2H5XA

Ruva from mycobacterium tuberculosis
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
195
structure length
183
Chain Sequence
MIASVRGEVLEVALDHVVIEAAGVGYRVNATPATLATLRQGTEARLITAMIVREDSMTLYGFPDGETRDLFLTLLSVSGVGPRLAMAALAVHDAPALRQVLADGNVAALTRVPGIGKRGAERMVLELRDKVGVAVRSPVVEALVGLGFAAKQAEEATDTVLAANHDATTSSALRSALSLLGKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of Mycobacterium tuberculosis RuvA, a protein involved in recombination.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Dna binding protein
molecule keywords Holliday junction ATP-dependent DNA helicase ruvA
total genus 43
structure length 183
sequence length 195
chains with identical sequence B, C, D
ec nomenclature ec 3.6.4.12: DNA helicase.
pdb deposition date 2006-05-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01330 RuvA_N RuvA N terminal domain
A PF07499 RuvA_C RuvA, C-terminal domain
A PF14520 HHH_5 Helix-hairpin-helix domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.10 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 DNA helicase RuvA subunit, C-terminal domain 2h5xA03
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 2h5xA02
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 2h5xA01
2KCMA 3G6EA 2FXQA 2FMPA 3B0XA 2E5LQ 4QWDA 2JA8H 4KLHA 4DR1L 2WFWA 1BPYA 4TUPA 1Z3EB 3PO3H 1XJVA 4RNNA 3GLFE 3IHPA 1KRTA 4BY1G 2D62A 4DV1Q 2IT1A 2UU9Q 3I4MH 5KT5A 1BPDA 4KITB 3CP0A 2JA7H 4JV5Q 4RPXA 5BOMA 2JA6G 8ICGA 4M6WB 1X6OA 5ELNA 1VQ9A 1OKSA 2DGYA 3HKZE 5M3MG 2BPCA 4DV0Q 4RQ6A 2OCEA 4JI4Q 4A3LH 4I2DA 4YMOA 4JI4L 2DFLA 3ORYA 4DL7A 1G41A 5DB7A 2BH8A 3VDYA 2MROB 2K0BX 8ICQA 1YHBA 1WHCA 5DFLA 5HHIA 9ICBA 4POFA 3RJJA 3RJIA 3SYZA 2EIFA 4QIWE 5KFYA 4K0KQ 2ASJA 4YN4A 4RQ4A 2JNHA 4GN4B 4NM2A 5D49A 3T5HA 2LTUA 4HIMA 2B3GA 3M8RA 5ELOA 5J29A 4I29A 2W9CB 3N4MB 1TK8A 1E22A 3CCMA 4Z6DA 3DLLA 8ICTA 4RNMA 4R8UA 3PY8A 5IYCG 5C0XJ 1UWVA 1WYDA 2ISOA 1RXVA 2XO7A 2E2IH 1SL2A 9ICCA 8ICJA 4QWAA 4UQGA 1L3TA 1EFUB 3QE9Y 4P71A 4DPGA 2JY5A 1JMSA 4TUQA 1XB2B 3EBEA 1VQFA 5GQOA 4TUSA 1C9OA 2AHOB 2HHXA 3AUOA 4QZ9A 4QZ8A 2Q2TA 3STBC 4NY8A 1EQQA 3RB4A 2Y0SE 1WFQA 2I1QA 2PXIA 1ZJNA 5DG9A 1NOMA 4RT3A 5IWAL 1WCNA 4XTCS 3FRHA 1UT5A 1YEZA 4BGDA 4BBRG 3C23A 3RNUA 2ES2A 4Q7JA 4UB2A 2C35B 2FMQA 5JJIA 4GNXB 1TVAA 1ZQQA 5EAYA 1G4AE 3E0EA 4LZDA 2KNVA 4DS5A 2JK8A 3K81C 3BQ0A 1R9TH 7ICLA 3A74A 1S72A 4KLKA 2CP8A 2LVOC 2MO0A 4LF7Q 3JPPA 1HJPA 1A76A 3RJEA 7ICVA 4TQSA 3GO5A 3HP6A 1A62A 5IP9H 7ICHA 5J0WA 4LF5Q 3PNCA 5J2KA 3RBEA 4LF6Q 1VEGA 1X54A 3THVA 5HP4A 8ICRA 2HHTA 8ICPA 4LFCQ 1VQIA 5J0PA 5C0XG 3M7NA 8ICAA 4HJ5A 4OXPA 2UXDQ 2KNZA 4B9UA 4A3GH 4DF4A 3BJUA 4DV1L 3F92A 3UDFA 5HMMA 4DSLA 5KFTA 5H1SE 2LXKA 4OWWB 4O0IA 4F91B 5DGBA 4EZ9A 5EWFA 2UVRA 8ICCA 3EW9A 1KXLA 3S15H 1FVIA 8ICKA 1AE2A 3PVXA 4QQBX 4B3TL 4L5RC 3F1ZA 2M9NA 3KYHC 3CXCA 4GXKA 2ZJ5A 3G6YA 3RJFA 1KFSA 3CPFA 4B3MQ 1SG9A 3GD7A 3PO2G 3ZDAA 4MTNA 4MF2A 2C2RA 3FKIG 1PVOA 4A3KH 1XC9A 5KFZA 1KYIA 1Y8GA 1PA6A 3PF5A 4OWXB 1XMOQ 1FGUA 5J2BA 1ASYA 1U9LA 4WJ3M 4ECWA 5HY6A 3HKSA 2VNUD 1ZMWA 1S40A 2R7FA 5KT4A 3H4DA 5KFCA 2ATWA 4IR1A 9ICQA 1SMXA 3S14H 2LBCA 2FPMA 3V6HA 1V43A 8ICNA 4GEWA 5F9NA 9ICWA 4PHDA 9ICPA 1VQPA 3GLHE 5KFWA 3M4PA 5EOZA 3JPRA 4DSFA 2N3SA 2DAIA 4DSIA 1VQCA 4NM1A 4A76A 1N34Q 2JA7G 4DSEA 4IQWA 4YXJA 1IFYA 3RBDA 7ICQA 4BBSH 2BPGA 3C5FA 4JV0A 3RTVA 4M9JA 3OHAA 4DQPA 4LFCL 1I94L 2ZJQA 2RHSB 1VQJA 4F1IA 3GTLH 3KJPA 3OJUA 2JZBB 1EYGA 4LFBL 3NGDA 2I5HA 4YMNA 4AYBG 1NKEA 1S0OA 4JWNA 2XCAA 3PV0A 4I27A 1ZQUA 1NJYA 5KFPA 1KRSA 4F5QA 1X9SA 4F8RA 3U4ZA 3GLGE 1ZQIA 4GOPC 5D4BA 4QZFA 2ASLA 3M9BA 3OSPA 3PO4A 1TWCH 4DR7Q 1E7ZA 4JC0A 1EXNA 1KQSA 1HNZL 4IPGA 1B8AA 1XPRA 3MABA 2JEIA 1XNQL 5C4JH 3HWTA 4KLTA 1S77D 4UB3A 4AH6A 2QEXA 1XNRL 4LF6L 2FLPA 5KFQA 1PYSB 2VW9A 1YLAA 4OO1I 4GLXA 4YCVA 1H95A 1I94Q 1QUQA 4XRHA 3PIOA 4R4QA 4UN2B 4X65L 2UUAL 1N32L 4JI1Q 2IHNA 3STBD 2CWBA 2IMWP 1C0AA 4HJAA 5IE8A 4X5VA 1OQYA 2LVAA 2PQAB 5M5WH 1JXLA 4Y52H 1JJCB 2VA8A 5DBAA 1WJ7A 1JE5A 1D7QA 1NJIC 4YCUA 4BY7H 2AKWB 2KNAA 4YR2A 2DHYA 4M2YA 4I2GA 4X64Q 3BDPA 4GKKQ 4APVA 1E3PA 1NV8A 1YZ6A 3ERSX 5KFMA 4IRKA 4O5KA 1KD1C 4BY1H 2F4VQ 4P4OA 4RQ1A 3TARA 2A1JB 9ICTA 2NRWA 5IIKA 5CB1A 4RPZA 2IX1A 3AEVA 4JUZA 4DQSA 2CKZB 3A5UA 4GNXC 1AROP 4X6AH 5IYBH 4FDBA 4X65Q 3UDXA 4J9NA 2HW3A 3QEAZ 1BKBA 4F2LA 1NJZA 2ZJPA 4J9LA 3JPNA 3UXNA 2W8KA 2ID0A 2B21A 2E2JH 1KTQA 3FRIA 2AWNA 4EYIB 4I2CA 3M4OH 4DFKA 3W5OA 4LF4Q 5KFBA 7ICUA 4JI0Q 5J2IA 2WAQE 3HOWG 1VQHA 2BQ3A 3KDFA 5CHGA 2NVTH 5KFIA 4UBCA 3AQQA 4J9MA 3FE3A 5J2CA 9ICAA 3CAMA 3TREA 5C5JA 4IRCA 8ICOA 2R6GA 2Y1IA 5M5XH 2XY6A 2NN6I 4YCXA 3JPSA 3T5KA 1ZJMA 4UAYA 3M4QA 1YNXA 3H7IA 2DKLA 4JG2A 3F2DA 5DG8A 3Q8RB 1ZQYA 3CMEA 2ZM6L 2PI5A 3AU2A 4O3QA 3RB0A 2PI2E 3K80C 4I28A 4KHPL 4I2FA 1P8LA 5KFKA 1UEBA 1ZQTA 2AJQA 4JI3L 1GM5A 4GC7A 1NK7A 4BBSG 2VL6A 3JPQA 1SKSA 2V4RA 1TV9A 1H38A 1U48A 4JWMA 4QY7A 1JIHA 2A1AA 5LMUL 5DBCA 1KFDA 5FJ8G 4HJ9A 2R7ZH 4A3CH 4EBEA 1AH9A 5LMUQ 1WCLA 7ICFA 3S1NH 2UXCL 4RNOA 1MN3A 2HHVA 3LCUA 1VEKA 4C8KA 1X55A 1U47A 1HNWQ 8ICYA 2I5LX 4F4XA 4YWLA 3KHLA 1UE6A 1BGXT 3T3FA 1DOQA 4UAWA 4KLJA 1B7YB 3QZ8A 4AIMA 5DLFA 2PFQA 2UVUA 1ZMVA 9ICFA 2FMSA 1FJGL 5C3EG 3K8AA 2N49A 4L5QA 4JI2Q 2PI2A 2PI4A 1EIFA 2UU9L 3RB3A 4I2BA 2R8IA 4DR4Q 1Y1VH 3AU6A 1X9WA 5IIOA 8ICUA 4UP8A 1XMQQ 1MSWD 1W3SA 3HFZB 4FS2A 4NXNQ 4F3OA 3B89A 3E46A 1Z47A 3OHBA 4LFAQ 1VQEA 1WIVA 1B43A 1UE5A 5DB6A 4BXOB 1MIUA 1L3SA 1Q1EA 1IBLL 5J2JA 2DI0A 2H5XA 3CCVA 4UBBA 1T7PA 1JN3A 4R8UB 2BCQA 1K1QA 2K50A 3I7FA 3Q8QB 1IBKQ 4YD1A 4DR3L 1IXSA 2E8GA 3M9NB 4MFCA 2AMCB 1NY4A 3C2LA 3PW2A 2BWEA 2K5VA 5KFVA 3KF8B 2C2DA 3AYHB 4BXOA 1ZETA 3S1MH 1VQAA 1J5EQ 4JI2L 3F2CA 4DUZQ 3KFUA 2XGTA 4KLIA 2DAKA 4DV6Q 4JI5L 4R1JA 1NE3A 1HNXQ 1RXWA 3EN2A 1N8RC 5DBBA 4XA5A 1PGYA 5M3FG 2Q2IA 4PZ6A 5DGAA 4O5EA 4GLVB 4Z6EA 3RN2A 2ZTDA 1RL2A 3PUYA 3B0YA 4RQ5A 4DK3C 3Q8LA 4DV5Q 3LWMA 3PSIA 5IYBG 3TI0A 3BBZA 1RZTA 5KFEA 1CSQA 1KSPA 9ICVA 1NK8A 1Q46A 4MFAA 4O2DA 2BHNA 4M47A 4DOAA 3UQ0A 4KLQA 1G3IA 1XSNA 2I9GA 4JK1A 2L15A 1QVCA 4C8MA 3K0XA 4YD2A 3HOYG 4ELTA 4B9MA 3EPGA 4F50A 3LWLA 1OXUA 5TZVA 4DF8A 1ZQXA 1KAWA 1R4GA 2FPLA 2GVBA 2B29A 1N36Q 8ICSA 3CCSA 1CSPA 1NJXA 7ICMA 4FBTA 1J6QA 4F4ZA 4C8OA 1VQOA 3OJSA 4R4TA 3MMPA 5JI2E 4QZGA 1HNXL 4IRDA 4J9QA 4Z6CA 1NMGA 2JY6B 5E7NA 2J6UA 2QNJA 4YHHL 5JJLA 4PPXA 4OONA 1V1QA 2ZJRA 2J6TA 3GQCA 4A75A 4ECUA 2RHQB 2KENA 1HZAA 3RH6A 3RN5A 1T43A 4RQ2A 1X9MA 2YYZA 4I2EA 1BPZA 1XO1A 2Z6KC 1EQRA 4UY8C 4RQ0A 4IQVA 2CCZA 4YFKA 4KLMA 1E24A 4QGUA 4O3RA 4QW9A 2OWOA 3JC66 2N78A 4MNOA 3UE0A 1SKWA 4FS1A 5C4XH 2R7ZG 5KFAA 3B6YA 4KHPQ 1D8YA 1Q81C 2D0OA 3H4JA 3ZDBA 1EOVA 1HH2P 4HJ8A 4PH5A 4RT2A 2EXDA 1I50H 1PH8A 2XTIA 1U49A 1HZBA 5J0RA 3CW2C 1U4BA 4TQUS 3CPWA 5KFGA 4NB3A 2XY5A 1CKNA 1BVSA 3RLOA 1M90C 2Y0SG 4B3SQ 3GDEA 5J3BA 4DS4A 4DR2Q 4NXMQ 3GTOH 3C5GA 1QZEA 7ICJA 3CCUA 1EWIA 4YR3A 4P2HA 4HIOA 4A3IG 1VG5A 4HEOA 2OQKA 1ZV1A 8ICEA 4L5SA 1LTLA 4OWTB 4UB5A 3PR4A 5DDYA 4DV0L 4ELVA 7ICOA 2Y1JA 3AFQA 4YMMA 4BY7G 2RCNA 4A3FG 2VQFL 4A3BG 4DUYQ 4C2MH 1ZQKA 2VQEQ 3A5ZB 4JI5Q 1N36L 1KHIA 7ICNA 1B22A 5J0UA 4RUAA 1TAUA 3U4VA 1A0IA 2VANA 4M04A 1L0WA 5KG7A 3MR6A 4K0KL 4P72A 1Q82C 2CWAA 3BJYA 2MAXA 2FPKA 5DLQE 1PH1A 1HUOA 2JA5H 3T5LA 1ZQGA 3CC4A 4NXML 1Q02A 4P4MA 2G3QA 1Y1VG 3U58A 4R4IA 1VQ7A 3UQ2A 1VQBA 3IHQB 3V6KA 1QTMA 4DR5L 2WAQG 4B9LA 9ICMA 1HT1E 3MFHA 2IX0A 5GROA 3RJHA 3PUZA 2ISPA 4M9NA 3LCVB 4QZHA 3V72A 8ICZA 4GS3A 3PUXA 3GIIA 4GN3B 5L1JA 4DNIA 4X62Q 4JI6Q 4KLOA 4ED1A 5GAGC 2BPFA 5K36G 2BGWA 1UA0A 1SE8A 5KFNA 3MFIA 3PUWA 4DLGA 1YVCA 1RYSA 3PR5B 8ICVA 5DLGA 5J0TA 2NZHA 2LVNC 2NRTA 4DAYB 4B3SL 3T5JA 3ZDDA 4ED2A 3KLWA 3GIJA 4BWMA 4OX9Q 5AJ3L 1WGLA 4ED8A 2JEJA 4EZ6A 4DR5Q 5HMLA 4O3OA 2K14A 2Q0ZX 5JUMA 3E9IA 1O7IA 1P3QQ 2HVHA 3L0OA 3RR7A 5J2HA 3F8TA 1PH3A 3BZKA 3CQZH 5DB9A 2JA5G 1MQ3A 1MQ2A 1JR3E 4JI1L 1T6OA 4IOCA 4EYHB 1L3UA 3GILA 3G48A 4JI6L 2R93G 1WI5A 2EQSA 1KIXA 1K0RA 4DR7L 2KTQA 1T4GA 3TANA 2Q2HA 3HOVH 2HHQA 3EIVA 4PMWA 1QVGA 3WWVA 1HNZQ 3MR2A 1U5KA 4A3EH 3GIMA 1TWFH 5BR8L 1TWAH 4M9LA 3GV8B 3F2BA 2UXBQ 5KG2A 2F1JA 2JQOA 4A3JG 2NN6G 3EYZA 3I4OA 4QZDA 3ZDCA 2KBNA 2IBKA 2LVPC 3I4NG 3MDCA 1HUZA 3GTPH 1S9FA 4EQ5A 1ZQVA 2KHIA 4CCHA 1OTRA 4GXJA 4DQIA 1PH4A 5IP7G 4DL3A 4KLEA 2AGQA 4DL4A 1DO2A 3HW8A 2LSSA 4MEYA 5L9XA 1FL0A 4DUZL 3CC2A 3RZOH 4DV3L 4LF9Q 9ICRA 2KN7A 3PIPA 3HOUH 1Y14B 2DAMA 4GLAC 4C3IH 1AIPC 3MDAA 1UA1A 4Q8FA 3JAMi 1TK5A 9ICJA 4LF5L 5IIJA 4NLKA 5L1LA 5KG6A 4DV2L 1Y88A 4IQUA 3S2HH 4P73A 4AQYQ 7ICIA 4QZEA 1NV9A 3KJOA 2BH2A 3FHWA 3Q8PB 3K4GA 3PMNA 2BWBA 4DFPA 2RDIA 4LUOA 2KFZA 1C7YA 1SFOH 5FLMH 4JV5L 1TKDA 2BA1A 7ICTA 4F5OA 3PW5A 4DKAC 3PW7A 4ED7A 2B63H 1NKBA 1KC8C 2P66A 1NBWA 2YTYA 4YG2A 1ZMUA 1KRPA 1EIYB 4O3SA 1GKHA 5J2DA 2DPIA 1NMFA 1TWHH 1ZQEA 9ICHA 4HIKA 2OO9A 3GTMH 2K75A 4DK6C 3TEHB 1L2FA 2NVQH 2WB1G 2ASDA 4TURA 2HHUA 1I5FA 3GIKA 1LYLA 2R92H 1Q12A 3H0GG 4HIDA 1ZQAA 2L2DA 1NKCA 1QSYA 4ALPA 1XNQQ 1E94E 3TQ1A 2IHEA 4DV7Q 5KT2A 4I2HA 3H4BA 4F92B 4BXXG 4DR6L 3NENA 1XWLA 1K73C 3HOYH 1VQLA 4NLZA 3W1GA 2E5LL 4B9SA 1IZ6A 2UUCQ 1S97A 3TS2A 2UUCL 4X66L 4PHEA 3E2EA 1YBYA 5M5YH 5GADC 5CR0A 4UP9A 4EEYA 2BQRA 3RH4A 4RG1A 2MGWA 3T6PA 1SZPA 3ZJYC 1Y1WH 4RUCA 1HZ9A 1IL2A 1G51A 3K75D 4Q44A 2EKKA 1ZQJA 4GOPA 4B3TQ 3C21A 1PH2A 5DQHA 1RIPA 2W9BB 3M8SA 9ICGA 1VEJA 4QWBA 4KLUA 2JY7A 3Q8DA 4PG3A 2A8VA 5IYDG 2AU0A 1YI2A 5KT6A 3Q8KA 1X3EA 3RLFA 1KL9A 4QWCA 2HIVA 4JV1A 4OO1G 2C22A 4LF8Q 3TRZA 3PX0A 4DV4Q 2QHOB 1WCMG 1ASZA 1XMOL 5KG1A 5LMNL 2ATLA 2QGQA 1GO3E 3MEFA 3T1YL 4DWIA 4DLEA 3HOZH 4GXIA 4IQTA 1VQ8A 3GTJH 2JA8G 1QVFA 4ECQA 4O3PA 3H8JA 2N8NA 2BR0A 4IPDA 4O0AA 4YVZA 4P74A 5J0OA 3HOXG 1PZNA 5J2EA 1NK4A 1HR0Q 1OAIA 3ISCA 1L5UA 4LF7L 1OXVA 1HR0L 4RQ8A 4KN4A 4QZIA 1GVPA 1VQKA 4IO9A 1ZQRA 5KFDA 1N34L 1Z00B 4F5NA 4LZGA 5DKWA 1VQ4A 3ICEA 4IFDJ 4DR3Q 3GFKB 2CFMA 2QSFX 1JX4A 3M85A 4ECYA 3RR8A 1OTCA 3CMAA 2ZUCA 2YTVA 1ZQOA 5J0SA 2C28A 1Q86C 1ZQNA 4F4WA 3OGUA 4A3BH 3HOVG 5IWAQ 3FP9A 5KFLA 8ICFA 2K4KA 3BQ2A 4C3HH 1QSLA 3ULPA 2PNHA 1HR0W 3TAQA 4PGYA 5IIMA 4A3KG 3PO2H 1K8AC 3G6VA 4A3JH 1HT2E 4M9HA 5CJ7A 3M9MB 1NK5A 2JEGA 2JZ1A 3K9OA 1ZQPA 3GV7B 1MJCA 2F1IA 5C4XG 4X64L 2HHWA 2WP8J 3A0JA 3LK9A 3KF6A 2WZJA 1XSLA 3Q8MA 2Q2UA 4MFFA 3TFSA 2A19A 1A63A 1YITA 1E1OA 2F4VL 4DQQA 4JCVE 3HOZG 3PF4A 1TFRA 2BDPA 2MNAA 4DSKA 4P75A 4DV7L 5IINA 1JJ2A 1B70B 3CCJA 3UXPA 1UE1A 1XNRQ 4PZ7A 1X9NA 1D9DA 1PV4A 2ZM6Q 2UXDL 3T1HL 2UUAQ 1N32Q 4XIGS 3J81i 3RJGA 2EKFA 5J0XA 2QA4A 4KHZA 3RZDH 1Z9FA 3RJKA 1LB2B 1ZQWA 3C1ZA 1Q1BA 1QZHA 3ER0A 4A3IH 1BPBA 3OYYA 1Q7YC 1PH5A 3BU2A 1N56A 1NK9A 3LDAA 2PFOA 3HT3A 4A93G 1K3RA 3V7KA 4P4PA 4GKKL 4IJHA 3D31A 4M0AA 2V4QA 1X3GA 4PZ8A 4BBRH 1WGNA 2OQ0A 2AWOA 2W9AA 4PGQA 4F93B 2L4FA 2UVVA 5KFSA 1OXTA 5L1KA 2D0PA 4TQRA 1XPOA 5EWGA 2UVWA 4DV2Q 9ICKA 4XQ8A 4DQRA 1YHQA 3S1QH 2W9BA 4LF8L 1NK0A 4DBGB 8ICXA 2NVYH 5M3MH 3FYHA 1K8GA 4DSJA 4JV2A 2JY8A 4LUVA 3JAMc 2PMZE 3ULLA 3FDSA 4WJ4A 2NRXA 2C2EA 4LW1A 4K4HA 3TQYA 1LV5A 1D8LA 4A3DG 1Z00A 2ZTCA 3J80i 4C8LA 4KN7A 1VDLA 4JBMA 4JI8Q 4YWMA 3H0GH 8ICBA 4AYBE 1TAQA 4YQWA 1MKHA 4B9VA 2NRVA 4A3EG 5IYDH 1L1OC 2KZZA 3KDFB 4QW8A 4JI0L 4BXXH 2VQFQ 4BA2I 5KT7A 2K9DA 1BPEA 5BOLA 4IOAA 1NJWA 2BCUA 2XGQA 3UXOA 4ECVA 1JT8A 2OOAA 3OSNA 3HX0A 1SL0A 2CWPA 3OTOQ 4GKJQ 4UAZA 2KFNA 1ZQHA 3LGJA 1PH6A 2KZMA 4K4GA 4YY3L 2F1HA 1S0NA 2MJ5B 5DB8A 4A93H 1XXHE 4O9MA 2MR9A 5KFXA 5HGQA 3IRBA 2VA3A 1VQMA 4ECXA 5DQIA 3J7A5 2RF4A 2R8KA 3SI8A 3MR3A 1HQYE 1K9MC 2F52A 1X65A 3CCEA 2YU9H 3U50C 1DO0A 2KCTA 4IR9A 1D9FA 5KTQA 2HVIA 2OTLA 3S17H 3GTKH 3FKIH 2JEAI 3ISDA 4J9OA 3RRGA 3KHGA 2JEBI 3V7JA 4IFDI 4M9GA 1VQGA 1A8VA 4LFAL 3I2ZA 4X62L 4ME3A 2BCVA 1RPLA 2RRUA 8ICWA 2J6SA 1ZQMA 3CCLA 4A3DH 5DQGA 4MF8A 2HHHL 3SV3A 1DV0A 4J15A 3NELA 5L1IA 4Q8EA 4B3ML 3S2DH 2ZJAA 4JBJA 3V7LA 4DOBA 5FLMG 5J2FA 2BCSA 2NRZA 2ZJ8A 2LXJA 1UT8A 3GDXA 2HT1A 4HYKA 3T1HQ 2KZ3A 4PGXA 1X2IA 1L3VA 3PV8A 4RPYA 4GC6A 4RU9A 4F2RA 4R64A 5C44H 1WR1B 4G3IA 1JJGA 2BA0A 4DR4L 4KLLA 4R66A 3EWAA 4GOPB 1SKRA 4BA1I 5JJKA 1S10A 3J80c 3J81c 4NLNA 3HKZG 2Z0SA 2R92G 1XMQL 1RYRA 1TR8A 3BQ1A 4KLDA 1AE3A 2Z6KA 4YHHQ 4YR0A 4A3FH 1WJJA 2I0QA 1LM0A 1TXYA 1K83H 1IYJB 3ETLA 4JYAL 3KHHA 3MXNB 1S3OA 2W9MA 1UE7A 4I2JA 3PCOB 2ALYB 3E21A 3RH5A 5BR8Q 1HNWL 3PO5A 5KFHA 7ICKA 3I4MG 4QZBA 3IECA 7ICGA 4R63A 4UB4A 5GAEC 5D46A 1SROA 7ICEA 4TVAB 4DV4L 1NK6A 1J5EL 3I55A 3CCQA 7ICRA 4QJFA 4XUSA 3RR5A 1S0VA 9ICXA 1PH9A 4A3CG 5KFFA 2JE6I 2VQEL 4NPSA 4RQ3A 9ICIA 4ELUA 2XGPA 1S0MA 3UPQA 2I5MX 2HQLA 1SN8A 2K5HA 1PYBA 1XSPA 4IPHA 4LF4L 4KI0A 2BQUA 2AGPA 4F4YA 4LF9L 3PGZA 2DPJA 5KT3A 2HHHQ 1CKMA 1KEJA 2JJQA 4QZCA 2ZUDA 1BBWA 2EJSA 3GLIE 2UUBQ 1N33Q 1A5TA 4DL5A 5C0XI 3NEMA 1COOA 1ZQBA 3QZ7A 2GN5A 4ED6A 2ASBA 9ICSA 2HHSA 2IY5B 5CA7A 3HOXH 4DV3Q 4J9KA 4KLSA 3N97B 4B3RQ 4DV6L 3G4SA 1L1OA 4EX5A 4JI8L 4DFJA 4UB1A 1SL1A 1GD7A 4R71A 3V6JA 1Y1WG 2JZBA 2V9WA 9ICOA 4E0DA 1I6HH 3PW4A 1Q8KA 1NTGA 2R93H 2P6RA 1DGSA 4DR6Q 3BQTA 3D0FA 2KHJA 2XY7A 4O5CA 1T8EA 4DOCA 2JEFA 4DV5L 4OX9L 2VUMG 3OTOL 3M3YH 8ICMA 2JA9A 3K7AH 2AQ0A 4EBCA 9ICNA 3I56A 2R8GA 2IA6A 1XS9D 3KF6B 5JEAG 1U0LA 2VA2A 3SGIA 4RQ7A 1WCMH 3K7UC 3L7ZC 2MO1A 1IM2A 3H40A 1ZQLA 4QWEA 3CCRA 4NXZA 1EUJA 1SLJA 4LVSA 2GWSA 2LYHA 1K1SA 1P16A 5IYCH 1TWGH 4YWKA 3UDGA 1XU4A 1UFZA 2DNAA 1PFSA 1WOCA 2R8JA 1G291 1S76D 2HAKA 4HJ7A 1VQ1A 4POGA 2AQ4A 4NLGA 2ZUBA 5IILA 2DAEA 4RMFA 5KFOA 4JYAQ 1KFTA 3G6XA 3SV4A 4FO6A 3HOUG 4DR1Q 2V1CC 5C44G 4JBWA 5AJ3Q 2F3IA 4X66Q 4F5PA 2VZAA 3J7ZC 3DM3A 1W2BA 3CD6A 3C2KA 2E2HH 2LVQD 4DEZA 4MZ9A 4LNQA 2NZOA 5KG0A 3T1YQ 4BDPA 4R4OA 9ICUA 3PW0A 1V9PA 4PHAA 3H8WA 4IFDG 4H02A 3H3VI 2PFNA 5CWRA 4ECZA 2HWJA 1QUQB 5LMNQ 3IM1A 3RAXA 3GV5B 1VQDA 4LFBQ 4ECTA 4KTQA 2VUMH 2A1JA 7ICPA 1X56A 1E1TA 1V92A 2W8LA 3ISBA 4ECRA 5GAHC 4L5TA 3NTUA 4I2IA 1GO5A 5J0QA 1M1KC 1CKNB 5DG7A 4AQYL 4LWCA 2YV5A 4A3LG 3MGIA 4BWJA 1YJ9A 4JBKA 3KOJA 1IBLQ 3JPOA 4O3NA 3PX6A 1N33L 2BKEA 2DAGA 1N9WA 5IP9G 5LMNW 2MQHA 1IBKL 2JP7A 5KFUA 3OW2A 1CUKA 3RRHA 3RAQA 4C8NA 1FJGQ 4IPCA 5IIIA 4FBUA 3TFRA 2PQAA 4JI7Q 3PUVA 5IY0A 4I2AA 4C3JH 3Q8SB 1LUZA 3S24A 3I4NH 2B3TA 4IJLA 2JA6H 1TTEA 5DDMA 1IBMQ 4ZH4A 1VQNA 2VS1A 3KHRA 4NXNL 2KHHA 5F9LA 3CC7A 3JPTA 2O25A 5IP7H 2CQOA 1JMCA 2PFPA 1U45A 4DR2L 1ZYQA 5J2AA 1IXRA 1CEZA 5BPCA 2UXCQ 4A4IA 5KG3A 2JUJA 8ICHA 2P6UA 9ICLA 4A3MH 1OXXK 5CP2A 1G6PA 4QZAA 1SR3A 4F2SA 4B9TA 4F4KA 1QLNA 5KG5A 4ED0A 2UUBL 2VY3A 4G3OA 1T9HA 2WB1E 5M3FH 2MUTA 2HIXA 3C1YA 2XC9A 3W1BA 1YIJA 4QL5A 2GVAA 5FLXc 4B9NA 3H3VH 2FLNA 1MJEA 3RB6A 1ZQCA 5JEAJ 4PHPA 4GN5A 2ZTEA 5FJ8H 3BZCA 1F4IA 2IHMA 4Q43A 1OXSC 3SZ2A 2NVXH 1PHJA 1YJWA 1KDHA 4EBDA 2R8HA 3NBHB 3H8SA 3AFPA 1BPXA 1ZQFA 2R0IA 2B63G 3GTQH 2W9CA 2UXBL 4J9PA 3C2MA 1ZQSA 3ZD8A 2R7DA 3E9HA 1I3QH 5C3EH 3HPOA 2K52A 4R65A 2FLLA 8ICIA 3TAPA 4DL6A 4LUZA 5KFRA 3EZ5A 2MFIA 2L4EA 4YXMA 4J9RA 1VQ5A 2YTXA 1XPUA 4DO9A 3MBYA 3ZD9A 4K4IA 4DUYL 4DAMA 3QEBZ 2DUDA 1L1OB 4JI7L 4UP7A 2MUTB 2ALZA 4UPAA 5IT9c 1SRUA 4A3MG 1VS0A 4M6WA 3TS0A 3PO3G 4B3RL 4JI3Q 3RLNA 1ZQDA 2WTFA 5J0YA 1VCIA 9ICEA 1IBML 4GKJL 4JOIA 4Q45A 4MEXA 4JOIC 2RDJA 4YY3Q 3UDIA 5HHHA 4WP2A 4F5RA 3H15A 2BCRA 4Z6FA 1KLNA 7ICSA 4DFMA 3EPIA 4RZRA 2OTJA 4DL2A 2OOBA 3CF5A 5KFJA 3PMLA 1YHAA 1MC8A 4KLGA 4KMUA 4J9SA 1YJNA 3ZDEA 1N48A 1QZGA 4ECSA 3ULJA 1VQ6A 1PH7A 3K9PA 1TK0A 1JXEA 2DENA 5HNKA 1XTDA 2IHFA 4ED3A 4A3GG 1QSSA 1HZCA 2AGOA 2JZ0A 3G71A 2XCPA 4Y7NH 3M9OB 1CKOA 2K5NA 3HOWH 3MGHA 5EWEA 1A77A 1JB7A 5J2GA 3S1RH 4R4CA 3KTQA 2DZLA 3MR5A 5KG4A 4YCWA 3L2PA 3J81j 3GTGH 1ZQZA 1X3FA 4GNXA 1T3NA 8ICLA 4KLFA 1IM4A 1BBUA 3UE1A 1EFWA 3PX4A 3S16H 4YP3A
chains in the Genus database with same CATH superfamily
2KCMA 1DGJA 2FXQA 3AOEC 3B0XA 2FMPA 3G6EA 2E5LQ 4QWDA 2JA8H 2GLEA 4LF4M 2RHFA 2QBYB 2QKIC 2GQFA 4KLHA 1QOHA 1L8QA 2WFWA 4DR1L 1BPYA 4TUPA 3NWLA 5ALLA 2MGSA 1Z3EB 1SE2A 3PO3H 1XJVA 5EKKA 4RNNA 3VCBA 1KKXA 2KA6B 3GLFE 5LMUL 2RDFA 1L7NA 3HU2A 3IHPA 3KP1E 5K4LA 2RP5A 1GKIA 1TH3A 2D62A 3NQIA 3IP4B 2IT1A 4QMGA 5KT5A 1BPDA 4DV1Q 4NL4H 4KITB 3CP0A 2UU9Q 5KRUA 2JA7H 4JV5Q 4RPXA 5BOMA 1ZQ1C 5AKLA 3MTSA 4S12A 4G4KA 2JA6G 8ICGA 5I6YA 4M6WB 1X6OA 5G5GA 5ELNA 4EX6A 1VQ9A 3B9JA 1OKSA 2DGYA 3HKZE 4HMIA 5M3MG 2BPCA 4MN3A 4DV0Q 2NYVA 4UHVA 2OCEA 4RQ6A 2H1EA 4JI4Q 3CF2A 3B7NA 4IBKA 4A3LH 1G91A 3RFAA 5M3FB 2KKVA 4I2DA 4YMOA 4JI4L 2DFLA 4DV4M 3ORYA 1F9RA 1GABA 1TWAB 4DL7A 4IUUA 1G41A 1NO1A 5DB7A 1R9TB 1PM5A 2DWNA 3HHYA 1D8BA 1IY1A 1WCMB 2MROB 2B2YA 3R8FA 2K0BX 8ICQA 2KJ8A 2DKZA 3SYLA 1JQYD 1WHCA 1OAOC 5DFLA 3WK9A 1SNMA 2WKDA 4KY6A 4FNFA 1TY2A 5LL6S 5HHIA 9ICBA 1JWMD 1SAPA 4I7AA 4FF4A 4POFA 3RJJA 4KY7A 5D14A 5DM63 3RJIA 3ONAB 3M0EA 4PD2A 3SYZA 2EIFA 4QIWE 1YSYA 3W2DA 4A3JB 5KFYA 2LYAA 1NSFA 4K0KQ 1GUWA 2ASJA 2JA7B 5AKHA 4YN4A 2XSZD 1QE6A 3P20A 1JWSD 2KOBA 4RGTA 4OW0A 2XGNA 3KBXA 4RQ4A 2JNHA 4GN4B 3GQ3A 4NM2A 5D49A 3T5HA 1COKA 2LTUA 3KFUF 4BS9A 5DYIA 4HIMA 2N35A 4C4TA 1UUPA 2ZM6M 3KZIU 2B3GA 1BBXC 3P1HA 3SARA 5FTKA 3GZFA 3M8RA 5JJZA 5ELOA 5I2XA 5J29A 5E4WC 1XMQM 4B7GA 1GUNA 4I29A 2JXNA 2W9CB 1TS3A 2MA1A 3N4MB 3IDWA 1TK8A 4YY3M 4C0ZA 1E22A 2J4XA 3CCMA 4Z6DA 3DLLA 3PXGA 8ICTA 1QAQA 5ALJA 4RNMA 1A3VA 4R8UA 3SMPA 4BJQA 1A6XA 3PY8A 5IYCG 4X3KA 5C0XJ 1UWVA 5ALEA 1WYDA 4HCSA 5CMDA 2ISOA 1N5XA 1RXVA 2XO7A 2EY1A 3H94A 2A68C 1SL2A 3I04M 2P35A 1L0XB 2E2IH 9ICCA 1XWIA 3F5AA 3GPUA 8ICJA 1Y1WB 4QWAA 4UQGA 5ITYA 1L3TA 3HU3A 1M8AA 4A3KB 1B3QA 1Q3UA 1N62A 1EFUB 2KE7A 4V190 5AK5A 2XFSA 3SVMA 2RSNA 2Y9UA 3QE9Y 4P71A 1PRTB 3TZUA 3MAQA 4DPGA 2JY5A 4WFN3 3S15B 3HOYB 1JMSA 4TUQA 1XB2B 2HSZA 3EBEA 2JWSA 2OHFA 1VQFA 1JROA 3D8BA 5AK4A 5GQOA 1XNQM 1XC8A 1EE8A 2AHOB 4TUSA 3AUOA 2HHXA 1C9OA 2P5ZX 2SDFA 2XWBB 2N88A 2VUMB 5J39A 4G6ZA 2CPRA 4QZ9A 4QZ8A 4AYBE 3J80L 2Q2TA 3QUQA 3STBC 5HR7A 1LTID 2LY7A 4RHSA 2DUYA 2DXIA 4NY8A 1PFNA 4QUFA 5E79U 1EQQA 3RB4A 1N78A 2Y0SE 1GUGA 4J1MA 1WFQA 4C80A 4CISA 2DQNB 2I1QA 1LACA 1T5EA 2PXIA 1D5MC 3QU2A 4NL9A 1ZJNA 3SAVA 5DG9A 3EA6A 1NOMA 4C2MB 1ZOLA 2DKXA 1XYIA 4RT3A 1QH9A 1WCNA 4XTCS 2W03A 2B2WC 3FRHA 3UI2A 3J7BA 1N77A 1UT5A 3BS5A 2R6FA 1YEZA 4F88A 1BCPB 3J81E 4BGDA 4BBRG 1XXHB 2NQ8C 3C23A 4HEDA 3RNUA 2ES2A 5BR8M 5FO8B 2MUYA 3S1RB 4Q7JA 3B74A 4DAVA 4UB2A 1YE9A 2C35B 1JQJC 2FMQA 5C6AA 2EZVA 3L25A 5JJIA 1AFPA 4GNXB 1DCZA 3TL4X 1TVAA 3PIO3 1ZQQA 2R4JA 1KQQA 1S5LU 1R7RA 2HDMA 5EAYA 1G4AE 2ZIUA 3E0EA 4LZDA 1PVPA 1EYDA 2KNVA 4DS5A 3MHBA 3I28A 2JK8A 1G6ZA 2LFNA 2K6AA 4NW2A 3K81C 2V1CA 3BQ0A 4GC5A 1VJ5A 2EO2A 2L7IA 3SYKA 7ICLA 3K1ZA 4H0LC 1R9TH 4G7OC 3A74A 2G07A 1S72A 2KMDA 4KLKA 4JXJA 4AKHA 3MC0B 4DV2M 2CP8A 2LVOC 2E1EA 2MO0A 4LF7Q 2RLTA 4QIWF 5CBEE 3JPPA 1HJPA 1A76A 3R2TA 3RJEA 7ICVA 1VF5C 5I9PA 2XIDA 4XYQA 4TQSA 1T5XD 2W55A 3HP6A 2H3ZA 3GO5A 2SEBD 1A62A 3FYDA 2ESEA 5T1IA 2K60A 5IP9H 7ICHA 4KT0F 5J0WA 5CR3A 3PNCA 4IZ8A 3L5KA 4IUTA 4LF5Q 4DNRB 5J2KA 5EE0A 3FUTA 2YQEA 3RBEA 2HT1A 1IN5A 4LF6Q 1VEGA 2UUAM 2D7GA 1N32M 1X54A 2IPKD 3THVA 5HP4A 8ICRA 4K6LA 2HHTA 4LMQD 1YT3A 2QB1A 3ZC7B 5J0PA 8ICPA 1VQIA 3KBGA 5C0XG 4LFCQ 3T1HM 4CGYB 4DUYM 8ICAA 3M7NA 2H3VA 4HJ5A 5AI8A 4OXPA 5ELFA 2KNZA 5CGKA 2UXDQ 4B9UA 3KLRA 4A3GH 1ED1A 4DF4A 4LK1C 3M6ZA 2VJ5A 4CF5A 5AIBA 5AM1A 3BJUA 3FPUB 4DV1L 3K5NA 2F4VQ 1STBA 1ZD3A 2O5IC 3QWNA 4C3IG 3F92A 2F3NA 2ZXRA 3UDFA 3HOUB 1L7OA 5HMMA 4DSLA 1IN6A 3A98B 2JN4A 4OHJA 5JPMC 5KFTA 4MHVA 5H1SE 3B7ZA 3U6MA 2BH8A 2QLTA 3B9PA 1KSFX 2LXKA 4O0IA 4OWWB 2E3TA 5J8YC 4F91B 5DGBA 2JMGA 3GRYA 1IIPA 4EZ9A 4V0BA 3NXWA 3A42A 2FNAA 4JV5L 5EWFA 1G2TA 2UVRA 8ICCA 3GTQB 2L9HA 1Q3CA 1Q3LA 3EW9A 1CFMA 1KXLA 1AZPA 4AP9A 2L7HA 4DGZA 5KNIA 1FVIA 8ICKA 3S15H 1AE2A 1Z4OA 3PVXA 1PZKD 4QQBX 4RQNA 4B3TL 5AKIA 1KDCA 2M9NA 1KW4A 3F1ZA 3KYHC 4GXKA 3CU7A 2ZJ5A 3CXCA 3AM9A 1S5DD 2K7VA 4GZYC 2F0IA 3G6YA 3RJFA 1KFSA 2KECA 3CPFA 4ZK9B 4KX5A 4B3MQ 1SG9A 4NC6A 2XICA 3L2AA 3L4PA 3GD7A 3HRZC 3PO2G 1N2XA 3ZDAA 4MTNA 4MF2A 4DR5M 2KSOB 1PJJA 1QANA 2EJFC 2C2RA 3FKIG 4WRDA 1PVOA 4A3KH 1XC9A 5KFZA 5IGCA 1IXZA 1KYIA 2XH9A 1Y8GA 1PA6A 3PF5A 4OWXB 1TS5A 4L4UA 2FE9A 1FGUA 1XMOQ 3HWSA 3RUZA 5J2BA 3R8BA 1ASYA 3K5LA 1SE4A 1U9LA 4WJ3M 2YFQA 4K0KM 3RFWA 2WB1B 3D2QA 2IW3A 1H9SB 4ECWA 2XN9C 5HY6A 3S2DB 4RGOS 3HKSA 2VNUD 1ZMWA 1IN4A 1S40A 3U6QA 4A3BB 2R7FA 5KT4A 3H4DA 3AB9A 2RQXA 3N6RA 5KFCA 2ATWA 4IR1A 9ICQA 1HR0M 3WK7A 1SMXA 2LBCA 2FPMA 2G09A 1RCVD 2WV6D 3S14H 2Z1CA 1ECWA 3GPPA 3V6HA 8ICNA 1V43A 5C0XH 3IG8A 4GEWA 5F9NA 1R4QB 2W3RA 1BNOA 3CQZB 9ICWA 3MK6A 4PHDA 9ICPA 1VQPA 1EU3A 4MNOA 1ICFB 3GLHE 5KFWA 4RF0A 5EOZA 3JPRA 4DSFA 2N3SA 2DAIA 3HG9A 4DSIA 3M4PA 1VQCA 3N52A 4CHTB 2PYKA 4NM1A 1ICWA 4NLCA 4Y2SA 4A76A 1TGUA 3E4RA 1N34Q 2JA7G 4DSEA 4IQWA 4YXJA 2DWMA 1IFYA 1FFVA 3RBDA 7ICQA 4BBSH 2BPGA 3F2UA 2VKQA 3C5FA 4KJOA 5TSSA 2F0JA 4RA8A 4JV0A 4IL6U 3DUZA 4ZKCB 3RTVA 4X3UA 1CA5A 4M9JA 3OHAA 4DQPA 1EWCA 3KOXE 1IHZA 2NO5A 1QUSA 3J7AF 4LFCL 2A5YB 1JRPA 2TMPA 4Q5VA 1I94L 2MP1A 2RHSB 2QARA 1GJSA 2ZJQA 2L12A 1VQJA 3C3DA 4IJFA 1TAMA 4F1IA 5C44B 3E3XA 4L78A 2Q8RE 4ME5A 3GTLH 2K28A 3OJUA 3KJPA 2JZBB 1EYGA 4LFBL 2JA2A 4CJ1B 5CV9A 3NGDA 2I5HA 3HY5A 4YMNA 3ILKA 4AYBG 2QPAA 1NKEA 1HCZA 1GJTA 1S0OA 4JWNA 1D2BA 2XCAA 3PV0A 4KX3A 4I27A 1ZQUA 1CZWA 1NJYA 5KFPA 2Y0SC 5A2QL 3FVQA 3GP7A 2KK0A 3IAYA 3U60B 1KRSA 4K6DA 3C29A 3MJ5A 4F5QA 4FVMA 3J7AS 1X9SA 4ODGA 1F77A 4F8RA 3U4ZA 5ALFA 4XYOA 3GLGE 1Y8NB 3T13A 1BCPF 3ZQJA 1LKYB 1ZQIA 5KEEA 4GOPC 4LCBA 2KSOA 5D4BA 3DWAA 5IT9S 4QZFA 2ASLA 2EAOA 1G8ZD 3M9BA 4LRSA 3OSPA 4C4RA 4X3TA 3PO4A 2AHMA 5F2DA 5FK9C 3GP1A 3M6KA 2NZ1D 1TWCH 4AI6A 2LMCB 3WKCA 3NQTA 4DR7Q 4CRXA 1CHQD 1E7ZA 4ZAIA 4JC0A 1VQOA 1OW5A 1EXNA 5AM2A 1KQSA 4KODA 1HNZL 3U6SA 4IPGA 4LRTA 2H3FA 1B8AA 1N34M 3K1JA 2FMMA 1XPRA 3MABA 3LYSA 2JEIA 4CF3A 1G71A 3P75A 1XNQL 5C4JH 3HWTA 4KLTA 1S77D 4UB3A 2NWGA 2M0NA 3BDLA 4AH6A 1YNJD 2FLPA 3NBIA 2QEXA 2R44A 4LF6L 1HFNA 5KFQA 3P7JA 1PYSB 2GO7A 2VW9A 1GL6A 1F0MA 2F2AB 1IN8A 1YLAA 1EYAA 3AMUA 1ILPA 5ALXA 4OO1I 4GLXA 5CRXA 2FDRA 1B9MA 3DEEA 3MXPA 4YCVA 1EY0A 1I94Q 1H95A 1QUQA 4DR2M 4EX7A 3SK6A 5L37A 4XRHA 4X3SA 3PIOA 4R4QA 4UN2B 4X65L 2KJXA 2UUAL 3J7AV 5EE1A 1BF4A 1N32L 3VFDA 1EY9A 2R92B 4JI1Q 2IHNA 3STBD 4EGVA 1EU4A 2CWBA 2IMWP 3TPZA 1C0AA 3A8IE 4HJAA 1CK1A 5ALGA 1P7DA 1PTOB 3LWEA 5IE8A 1PH1A 4X5VA 1WTHA 3OOCA 3KZXA 3SDZA 4CF4A 1OQYA 4LJXA 1BUVT 2LVAA 4UAIA 3SHLA 2LWXA 2UXDL 2PQAB 1BCPC 3NTKA 4B9XA 4Y7NB 4TKOB 5M5WH 4IBJA 3I4YA 1JXLA 2NBFA 4Y52H 1AW7A 1JJCB 4RGNA 1JI7A 2VA8A 4PDGA 1WJ7A 4IIWA 5AKJA 5DBAA 3KUPA 1JE5A 1D7QA 1NJIC 4YCUA 1XMOM 4BY7H 2VB3X 1I4PA 2AKWB 3QU5A 1B4FA 2KNAA 4YR2A 2DHYA 3RGPA 4I2GA 4M2YA 2ZBKB 1Y69U 1DYQA 2R61A 1NSNS 1HPCA 3CNHA 4X64Q 3BDPA 4GKKQ 1SXEA 4R7GA 4RAUC 3DEOA 2FI1A 4APVA 1E3PA 2JEGA 5KNCA 5ITXA 2QB0A 2L09A 1NV8A 3WK5A 4IBFA 2F0DA 3J80S 3L9AX 1YZ6A 2EY5A 3RE8A 5KFMA 2WF8A 4IRKA 3ERSX 2YY6A 4O5KA 4DU9A 4Y28F 5GTHU 2A6HC 1KD1C 4P4OA 2VF7A 1N33M 1U4MA 5CBAE 5EJCA 3VYRA 4RQ1A 3TARA 1FD7D 1S5CD 4HCEA 2A1JB 2K4PA 5AHXA 9ICTA 1OFIA 3I4VA 2NRWA 5IIKA 5CB1A 3I4MB 4RPZA 1BNZA 3AEVA 2IX1A 1N60A 4JI4M 1RQLA 4JUZA 4DQSA 2CKZB 1SXJD 2M60A 3A5UA 2IOHA 2B63B 4CE6A 1AROP 4GNXC 3HOWB 2DVWB 2EAMA 4X6AH 5IYBH 4FDBA 4X65Q 2R93G 3UDXA 1N63A 4J9NA 3QEAZ 3QNMA 2HW3A 4WURA 1BKBA 3A55A 3PVSA 4F2LA 1NJZA 1BNPA 4ZKBB 3MHVC 5AM5A 2ZJPA 3L26A 4J9LA 3SAFA 3JPNA 2Q2EB 2OEHA 3UXNA 2W8KA 2ID0A 2B21A 2VIXA 2E2JH 4QNMA 2WB1F 2KVMA 1GOZA 1SMYC 1QB5D 1KTQA 4GFJA 4JPBW 3FRIA 2AWNA 4EYIB 4I2CA 2BOSA 4DFKA 3M4OH 4X66M 4KKUA 1PJSA 3W5OA 1RJTA 4LF4Q 3R9KA 4C1NI 5KFBA 7ICUA 4EIWA 2E5LM 3H0RB 4JI0Q 5J2IA 1Q90A 3AOGA 2B2UA 4KK7A 3Q0AA 2WAQE 4NJ8A 2O2LD 3HOWG 1VQHA 2BQ3A 3KDFA 4MGZE 5CHGA 2F0NA 5KAIU 3H0GB 2NVTH 3U6LA 3NVZA 5KFIA 4FXDA 1NY5A 4UBCA 3AQQA 4KN4C 3CKIB 4J9MA 3FE3A 2G5IB 5J2CA 5JRTA 9ICAA 2HUGA 3CAMA 3OHXC 4KD4A 3TREA 3EUB2 1L2DA 5C5JA 5BN4A 4IRCA 8ICOA 2R6GA 2Y1IA 3QO2A 2XY6A 2NN6I 5FO7B 5M5XH 4YCXA 3JPSA 3T5KA 4HAEA 4US9A 1ZJMA 2KD1A 4NLBA 4UAYA 1Z7TA 1YNXA 3M4QA 3H7IA 3TP6A 5ALIA 2KICA 2DKLA 3F2DA 4JG2A 5DG8A 1ZQYA 3Q8RB 2A73B 2ZM6L 2LKYA 4KO8A 2FFKB 3CMEA 4G7ZC 2PI5A 4QHTA 4GITA 3U6DA 1TDZA 2ZIVB 4ZUJA 3AU2A 3OSOA 3DV9A 3RMHA 5J22A 4O3QA 3RB0A 2KIWA 2PI2E 1L7PA 4I28A 3K80C 2L55A 4KHPL 4G4RA 4I2FA 1PFBA 1EIJA 1JR3A 1P8LA 2KCCA 5KFKA 1IW7C 1UEBA 2BCOA 3SR1A 4GRIA 4BY7B 1ZQTA 2AJQA 5ALHA 1A3TA 4JI3L 1GM5A 4IJEA 4GC7A 4A8EA 1NK7A 4P0PB 5EXPA 2K6BA 5J8YA 5KAFU 5IZ7D 5EE9A 4OEMB 4BBSG 2OH2A 2VL6A 5IREB 2ES6A 4HSVA 2XIWA 3JPQA 4RQMA 1SKSA 2V4RA 4MGYE 1TV9A 2OYYA 5B5EU 1H38A 1SNPA 1U48A 4QIWC 3MA2B 4JWMA 3UZUA 3HGBA 1LLRD 2FMCA 3BVMA 4QY7A 1JIHA 2A1AA 4JMUA 5DBCA 3DOAA 1KFDA 4F71A 2KNJA 3HHXA 1Z19A 3UMMA 3I70A 4FCTA 3ED5A 2R7ZH 4EBEA 1AH9A 1IL8A 3KP0E 5A2QS 5LMUQ 1WCLA 7ICFA 5AFWA 3S1NH 4ACOA 1LT3D 2UXCL 4RNOA 1MN3A 2E8NA 2DZOB 2K04A 2HHVA 1Z59A 3LCUA 1VEKA 3SENA 1F44A 4C8KA 4Q0FA 1X55A 1U47A 2AQ1B 8ICYA 2I5LX 4F4XA 4KMOB 4QIWB 2W7OA 3KHLA 2CRXA 1U4PA 1KLGD 1BGXT 1UE6A 3T3FA 4YWLA 4GH9A 1STGA 3PO2B 3RZDB 2KEBA 1DOQA 4OX9M 3E5SA 2J7OA 4UAWA 1V1PB 2EYMA 2XRSD 3IL8A 4KLJA 1B7YB 2NVXB 4DAYA 3QZ8A 4AIMA 5DLFA 5ALTA 1KLUD 2PFQA 1F9PA 3DMUA 2UVUA 1ZMVA 9ICFA 1J5EM 5EQ0A 2B2YC 2FMSA 4J6HA 1FJGL 2PMZC 5KNBA 4B3SM 5C3EG 2IL8A 3K8AA 1X9XA 2QB0B 3TADA 2N49A 4L5QA 5EBDA 4JI2Q 3NVWA 3HU1A 2PI2A 1ZYRD 1LTAD 4JI6L 4QCLA 1Y8OB 2PI4A 5E1FA 2ZG6A 3V96A 1EIFA 4LJZC 2UU9L 3RB3A 4I2BA 2R8IA 5KQDA 2ERCA 5CEHA 1PXUA 1Y1VH 3AU6A 1X9WA 4A3FB 4DR4Q 1RYUA 5IIOA 1OUQA 3OWEB 3FKEA 8ICUA 4IBGA 4JI3M 4UP8A 5B66U 1XMQQ 3QUBA 1MSWD 2J5YA 4IURA 1PVQA 1W3SA 2WHEA 3HFZB 5FTMA 4KHPM 2K8AA 4FS2A 1MD2D 4DXFA 4F3OA 4NXNQ 1IBLM 2ZIWB 3B89A 5EXTA 4ZLTF 2E2HB 3E46A 2CH4W 1E0BA 1SMYD 4QUCA 3WOFA 1Z47A 2F0FA 3OHBA 4LFAQ 3SD7A 1NHWC 1VQEA 1B4OA 1WIVA 2J7ZA 4C1NK 1SIJA 3L27A 1B43A 4GIBA 1UE5A 2EY6A 1NY6A 1YUBA 2JH1A 3BS7A 5DB6A 4ULLA 5CV4A 4BXOB 1NZBA 1MIUA 1L3SA 1Q1EA 5HURA 1IBLL 1ZKOA 5J2JA 5ELDA 2DI0A 3BVZA 2YN4A 3TMEA 2H5XA 1Q8IA 1SNCA 3K0YA 3CCVA 4UBBA 1T7PA 1C4QA 3TE6A 1JN3A 4R8UB 5IGEA 2BCQA 5KQ8A 1K1QA 2K50A 3I7FA 3Q8QB 2MH8A 1IBKQ 4YD1A 1WTOA 4ANRA 1ENFA 4DR3L 2PCFB 5EP3A 1IXSA 1CQFA 2E8GA 3M9NB 2EY2A 3N28A 3DWPA 5LL6X 4MFCA 1ET9A 4DR4M 1NY4A 2AMCB 3JAME 2E2DC 1KTKA 1ZYRC 3C2LA 3PW2A 2BWEA 2K5VA 2QEJC 4K8JA 2EH9A 5KFVA 4XQJA 3I51A 4AYBB 4HAIA 3KF8B 2C2DA 3AYHB 2Y0SF 4BXOA 1ZETA 2OXPA 2Z4HA 2EAPA 2QILA 3S1MH 1SXJA 1ORYB 1VQAA 2EQYA 1J5EQ 4JI2L 5ITQA 3F2CA 1XTCD 2MPMA 4IN3A 4DUZQ 3KFUA 2XGTA 4KLIA 4BB9A 3SK4A 2DAKA 4DV6Q 2C99A 4G9BA 3EROA 3FTFA 4JI5L 1TH2A 3T16A 2ZANA 4R1JA 1NE3A 4F7XA 1HNXQ 3GTMB 4WW0A 1RXWA 1QJOA 5H37D 3EN2A 1N8RC 4FZNA 1WTVA 2D3DA 2SNSA 3SMVA 5DBBA 1TWHB 3E0JA 4XA5A 2UXCM 1DD2A 1N36M 2OT2A 1PGYA 3U6PA 3ONNA 1EYCA 2CV0A 1J9OA 2DHRA 1F9SA 3URYA 3SK8A 5M3FG 2Q2IA 3SAWA 3THGA 4IBCA 2QBYA 4PZ6A 5KNDA 5BPVA 2BJWA 2QQ8A 5DGAA 4O5EA 2WSCF 5AKZA 4Z6EA 2QKQA 1JOKA 2ZTDA 1XXGA 2KA7A 1RL2A 1O03A 3I72A 3PUYA 3RN2A 3TWLA 3B0YA 3CYMA 3BS5B 3RF9A 4RQ5A 2F0WA 4I81A 3NK9A 4DK3C 8CATA 3Q8LA 1ZXIA 2RCFA 3PSIA 3LWMA 4DV5Q 5IYBG 3TI0A 3BBZA 1RZTA 1STEA 1AEXA 5KFEA 1CSQA 2EOTA 3C58A 4OJLA 2LMRA 5AI4A 1KSPA 2D7HA 9ICVA 4IBEA 5AICA 2FHTA 1NK8A 1Q46A 1QNKA 4MFAA 3M6AA 3VR4A 5JOBA 1HQCA 2PZUA 4O2DA 2BHNA 4M47A 3SASA 1Z1BA 4DOAA 3UQ0A 4KLQA 4IBDA 1G3IA 1XSNA 2I9GA 4CDEC 1O7ZA 4JK1A 2L15A 1QVCA 2M2LA 4FXGC 5ITRA 4C8MA 2KV2A 4YD2A 2QF7A 4ELTA 3K0XA 3HOYG 1B50A 4B9MA 2JH7A 3EPGA 4F50A 3LWLA 1OXUA 5TZVA 5C5MA 1II3A 5EBCA 5ALDA 5F3XB 4DF8A 1ZQXA 1KAWA 1R4GA 2FPLA 5KPRA 2GVBA 4ABNA 3NUQA 2B29A 2RKOA 1N36Q 8ICSA 5IGGA 2M5ZA 3FPPA 1IBKM 1CSPA 1NJXA 7ICMA 3CCSA 4FBTA 1SFOB 1I6HB 1J6QA 1SXJE 3HJ8A 2W7PA 4F4ZA 3OJSA 4C8OA 3MMPA 5JI2E 2E5SA 2XSCA 4R4TA 5A35A 4QZGA 3RD4A 5DM73 4IRDA 4J9QA 1HNXL 4Z6CA 1NMGA 1IV8A 4NOOB 1WVLA 3GTOB 2APLA 4CIZA 4IFDH 2JY6B 5E7NA 2J6UA 2PMZB 2QNJA 1JCKB 4YHHL 5JJLA 3AFHA 4RHRA 4NXMM 3K1RB 4PPXA 1TE2A 1V1QA 1CI3M 4OONA 2ZJRA 3VR3A 3IV6A 2J6TA 1URJA 3GQCA 4A75A 4CGZA 2R3ZA 1NNJA 4ECUA 1L2BA 2RHQB 2VB2X 4IUQA 3GTGB 2KENA 1I4WA 3D8LA 1QQ6A 1HZAA 2VIIA 5G5HA 3RH6A 3TWMA 1W6JA 1T43A 3GLFB 3RN5A 1V38A 4RQ2A 1I4QA 1X9MA 2YYZA 4I2EA 1BPZA 1XNRM 4NKLA 5E6JA 3KSJA 1XO1A 1SE3A 1ZXTA 3IFTA 2Z6KC 3PMFA 4QNRA 1EQRA 4RQ0A 3U6CA 2G06A 4IQVA 3R2IA 2CCZA 4UY8C 2L1BA 2HL7A 4YFKA 4KLMA 1ML0D 2DBYA 3TADC 5I2YA 3LQQA 3L3FX 4O1NA 2R93B 1E24A 4QGUA 5A2QE 4RKLA 2DJFC 5C3XA 5I9OA 4O3RA 1TS2A 3GLIA 4QW9A 3VDPA 2OWOA 1X3PA 3BZDB 3Q22A 1YNNC 3JC66 2N78A 3A7AB 2EZYA 2NV3A 2EYOA 2ZXOA 3LNNA 2KHSA 1SKWA 4ITQA 3AQFA 4FS1A 1E2VA 2I46A 5C4XH 2KKPA 1GUTA 3D6WA 1CI4A 3JAMS 4OGQC 4ZYSA 2R7ZG 1I4HA 5KFAA 3B6YA 4NXNM 3QUCA 3H91A 4KHPQ 1D8YA 2Z8YM 3AL0C 3C28A 3FEWX 1Q81C 5M5YB 2D0OA 3H4JA 3ZDBA 1JE4A 1EOVA 3LWUA 4PQXA 1HH2P 4HJ8A 3GTJB 4PH5A 4RT2A 1EZ6A 2EXDA 3NVVA 1I50H 1PH8A 2XTIA 3BVGA 5ALKA 1U49A 1HZBA 3KLSX 3W0LB 1ZQ9A 1FNWA 1D0LA 5J0RA 3CW2C 1BR9A 1M4VA 1U4BA 3S17B 1X66A 4TQUS 3CPWA 3LVWA 1J2MA 5KFGA 2XY5A 4NB3A 4UDUC 1CKNA 3WKBA 1BVSA 3RLOA 1M90C 2LBOA 1OIZA 1PTOD 2Y0SG 4B3SQ 3GDEA 5J3BA 3CF0A 4DS4A 4DR2Q 1SXDA 4NXMQ 3GTOH 1F2YA 4IBIA 3C5GA 3T79A 4RGMA 4CJ6A 1QZEA 2F5OA 7ICJA 3CCUA 1EWIA 4YR3A 2YX8A 3NPPA 1S8OA 4A3MB 2JRZA 1KFVA 4P2HA 4HIOA 4Y2JA 4A3IG 1JWUD 4PMCA 1VG5A 4HEOA 2OQKA 1BOSA 1ZV1A 8ICEA 4L5SA 4QNLA 1LTLA 4OWTB 4MIUA 3DDHA 4US8A 4UB5A 1HUMA 1MX0A 1K3BC 1MJGM 1G59A 4G4NA 4DNTB 5JU5A 3PR4A 1TKWB 5DDYA 4DV0L 4ELVA 7ICOA 2Y1JA 1WUDA 3AFQA 4YMMA 5IT9L 4BY7G 5ISRA 2HDLA 4UATA 2RCNA 2WINB 1EQVA 4A3FG 2UXDM 2VQFL 1D5ZC 1SWWA 3D4WA 2OEOA 4A3BG 4DUYQ 4C2MH 1ZQKA 2IWHA 2VQEQ 2ZIWA 3A5ZB 2G0AA 4OJOA 1N36L 1KHIA 4H13C 7ICNA 4JI5Q 4FF2A 3Q24A 2AQ3B 1R2YA 1WWUA 1B22A 4HN7A 5J0UA 4RUAA 4C3HG 1GHKA 1TAUA 4AKIA 3U4VA 3UK6A 1FIQA 1A0IA 2K03A 3KBBA 2VANA 2EZXA 2B2TC 2F77X 1SXJB 4TUWA 4M04A 1Z6HA 2VDBB 2Z8LA 1L0WA 3K6OA 2CV2A 4A3EB 3VR6A 3A0HU 4UAUA 5KG7A 3MR6A 3MXUA 4K0KL 4P72A 3EIEA 1DXSA 1QYRA 3NTHA 3O13A 1EQTA 2Q8IB 2O01F 4F72A 2CWAA 1Q82C 3BJYA 1PFMA 2MAXA 2FPKA 3PSFA 1PJIA 1HUOA 3NRZA 3T5LA 1ZQGA 5ALOA 4BX9C 1PRTF 5FKAC 2JA5H 3CC4A 4NXML 4LF8M 1MU5A 1Q02A 4YHHM 2YR0A 4P4MA 2G3QA 1E9RA 1Y1VG 2E76C 3MVVA 3VKHA 3U58A 2L5YA 4R4IA 1VQ7A 3UQ2A 1LO5D 1VQBA 4F87A 3IHQB 3V6KA 1QTMA 4DR5L 4K5VA 3SBJA 2LS01 1SZHA 2PMZF 4B9LA 9ICMA 2WAQG 3T53B 1HT1E 4BLCA 3MFHA 3GTPB 2IX0A 4P0QB 4DV6M 4PL2A 1S5FD 1NJGA 5GROA 3JR5A 3RJHA 3PUZA 2ISPA 5AI5A 4FCWA 3M4YA 2CEAA 4M9NA 4RKBA 3GPXA 3GQ5A 3LCVB 4B3TM 4QZHA 3V72A 8ICZA 4UASA 2HBJA 4LJ7A 4GS3A 2DWLA 4FW9A 3GIIA 3PUXA 5KYIA 2NN6H 2NYZD 3K5MA 4DFDA 5L1JA 4GN3B 4DNIA 4X62Q 3OTQA 4JI6Q 3IN5A 2HCFA 4ED1A 4KLOA 5ITUA 1IKLA 5GAGC 2BPFA 4BY1H 1SNDA 4ZOHC 5K36G 1N5WA 3W0FA 4LJAA 4O42A 3WHKA 2BGWA 4P0QA 1UA0A 1SYEA 1SE8A 1L7MA 5KFNA 3BQ7A 2F0TA 3MFIA 4OD0A 3QWLA 3PUWA 4DLGA 1YVCA 1C1KA 1DGGA 2FOIC 1RYSA 1OO9B 3PR5B 8ICVA 4LJ5A 1KNAA 3KW6A 4AG5A 5DLGA 5J0TA 5ALNA 1PTOF 2NZHA 3I91A 4R8IA 1J09A 2LVNC 5EP4A 2NRTA 3MGVA 1MHWC 4DAYB 3T5JA 4C3JB 4B3SL 3ZDDA 4ED2A 3KLWA 3GIJA 1A6SA 2KIVA 2BJVA 2HOFA 2TSSA 5C4XB 4BWMA 4OX9Q 5EQTA 5AJ3L 3ZH9B 2YQZA 1WGLA 4ED8A 1LT4D 5J1ZA 2JEJA 4EZ6A 3KD3A 4DR5Q 1SEBD 3HGIA 5HMLA 3F5EA 2F0UA 4NSRA 4C7ZA 4O3OA 1RDPD 2F4VM 2K14A 3OTOM 2Q0ZX 5JUMA 1QAMA 4U7CA 2OM6A 2P5TA 1O7IA 5AKGA 1P3QQ 2HVHA 3E9IA 3RR7A 3L0OA 2WACA 5BN3A 2JA8B 5J2HA 3F8TA 1PH3A 2CHGA 3BZKA 3CQZH 3A0BU 5K5PA 4Y2TA 2RRDA 2PW5A 1D6EC 2ZAOA 5IT9E 2CV1A 4GMQA 5DB9A 4X64M 1MQ3A 1C8CA 2WIIB 3BYTB 1LV7A 2JA5G 1L1TA 1U4RA 2F0QA 1V34A 4OVZB 1MQ2A 1JR3E 3IFDA 4JI1L 1FNVA 1T6OA 3NTIA 2WSEF 4IOCA 4LJ9A 4EYHB 3GILA 1L3UA 3G48A 3GV3A 1WI5A 5C3EB 1LT5D 2EQSA 1K0RA 3L3OC 1KIXA 4DR7L 1ESFA 2KTQA 1T4GA 3TANA 1CQVA 2Q2HA 4BBAA 3HOVH 3PF4A 2HHQA 1B0XA 3EIVA 1HA6A 4PMWA 4LAAA 1QVGA 4DXGA 1RODA 1HNWM 4ZQ3A 3WWVA 5AKYA 3MR2A 1JR0D 1HNZQ 1U5KA 3BDOA 3K59A 4A3EH 3GIMA 1TWFH 5BR8L 1HTPA 1TWAH 4M9LA 2VF8A 3GV8B 3OW7A 4AYBC 4M8AA 5KPZA 3F2BA 1BXTA 1AZQA 2UXBQ 5EE3A 5KG2A 2F1JA 4D81A 5IWAM 3HJSA 2HBLA 3IRUA 1QDRA 1UM8A 2JQOA 2NB0A 2NN6G 5JEAH 1JOOA 1X6IA 1RQNA 5ALUA 2CQAA 3DHQA 5BN5A 1Q39A 3EYZA 4OO1J 3I4OA 1N75A 3GRVA 4QZDA 4UB6U 3PIP3 2X4AA 5K36H 3ZDCA 3UMGA 2KBNA 2XZFA 2IBKA 2L4NA 3AN1A 2K5DA 2LVPC 2C9CA 3I4NG 3MDCA 1Z5AA 1HUZA 3GTPH 4FE3A 1WWVA 1YZ7A 1S9FA 1XX8A 4XBOA 2H4OA 3AU7A 5IWAL 4QB4A 4EQ5A 1ZQVA 3KOZE 1NNLA 4A3JG 1OJLA 3B7QA 3LMMA 3D8GA 2KHIA 1VLBA 3GLGA 2W82A 4CCHA 4HR7B 1H9SA 4DF7A 1OTRA 4GXJA 4DQIA 4DV1M 1X42A 2N55A 5IP7G 4DL3A 1PH4A 4KLEA 4LF7M 2AGQA 4DL4A 1DO2A 1ZRNA 5AKXA 3HW8A 1F2MA 3TP5A 4LF9M 1B2TA 2LSSA 4CKCA 3AKZA 4MEYA 5L9XA 2H1RA 1FL0A 3KSXA 1F2LA 1DRGA 3ITPA 4DUZL 2PPBC 1TVXA 3CC2A 4M9XA 4LJ6A 3RZOH 4DV3L 4LF9Q 4HJ9A 9ICRA 7CATA 4DAPA 2KN7A 3PIPA 2VXWA 3HOUH 1Y14B 1V97A 2DAMA 3U9OA 4GLAC 2WF6A 4I7ZC 3FTEA 4C3IH 1AIPC 4EENA 3MDAA 1UA1A 1BQQT 2EJMA 4Q8FA 2X49A 1MBYA 2F0LA 1TK5A 3JAMi 9ICJA 1CA6A 1K8OA 4LF5L 2KOLA 5IIJA 4NLKA 5L1LA 5KG6A 4DV2L 4B7FA 1Y88A 2D8CA 4IQUA 2CVRA 3S2HH 4P73A 4AQYQ 2MRLA 3MFGA 7ICIA 2F4IA 4HTHA 4QZEA 3NASA 2FJ2A 1MSGA 1NV9A 1Z5BA 2DZNB 1K3WA 1K5OA 5AI0A 3I4LA 3GU3A 2PZTA 3KJOA 1HRJA 4NSOB 2BH2A 4I8OA 3FHWA 2R45A 3DM1A 3Q8PB 1PK1B 3K4GA 2SNMA 3PMNA 4TRDA 2BWBA 3GQBA 4DFPA 2RDIA 4Y2RA 1B53A 2KFZA 4LUOA 5C4ZA 1EL0A 1C7YA 1HXYD 1SFOH 2H3QA 3QUTA 1NR4A 5FLMH 1TKDA 3SMSA 2FH0A 2B8FA 2BA1A 3CRLC 2LXEA 2W43A 4F5OA 3PW5A 7ICTA 4DKAC 2F1MA 2DGZA 3PW7A 4NDXA 4ED7A 1N61A 3TP8A 2B63H 2F8LA 3KXEC 1NKBA 2P66A 1NBWA 1K82A 1KC8C 2YTYA 4USAA 2E1FA 4YG2A 1B44D 3GV6A 1OIPA 4JVZA 2AUJD 3D2NA 2HOIA 1ZMUA 2DWZB 1KRPA 3AL0B 4O3SA 2K8CB 1GKHA 5J2DA 2DPIA 1NMFA 2B39A 3NP8A 1TWHH 4Z8XA 4GLVB 4CDFC 1QZMA 1ZQEA 3HOZB 5DAUA 9ICHA 3SAHA 4HIKA 3K2LA 3V76A 2OO9A 3TN2A 4I65A 2K75A 3GTMH 4DK6C 4K5WA 1RD9D 3TEHB 1L2FA 2XVTA 2NVYB 5M3MB 1NHGC 2WB1G 4MHEA 2NVQH 1QILA 2ASDA 3S16B 1PZID 4TURA 2HHUA 3HS0C 1JR3D 3GIKA 1I5FA 1WTWA 1LYLA 2R92H 1Q12A 3SEBA 3RZOB 2PNRC 3HZXA 2XEPA 3H0GG 4HIDA 1ZQAA 2L2DA 1NKCA 1QSYA 4C3HB 4ALPA 1E94E 2ZXHA 3TQ1A 2IHEA 1XNQQ 1A0PA 4DV7Q 5KT2A 2CE7A 2B6GA 1BO0A 3TACB 3H4BA 4I2HA 4BUGA 4F92B 3VK7A 5AI6A 4BXXG 4DR6L 2J0TD 5FLXS 3NENA 1XWLA 1K73C 3HOYH 1VQLA 1TQOA 3PSPA 4NLZA 3W1GA 2KHVA 4B9SA 1IZ6A 2L11A 2E5LL 2UUCQ 1S97A 1J2NA 4R9WA 5CC4A 3TS2A 5ALWA 2UUCL 4X66L 5IIFA 3OIQA 3UGJA 1Q3BA 4OU7A 4PHEA 1W5SA 2K33A 3E2EA 1EIHA 1YBYA 3TKAA 1LTTD 3VYSA 3FC4A 5M5YH 2LHTA 2EYJA 4C3JG 3K92A 5GADC 3S1QB 3IG5A 4PT5A 2GH1A 5CR0A 4UP9A 3R93A 5FOBB 4B3MM 4EEYA 2BQRA 2ODGA 3RH4A 4OELB 3S6JA 4U6PA 2EDGA 3KVWA 5ALVA 4RG1A 2MGWA 1J97A 1NVMA 2HDOA 3QG1A 5ALMA 3T6PA 3KOYE 3D2SA 1SZPA 2WB1C 4WJWA 4RUCA 3ZJYC 1Y1WH 1HZ9A 2EE1A 4KHVA 5DNYA 1TH4A 1I4RA 4UB8U 1IL2A 2PO4A 4X62M 1QWYA 1CHPD 1G51A 4J8QA 3K75D 4K14A 4D80A 4Q44A 5JEAJ 1NJFA 2EKKA 4XT3B 2KP7A 1V33A 1ZQJA 4U68A 4GOPA 3C21A 1PH2A 4B3TQ 3AQEA 2W3SA 5DQHA 1RIPA 1STAA 2W9BB 3M8SA 9ICGA 1VEJA 4QWBA 4KLUA 4B9WA 2JY7A 3Q8DA 1E2ZA 4JV5M 3SK5A 1NNXA 4PCZA 4PG3A 3HOXB 3GLGB 3NSWA 3OWFA 5IYDG 2D2CC 2A8VA 2KXEA 3J81S 4EEKA 4DR7M 2AU0A 1YI2A 3VKGA 5KT6A 3Q8KA 3A56A 2F76X 1X3EA 3PNVA 2ZIVA 2LYBA 4K2LA 1KL9A 4QWCA 2HIVA 4JV1A 3RLFA 3S1NB 4OO1G 2C22A 4LF8Q 3TRZA 3PX0A 4DV4Q 2QHOB 1R6BX 4LFCM 1WCMG 1ASZA 2QDLA 2NTTA 2C5RA 2EZZA 4OCZA 1HA5A 3KLSA 1XMOL 3QU9A 3PQIA 1J8IA 3E58A 5KG1A 5LMNL 2KCNA 2ATLA 2QGQA 1PYWD 1PLFA 4LF5M 4OIJA 1E2WA 1IY0A 2PKEA 2YMMA 3HJEA 1L8OA 1GO3E 1H9MA 3MEFA 3H09A 3T1YL 2K89A 3EFXD 5E4XA 5AI9A 1TIID 4DWIA 1WD1A 4RH6A 4DLEA 3HOZH 3JR4A 1ENAA 3AJIB 3H3VC 4GXIA 1HUNA 4IQTA 2Y0TA 1VQ8A 2KG5A 3GTJH 1G2SA 2JA8G 4ZCKA 3GQ4A 1K3XA 4ECQA 4O3PA 3H8JA 2N8NA 1QVFA 3J7YW 1H6UA 2BR0A 1JORA 4IPDA 1A3UA 4O0AA 5EXXA 2DL0A 4YVZA 5J0OA 4P74A 3HOXG 1PZNA 1UQVA 2Z9HA 1W5TA 5J2EA 1NK4A 4L6V6 1OAIA 2R65A 5A0LA 3ISCA 1L5UA 5IGBA 1HR0Q 4LF7L 4N9PA 1OXVA 2G9DA 3V05A 3G6JB 1HR0L 4RQ8A 3A8KE 4CJ2C 3FAHA 4FFDA 4KN4A 5FJ8G 2Z4RA 4QZIA 3R9XB 3SHGB 1GVPA 3SE0A 4IO9A 1E32A 4B7HA 1VQKA 2E2IB 1GUOA 1ZQRA 1SYGA 5KFDA 1N34L 1Z00B 1FYCA 2I7NA 1HNZM 4F5NA 1EWHA 4LZGA 5FTNA 5DKWA 1VQ4A 3ICEA 1TDHA 5C4JB 2Z7JA 3H4MA 4DR3Q 3GFKB 3BG3A 3FRPB 4IFDJ 2CFMA 5CYUA 2QSFX 1MA7A 1JX4A 1TF0B 2JXJA 3M85A 4ECYA 3RR8A 2CRUA 2YMPA 1D1IA 2LH0A 1OTCA 3CMAA 1SWVA 2ZUCA 1PMRA 2YTVA 1QNUA 3KK7A 1H9RA 1ZQOA 5J0SA 2F0PA 2C28A 1Q86C 5AIAA 1ZQNA 4A3VB 4F4WA 2B2WA 1C48A 3OGUA 3OMGA 2CW0C 3WKAA 4FF3A 3TQSA 1R5LA 4Y2VA 5JAVA 4A3BH 3QR8A 3HOVG 4MB7A 1SV0A 2HD3A 5KL1B 5EKLA 5C5LA 3FP9A 5IWAQ 3TDQA 4FF1A 1JOQA 5ALZA 3U60A 5KFLA 8ICFA 2F5SA 1RU3A 2K4KA 3V2TA 3BQ2A 2LM4A 1NR2A 2MHVA 4C3HH 1GVNA 2BDUA 1PJTA 2XLJA 1QSLA 2PNHA 3ULPA 1HR0W 3TAQA 4PGYA 5IIMA 5COYA 4A3KG 3PO2H 3A7LA 1K8AC 3G6VA 4A3JH 1HT2E 4MGHA 4M9HA 1D1KA 4EVOA 3QOJA 4QHSA 1TWGB 2HKJA 4XQQA 4XDXA 5CJ7A 1KABA 4DA2A 3WKDA 4PZNA 3M9MB 3SATA 4NRWA 1NK5A 3GLHB 2JZ1A 3K9OA 1ZQPA 2HCBA 3GV7B 2F1IA 1MJCA 2B2VC 2MJ8A 1LVHA 3VYTA 5C4XG 4X64L 2AH5A 2HHWA 2WP8J 3A0JA 5TISU 3LK9A 5ITTA 2ZIXB 3KF6A 2WZJA 1XSLA 2OPFA 3Q8MA 2Q2UA 4MFFA 4A3CH 1D0KA 1UPHA 4G57A 2F5PA 2A19A 3TFSA 1A63A 1YITA 1E1OA 4OL7A 3WK6A 4GKJM 2F4VL 1AP0A 2D7EA 4M9ZA 5CV5A 4DQQA 4JCVE 3H8MA 4C56C 3VA7A 3HOZG 3J2PB 1TFRA 2BDPA 1EY5A 2MNAA 1K28A 1EY4A 4DSKA 1Y8PB 1IG6A 4P75A 4DV7L 1F2ZA 5IINA 1JJ2A 1B70B 3CCJA 3UXPA 1UE1A 4ID6A 1XNRQ 4AYBF 4PZ7A 1X9NA 3NHHA 1D9DA 1PV4A 3EQLC 4RWSC 2G5GX 2ZM6Q 2EDUA 1VDDA 2VQFM 2Q4TA 3T1HL 2F03A 2UUAQ 1N32Q 4XIGS 3J81i 3RJGA 2D5DA 2EKFA 1HQRD 1PRBA 5J0XA 4CDCC 4KHZA 4CJ0B 3QAUA 4DV0M 2QA4A 3RZDH 1Z9FA 4PV1C 3RJKA 2HBKA 1LB2B 2A69C 1H9JA 1ZQWA 3C1ZA 5FP0A 3A54A 5T14A 1Q1BA 1QZHA 2KW0A 3K58A 4I5SA 4QOSA 2EJGC 3ER0A 4A3IH 1BPBA 3I4NB 1XNSA 3OYYA 3KS4A 1Q7YC 1PH5A 2JYOA 3SQIA 4P0PA 3T1YM 2EXZA 3BU2A 5D65A 3VR5A 1N56A 2KQ3A 1SXTA 2CH4A 1SXJC 3LDAA 1OXJA 1NK9A 4ZUIA 2K47A 1K0SA 1S3SA 2M00A 3M7DA 3D4DA 2PFOA 3HT3A 2C5CA 4C7YA 2ZAMA 4A93G 2WKCA 1DGHB 3Q23A 3LW5F 1PTOH 1K3RA 3V7KA 4PMBA 4P4PA 4GKKL 2F0EA 3CHBD 4IJHA 3D31A 3S14B 4M0AA 2Z4SA 4G4OA 3MC1A 2V4QA 1X3GA 4PZ8A 2K4HA 4BBRH 1WGNA 1QDTA 2AWOA 2OQ0A 4RKUF 2R46A 2W9AA 3FTDA 2H3IA 4L8JA 4PGQA 1HNWQ 1QG7A 4F93B 1L0YB 2L4FA 1ZD5A 4RCOA 2UVVA 5KFSA 1OXTA 5L1KA 5EXSA 1EY8A 2D0PA 4TQRA 3I4MH 4LZZA 1XPOA 3I76A 5EWGA 2UVWA 4DV2Q 3E9SA 9ICKA 3SHFA 1CT1D 2YTUA 2G8LA 4AKGA 4XQ8A 2WFAA 4DQRA 3WKEA 2F0VA 5KO3A 2RDHA 2W9BA 5EKIA 4LF8L 3S1QH 2LM1A 1NK0A 4DBGB 8ICXA 1V1OA 2NVYH 5M3MH 3FYHA 2B0CA 2KVSA 2PW7A 4MGKE 4DSJA 4N8X1 5L8RF 1ZD2P 2G08A 4XK8F 4JV2A 4F8MA 1K8GA 4LG2A 1CM9A 2JY8A 4LUVA 3JAMc 3N7RC 2PMZE 3ULLA 1HIWA 3FDSA 1EEID 2JSOA 2DNCA 3DZDA 4WJ4A 2NRXA 1IYVA 2F5NA 2C2EA 4LW1A 4K4HA 4E6IA 1WTXA 1SYDA 3TQYA 1LV5A 1D8LA 3VR2A 1Z00A 4A3DG 2ZTCA 3H6MA 3J80i 4WJ3B 4C8LA 2DY8A 4KN7A 2G5DA 1VDLA 5ELEA 4JBMA 4JI8Q 3X3NA 3QIAA 3H0GH 2CFOA 3OMCA 8ICBA 4YWMA 1TAQA 4YQWA 1L2CA 1MKHA 3BXWA 1ZRMA 4B9VA 2NRVA 3ALRA 1O7LA 2K05A 3C1EA 4A3EG 5IYDH 1L1OC 3TZDA 2KZZA 2UUCM 3KDFB 4QW8A 2F0GA 4JI0L 2D6FC 4KN7C 4KKSA 4BXXH 3LVVA 1V85A 2WAQC 1ESRA 3TWKA 2VQFQ 5KT7A 4BA2I 2K9DA 1BPEA 4Y2PA 5BOLA 4IOAA 1NJWA 4DR6M 2BCUA 2M9VA 4L15A 2XGQA 2ZXPA 1Z1VA 3UXOA 4ECVA 2R7ZB 1LTGD 1JT8A 2OOAA 5L1MA 3OSNA 2A6HD 3K8ZA 3HX0A 2E8MA 2NVQB 2B2UC 1SL0A 4JW0A 4KY5A 1SNOA 4KLNA 2CWPA 3OTOQ 3L28A 4GKJQ 4TSSA 4UAZA 3OIPA 4G4QA 3H0MB 1ZQHA 2KFNA 1IYUA 1F9QA 2LKVA 2KZMA 3LGJA 5C3WA 1PH6A 1TWCB 4K4GA 4ZPXA 2F1HA 1ILQA 1S0NA 1RTOA 2MJ5B 5DB8A 1KDAA 3W3AA 4YY3L 1DONA 4A93H 1XXHE 3SFZA 1LV9A 4O9MA 4P2CB 4PNYA 2E8PA 1DK2A 4KJNA 2MR9A 2N1RA 5ALQA 5KFXA 5KYLA 5JVH3 4A3IB 1L1ZA 5HGQA 4MH0E 2VA3A 3D4RA 3NBXX 3IRBA 1VQMA 4ECXA 5IOCA 2KHQA 3ZI4A 2XVSA 2OQ4A 4L8RC 4CNQA 5DQIA 3J7A5 1B9NA 1D5XC 2EPBA 2F44A 2R8KA 2HCIA 3SI8A 2RF4A 3MR3A 4BBSB 3FUVA 1HQYE 1K9MC 2BE5D 2F52A 3FYCA 1SB3C 1X65A 3U50C 3CCEA 1DO0A 2YU9H 1HHVA 2K5QA 2KCTA 4IR9A 1D9FA 5KTQA 4L16A 2HVIA 2OTLA 2FE8A 2BDOA 3S17H 3GTKH 3FKIH 4FWDA 2XFTA 3ISDA 4J9OA 3RRGA 5M5WB 3C2PA 3HJQA 5FTLA 3KHGA 1RHPA 2NTSA 4YIJA 2JEBI 3V7JA 1NZPA 4IFDI 4M9GA 5ALSA 1VQGA 1A8VA 1L8LA 2RVLA 5AK6A 2K5WA 5JPNC 3U26A 3CTWB 3I2ZA 4ZRZA 4X62L 4LFAL 1GL7A 5FLXE 4ME3A 2BCVA 1RPLA 2RRUA 3PZPA 3WK4A 4AQYM 3QXGA 8ICWA 2AQ2B 1JICA 2J6SA 3ND9A 2F5QA 3U5ZB 2HI0A 1ZQMA 5CV8A 3CCLA 2Z3XA 1WXQA 3FMCA 4OJ5A 3DWQA 4A3DH 4GIPA 5DQGA 1PTOC 3BOSA 4MF8A 2HHHL 2ZT9C 1DGFA 1DV0A 3SV3A 4QOZC 1VMPA 5L1IA 3NELA 4J15A 4N8FA 4Q8EA 2DY7A 4B3ML 3S2DH 2ZJAA 4JBJA 4GHLA 2JHDA 3V7LA 4G7HC 1RM6C 1X3QA 2HQEA 4DOBA 5AM4A 5FLMG 2BNKA 1T3QA 3HRDD 5J2FA 2BCSA 2NRZA 1SNQA 2ZJ8A 4JB3A 2LXJA 1UT8A 2Q8TA 1I6VC 1KBUA 1K83B 1NUCA 3HKZB 5DEHA 3QYBA 3GDXA 4OJ6A 5NUCA 4BWGB 1QCBD 3HILA 4HYKA 1SYFA 4DR1M 2KZ3A 2C96A 3U6OA 3SR6A 2BDNA 4K2KA 3T1HQ 2KRKA 4PGXA 1YHBA 1X2IA 4KKTA 5G3LF 1L3VA 3PV8A 1SBBB 4NP5A 4RPYA 4RFBA 1JB0F 4GC6A 4RU9A 4F2RA 4R64A 3KF8A 5C44H 1WR1B 4G3IA 1JJGA 1PVRA 2BA0A 5D3IB 5ALPA 1R4PB 3MXNA 3PSTA 4DR4L 2WAQF 4R66A 1XO0A 1IY2A 4KLLA 2K4EA 1STHA 3EWAA 1I4GA 2B2VA 2X6LA 2Z6BA 4GOPB 1X40A 2RSOA 2HMXA 1SKRA 2RGOA 4BA1I 5JJKA 1R2ZA 5ALRA 1S10A 3R3OA 3EIHA 5CORA 3J80c 3T56B 3CP8A 2YB4A 3J81c 3KOOA 4NLNA 1EEFD 2Z0SA 3HKZG 1YHQA 3LQRA 4Z9CB 2R92G 1XMQL 4H44C 4J03A 2JEAI 5AKEA 1RYRA 1TR8A 3BQ1A 4KLDA 1AE3A 2Z6KA 4YHHQ 4YR0A 1DOMA 3RGSA 1WJJA 5KPTA 1Y1VB 3TSSA 4A3FH 3TP7A 1MSHA 2I0QA 1LM0A 1TXYA 1K83H 4IALA 1IYJB 3ETLA 4RCNA 3M4OB 1PJQA 3NVYA 4JYAL 3ETRA 4FWGA 3KHHA 3GLFA 4M9SA 1TS4A 3MXNB 3WU2U 1WTRA 4QJFB 1UHUA 1S3OA 3AV0A 2W9MA 1UE7A 1DGHA 2R18A 2DWQA 4I2JA 3KKAA 4Y2QA 1H9KA 1DGBA 1S5BD 3PCOB 2ALYB 3E21A 4D82A 1C20A 3RH5A 2CW0D 1EIGA 5BR8Q 5IT9c 1AUAA 1HNWL 4PDIA 3PO5A 2NVTB 5KFHA 7ICKA 1ENCA 1MGSA 4QZBA 2QDBA 3I4MG 3NS1A 3IECA 2CHQA 7ICGA 3NBHA 4R63A 3TBIB 4UB4A 5GAEC 2KJ9A <