UA 3PMLA 2L11A 5EKKA 7ICGA 1ZQGA 3MZ5A 1PTOD 1OW5A 4DKAC 5EE1A 2RSOA 2N35A 4C3JB 3P7JA 1JALA 4Y2JA 3C2MA 4P72A 2VQEQ 2DHYA 2F0KA 2BCQA 2L4EA 5HGQA 1DOMA 2ZIXA 4B6JA 3C46A 3J27B 2C5RA 2EYMA 1OXUA 3DMUA 4OX9L 3HOXB 3M1YA 1UUPA 5GAEC 4DV2L 5J0RA 1DRGA 3GQBA 1Y8NB 4A3IB 2G5DA 4ELTA 2EANA 5J2DA 3S24A 3QO2A 1UT8A 2DN8A 1Q90A 1R5LA 3IG8A 2OCEA 5FLXE 1E2VA 4O42A 2EQSA 3I70A 1ZQYA 2ISPA 1M90C 4IBDA 3UMCA 3SK5A 3M6AA 4P2HA 1HR0M 1CI3M 3HILA 2JA6B 4O5KA 4FF1A 5KFDA 5GKNA 3B6YA 2JA5B 4L63B 7ICPA 1PH3A 3NVVA 1QUSA 1YT3A 1VQMA 1SL2A 1T3TA 3KHRA 4IOCA 4JW0A 1HNWQ 5FOBB 2B39A 3V7LA 3RR8A 3NBHB 3AU6A 8ICAA 1Y1VB 4FBTA 3S1RH 2A1JA 2KW0A 2MO0A 4C8MA 2I5HA 3TDQA 1QDRA 3H0GG 5KNDA 1RYRA 4K6LA 3RR5A 1N34L 4L8RC 3T1HL 5AK4A 1VF5C 2MNAA 2VF7A 3C1ZA 1BCPD 2NVTH 1I6VC 2FXQA 5C4ZA 3BDPA 1ZQSA 3GP1A 5ITUA 4OWWB 1Q8KA 2CVRA 8ICSA 3I4NH 5KQDA 5C4JB 4GKKQ 1DK3A 3VR2A 4ECYA 1ZQBA 2O5IC 1GKIA 2LKVA 2ZUBA 1COOA 2VANA 5EKLA 4X62L 1JWMD 2KN7A 3RAQA 4OW0A 3GDEA 4UBBA 2L7HA 1Z5BA 4I2IA 3QNMA 5KFGA 1ZYRC 2EJSA 5EE9A 5C0XG 2VQFQ 3R9KA 5ELBA 1I4RA 3PO3G 1HHVA 3FM9A 3RB4A 1IIPA 5J39A 1E1OA 3QJYA 3H3VH 1J5EQ 2D0PA 4GC5A 2F77X 2OO9A 3ZD9A 1U9RA 5C6AA 1K8AC 2F0NA 4RNOA 1LT6D 1QQ7A 2B2VA 1KL9A 5CHGA 3NVWA 2PW7A 4DAVA 2F52A 2XZFA 1I4QA 4OELB 4I8OA 4TQUS 2PI4A 3V2TA 2KVMA 5C0XI 5L8RF 1EQQA 1P7DA 9ICUA 4DL3A 4ELUA 2MO1A 1PZID 4XXEA 4ZOHC 3AU2A 1SRUA 4WRDA 1KABA 2TMPA 1M6YA 2JY8A 3BVMA 1YNND 5IOCA 5KG0A 4HMJA 2CWAA 4I7ZC 3WK6A 4RF0A 1AZPA 4LFAQ 1LO5D 1GO5A 2NVQB 1R7RA 1NI3A 3CQZB 1NNUC 2LMCB 3I4MH 2Z8LA 3QUTA 5J0WA 4F7XA 1ZD2P 2IX0A 2XY6A 4LFBL 1VQDA 3NSWA 2JA8G 1KQSA 3L0OA 5IE8A 3T5LA 3L2AA 1LV7A 1MC8A 4RPZA 2MAXA 4FXGC 3H0RB 3TL4X 3VCBA 1W3SA 5ALTA 1LACA 4H0LC 4O5CA 3ISDA 3KLSX 4BX9C 2KG5A 1IY0A 1OQYA 2VJ5A 1VF7A 1MKHA 4MHVA 3BDLA 5HMLA 3QYPA 2EY2A 1X65A 3KP0E 2DNCA 1H9RA 3UXPA 3HU3A 4ECQA 4DQPA 4K5VA 5KFVA 1I3QB 1VJ5A 2HW3A 1F9SA 2OTJA 4YCXA 4JI3M 3QOJA 2NVYB 2K5QA 4QZFA 1QZHA 3F5AA 3PNCA 2HOIA 1TDZA 3DHQA 3BQ1A 2XO7A 4QIWF 1LT5D 2WB1B 1S5LU 3SK4A 1ZQVA 4C3JH 5LMNQ 4UB4A 4A3BB 3GLHA 5LMUL 1I4WA 3DUZA 1EIJA 2PZUA 4GH9A 1HR0W 4QZHA 4MTKA 1RHPA 2KCNA 2J7ZA 4F5RA 1A3UA 1S72A 4RGNA 1LYLA 1AW7A 4Y2QA 5FLMG 3LMMA 1TE2A 4TQSA 4L78A 4DR6Q 2A8VA 3BVGA 4NSRA 4K4HA 2QP9X 2R92G 2XZUA 2JGAA 3AFHA 3Q0AA 4O0AA 4CKCA 5D14A 2JEAI 4G4OA 1Z1VA 8ICIA 3E0EA 2KD1A 2Y0SC 2HI0A 2R93G 2PQEA 1PVRA 1PH6A 2C2EA 5J2IA 1BKBA 2L55A 2JA6H 2K8AA 4DOCA 4ZKCB 2UXDL 2LMRA 1G51A 1S97A 4LF4Q 3J81S 4UAYA 5JPNC 1FNNA 4A4IA 2VZAA 2JA5H 4DL4A 5EP4A 1XX8A 5DDYA 4J9QA 5JU5A 4IFDG 4AYBG 2E2HH 3PX4A 4C1NK 2KCMA 4MH0E 4JBMA 4QMGA 1TWGH 1HA5A 2G3QA 1T43A 3NEMA 2F8LA 2BWEA 1TFRA 2VQEM 1DXSA 2ZM6Q 1K8GA 4CDGA 3VYTA 5M5YB 3JPNA 5KFYA 5ELOA 3WK7A 2EKFA 1KW4A 2CHBD 1WXQA 1HA6A 1XMOL 3PW2A 4NLKA 1XXHA 2Z0SA 3AV0A 4TRDA 1UEBA 5I2YA 4C3IH 1KRPA 7ICEA 4GS3A 2A1AA 3B0YA 2CCZA 1N48A 3KKAA 1G41A 2AGQA 3U61A 1STAA 4R8NA 3K81C 4B3RQ 1L0XB 1FIQA 3MR5A 3UQ2A 2DPIA 2YV5A 4NXML 4IR9A 2HHHQ 1DXMA 2ID0A 2WB1E 4ZQ3A 1IV8A 2A19A 1D2BA 2MRLA 4DQQA 1Y69U 2DKXA 2V4RA 1BPYA 2NZOA 3U4VA 4M9LA 2BCSA 1RL2A 2R8KA 3PO3B 3IAYA 5CV8A 2PI2A 5ALGA 5CV7A 3C3DA 1XPRA 4YR3A 3WKBA 1HNWM 3K1JA 4QWCA 3L25A 3MDCA 1TWCH 5ITXA 1IHZA 3I4LA 3TS2A 5TZVA 1ZQCA 1GHJA 5L1LA 3NUCA 1UM8A 4F5NA 4Z8XA 9ICEA 3BQ0A 3GTMB 3MC0B 1ZQPA 3CHBD 3SEIA 3NBIA 4GC7A 3T5JA 2LXJA 1ZQFA 4DV1Q 1IM4A 4ED6A 1PYWD 2WACA 3MMPA 4GKKM 2PCFB 1NY5A 4ED0A 3PIPA 4P75A 1IBLM 2NVQH 4YXMA 1JCKB 4F8MA 2KSOA 3P75A 3UPQA 3LCUA 2OWOA 4LZGA 5AKHA 1TWHH 5ALJA 4PJ0U 3PR4A 2KOBA 5HNKA 5EJWA 3JAML 2ZJQA 1MSWD 2VQFM 4MF2A 4Q5VA 2UUCL 4X65Q 1TWFB 2JA8B 4R8UB 1NJZA 2JEGA 1IM2A 1VQOA 4P0PB 5BOMA 1MJCA 1B4OA 5IYBG 4Z6EA 1XWEA 5L1JA 1N5XA 2UVRA 3LNNA 2JXNA 3TWKA 4EYIB 1STNA 2Z6KA 3I28A 5AIAA 2CV1A 2FOIC 1SV4A 9ICLA 3FP9A 1RPLA 4UP7A 3FUWA 5J2AA 1I3QH 1SXJC 2FINB 1NNXA 2BWBA 1QNUA 5JRTA 1STBA 2YTUA 2LYHA 4BB9A 5DGAA 4JCVE 2Y1JA 5J22A 4DUZL 5HR7A 3GRRA 1V1PB 4QJFA 5KG2A 4R64A 3B0XA 4RNAA 4M9XA 2EZXA 5AM2A 2C9CA 4GIBA 1D0KA 2G08A 1EY7A 1ILQA 4MEXA 1N5WA 3FDTA 5EKIA 2Q2HA 3MR6A 1OXJA 3EFXD 3U50C 1YNJD 3VA7A 4LFAM 4PDIA 5JI3E 4QNMA 3S1NB 3Q8PB 2YB1A 5CA7A 2IW3A 1ZMWA 4RCOA 3K58A 3I1YA 2K60A 4R4CA 4B9UA 1I4HA 2R92B 1BPEA 1HCZA 4RNNA 4LJ4A 1SNOA 2BA1A 3H15A 2D3DA 1Q12A 2HBMA 4B3MQ 3M9MB 3QWLA 4CHTB 4EQ5A 3GLIB 2R93B 4ILWA 4ZAIA 3JPRA 1A76A 5J2GA 4CDEC 5DLFA 5KFNA 4UB8U 2VDBB 1WYDA 3TE6A 3UM9A 2ZBKB 3KF6B 4DR4Q 1R4GA 2JNHA 1L7OA 3LQQA 2QARA 4QF4A 4ZH4A 4DNIA 3RJEA 2ZUDA 1K5OA 3FD9A 4O3QA 5IGDA 4AYBB 4RGTA 1Z00A 3B7NA 1MQ3A 3WKCA 1J2MA 3DZDA 3GTJH 4JBJA 1XC9A 4DV2Q 1PJJA 5LMNM 1VQ7A 4O3NA 1TK8A 2AXTU 4ECZA 5M3FG 2QLTA 3L3OC 3UXOA 4A8EA 3H0GH 3MA2B 9ICHA 2UUAQ 3ZC7B 3LWMA 1T3QA 2A69C 2YTYA 9ICJA 4LGYA 2IHMA 2DKLA 2APLA 2YX8A 4Y2XA 2MU2A 3QXGA 3TADC 1DGHA 3IRUA 3HP3A 5BPCA 5J0XA 2V4DA 3C1YA 3KJPA 4DR6M 4KO8A 1G91A 2IT1A 3TN2A 2LHGA 5C0XJ 4OGQC 2JZ1A 3TFRA 2K04A 2LVNC 3CCJA 4JN6A 2FFKB 3SE0A 3J7YW 1TS2A 1MX0A 4QZEA 5ALFA 2A6HD 3VR6A 3STBD 4GNXC 3FC4A 1XWIA 3F2BA 3VYSA 1EFID 4KN4C 2PFNA 2NV3A 1ZJMA 5J0YA 3MXUA 4B9TA 3FVQA 5C0XH 1Z47A 2HAKA 3IECA 1TVAA 4JV1A 3MXGA 2Q0ZX 1MJGM 4KLSA 3U6CA 4DN4M 1RJTA 3HS0C 3T1HQ 3T1YQ 3MBYA 3A42A 4MFCA 4J9OA 1J9OA 3VLFB 1AROP 1SKWA 4OJ6A 1Z3EB 3IV6A 3O13A 3GP7A 2AQ1B 7ICFA 4PL1A 4F5PA 1JORA 1H9SA 5I2XA 4Z6FA 2W9BA 2I07B 2LVPC 2UU9Q 5KFXA 3GTMH 4F4ZA 4QZDA 1QYRA 4XGIA 1AN8A 1NBWA 4KMUA 3GLIE 4DR5Q 2XIDA 1PRTF 3GIJA 4DAYB 3SMVA 1O08A 5J2HA 3U5ZA 5D49A 4HJAA 3VKGA 8ICXA 2GH1A 4GLAC 2WIIB 3G48A 4PHAA 1F2LA 2E76C 1E9RA 1QOHA 2K28A 4RQ3A 4HJ7A 1W2BA 5DM63 1GUOA 2QA4A 2HL7A 3SHGB 4F5QA 2AGPA 2M5ZA 2WP8J 4B3RM 3EW9A 5KFSA 4AYBE 3S1QB 5KL8B 4BY7G 1IBKL 4LF5Q 2UVVA 1ZETA 4KLKA 2HHHM 3AQFA 3OGUA 2F8KA 1EQRA 3CC2A 3HOVG 4DR7L 3OTOL 3TPZA 2JZ0A 1DGBA 1TWFH 2JA8H 1FJGM 3TQYA 4B7FA 4DV7M 3W1BA 1XNSA 3AQEA 3C9PA 4NC6A 4LF9M 2L15A 4DV4L 2OEOA 2AQ0A 4OHJA 4OONA 2DF4B 4UAUA 3E5SA 4RMFA 2ZAMA 2G09A 3U60B 4UB2A 2XGTA 1VS0A 2EZVA 1DO2A 1A3TA 5AM0A 1HEKA 1MGSA 1ZD5A 2F5OA 3V6HA 2LY7A 3V76A 4EGVA 4X66L 1STEA 1D7QA 4ECRA 2YU9B 2OYYA 1QG7A 4HAIA 4IOAA 1SYFA 2PQAB 2KNZA 5AM1A 5KFPA 1X55A 2R7FA 3KSXA 4GOPA 5FTNA 3VC8A 5KNCA 1DOQA 4KV6A 4LFBQ 2ZIUA 1YITA 4FO6A 1XTCD 4CDDC 3QOLA 3FTEA 5K36G 3EYZA 5KFCA 5JAVA 2SOBA 1U49A 4EIWA 3NTIA 1EYDA 4DFDA 3HHWA 2FLLA 5AI4A 1SROA 3GTOB 2OOBA 5IWAL 3S16H 1YNJC 5FLMH 4LFCL 5IP7G 2F0VA 1N36M 5AI6A 3K4GA 3LK9A 2HOQA 1L7NA 4A3GB 1L7MA 2XGQA 3H8MA 2ODGA 4ED2A 4JV5L 4X65M 5ALYA 5AK6A 1CA5A 1PTOB 1Z9FA 3NQIA 5DGBA 2DWQA 3HGIA 4IFDJ 2C2DA 4BBRG 3PUYA 1PM5A 3BDCA 4XBOA 4RUAA 1XNQQ 2RP5A 2PNRC 2W04A 3G6VA 2EE1A 1WTXA 1PVOA 1QVRA 1EIFA 5FTKA 4Y2SA 1N75A 3GTGB 5LMUQ 2WF8A 4FBUA 4BA2I 1LLRD 1KQQA 1R4QB 4NL9C 4IFDH 7ICVA 1ED1A 3OPOA 2HIXA 3ONAB 2AQ2B 3FUXA 2JY6B 1MHWC 1ESRA 4E0DA 3Q8LA 3OSPA 1R4PB 3GILA 4MZ9A 3F2CA 2KJ5A 4Q8FA 3BU2A 3HX3A 1ZV1A 5M3FB 5KFUA 4MHEA 2G8LA 1NTGA 3Q8KA 2DPJA 3AOEC 3E6ZX 1JWSD 1KSFX 1B8AA 1OXSC 4GKJL 3WKEA 5ELCA 2CP8A 2F1JA 4KLOA 9ICPA 4BA1I 5JI2E 3I4YA 5AKEA 7ICMA 1KNAA 1NJXA 4DBGB 1RYSA 1QQ5A 1HZ9A 5AKKA 4BBAA 1LTLA 2QB0A 3I4VA 2Y0QA 3QYBA 4LUOA 4IBIA 4DS5A 4I2FA 2YTVA 3STBC 1BCPB 5DBBA 1KTKA 4EX6A 1FR3A 1VQIA 4LZDA 3GQ4A 1JOOA 5IT9S 1HTLD 5C44G 4JV0A 2LXKA 4DR4M 1EY5A 1Q81C 1MSHA 4QHSA 3D2SA 4IZ8A 3HKZF 1HUOA 5G3LD 2MUYA 3U6EA 3IP4B 2F44A 3FPPA 4LNQA 1A8VA 1JE5A 2DWZB 4CBVA 2ESEA 4GC9A 4RQ6A 4LJAA 3T16A 1X32A 4DV2M 1T5EA 2XWJB 1F9QA 3CCEA 3D4DA 4FW9A 3Q8MA 5FK9C 4AQYQ 5DYIA 2UUAM 4OCZA 1KKXA 4N8FA 2IPKD 2ZJPA 3N28A 3SGIA 1IL8A 1NUCA 4DL7A 1NAPA 4NXMQ 3GV6A 4FCTA 1NR2A 4RQMA 4M6WB 2RLTA 1NE3A 3G4SA 4J9KA 4PHDA 5KFBA 1C4QA 2XCAA 5L37A 3AMUA 4DV0L 2XY5A 4OJOA 1ILPA 4S12A 4CRXA 8ICWA 2NO5A 4QNLA 4I2HA 2E5LL 4B9NA 4WW0A 2JR5A 2R8GA 1U4MA 1H95A 5KNIA 5KFKA 2N8NA 1YJ9A 4BY7B 1VCIA 2YY6A 4WJ3M 3I76A 2V1CA 5C5MA 1DCZA 5KG4A 1QVCA 1F2MA 3SR1A 2ZTEA 4RPXA 5IT9L 1L1OA 1H38A 5FLXS 4DV6M 4IUVA 1ZRNA 4LGMA 2MUTB 1HJPA 1VDLA 3T1YM 3SYKA 2K8CB 3PGZA 3LX0A 4PV1C 2E2DC 3VYUA 1S4ZA 1QSLA 4RGMA 5GTIU 3RBEA 3ILKA 2K4KA 2CRXA 1H9KA 3CMEA 3S2DB 1IQPA 3ETLA 2FNAA 3SXHA 2YU9H 1IL2A 2UU9M 4LW1A 1JMCA 1PZKD 3J80c 3F2UA 4QB4A 4DR5M 2DUYA 2E5SA 3RH6A 3WK5A 1U4RA 2E3TA 2YQEA 1GJXA 4IBJA 1YHBA 3QX7A 3A0HU 5BR8L 4GN3B 1XB2B 2HHXA 2H1EA 4EBEA 1RTNA 3ZQJA 5ALRA 1L3SA 4XQJA 4NB3A 4RQ8A 1IY1A 1NY6A 1K83H 2F3IA 1A2UA 3KBBA 3SASA 4HIMA 4UN2B 4GHAA 1IN8A 5KPRA 3GLGB 3GTOH 3FDSA 8ICKA 1Q82C 4MGZE 2BCVA 4LF5M 2KJXA 4NLCA 4NL4H 1HZAA 4IRDA 2MFIA 4G4QA 2FPLA 3E21A 1SYEA 1ZQ1C 1IN7A 1QANA 1KFDA 3AOGA 1PTOH 4DSFA 3L28A 1GUSA 3ISBA 1U9LA 3C2LA 2F4VL 1QQWA 3PIP3 5FLXL 2IBKA 4LRTA 2W8KA 4L4UA 3CRKC 2A73B 2RQXA 2F0OA 4LUZA 4R63A 3LWUA 3C5FA 1VDZA 3G6JB 3QUBA 4P4MA 1GO3E 1TR5A 2XFSA 1X9MA 2Y21A 1PRTD 1L3TA 5IIKA 4I5SA 4TSSA 2B3TA 4Y7NB 3A8KE 1A6SA 2J4XA 1T9HA 3SBJA 3FTFA 5DG9A 4JOIC 1SE4A 2L12A 5IODA 4KHPM 3PR5B 2Z4HA 1Y1WB 4JI4L 1TKDA 3RFWA 1LTBD 1ZOLA 3OW7A 1GVNA 2B29A 2ZJAA 4M0AA 5JVH3 2Z6BA 3GIKA 4FS2A 4K14A 3DA1A 4XYOA 3IHPA 3PW0A 2A6EC 2IHFA 4ED8A 2JQOA 1EQTA 4F91B 2JA9A 1DONA 2GN5A 5J0QA 4KLJA 2AUJD 3Q8DA 3SK8A 1ZQIA 3D3RA 5ELFA 2VUMH 2RVLA 1O7LA 4Y52H 3SD7A 1SFOB 1BBXC 4BXOB 2RDIA 4F87A 4RQNA 5EPLA 2K03A 1GJSA 1XNQM 1PJQA 2F0TA 8ICVA 1V97A 2E2JH 1SNMA 1TT2A 1X6IA 3OTQA 1S5FD 2BGWA 1O7IA 4ODGA 2BDUA 7CATA 4J9MA 5CBEE 4YWLA 3U6QA 2K32A 1AEXA 5C44B 3K75D 2KHHA 3J81E 5IIOA 3NRWA 3GLGE 4DR2L 2KVCA 1D6EC 5AFWA 1N56A 4J9NA 2AQ4A 4GXIA 4A93G 3A55A 4B7GA 1SAPA 2RHFA 1XO0A 2VNUD 4US8A 3VR3A 2Q8TA 3HFZB 5FO7B 2KZMA 3HHZA 2BQ3A 2WV6D 2JK8A 2XRQD 1B1ZA 2ZXPA 3BQTA 1GOZA 1AP0A 4C4RA 2W9CA 4A3JG 2F0PA 2W3SA 2Z6KC 2LYBA 3MXNB 1EUJA 3G7LA 2DAMA 4MIUA 3RZDH 2HHSA 3L26A 2LM1A 4QZBA 4PL2A 2MH8A 1HRJA 5DG7A 4CDCC 3GD7A 3NWTA 2DZOB 3A7LA 4WJ4A 4F92B 1HTPA 1G6PA 4HEDA 3J81i 5J2JA 4HTHA 3CU7A 4M0DA 1NNLA 5JVG3 3U9SA 1G2TA 1KDCA 3HOVH 1ZYQA 3L2PA 3DEEA 2R7ZG 3X3NA 5M9OA 3W0FA 2E8PA 4DR3L 2VA8A 4KHVA 2DZLA 1M1KC 2C98A 1EYAA 1S3OA 4A75A 3WKDA 4UQGA 4I2GA 3MHBA 2FMMA 1RCVD 4KLFA 4NRWA 9ICFA 4A3EH 4P0QB 4PHEA 1IBML 2SNSA 3GPUA 2K4PA 2H1RA 5IREB 4TUWA 4C1NI 2Q8RE 1LV9A 1YVCA 5KFWA 3C1FA 4C8NA 4I2DA 3T56B 1BNPA 4DSLA 4AQYM 5JTIA 1SYCA 5E6JA 4JI8L 2ZIXB 3CP0A 2ZJRA 3T53B 2R0IA 4IJLA 1BNOA 4K8IA 4OVZA 3M3YB 1J09A 4PH5A 2QEJC 2F5NA 5H2FU 4PMBA 4Y2VA 5FTJA 5HMMA 3OHXC 1XYIA 5FKAC 3OJUA 4C7ZA 1LVHA 3EN2A 4K0KL 4JI1L 4EEKA 3M85A 3ZDAA 3B7QA 4B9WA 5IP7H 5GAGC 4X3KA 5KT7A 4Q45A 4LJZC 1HUMA 3NVYA 2RF4A 5KG6A 3PY8A 4IPCA 1YLAA 4M9HA 1JJGA 1HT2E 5ALDA 5KT4A 1N60A 5DAUA 4OJPA 3HPOA 4DLGA 1NJGA 4BBRH 4MTNA 4C0ZA 1WHCA 2Y0TA 1VQLA 2NRWA 2EJMA 2E1EA 2E2IH 4XQ8A 4QZ9A 1EYGA 2DNEA 2A1JB 4YCVA 3NRZA 2OF1A 4KX5A 4MEYA 3VDUA 3QZ7A 1BPBA 1OFIA 3GPYA 1YHAA 2I0QA 2LNHC 4UY8C 4PG3A 2LM4A 4C2MH 3PNVA 1JI7A 5DB8A 4MGKE 2JE6I 4LFCQ 1B50A 1PH1A 4DNTB 1PDQA 3C3LA 2GOLA 3THGA 3RZOH 1TAMA 3E58A 3DFZA 4JV5Q 2NWGA 2X69A 2XH9A 3C21A 3P20A 3FAHA 8ICZA 4RPYA 4PMCA 1KEJA 1TF0B 2YB4A 4CNQA 2FPMA 1TS4A 1ZAEA 4A3DG 4JYAQ 2NN6I 3TQ1A 3I4NG 2XEPA 4RQ4A 4EYHB 1WTQA 1SFOH 4I2EA 1NJWA 1ECWA 1RODA 4F71A 4NPSA 3KOWE 4KLTA 2EYFA 4YHHM 1XNRL 2I1QA 5CV9A 5DM73 2H3QA 5KT2A 2HDOA 1UAPA 1L3UA 3ZCBB 5IP9H 2P66A 4KITB 5C44H 2FMQA 1VQ1A 1RDPD 3F5EA 4ZKBB 5KG5A 1NZBA 3KLRA 1OIPA 5M3MG 1LTRD 2K33A 4WJ3B 3V7KA 2BE5D 3BVZA 4IQTA 1RXVA 7ICQA 2CN1A 4GKJQ 1LKYB 1EFUB 2CHQA 4LJXA 2K75A 1IXSA 1EOVA 4A93B 9ICTA 1WCNA 3GV5B 1L2DA 4FS1A 9ICNA 2M9NA 2K89A 1QUTA 1I4XA 3TACB 4CISA 3EZ5A 2OPFA 1VQFA 3JPTA 2TSSA 1Z5CA 1RD9D 1D1KA 1EWCA 4A3JB 3N6RA 4DWIA 3FYHA 2KHVA 3HEJA 4AZFA 3TWLA 4BBSH 1NKBA 3ICXA 2WAQB 2CV0A 5DNYA 4YP3A 5DG8A 5KO3A 4G6ZA 2F3NA 4IRCA 4PZ6A 3EROA 3H8JA 4RQ2A 4MB7A 4DR1M 1EXNA 3PVSA 4RHRA 3I04M 3NBXX 3U26A 4GOPC 1HNXL 2J7NA 4CJ2C 3G6EA 3LDAA 1TQOA 1C8CA 3AMZA 2VB3X 2F4IA 1CRXA 1HNZL 1F2ZA 3U6SA 2CPRA 4JI2L 5E4WC 3HHXA 1ENCA 2FMPA 5J0PA 3N52A 4PZ7A 1TWAH 5DLGA 9ICQA 3SFZA 4UAVA 2GNOA 3T38A 3EBEA 1C9OA 4WORA 1E24A 2F0HA 1I94M 1JIHA 2DJGC 4QWBA 3CCVA 1O80A 5AJ3L 4DGZA 4YFKA 2C35B 2A5HA 3GLHB 3J7AS 1S0MA 2DY8A 5JEAG 2QCPX 4O5EA 4YG2A 4JXJA 2IOHA 3C29A 1N63A 1X3FA 1VDDA 3M3YH 3ZDEA 4RKLA 4DPGA 3UMBA 1STGA 4LF8L 3A54A 2KNVA 4II7A 1CQFA 5IIJA 5EXPA 2HVIA 2O2LD 1EL0A 4Y2TA 3OMCA 1COKA 1K0SA 1RXWA 1B3AA 1NMGA 4NM1A 2QGQA 1Z19A 5J3BA 2XGPA 1RDFA 1O7ZA 2DWNA 1LV5A 3M7NA 4DUYQ 1S0OA 2L6OA 4RQ0A 4Y2PA 8ICQA 4FXDA 2H3VA 5T1IA 4CGYB 2WB1F 1SXEA 3GTPH 1VEKA 5AI8A 2A5YB 3EPIA 3BS1A 4JI5L 4RQ1A 4HEOA 3HKZC 1B44D 5EE3A 1SXJA 2QEXA 2CH4W 4DA2A 4DO9A 4P16A 3GTQB 2MGSA 1A0IA 1Q3BA 3VA5A 2Z9HA 2EJFC 2PMZB 1WTRA 2KJ8A 1D9DA 4ULLA 3KHGA 1ZQTA 2PPBC 2WAQE 4ZRZA 3N7RC 4JB3A 5EPKA 1QLNA 4B3SM 3KLWA 4PDGA 4R1JA 3CP8A 2HMXA 1SR3A 3DEPA 1VQPA 2AWOA 5H37D 3K0YA 1X9WA 5IYDG 3J81j 3KBGA 3SAWA 4GEWA 2HD3A 3U6LA 4HLQA 3U61B 2F4VQ 1CTMA 4DOAA 1YZ7A 1RQLA 3TI0A 3ZD8A 3D8GA 1UCVA 4UPAA 2K4HA 4Z9CB 2NVTB 2KECA 4R71A 1WTHA 3GLHE 4FCVA 1X3GA 1E2WA 5KFLA 4KHZA 3I4NB 3KOOA 2DFLA 4GMQA 1L2BA 4POFA 1HR0L 1U5KA 1B2TA 2ALYB 5EXSA 5EOZA 1VQKA 1SV0A 3DWPA 1GJTA 2XSZD 1VQNA 2LKYA 4JMUA 3GPXA 1LB2B 2F1IA 2Z4IA 4HIOA 2JXJA 4G9BA 3TADA 2BE5C 2HKJA 4FD2A 2HHWA 4A93H 5BN3A 2XSCA 1HQRD 3TANA 1ICFB 2LBCA 4J9RA 3V6KA 2XY7A 3D8BA 2XRSD 4KY6A 1XSNA 2BJWA 1MQ2A 2K9DA 1JB7A 3UMGA 2KSOB 2MR9A 4R8UA 2PMZE 4ECUA 3ALRA 7ICUA 3BZCA 4JYAM 4ZUJA 4Y28F 4M04A 3HRDD 4B9VA 1JXLA 2R18A 3VFDA 1IN5A 5AKZA 4UAZA 5A2QL 3BJYA 1DGJA 2AH5A 1VMPA 4R9WA 4UW9A 2QKIC 1L5UA 2GA4B 2R7ZH 2F5PA 2KJ9A 2O25A 2VW9A 3PQIA 3GZFA 3UDIA 3MK6A 1EOTA 3K5LA 2ATLA 5KT6A 2G9DA 9ICGA 2PMZC 8ICPA 1VQ9A 4CE6A 1WTVA 3K59A 3O0FA 4G4NA 3A45A 4QJFB 3DLLA 2I7PA 4M9JA 4GKJM 1ENAA 2B2UC 5C1BA 2QB1A 5BN4A 1V1OA 4F50A 4H44C 1NV9A 5TISU 1GHKA 5HHIA 2EIFA 5JJKA 2PI2E 1S10A 2WF6A 3IFTA 4G57A 4OJLA 1RIPA 3CKIB 2WFAA 3CCMA 1I6HB 2O01F 5ITYA 3HW8A 3VKHA 4HCSA 3B7ZA 2IX1A 1EY9A 5AKYA 4NXNM 1S0VA 1K3XA 4EX5A 4KLLA 1RF2D 1V1QA 5ITXE 3M4PA 2JH1A 2L09A 3H40A 5ALWA 4ZCKA 1X3PA 1ZD4A 1K82A 1IBMQ 3OYYA 5GQOA 3T5HA 3TS0A 3GO8A 3RH4A 3KYHC 4H7BA 4DQIA 1IG6A 3S15B 4O3RA 1N9WA 4DXGA 3GTQH 3CRXA 3FTDA 4F3OA 2G5HB 2WF9A 1R2YA 2HSZA 2AMCB 4USAA 1I50H 4JI8Q 4IIWA 1A2TA 5DYGA 2BOSA 3M4QA 1Z00B 3FEWX 4BWMA 2Y9UA 2KV2A 1KD1C 4GLXA 8ICTA 5I6WA 4GXKA 4JI3L 4ME3A 1STHA 1BVSA 3H3VC 3HKZG 5CV5A 5EXXA 3NXWA 4G3OA 3EVQA 4DL5A 1QUQB 1PVQA 3C2PA 3KTQA 4ECWA 3MFYA 4LF6Q 3THVA 1ASYA 4K0KQ 2E2HB 3SDZA 4EQPA 4KODA 1E94E 1TWGB 1TS3A 1CQVA 1P8LA 4I28A 3S14H 1YUBA 2KQ3A 4FO2A 4C3HH 2CE7A 3PX6A 1IYVA 3RN5A 5HURA 4DUYM 1PRTB 3QU2A 4HN7A 4P71A 2W8LA 4K6DA 1WGNA 1PFMA 5AM5A 1V92A 4A3DH 4DL2A 2VIIA 1E0BA 1CEZA 2JP7A 4OXPA 4K8JA 2F0EA 1G59A 4C3IB 4BY1G 3NWSA 4XT1B 3TAPA 2DAEA 2YYZA 5EP1A 3CW2C 1UNSA 2CFOA 4NL9A 3PVXA 4OD0A 4TUPA 5J2BA 2W7PA 4IBGA 1X54A 3AL0C 5J2FA 1PFBA 4AKGA 2D0OA 4I2AA 2NRVA 4W5WA 8ICFA 1KSPA 5M3MH 1T6OA 3I91A 1F44A 3OSNA 1TTEA 5ISRA 4DSIA 3JAME 3I56A 3AOEA 1WOCA 4GN5A 1KHIA 3U5ZB 3CC4A 2NUCA 5L1IA 3J2PB 4NKLA 3RRHA 4RFBA 2ERCA 5GAHC 3FRHA 1TWCB 1BPZA 3AQQA 2AU0A 5KQ8A 1NK8A 3T4AC 1PZNA 1X3EA 5JUMA 5G5HA 2F0JA 4OO1I 3HWTA 3WHKA 1XNRQ 2W54A 4GHLA 5ELDA 3T6PA 1U47A 1WR1B 2ASJA 4ANRA 4JI6Q 2ZXIA 1E2ZA 2QDLA 5KEEA 1XC8A 3U60A 5ALKA 5M5XH 3WHLA 1G8ZD 3FHWA 4F72A 4HYKA 2E74C 4QUFA 4OIKA 2KRUA 2JA7G 1TWHB 1IW7C 2IHEA 1X40A 4LAAA 4POGA 4QZIA 2G5IB 2RKSA 4FF2A 4YWKA 5JEAJ 5JPMC 1HNWL 5KFTA 3ULLA 1N32Q 1Q3CA 1GKHA 1PUZA 4D81A 1EIHA 3GTLB 1K8OA 2V9WA 2BDPA 3M8RA 1LTSD 4QZ8A 3SV4A 1LTGD 3V6JA 4HMIA 1SXJD 2E8GA 4EQOA 3LVVA 5JEAH 1DM0B 1IN4A 2ZIUB 3NASA 5E79U 4M8AA 2XLJA 2P5TA 4FWHA 3QE9Y 3PF4A 5KFEA 1Q1EA 1I6HH 2XN9C 2VA3A 4GKKL 1SWVA 8ICJA 1HQCA 2UVWA 4LMQD 4YQWA 1CHPD 3TEHB 3VDYA 1DYQA 1IBLL 4J9PA 3C1EA 1YIJA 8ICEA 2ZAOA 3CCUA 1S3SA 1DOKA 2BCUA 1HNXQ 3MTSA 5CV4A 2R8JA 2K5WA 2CHVA 1HNZQ 4RKUF 1SYBA 1MN3A 2K5DA 2D5DA 4KLIA 4JI2Q 1EY8A 1NVMA 3K7AB 3JPQA 5EWGA 2RRUA 2DL0A 1GXDC 4UB1A 1Z1BA 3DEOA 2RKOA 3QAUA 1NOMA 2BHNA 4QW9A 3S15H 5AJ3Q 3IRBA 4A3CH 4IPHA 2FE9A 3S9WA 1GUWA 4MF8A 4B9LA 2JSOA 1CA6A 3KFUA 8ICLA 3HKPA 4JI7M 3FMCA 1T94A 4LVSA 1SMYD 2R3ZA 2X6LA 2Y20A 3SAVA 3MXPA 1LUZA 2JWSA 1IFYA 1OTCA 2JMGA 3KVWA 1Z6HA 4A3MH 2EDGA 3HJQA 3FTCA 3KDFB 2ZTDA 5C4HA 4LJ7A 1UPHA 1IXZA 1QZGA 4CF4A 3QUCA 1BGXT 3QIAA 2EAPA 1L0WA 4DS4A 5C4XG 4F2RA 3RJIA 4I2CA 3KD3A 4ED7A 5IYDH 2BPFA 3GTJB 2A69D 4JI5Q 1D8BA 1HPCA 1RM6C 1QTMA 3Q6SA 3H0GB 4Y2UA 3KW6A 3M7GA 5CRXA 4RZRA 1CM9A 4YN4A 1PJIA 4ED3A 3KFUF 1X66A 3ETRA 3IKJA 2QB0B 3SMSA 3KK7A 1F0MA 1IBMM 4QY7A 1VLBA 1K3WA 2RHSB 3RFAA 4NDXA 5AKGA 3FUVA 3GLFA 1DO0A 2BA0A 3GU3A 4RKBA 2IL8A 3L9AX 4Z6CA 4BY1B 1SXDA 4NSOB 1GUGA 7ICLA 4XYQA 2UXCQ 4LY6A 2EZYA 3H3VI 3FRIA 2K5NA 3PMNA 4JOIA 3AYHB 2KTQA 1L7PA 4F93B 2K52A 1ZMVA 2N3SA 4KLHA 1QDTA 2WSEF 2ENBA 1MIUA 3J81L 1MSGA 2D7EA 4M6WA 2XVTA 5LMNL 1PA6A 2F5SA 5IGFA 4LF6M 1VEJA 4K0KM 3OIQA 1OAIA 2BH8A 8ICMA 5D46A 4HCEA 1X9XA 3QR8A 4TUQA 4ECTA 2C5CA 2OTLA 3GPPA 2OQ4A 4UB6U 3UXNA 3D6WA 1AE2A 2PFOA 2C9OA 2RA4A 3J7ZC 2FFJA 4UHVA 2WB1C 4CJ6A 1KNEA 1B9NA 4DR6L 2GWSA 4FXKC 2PFQA 1Z6TA 2V4QA 1WUDA 5AHXA 5J2EA 2IY5B 1JX4A 3FYDA 1S5BD 3JR4A 3UE0A 2R8IA 5IT9c 8ICOA 1B9MA 2VKQA 4GC6A 1VQ5A 1F4IA 2DHRA 4F2LA 1TY2A 4R7GA 2JN4A 2EQYA 4IUNA 1DGSA 4QWDA 2B63G 2LWXA 1JRPA 4XQQA 2O4XA 3D6JA 1GM5A 1L1OB 2JA2A 4Z6YA 1ZD3A 4RQ7A 2EY5A 3H91A 5DDMA 2R6FA 4PPXA 3TP6A 1PH2A 4EZ6A 2F3WA 2P5ZX 4L8JA 2JA7B 4QNRA 4LUVA 3H4MA 1EY4A 4B3TQ 3QYEA 4KKTA 1UHUA 1WYGA 2ZUCA 3H6MA 2XWBB 1FEZA 3GTLH 2OT2A 4IQZA 2F0LA 3SI8A 1J5EM 2KCCA 2ES6A 4R8IA 4REZA 3GFKB 4NLZA 1W6JA 3S2HH 4IUUA 4KLQA 3L27A 1KYIA 2QDBA 3CGWA 5EXTA 2DGZA 2I5MX 3GLGA 3R8BA 2UUBQ 3GV7B 3BXWA 2O5RA 4YR0A 4RH6A 4CJ1B 2XF3A 3MEFA 5KAIU 3PFIA 3L7ZC 1SG9A 1X9SA 1CKMA 3A8IE 3WDNA 5LL6X 1NJFA 1G71A 2H3ZA 4F2SA 5FLXc 3AM9A 1N33L 1XNRM 3LYSA