2H5XA

Ruva from mycobacterium tuberculosis
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
195
structure length
183
Chain Sequence
MIASVRGEVLEVALDHVVIEAAGVGYRVNATPATLATLRQGTEARLITAMIVREDSMTLYGFPDGETRDLFLTLLSVSGVGPRLAMAALAVHDAPALRQVLADGNVAALTRVPGIGKRGAERMVLELRDKVGVAVRSPVVEALVGLGFAAKQAEEATDTVLAANHDATTSSALRSALSLLGKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Holliday junction ATP-dependent DNA helicase ruvA
publication title Structure of Mycobacterium tuberculosis RuvA, a protein involved in recombination.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Dna binding protein
total genus 43
structure length 183
sequence length 195
chains with identical sequence B, C, D
ec nomenclature ec 3.6.4.12: DNA helicase.
pdb deposition date 2006-05-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01330 RuvA_N RuvA N terminal domain
A PF07499 RuvA_C RuvA, C-terminal domain
A PF14520 HHH_5 Helix-hairpin-helix domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.10 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 DNA helicase RuvA subunit, C-terminal domain 2h5xA03
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 2h5xA02
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 2h5xA01
5KFBA 3RB4A 4AYBG 5L9XA 1EYGA 4B9VA 4DV3L 3HOVH 2KHHA 3HOWH 1J5EL 1VEGA 1YHAA 4ED8A 4A3FG 4X66Q 8ICLA 1SL0A 9ICTA 1HUOA 4JYAQ 3AU2A 2EJSA 2YTXA 3FRHA 2NVQH 3C2LA 5KG4A 2V4RA 4R4TA 1NK9A 2ZJ5A 2JZ1A 5JEAG 5J2HA 1CUKA 1HNXL 4J9RA 2JY7A 4IRCA 4UB2A 1SROA 1ZQPA 2AWNA 4RQ0A 4DR1Q 3RN5A 1IBKQ 1SFOH 3RJIA 4POFA 3EPIA 4J15A 2R92H 3QE9Y 3CCMA 5CJ7A 8ICIA 2UVVA 2HT1A 5KT2A 4YXMA 5KFFA 1ZQKA 3GDEA 3UXOA 5J0YA 2CP8A 4R1JA 2NVXH 2KZ3A 1NJWA 3ORYA 3S1RH 5KFWA 3M8SA 3GTPH 1L1OA 2LVAA 4DL5A 4MF2A 4GKJQ 2VW9A 2I1QA 1YLAA 1BPZA 1JE5A 3T6PA 2R8GA 9ICQA 1K83H 2K5NA 3V6HA 2BCQA 1XPRA 4BBRG 2JA7G 1XNRL 2OQKA 4C8LA 1V1QA 4LVSA 3AFPA 3T1HQ 4RT2A 1QZEA 2R8JA 1SMXA 4DR2L 3C23A 3B6YA 1TK0A 2PI5A 4DWIA 1EQRA 5IYDG 4OO1G 3OTOQ 2WTFA 1KXLA 1V43A 4JI1L 1QTMA 3E46A 1CKMA 1YJNA 5L1IA 5KFDA 1LYLA 3BZKA 3FRIA 4GN5A 3FKIH 2H5XA 3MR2A 4KITB 3OHBA 1D8LA 4O3PA 1SL1A 2BPCA 5H1SE 4MNOA 4BBRH 4JI6L 2JA7H 5J2GA 3RH5A 1QSSA 4Y52H 3GTQH 3C1YA 3KDFA 1GO5A 2UUAQ 4A3EH 1KAWA 1S0MA 4Y7NH 3I4NG 4K0KQ 4IPDA 9ICRA 3STBC 3PX0A 5IYDH 4DV0Q 3BQTA 4ECXA 4FBUA 2HVIA 3NENA 3LDAA 3M8RA 3PGZA 4DLGA 3HW8A 3FYHA 4KHPQ 3Q8DA 1QUQA 2F1HA 5J0PA 3M9MB 1XMOQ 4CCHA 3UXNA 4GC7A 3CQZH 4H02A 1DV0A 2KFNA 2AMCB 4Z6CA 4FO6A 4TUSA 3UPQA 3ZJYC 1E7ZA 3PUWA 3GIJA 1WCMG 3S1QH 1PH7A 4XQ8A 4JI2Q 1VEKA 1VQHA 2K0BX 5J2BA 4C3JH 1DO2A 1B22A 1U45A 4DUZQ 4TQSA 4YWLA 5IT9c 5IIJA 1NMGA 1VS0A 2JA6G 1VEJA 3TQYA 4DOAA 4LZDA 3JPNA 4B9UA 4NXNL 4YR0A 3JPOA 1VQ7A 1WGLA 1W2BA 1D7QA 1HZBA 4DK3C 1ZMUA 1E3PA 3G4SA 2QSFX 4O0IA 1ZV1A 4HIMA 5DQIA 2JY5A 1EFUB 9ICCA 3GTLH 1VQOA 1IYJB 4B3TL 2YYZA 1CEZA 1PH2A 3HOUH 5KG1A 4I29A 4O3RA 1KFDA 3KFUA 1KYIA 4GXJA 2WFWA 2JA5G 4GOPA 3BQ1A 2XGTA 4J9OA 4DV4L 2DNAA 3V6JA 2QHOB 2A1AA 1B43A 2KZZA 4RQ8A 4YR3A 4F92B 2EXDA 1U49A 4RPZA 4ELUA 4ED6A 1XS9D 3A5UA 3RJGA 1ZQUA 3PW4A 1ZQRA 3TS0A 3A0JA 4I2DA 5KFIA 1YJ9A 4DSEA 2DPIA 4IQTA 1YIJA 5KFTA 1Q81C 4O5EA 1EXNA 3C5GA 1IM4A 4ELTA 3K80C 3T1YQ 1L1OB 2PFNA 2LXKA 2R7DA 3HFZB 5CWRA 1XSPA 3OW2A 1KRSA 2DUDA 2UXBL 3AQQA 3LCUA 1VQ8A 4EEYA 3CCUA 4RQ6A 3H0GH 3ZDBA 2XCAA 3BJYA 2R0IA 5JUMA 4UPAA 2PXIA 5IE8A 4NLZA 1FGUA 4NXML 2FPLA 1NKEA 4ZH4A 1L3UA 5J2FA 8ICFA 9ICPA 4IOAA 2JEJA 1JX4A 1IZ6A 1PZNA 1RL2A 4Q8EA 5DLGA 4DL4A 2NN6I 2CQOA 1HR0L 1MSWD 1YITA 9ICAA 3KHHA 4QZIA 4A75A 2W9BA 4EBCA 3KDFB 1JJGA 3S16H 4BY7G 1NJZA 4WP2A 1U4BA 1JMSA 4JI0Q 3M4PA 3ZDAA 4B3MQ 1ZQIA 7ICSA 5IP7H 1MKHA 3ER0A 8ICJA 2MQHA 3S2HH 1VQCA 1M90C 1ZQYA 1CKNA 5L1LA 2NRVA 1TWHH 5C5JA 3IRBA 1FJGQ 4TQRA 3JPQA 5DG8A 1ZQLA 1XSLA 9ICUA 1TVAA 2Y0SE 1DO0A 4B3SQ 3GQCA 5HHHA 5K36G 4IR9A 4JBMA 2UUBL 2BA0A 5CA7A 4JOIA 1S77D 2MUTB 4PHEA 4DAMA 4IPCA 1P16A 5C0XJ 2W8LA 2B21A 1HJPA 2JE6I 4ED0A 4DR7Q 1YEZA 4IRKA 1BPEA 1HNZQ 4F5PA 2ZJQA 5EAYA 1VG5A 2DAGA 2EQSA 2UVWA 5IILA 5LMUQ 3M7NA 2JEBI 4GNXA 1UFZA 1XNQQ 5KFAA 2BR0A 4WJ3M 4C8MA 3RBEA 1C9OA 4XUSA 2OOBA 4OXPA 3PO3G 2FMQA 3ULPA 2ATLA 2BDPA 3GLFE 5CP2A 4YHHL 8ICXA 2W8KA 4LF9Q 3Q8MA 1BBWA 1L5UA 1D9DA 4RQ3A 2OOAA 1X54A 1U9LA 4MEXA 4LFBL 3RBDA 3CD6A 3PIOA 4UY8C 4JI4Q 1L2FA 3A5ZB 4KLUA 3CCJA 2B3TA 2VZAA 4C8NA 1PH4A 4DV7Q 2KN7A 4OX9L 1TAUA 9ICSA 5IINA 1SKSA 4KLLA 3CPWA 1WGNA 3LWLA 4X62L 2WB1E 4XA5A 5KT5A 4PHDA 3H15A 4F2LA 4NB3A 1KHIA 2F52A 3PO3H 2F4VQ 2KCMA 7ICOA 4F5NA 1BBUA 4K4GA 4EYIB 2VS1A 2IT1A 1EIYB 4BDPA 2E2JH 1OXSC 4QWAA 4BWMA 4LFAQ 2UXCQ 1RYRA 2BWBA 4P71A 1YI2A 4J9MA 4HJ7A 4A76A 4RQ5A 5BR8L 1MIUA 4M9JA 2KFZA 4IQUA 4UBCA 1JB7A 3GV8B 1VCIA 4UQGA 3EZ5A 4JG2A 4HIKA 3PIPA 1C0AA 4PGXA 1RIPA 1XXHE 1T3NA 2BCUA 2DAIA 3PO5A 4JV5L 4A3IG 3PY8A 4P4MA 4P75A 2HHHQ 1R9TH 4P2HA 2FMPA 2MR9A 4A3KG 3FDSA 4QIWE 4ALPA 5KFOA 1ZMWA 1X9NA 3IHQB 1I50H 2ASJA 3S14H 5J0OA 4PMWA 3CCEA 5KFXA 3SYZA 1NBWA 4O5CA 3CCLA 3FP9A 4O3SA 4L5RC 1Y1VG 9ICWA 2WB1G 5M3FG 2DAMA 5KFMA 2R8HA 2D0PA 1WHCA 4GXIA 3K7AH 2PI2A 4LUZA 3NGDA 2W9BB 3EYZA 5DBCA 3A74A 4LF8Q 4DV5Q 4X65Q 1PH8A 4R63A 4A3IH 3PV0A 1G6PA 2IA6A 1HZCA 1YHBA 5KG5A 5J2EA 3MGIA 2BQUA 4YG2A 1EUJA 1KRPA 4X66L 4A3KH 2K14A 4JYAL 1X2IA 3H40A 1S40A 4M9GA 4IPGA 2PMZE 4A3LG 3PUYA 1QVFA 3MDAA 2CKZB 2K5VA 3N4MB 3IECA 1XU4A 1OTRA 5GADC 1NK8A 2CFMA 4KN4A 4KLMA 1Y1VH 2ZUCA 4DFPA 4IRDA 3MEFA 3OJSA 5KT4A 1NY4A 1HNWQ 3RN2A 4JWNA 2RRUA 1GVPA 4DR1L 1IBKL 3EPGA 4UB4A 3PW7A 4UP7A 4X6AH 3MXNB 3ETLA 1R4GA 2PFOA 1HR0W 2NVTH 4RU9A 2XTIA 5J2DA 4R8UA 4LF4L 4I2IA 1AROP 1OKSA 2IBKA 2ISPA 4GKJL 4RUCA 4A3LH 3RAXA 3RJKA 3NTUA 1X6OA 1B70B 1XMQQ 2IHMA 3BBZA 2RF4A 4PG3A 3AYHB 1IL2A 2HHQA 2DFLA 4F4YA 4YCWA 3LCVB 1HT1E 3T1HL 3UE1A 1EQQA 5IY0A 4JI3Q 4GN3B 3CW2C 1K3RA 1FL0A 1MJCA 3U58A 4GNXB 4IFDG 1COOA 3VDYA 3OTOL 4OWTB 2MJ5B 5BOMA 2UUCQ 1S97A 1LV5A 1S0OA 4LF7Q 3GDXA 9ICIA 2N8NA 3TFRA 1VQEA 1ZQVA 4IQWA 3HOZH 3W5OA 5DG9A 4KLHA 3GIMA 2UVRA 1DOQA 4RT3A 2NVYH 1IXRA 1Z47A 1ZQDA 3UDXA 3RJFA 4A3MG 3MMPA 4GN4B 1RZTA 5F9LA 5D4BA 2UUAL 2DPJA 1X3FA 8ICUA 4XIGS 4K0KL 1UE7A 2F1JA 4OO1I 1Q02A 1P8LA 4DV0L 4DL7A 2XY5A 1E1OA 4O2DA 4QL5A 5JI2E 4G3OA 3U4ZA 9ICOA 3PUVA 3JAMc 3CMAA 1N34Q 2PFQA 5DGAA 4QY7A 4KHPL 3W1BA 1OXVA 5JJLA 1XMOL 3HKZG 3K7UC 4JK1A 1KFTA 1BGXT 4RPXA 5J0UA 1XWLA 2PI2E 2HHSA 4UP9A 4DR3Q 1TV9A 5F9NA 3V6KA 2B29A 2HAKA 4JBJA 2LVPC 2KENA 2FMSA 1LTLA 4JI2L 7ICVA 2AJQA 2Z6KC 1HH2P 3M9OB 2NRWA 4BGDA 3K9PA 3H7IA 5KT3A 3EN2A 4DUZL 1YVCA 4JV0A 1VQKA 3MBYA 8ICSA 3GIKA 1ZJNA 8ICWA 3PMLA 1SZPA 4A3FH 3UXPA 3PV8A 5DBAA 1S72A 3MR6A 4QZAA 4QWEA 4YY3Q 4HEOA 4JUZA 5E7NA 3ULJA 3NBHB 1KFSA 3KJOA 2LYHA 3GILA 2ALYB 3F1ZA 4ECUA 2K4KA 1PH1A 1TWFH 3S17H 2MNAA 1O7IA 4B9SA 9ICLA 3K4GA 1TWCH 4I27A 1ZQQA 2C2DA 1KRTA 1KEJA 3I4OA 3Q8RB 3E21A 2LXJA 5EWEA 1OQYA 7ICNA 1UT8A 1T9HA 1KTQA 2J6SA 2BHNA 3V72A 2C2EA 2HW3A 3KF8B 2L4FA 4LW1A 3SV4A 4BY1G 4LUVA 3QEAZ 4QZHA 5HGQA 4J9PA 4A93G 1UEBA 3OGUA 3SZ2A 3SGIA 2I5HA 1N33Q 4UBBA 5HMMA 3CXCA 3G6VA 4YXJA 4KLSA 4ME3A 1AE2A 4F93B 8ICZA 4X5VA 1NJXA 1CSPA 4R8UB 1GD7A 5D46A 3T1YL 5C4XG 4BWJA 3WWVA 2M9NA 5CHGA 3PUXA 3H8WA 4BY1H 1PYBA 1T7PA 5HMLA 2Q2HA 3I4NH 2D62A 2MUTA 4IR1A 4M9HA 1UE1A 3I2ZA 5DQHA 3KJPA 3EWAA 4PZ8A 2HHWA 4JI5Q 1IBMQ 1WYDA 5DB9A 8ICHA 4GLXA 2W9CB 3GTJH 2L2DA 4R64A 5KG7A 3ERSX 1Z00B 2EKKA 4O0AA 2JZ0A 2ZTCA 5C4XH 1PA6A 1VQ4A 2OQ0A 4LWCA 2HHVA 1HT2E 5D49A 8ICMA 1WCMH 2R8KA 3K0XA 5DBBA 3HOXG 1YHQA 4B9LA 1TXYA 4J9LA 3ULLA 4C2MH 2JA6H 4Q44A 1Y14B 3DLLA 5AJ3L 4RNMA 4DSIA 3S2DH 4MFFA 1S3OA 1ZQCA 4IJLA 4JI0L 2UU9Q 1Q46A 4FBTA 3HPOA 4B3ML 2JEAI 2PQAB 3C1ZA 2BPFA 2E5LQ 4GLVB 4JWMA 4DV2Q 1X9MA 1NJIC 3CMEA 4ECTA 5KTQA 1FJGL 2P6RA 2MFIA 5J3BA 4YMMA 4DQPA 4YCVA 4B3SL 5FJ8G 1JIHA 5J0WA 8ICAA 3RZOH 1KDHA 1K73C 2JA5H 2VA2A 2K50A 1PV4A 4DF8A 4L5QA 3B89A 4YCXA 2AHOB 3E0EA 1PGYA 4POGA 5J2IA 2XCPA 4L5SA 4DR7L 2J6TA 3GO5A 1X3GA 4RQ1A 3STBD 3S15H 4A4IA 1FVIA 4OONA 1L3TA 1VQ9A 5IYBG 4KLFA 8ICVA 5IYCG 1ZQXA 5LMUL 3ZDDA 4DQQA 2JP7A 1ZMVA 5KFJA 4GC6A 2JNHA 4F91B 1XNQL 1MQ3A 4B3RQ 4G3IA 1JN3A 4YN4A 4TVAB 3PW0A 2N78A 2IMWP 3PO2G 3PW2A 2OCEA 3CCRA 4DR4Q 2OTLA 4KMUA 2IHFA 3F2BA 2ZUDA 4I2GA 1I3QH 2NZHA 4LF9L 3NEMA 1RYSA 4UN2B 4ED7A 4KLGA 8ICKA 1WJ7A 4F4WA 4B9TA 2JA8G 3LK9A 3SI8A 2IX1A 2CWBA 3H8JA 3JAMi 2E2IH 5IYCH 4JI4L 5DQGA 7ICMA 9ICGA 2P66A 2CWAA 1NV9A 7ICKA 4C3IH 1VQGA 4DR5Q 1TWGH 4DV7L 2VY3A 2DAKA 2L15A 1ASZA 3MDCA 2YU9H 1OTCA 4I2HA 1A76A 2BKEA 1S76D 2ZM6Q 2F4VL 1PH6A 1XTDA 4QZDA 1TFRA 3CAMA 4GKKQ 3HWTA 4QZBA 2QGQA 1G4AE 1K8GA 1YZ6A 7ICPA 3CCVA 2I0QA 3LWMA 1ZQAA 1G51A 1IBLQ 3JPPA 4LFAL 1Q7YC 2UXCL 4A3JG 1NMFA 4DAYB 5IWAQ 2JJQA 2A1JA 2JEIA 1XC9A 3U4VA 3H4BA 3E2EA 5J0SA 3OSPA 2BGWA 4M2YA 4P72A 3ZDCA 1EWIA 1ZQNA 2VL6A 4NLGA 3UQ0A 4F2RA 4BY7H 1S10A 3PF5A 2WZJA 3TANA 3LGJA 4C8OA 5J0RA 4MTNA 1SG9A 2HHHL 4P4OA 3Q8LA 1RPLA 4DFMA 3TI0A 4KLQA 3PW5A 4A3JH 2LTUA 4DBGB 7ICTA 1E22A 1K1QA 2BCVA 3K81C 3G48A 5DKWA 4YD2A 1NKBA 1J6QA 4LUOA 1AH9A 3PVXA 3S24A 5DB8A 2XY7A 3G6YA 2BH8A 3TFSA 4I2CA 4JI7Q 4PGQA 4ECYA 3FHWA 3JPSA 4Q8FA 5ELOA 4LF8L 4DV5L 1N56A 4X65L 5EWGA 1OAIA 3KOJA 5M5WH 2GWSA 1U47A 8ICNA 2F1IA 3AUOA 2BWEA 2DENA 1F4IA 4QZGA 1JJ2A 4QZEA 5IIKA 1ASYA 3RB0A 1GM5A 4MFAA 4UB1A 4UAZA 1GO3E 1JXEA 1MJEA 3PUZA 9ICFA 3I55A 4JV1A 5M3MG 5EOZA 1JT8A 4KLTA 3ZD9A 2NRTA 2R8IA 1B7YB 1HNWL 3Q8PB 2HIXA 2BQRA 4Q45A 4LF6L 8ICEA 2I5MX 4A3GG 1N36Q 2JEGA 4DV1Q 3KHLA 3GTOH 4X64Q 4DR6Q 5JEAJ 1YNXA 4HJ8A 3V7KA 1KIXA 2Q2UA 2CWPA 3S1MH 3M4OH 2IHEA 1X65A 3S1NH 2KCTA 2KNVA 4PGYA 2QEXA 3J80c 5M3MH 1XMQL 1Q12A 4DUYQ 1XPOA 3QEBZ 4QZ9A 3GTKH 3GLIE 3OSNA 8ICCA 1NOMA 8ICYA 4R4QA 2VUMG 3H3VI 3J7A5 1EOVA 4JI3L 1N32Q 2PNHA 1VQFA 1L0WA 7ICIA 2EKFA 3BQ2A 4M6WA 2K9DA 2UUCL 1XJVA 7ICGA 2VQFQ 4LF7L 3QZ7A 1HZAA 1NV8A 1I5FA 2XO7A 4KHZA 5J0XA 3M9BA 3RZDH 4JI8Q 4EQ5A 5J0TA 3KF6A 1VQBA 2B63G 4EZ9A 1TKDA 4YD1A 2VUMH 4F5OA 1ZQSA 2YTYA 4IFDI 8ICBA 1VQIA 3RJHA 1HQYE 4MZ9A 5KFPA 3E9IA 4J9KA 1RXVA 4UAYA 2VNUD 9ICEA 2RDJA 1X9WA 4LF5Q 1I94Q 2B63H 2VA8A 2AGOA 2D0OA 3G6EA 3MABA 2DAEA 4DR3L 3GTMH 1PYSB 5M3FH 2RDIA 3ZD8A 5DGBA 1UA0A 2A1JB 3RJEA 1P3QQ 3PMNA 4DO9A 4DQIA 2MO1A 3K8AA 3OJUA 4IOCA 4YWMA 4A3BG 1SN8A 8ICOA 7ICQA 2ZJRA 4LFCQ 1YJWA 3GD7A 4IPHA 1E94E 9ICKA 1UWVA 2V1CC 1UA1A 5J2JA 1ZQGA 8ICQA 2ZJPA 1XPUA 3C5FA 2P6UA 4YY3L 3GTGH 1NTGA 2ES2A 2KHJA 3AFQA 4M04A 3HKZE 4YWKA 1VQ1A 2VA3A 2W9MA 3IM1A 4I2EA 3H3VH 2I5LX 3TRZA 2W9CA 1VQAA 4MEYA 4A3BH 1MC8A 5C44G 1Z00A 5LMNQ 3H4JA 4RG1A 4I2JA 2KHIA 3JC66 5C0XG 3BU2A 5KG6A 4QZCA 2LBCA 4KTQA 3UDGA 2KBNA 1SE8A 4AQYQ 3KYHC 4RZRA 2LVOC 1T43A 4M47A 9ICBA 1KQSA 1VQ5A 4EBDA 4C3HH 2FPMA 2V9WA 1A0IA 2ALZA 1PFSA 2KTQA 3KHRA 3HOVG 3HOWG 3HX0A 5DG7A 4OWXB 2R6GA 3H4DA 2Q2TA 5CB1A 5GAGC 4I2AA 3J81c 4QZFA 3KHGA 4YP3A 4E0DA 2WAQE 5C44H 4O5KA 3CC7A 4DFKA 4GS3A 1N33L 3MFIA 4HJ5A 3MGHA 2PQAA 2OWOA 3GV7B 3G71A 3CC2A 4P74A 4EBEA 3I7FA 2OO9A 2DHYA 5IIOA 1S0NA 2UXDQ 4BA1I 4DV6Q 1G291 8ICTA 5HHIA 4TUQA 5KT7A 2R92G 2ASBA 4A3MH 5KG2A 1X56A 3V7LA 3TS2A 1ZQMA 4AH6A 4DQSA 3BJUA 5J2KA 5HP4A 7ICLA 4ECWA 5DFLA 1TR8A 1BPDA 2AKWB 4A3DG 1X9SA 3TQ1A 7ICEA 2C2RA 4GEWA 3RR7A 5M5XH 4BA2I 4F5RA 1QVCA 1QZHA 4JI5L 3SV3A 3PNCA 1IBML 2JA9A 3NELA 1VQMA 2LVNC 4M6WB 3N97B 1IM2A 1BKBA 1K8AC 1PH5A 3AEVA 5EWFA 5KFEA 1UE5A 3E9HA 5KFUA 4R65A 1TK8A 3T5JA 5M5YH 4ED3A 4R71A 4YR2A 4KLIA 3KF6B 3L2PA 4GOPC 2FXQA 2OTJA 4IJHA 4A3DH 2I9GA 5KFHA 2WAQG 1NK5A 4LF4Q 9ICMA 3FKIG 1NJYA 3D0FA 2L4EA 4KLJA 1IFYA 3MR5A 3OHAA 4UB5A 4KI0A 3C21A 2Y1JA 2UU9L 2FPKA 1T6OA 3TARA 3PSIA 5KFCA 3RR8A 2E5LL 3AU6A 4A3EG 4DV2L 2AGQA 3I56A 3OYYA 1XB2B 1TAQA 1B8AA 1AE3A 1V9PA 5LMNW 4M9LA 5IIMA 4TURA 4ECVA 1NKCA 2IX0A 5FLMG 3IHPA 3RAQA 3J80i 2C28A 1PHJA 1ZQOA 4J9QA 4APVA 4HYKA 5GAHC 2CCZA 1XO1A 4NPSA 2HWJA 1XSNA 4YMOA 1PH9A 4PPXA 1Y88A 2JZBB 4F4ZA 5JJIA 4KLDA 2BA1A 2VQEQ 4DL2A 3GV5B 1U0LA 4DSLA 1JR3E 4DV3Q 2E8GA 1Q86C 4YMNA 2MROB 5DDMA 3TAQA 4GLAC 4UP8A 4JV2A 1J5EQ 2R7FA 1NK7A 2XGPA 4BXOB 2XY6A 5FLMH 5KG3A 5DB7A 1BPYA 4TUPA 4ED2A 4A93H 4B3RL 4DS5A 4PHPA 9ICVA 2ID0A 5KT6A 4R4OA 1U5KA 4DR4L 3TEHB 1D9FA 1HNXQ 2EIFA 4NLNA 1W3SA 4Z6EA 4I2FA 3T5KA 3UQ2A 3Q8SB 4K4IA 3ISBA 2IHNA 2RHQB 3PF4A 3HOUG 2JK8A 4WJ4A 4DR5L 3GLGE 1ZQHA 2BH2A 3HKSA 2Z6KA 3RRHA 4P4PA 1WOCA 1AIPC 1X55A 4XRHA 1ZQBA 2JEFA 2ZM6L 2ZTDA 4QW8A 4GKKL 4TQUS 5HY6A 3RB3A 1XNRQ 4DOCA 4Z6DA 2NRZA 5C4JH 1IBLL 4DR2Q 4JOIC 1WCLA 5IWAL 5BOLA 3HOXH 4JI1Q 3Q8QB 5L1JA 4DKAC 5FLXc 4ED1A 4F50A 1E24A 5IP9G 4HJ9A 1ZQFA 2JUJA 4F1IA 2R7ZG 1N9WA 2F3IA 2ZTEA 1BPXA 2DGYA 1A63A 1TWAH 4RNNA 1LUZA 4JI6Q 1ZQTA 3EIVA 4A3CG 2ZUBA 4M0AA 3HOYG 3QZ8A 1CSQA 2R93G 1Z3EB 5KFLA 1JMCA 3V7JA 1KL9A 1HNZL 3PR4A 3HP6A 2HVHA 4GNXC 4EZ6A 3H0GG 5JJKA 1T8EA 1A5TA 7ICJA 4O3NA 4QWDA 4RUAA 3PO4A 4JBWA 1ZJMA 5DDYA 2BCSA 4DPGA 3RH4A 5KG0A 2AWOA 2B3GA 5IP9H 5FJ8H 4RPYA 1YBYA 1L3VA 3KTQA 2RHSB 4JI7L 2R7ZH 2IY5B 4QWBA 1T4GA 3Q8KA 4A3CH 1OXTA 3HOYH 4O3QA 9ICNA 4R66A 3JPTA 3J81i 2R93H 2K52A 2A8VA 1VDLA 4DSKA 3EBEA 4K4HA 1KD1C 1WR1B 5HNKA 3B0YA 1WFQA 5IYBH 4HIOA 1OXUA 4NXZA 1QLNA 2DKLA 3PX6A 4BBSG 1NE3A 3T5HA 4F2SA 1L3SA 4R4CA 3U50C 3I4MG 2XGQA 4NXNQ 3RB6A 4FDBA 1WI5A 1BPBA 1S9FA 4GXKA 3PO2H 5IP7G 8ICRA 3UDIA 1V92A 4DFJA 1N36L 3THVA 1SLJA 4C8KA 4DL6A 1Y8GA 4DV1L 1D8YA 4BXXG 4X64L 4DR6L 3F2CA 4B3TQ 5J29A 2JA8H 1Q1BA 4NM1A 1N8RC 4BBSH 3PCOB 1S0VA 4JCVE 4XTCS 7ICRA 1VQDA 1SRUA 2HHTA 4DUYL 2C22A 3I4MH 5AJ3Q 4DQRA 4PH5A 2Q2IA 3CCSA 3M4QA 4YCUA 1DGSA 4DV4Q 2GVAA 3J7ZC 4EX5A 1TTEA 4B9NA 1N32L 1GKHA 4DOBA 1EIFA 4DSJA 3CF5A 2O25A 1VQ6A 1QUQB 4IQVA 4F4KA 4P73A 1NK6A 4BXXH 1VQJA 1JJCB 2VQFL 8ICPA 4DF4A 3GFKB 7ICHA 2AGPA 4JC0A 1ZQJA 4YQWA 4IO9A 2N49A 4JI8L 2GVBA 4MFCA 5DB6A 4IFDJ 4KLEA 4O9MA 4YFKA 4QW9A 4NY8A 9ICXA 4DEZA 4L5TA 2LVQD 2Z0SA 2HHUA 2KNZA 2A19A 3C2MA 1A8VA 2YTVA 3RTVA 3KLWA 2BQ3A 1C7YA 1K0RA 4NM2A 3L0OA 2JQOA 2UXBQ 2V4QA 2WP8J 4KLOA 4FS1A 2W9AA 3F92A 3PR5B 3GIIA 4Q7JA 1ZYQA 1VQLA 2NN6G 3CPFA 4PZ7A 1HZ9A 4F4XA 4O3OA 4DNIA 1I94L 4LF5L 5DLQE 4QQBX 4R4IA 1MQ2A 1HUZA 4I28A 2HHXA 2KZMA 2FLLA 2BPGA 4NXMQ 1Q82C 7ICUA 2Q0ZX 3HT3A 2QA4A 9ICJA 4ECSA 1NK0A 1K1SA 3F8TA 3B0XA 4MF8A 5J2CA 4GOPB 4DLEA 3M9NB 2J6UA 5KFGA 3J81j 4OWWB 3ISCA 1A62A 1Z9FA 2Y0SG 1KC8C 4LFCL 2ISOA 3JPRA 4LZGA 1HR0Q 4PZ6A 3EW9A 3TAPA 3C2KA 3BZCA 2HQLA 1G41A 1RXWA 4AIMA 3MFHA 4J9SA 3RH6A 1M1KC 4M9NA 3CCQA 4UB3A 3RLNA 3D31A 3UE0A 2QNJA 4DL3A 1OXXK 4DK6C 2MAXA 1JXLA 3CC4A 1BVSA 1H38A 4QJFA 4A3GH 3G6XA 5DLFA 2KNAA 3CP0A 5LMNL 4UAWA 5IIIA 4KN7A 2ATWA 1WCNA 3T3FA 1E1TA 9ICHA 2UVUA 4JBKA 2GN5A 5KFSA 8ICGA 3ZDEA 5KFKA 4AQYL 2C35B 5J2AA 1ZETA 3RJJA 4F5QA 3MR3A 2UUBQ 4HJAA 1QVGA 3RLFA 2VANA 4HIDA 5KFZA 4ECRA 1Y1WG 3K75D 2K75A 5J0QA 5TZVA 2MGWA 4FS2A 4LNQA 4ECQA 3PX4A 1PH3A 4F8RA 3BQ0A 5KFRA 4EYHB 3H8SA 1KSPA 5C0XI 1QSYA 1K9MC 4B9MA 1N34L 1G3IA 3F2DA 5GAEC 1ZQWA 2UXDL 4DV6L 4KLKA 1IXSA 4RNOA 2FLNA 2XC9A 1UE6A 1X3EA 2RCNA 1WIVA 5GQOA 3M3YH 3FE3A 1Y1WH 4ELVA 1WJJA 5KFYA 2ASDA 1L1OC 4YHHQ 2DI0A 1A77A 4NLKA 2N3SA 1SR3A 5C3EG 2LSSA 3RNUA 4LFBQ 2JZBA 1EFWA 4RQ4A 2AU0A 1SKWA 1CKNB 2ASLA 2ZJ8A 3L7ZC 4OX9Q 1SL2A 3ICEA 5BPCA 1VQNA 2ZJAA 1UT5A 4X62Q 2PI4A 3GLHE 4LF6Q 4BXOA 4PHAA 4AYBE 5L1KA 1ZQZA 2HIVA 3UDFA 4QGUA 1TK5A 3RLOA 3W1GA 3DM3A 2NZOA 2JY6B 1Q1EA 2MO0A 5C3EH 4QWCA 2BCRA 2PFPA 4DSFA 1NK4A 1QZGA 3HOZG 2NRXA 1KLNA 4RQ7A 3RR5A 2Y1IA 4YVZA 5BR8Q 1N48A 4F3OA 1QSLA 4ECZA 3RRGA 4DS4A 3T5LA 1ZQEA 1LB2B 3BDPA 2JY8A 4I2BA 1PVOA 4Z6FA 2K5HA 4J9NA 1H95A 1U48A 7ICFA 5KFQA 1CKOA 5ELNA 5KFVA 5CR0A 2AQ4A 5GROA 4JV5Q 5KFNA 4Q43A 3ISDA 3K9OA 4QZ8A 2AQ0A 2FLPA 1MN3A 4RQ2A 1Q8KA 2G3QA 1LM0A 3TREA 2E2HH 2YV5A 3M85A 2DZLA 1SKRA 2VQEL 1VQPA 4RMFA 1I6HH
chains in the Genus database with same CATH superfamily
5KFBA 4A3FB 4A3VB 3HOVH 3HOWH 4R8NA 3A55A 1TH2A 1PRTF 3M7GA 3AJIB 1YHAA 3J2PB 4A3FG 4X66Q 1SL0A 2EJSA 2YTXA 3FRHA 3NWSA 2NVQH 5KG4A 1KQQA 3IN5A 3WK5A 4IUVA 3EQLC 5J2HA 3U6LA 4JB3A 1SROA 1ZQPA 4RQ0A 2R92H 5CJ7A 1JCKB 5TSSA 4YXMA 4K0KM 5KAIU 2CP8A 2OPFA 4BBRB 3ORYA 3S1RH 5KFWA 3UMMA 3M8SA 1L1OA 4GKJQ 3T6PA 4KHPM 3M1YA 4NDXA 3TDQA 3V6HA 1XPRA 4BBRG 2OQKA 4G7OC 3AFPA 3Q6SA 1QZEA 5EJCA 3B6YA 4IBFA 4NSRA 4DWIA 1EQRA 3OTOQ 1DGHA 2WTFA 3E46A 2B2UA 1ONLA 1ZRNA 2QF7A 3BZKA 1AN8A 3MR2A 4E6IA 4KITB 3OHBA 1GUSA 3VR5A 1JQJC 1D8LA 4O3PA 2FJ6A 5H1SE 4MNOA 2JA7H 5J2GA 3C1YA 1GO5A 2UUAQ 3GTJB 2QCPX 1B9NA 3SHGB 3PX0A 5IYDH 4ECXA 5FSWA 4FBUA 3B7ZA 4GIPA 4KMUC 3FYHA 1CTMA 1WCMB 3K1JA 4ZUJA 5J0PA 1XMOQ 4CCHA 4H02A 3H4MA 5KO3A 4Z6CA 4A8EA 1EU3A 4C2MB 4TUSA 1E7ZA 4EX7A 3S1QH 1WCMG 1K82A 1PH7A 4JI2Q 3L3OC 5J2BA 1DO2A 4DUZQ 4TQSA 4YWLA 5IT9c 5IIJA 1PUZA 3JPNA 4NXNL 1VQ7A 1W2BA 4CISA 1ZOLA 3SAGA 1E3PA 1S5FD 5DQIA 1EFUB 1EEID 3GTLH 4K8IA 2YYZA 2ZAMA 1CEZA 1F9QA 1UPHA 3HOUH 1COKA 2A1AA 4RQ8A 3U9OA 4YR3A 3VYUA 5AK6A 1U49A 4ED6A 3A5UA 4FYDA 3SENA 5G3LD 1CRXA 5KFIA 1LV9A 3HRZC 5KFTA 1IM4A 1A0PA 4UDUC 4ELTA 2E2IB 3K80C 4RF1A 1PDQA 3IFTA 2O5JC 3TP6A 4B3MM 3AQQA 2WF7A 2YU9B 1VQ8A 2LFNA 1GUWA 3CCUA 4RQ6A 2KMDA 3H0GH 3JR4A 1QUSA 5KQDA 3D4DA 2KECA 3TADA 3I51A 2PXIA 1FGUA 5J2FA 9ICPA 5AK5A 1ZXIA 1IZ6A 1JX4A 2D3DA 5CBAE 3NS1A 3A42A 1L6NA 1NNUC 1CQFA 1HNZM 4QZIA 4J1MA 4EBCA 3KDFB 3S16H 1TKWB 1NNJA 3J80E 1V38A 4LJ4A 1JE4A 7ICSA 1L0XB 5IP7H 1MKHA 3ER0A 1D0MA 4FXDA 5AKZA 1E9SA 1EY7A 1FJGQ 4TQRA 1A6SA 1XSLA 1TVAA 1GUTA 3MJ5A 1LTID 2BA0A 1LACA 3Q23A 4M0WA 1P16A 1B0XA 1HJPA 1Z1VA 3HZXA 2JE6I 2R45A 2F4VM 2F3WA 4IRKA 3NPPA 3U6DA 3ETRA 1G71A 2DAGA 4LFAM 1HUMA 3M7NA 3QUQA 1UFZA 3HGIA 4WJ3M 5C3XA 3JR5A 4XUSA 5IGEA 4IIWA 3PO3G 3ULPA 2BDPA 2DN8A 3DOAA 5CP2A 2EY6A 1OFIA 1D9DA 2OOAA 1U9LA 4LFBL 4HLQA 3NVWA 4IURA 1IYVA 2B3TA 1PH4A 4OX9L 4OJOA 2AQ1B 3LWLA 4GC9A 1PVRA 3D2SA 7ICOA 4CDEC 4EYIB 1PK1A 2B39A 4X65M 4DAPA 2E2JH 3MXUA 1W5SA 3NTIA 1NSNS 4P71A 4HJ7A 2W54A 4A76A 3KOOA 5FTJA 1TQOA 5BR8L 2KFZA 1VCIA 4HIKA 2F0SA 1C0AA 1HNWM 4IUUA 1XXHE 2ZIWA 2TMPA 2BCUA 2DAIA 4JV5L 2X6LA 3PY8A 4A3IG 4P4MA 4P75A 3QYEA 2F4IA 4P2HA 2FMPA 2MR9A 5KFOA 1I50H 5J0OA 3CCEA 3CCLA 3FP9A 4O3SA 4ZKCB 4F87A 5KFMA 5EP1A 2WF8A 3LW5F 3C3LA 4GMQA 1RD9D 4LUZA 5DBCA 4LF8Q 2HDMA 1G2SA 4JI3M 3CRKC 1HZCA 3GTGB 2XH9A 3FUXA 2BQUA 3M6AA 1S40A 4LF7M 4IPGA 4HAEA 2Z3XA 2CKZB 3N4MB 1STEA 3P75A 5GADC 4KN4A 4DFPA 4IRDA 3MEFA 3OJSA 5E26A 1NY4A 3KFUF 4DR1L 1IBKL 2Y20A 4UB4A 4X6AH 1FYCA 3KOYE 1X66A 2KVCA 4LF4L 4EELA 5BN5A 4A3LH 1TS2A 1N34M 1X6OA 2F76X 1EQQA 5B5EU 1JI7A 1N77A 4GNXB 3VDYA 5BOMA 2UUCQ 2QBYA 2ZBKB 1S0OA 2DGZA 3GDXA 1KLUD 9ICIA 4A3MB 4NRVA 4ZLTF 1ZD5A 4Y2QA 5M5XB 5IT9L 4A3MG 5F9LA 2F0HA 2N35A 8ICUA 4XIGS 1UE7A 2F1JA 2BZFA 1Q02A 1P8LA 4MGKE 1PLFA 4DL7A 4QL5A 4O2DA 1O78A 4B9WA 1HA5A 2EJFC 3PUVA 2E74C 2E8PA 5IZ7D 2M0NA 4I81A 1OXVA 5JJLA 1CI4A 1A3VA 3K7UC 4JK1A 4RPXA 4UP9A 1TV9A 4XGIA 2K8CB 1LTLA 2Z6KC 4IBJA 1SXJB 3KOXE 5EXXA 1VQKA 5AKIA 1SZPA 4A3FH 3PV8A 3FEWX 5E7NA 1KFSA 1BCPC 1AEXA 2MP1A 1C8CA 2MNAA 1O7IA 3AOEA 2CXYA 1SV0C 3MWYW 2C2DA 1MA7A 3Q8RB 2PZWA 2DWLA 1FNUA 3FUTA 3VYTA 1T9HA 2G9HD 3I90A 1KTQA 4A93B 2XI9A 1D1KA 3K5NA 3V72A 2C2EA 3Q0AA 2HW3A 5KGUA 5HGQA 4J9PA 4A93G 2DL0A 3OGUA 1F9RA 4BLCA 3KSXA 4UBBA 8ICZA 4X5VA 1NJXA 2BE5D 2UU9M 3DWPA 4BWJA 5DAUA 2M9NA 5CHGA 3R3OA 3IFDA 1F5SA 2E5SA 3AKZA 1L7PA 2H1EA 3SHLA 3I2ZA 3QUCA 4JI5Q 3I73A 5DB9A 4GLXA 4IUNA 3GTJH 2KHVA 1EYDA 4HCEA 1N75A 3ERSX 1Z00B 1SZHA 4OVZB 5C4XH 1VQ4A 3I76A 2OQ0A 4AI6A 1HT2E 2EDUA 1WCMH 2R8KA 3K0XA 4G6ZA 2KE7A 3ZYYX 4J9LA 2JH1A 4C2MH 4Q44A 1Y14B 4US8A 3S15B 1BBXC 4JI0L 3T53B 3HPOA 2E5LQ 4C4TA 5KTQA 2GQFA 2P6RA 1DM0B 2R7ZB 4B3SL 1Z5AA 2R65A 5FJ8G 3L5KA 1TDZA 3SAWA 1NR4A 4LCBA 3TQSA 5F3XB 1KFVA 2HBMA 2IJ0A 3E0EA 5J2IA 2P5ZX 4DR7L 3GO5A 3FAHA 3STBD 5ALIA 1K3XA 1VQ9A 1ZQXA 5LMUL 3L27A 1ZMVA 3U60B 1K28A 5IWAM 1XNQL 1MQ3A 4B3RQ 1JN3A 4CJ2C 1L2DA 1GOZA 3AL0C 3PW2A 4L8JA 5EP3A 2IHFA 3F2BA 2KXEA 4I2GA 4LF9L 3KP0E 4ED7A 8ICKA 2HUGA 1IKMA 3H8JA 5ALJA 2E2IH 5DQGA 2P66A 4DR5Q 5ELDA 5HR6A 2L15A 2YU9H 4MGZE 1XTDA 4JI7M 1TFRA 1G4AE 1ZQAA 1IBLQ 1VLBA 2UXCL 2VB3X 2C96A 1RHPA 1QQ6A 1ZAEA 1NMFA 2JJQA 1DXSA 2F0IA 2VIXA 2BGWA 2F5NA 3K92A 1EWIA 5ALLA 1ZQNA 7CATA 1S10A 3LGJA 2PNRC 1NVMA 2HHHL 2ZXRA 3A56A 3NHHA 1N36M 2LWXA 4DFMA 3TI0A 4DR6M 1E22A 1GKIA 4YD2A 1NKBA 1AH9A 3PVXA 3S24A 3G6YA 3SAVA 5C5LA 2YFQA 4I2CA 3FHWA 1NCVA 5AM1A 4DV5L 5EWGA 1Z6TA 4LJ6A 4LJZC 1D2BA 5AI8A 1OAOC 3AUOA 2DENA 1Z59A 4N8X1 5IIKA 2VQFM 3RB0A 4UAZA 1GO3E 1V8QA 9ICFA 1Z6HA 1MBYA 4CDCC 1TAMA 2BQRA 3HJEA 2FI1A 2JEGA 2FNAA 4PDGA 4HJ8A 3V7KA 2Q2UA 3GPUA 3L2AA 1SXJD 1X65A 4WJ3B 5IT9S 5M3MH 1XMQL 1Q12A 4FFDA 3QEBZ 1NI3A 1YZ7A 4PDIA 5CV4A 3MXPA 3W0FA 2VUMG 3J7A5 3L29A 2Q4TA 2K9DA 1B3QA 1I4XA 1HXYD 1SXTA 4KHZA 3M9BA 4LFCM 4LJ7A 5GTHU 3NBHA 1CM9A 1TKDA 3HU2A 5FLXS 2EAOA 1FIQA 2R4EA 2K1BA 1IL8A 2YTYA 1WTHA 5KFPA 3QAUA 1R2ZA 3E9IA 4TKOB 5CR3A 3L3FX 2OH2A 1TGUA 1Y69U 3GPXA 2J0TD 5FO9B 3GPPA 3BOSA 5KL8B 2DVWB 2EY5A 3KF8A 2J7ZA 1EY8A 2DAEA 4DR3L 5D3IB 2FHTA 1UA0A 2A1JB 2RSOA 3RJEA 4DQIA 3KD3A 3OJUA 5E6JA 1STAA 4K5XA 4FXGC 5AK4A 2VB2X 1E94E 9ICKA 1UWVA 5I2YA 1D5ZC 1BCPF 4LGMA 2P6UA 4YY3L 3GTGH 1NTGA 4M04A 2I07B 5ALNA 1SNMA 5ITTA 3TRZA 5ALDA 5ITYA 1VQAA 2K5QA 1I6HB 1MC8A 5LMNQ 4RG1A 3WK4A 4QZCA 3UDGA 1E2VA 1GJSA 2QLTA 4M47A 1KQSA 1SXJE 3TWKA 3FYDA 2FPMA 3NTKA 1STHA 2ALZA 4BB9A 4C4SA 4HSVA 4OWXB 1JR3A 3OIPA 5CB1A 2QP9X 4QZFA 4YP3A 2F8KA 4AYBB 3CC7A 1SNQA 5JU5A 2ZXIA 3GV7B 2JXJA 3CC2A 4G57A 2JR5A 4K5VA 2H3IA 2OO9A 4A3DB 2UXDQ 4DV6Q 3GTPB 3E0JA 4A3MH 3V7LA 3TS2A 3BJUA 3RFWA 2EVBA 5DFLA 2AKWB 1K83B 4A3DG 3TQ1A 1X9SA 4BA2I 5M5XH 5K4LA 1QVCA 2HBJA 3U61B 2A6ED 3KKAA 1BOSA 1IBML 2JA9A 4FXKC 1F77A 2LVNC 1K8AC 4ZK9B 1PH5A 1MHWC 5KFEA 3E9HA 1TK8A 2NO5A 2Y0SC 4R71A 3HJSA 3J7AF 2FXQA 3A8JE 3DM1A 1RDFA 9ICMA 3I8ZA 3SR1A 2L4EA 4A3EB 1TF0B 1QCBD 1G59A 4ABNA 3QO2A 2FPKA 1T6OA 1FR3A 3RR8A 3AU6A 4A3EG 2AGQA 5JJZA 1SMYC 5LMNW 5IIMA 3KVWA 2DWMA 1NKCA 2DZOB 3J80i 2C28A 1WG8A 3SC3A 4HYKA 2AQ2B 5GAHC 2L55A 3L26A 4NPSA 3DV9A 2CHVA 5CV5A 1PH9A 4PPXA 1RCVD 2FFKB 1WTPA 4KLDA 1V1OA 4DL2A 5A0LA 4DSLA 4DAYA 3QG1A 2E8GA 3U9SA 4R8IA 1Q86C 2ZT9C 2PPBC 5DDMA 3TAQA 4F7XA 1NK7A 2WB1C 2QKIC 1ZQ1C 4ED2A 4A93H 4DS5A 3SK8A 4KTAA 1ZEQX 2G8LA 3D8GA 9ICVA 3BYTB 4R4OA 1U5KA 4DR4L 4NLNA 3MHVC 4Z6EA 1K3BC 3KS8A 5AI0A 3UQ2A 3I4LA 3ISBA 4LZZA 2RHQB 2KKPA 1SNDA 2F77X 1B4OA 1ZQHA 3T51B 2BH2A 4LJ9A 3HHZA 3KDSE 2ZTDA 4IZ8A 2F8LA 1FFUA 2Z8YM 4GKKL 5HY6A 3LQQA 3QOJA 1Z5CA 2F44A 2RA4A 1LTMA 4JOIC 3KBBA 1IN7A 1SB3C 4JI1Q 1LKYA 1E24A 5IP9G 2OHFA 4HJ9A 4RQNA 1SYEA 2D5DA 2XICA 4NXNM 1N9WA 3DEPA 4RNNA 4RCOA 3EIVA 2ZUBA 4ME5A 3QZ8A 2R93G 1Z3EB 2HVHA 1T8EA 1O7LA 4RUAA 2A3VA 4JBWA 2HBLA 1VDDA 4DPGA 2AWOA 5KG0A 1G2TA 5FJ8H 2A68C 2ZXOA 2R7ZH 2IY5B 4A3CH 2I7PA 9ICNA 4R66A 1KABA 2JH7A 5GKNA 3B0YA 2NTTA 1OXUA 2KHQA 1HRJA 2XIWA 1DOKA 1NJGA 1V92A 2SOBA 4QNLA 3R9KA 4BXXG 2DBYA 3F2CA 1Q1BA 5AKEA 3I72A 1EZ6A 4JCVE 7ICRA 1VQDA 3FDTA 3N7SC 3GQ5A 3J7ZC 4GC5A 4B6JA 1LTGD 3CF5A 1VQ6A 2ZIXA 4H7BA 4P73A 1B3AA 1JJCB 4DF4A 3RFAA 2A5HA 1ZQJA 1WTWA 1EFID 3F53A 2JYOA 2K8AA 4IO9A 4JI8L 4RAUC 4IFDJ 4YFKA 9ICXA 2DWZB 1Y8NB 4Y2JA 1K0RA 1GXDC 4FS1A 3F92A 1ZYQA 3GIIA 1VQLA 3CPFA 1HZ9A 4DNIA 1I94L 1URJA 3ZI4A 4GITA 3WOEA 2HHXA 2FLLA 2Q0ZX 9ICJA 4ECSA 1K1SA 3F8TA 1N61A 2N88A 2P5TA 4PL1A 3J81j 3E0FA 3ISCA 1A62A 1S5ED 2ISOA 3N52A 3TAPA 3C2KA 1U4LA 2LYBA 4QMGA 5KQ8A 2AUKA 4M9NA 5C0YA 4PZNA 4UB3A 3RLNA 3D31A 2BNKA 4DL3A 1MSHA 4CNQA 1SDFA 2Q8RE 1JXLA 2B2TA 3CC4A 1SEBD 3CP0A 4BBAA 2MU2A 1IXRC 4CKCA 4LFBM 4JBKA 5C5MA 4AQYL 3ZDEA 2C35B 4K14A 4LY6A 5E79U 4HJAA 4OX9M 2XFSA 2WINB 2K60A 3UMBA 5KFZA 4LF6M 2GH1A 4IN3A 5J0QA 4FS2A 1Y1VB 1PH3A 4HMJA 2J7OA 1QSYA 1K9MC 4FVMA 4B9MA 2Z4IA 3WHKA 4J03A 2NVTB 5GAEC 1ZQWA 5BR8M 2EPBA 2L0CA 1ICFB 1WIVA 3FE3A 4ELVA 4LRTA 1WJJA 1L1OC 1D2NA 1SR3A 4JV5M 1QE6A 4RQ4A 2ASLA 2LKYA 1FEZA 2WV6D 4EENA 1H9RA 2Y0SF 1WTOA 2PI4A 1ZD3A 3DEOA 4AYBE 5L1KA 1ZQZA 1W6JA 4P0QB 2NZOA 1Q1EA 1MGSA 2NVYB 4JXJA 2XVTA 1KLNA 1RU3A 3RR5A 2Y1IA 5LHY1 4P16A 4YVZA 4ECZA 3BDPA 2BDNA 2K5HA 1H95A 7ICFA 1RYUA 5KFQA 4DR1M 1IBKM 5KFVA 5CR0A 2AQ4A 2Z8LA 1DCZA 5GROA 1BF4A 2QILA 2AQ0A 1MN3A 1X6IA 5EJWA 3FTDA 2F3VA 1SKRA 5ITUA 1VQPA 4RMFA 1I6HH 5ALHA 2EYPA 1EYGA 4B9VA 3IV6A 2MGSA 1J2NA 2JXNA 1J5EL 3KBXA 3DZDA 3WKDA 8ICLA 4G4KA 9ICTA 1HUOA 4JYAQ 1PK1B 4NLCA 1TWFB 1BUVT 1RM6C 2ZJ5A 5JVH3 4XXEA 4WW0A 1HNXL 1JB0F 4U7CA 3RN5A 3VYSA 3RJIA 4J15A 4FF3A 5KFFA 3UXOA 4R1JA 2ZIWB 3GTPH 4DL5A 1SE4A 2VW9A 3GTQB 1YLAA 4DA2A 9ICQA 1K83H 2K5NA 4I7AA 4DNTB 4RCNA 4LVSA 4DR2L 3C23A 4EQNA 4CJ1B 4OO1G 2ERCA 3P7JA 1CKMA 3FRIA 1QDTA 5EGTA 5L1MA 2RLTA 1SL1A 4CF3A 3I4NB 3VR6A 2BPCA 4JI6L 4EEKA 2Y9TA 5KNDA 4Y52H 3KDFA 4A3EH 2Y0QA 2EY2A 3BDCA 5KPTA 1S0MA 3I4NG 4K0KQ 4C3JG 3E5SA 3BS7A 4AYBF 2HVIA 3LDAA 4HL4A 4MGYE 3PGZA 3BS1A 4KHPQ 1QUQA 2F1HA 3Q24A 4FO6A 3ZJYC 1VEKA 3H8MA 5CV7A 1B22A 2O6KA 5HR7A 4J8QA 1NMGA 1VS0A 4DN4M 3LX0A 4DOAA 2WF9A 4B9UA 4H13C 4YR0A 2QBYB 4CHTB 4DK3C 1H9KA 3U6EA 3GV3A 4HIMA 2JMGA 4NWIA 2EAMA 1G8ZD 1LO5D 2V1UA 4B3TL 3ND9A 5E3FA 1RTNA 4LAAA 2RHFA 1KFDA 4O3RA 3UM9A 3BQ1A 2XGTA 4DV4L 5JAVA 1B43A 5EXSA 2KICA 1SWVA 2EXDA 4OGQC 4ELUA 3A98B 1L2BA 1GL7A 1ZQRA 3A0JA 4OJLA 1I3QB 3ONAB 1QYRA 4XQNA 2K89A 4O5EA 3C5GA 2OXPA 2PFNA 4JI0M 2LXKA 2R7DA 5CWRA 1ZRMA 3HFZB 2DUDA 2H4OA 3H6MA 1HEKA 4EEYA 1J7KA 3KK7A 3DXJC 1WD1A 2KK0A 2R0IA 3HKZC 4XDXA 1XTCD 4B3SM 3GQBA 4NLZA 3B7QA 4NXML 5ELEA 1L3UA 4WFN3 8ICFA 4IOAA 2LMCB 3SEBA 1FNNA 1UCVA 4DR7M 3HS0C 1L2CA 1SBBB 2CFOA 2CQOA 1HR0L 1MSWD 2KOBA 1FGBD 5AHXA 1QQWA 5AK3A 1LT3D 2CV0A 5LMUM 3AOGA 1XYIA 1NJZA 1XNQM 1U4BA 3SK6A 3U6MA 3M4PA 4B3MQ 4LF9M 2F2AB 4N8FA 5C5JA 3SQIA 1XNSA 5CMDA 1ZQLA 9ICUA 3ICXA 1DO0A 4RWSC 5K36G 2UUBL 1S77D 4PHEA 2RQXA 4IPCA 3SHFA 2W8LA 3C3EA 4C56C 5CV8A 5C1BA 3E4RA 1HNZQ 4HCSA 1TS4A 3WKEA 1EYCA 4PNYA 5EAYA 2G07A 3I01M 2UXCM 2L4NA 5G5GA 3VA7A 4GNXA 3EA6A 5KFAA 2BR0A 2OOBA 1TS5A 2ATLA 1GL6A 3K1ZA 1S4ZA 5KNCA 2YR0A 1G6ZA 1X54A 2HHHM 2ESEA 2E8MA 2XRQD 2RP5A 3PIOA 2PW7A 4UY8C 4C7ZA 4IJFA 2W3RA 3HEJA 3C3DA 1GABA 5CV9A 3P1HA 4BS9A 2F4VQ 3S14B 2KCMA 4K4GA 4DV5M 4BDPA 4HMIA 1T5XD 4LFAQ 4B7FA 2IW3A 1RYRA 3HHYA 3NUCA 3AM9A 1LLRD 4M9JA 4B7HA 2G5HB 3NQIA 3P20A 4JG2A 4PGXA 1RIPA 3FRPB 1QQ5A 2F0TA 2XF3A 2EJMA 1D0LA 3HX3A 3FDSA 1JWUD 2LKVA 1GUGA 2A69C 4O5CA 2NZ1D 1MJGM 2WB1G 1XMQM 2R8HA 1JALA 1SYBA 4RA8A 2PI2A 5IGGA 1SXEA 1JQYD 4X65Q 3GLIB 4R63A 1G6PA 3PV0A 3KZIU 5AI5A 1YHBA 2EYMA 5TISU 4A3KH 1X2IA 3KP1E 3DA1A 3PUYA 3MDAA 3C28A 3IECA 1T5EA 4F8MA 4A3BB 1Y1VH 2ZUCA 3SE0A 5KT4A 2EYLA 1HNWQ 1GVPA 1I4GA 3MXNB 1R4GA 2VKQA 2ZIVB 4DNRB 1HR0W 2NVTH 1RODA 4C3HB 1AROP 1OKSA 2ISPA 2L11A 4EIWA 1X37A 4MGHA 2IHMA 3J7BA 2RF4A 4C3HG 2HHQA 1OJLA 4DV6M 3T1HL 3LCVB 3UE1A 4JI3Q 4DR3M 3CW2C 4R7GA 1QB5D 3CP8A 1MJCA 3A0BU 1COOA 5EKLA 4PT5A 2MJ5B 1S97A 1LV5A 4LF7Q 3TFRA 1EIHA 1ZQVA 2HMXA 5I6WA 4PL2A 3TE6A 4ICAA 2W11A 5EXTA 1DOQA 4RT3A 2JV3A 2NVYH 1ZQDA 4GN4B 4YY3M 3SYLA 2DPJA 1X3FA 3AQEA 5AM3A 2NYVA 4OO1I 5IREB 4DV0L 2XY5A 1AW7A 4KD4A 5JI2E 1M4VA 1N78A 1R6BX 3JAMc 1N34Q 2PFQA 2Q8IB 1YNNC 4IBBA 4KY5A 2NUCA 5J0UA 2YMPA 3WHLA 4JBJA 2LVPC 1DJRD 5KRUA 1KAAA 3MBYA 8ICSA 8ICWA 3UXPA 1S72A 1UHUA 1H6UA 1UAPA 4FCTA 4QZAA 2K47A 3ULJA 3NBHB 3KJOA 2W04A 1TWFH 5ALRA 2D9UA 1WUDA 4I27A 1ZQQA 1HUNA 1KRTA 5JOBA 3MFYA 3I4OA 1CHPD 1OQYA 1IBMM 4BY1B 1UT8A 3W67A 2BHNA 3UI2A 3KF8B 2L4FA 4LW1A 3SV4A 4BY1G 3K2LA 3KXEC 4OO1H 1L8OA 2I5HA 1ENCA 4KLSA 2JP1A 4F93B 4R8UB 1NAPA 3T1YL 1FO4A 4QNRA 3H8WA 3FMCA 3HKZF 3I4NH 2MUTA 2EA0A 4IR1A 1PRTC 5KPZA 8ICHA 2DNEA 4R64A 2MA1A 2B2VC 2ZTCA 1OFHA 4LWCA 2JHDA 2BDUA 1STGA 1TS3A 1TWAB 1F2ZA 3RF9A 3ULLA 2BOSA 3DLLA 3CF2A 4RNMA 1S3OA 1RKNA 1X42A 1ZQCA 2UU9Q 2JEAI 4DR4M 3ZH9B 4GLVB 4JWMA 1WWUA 4ECTA 5J3BA 1S3SA 1EIGA 3HOYB 1JIHA 5J0WA 1K73C 5DEHA 1PV4A 4L5QA 3IL8A 2M00A 4YCXA 3B9PA 1EQTA 1LTBD 3I28A 2PKEA 4GKKM 3MZ5A 4A4IA 5IIFA 3O0FA 5IYBG 2QCUA 4KX5A 4DQQA 2JP7A 4C3IG 5KFJA 5KIXA 4F91B 4YN4A 2N78A 2JA8B 4I65A 3BS5A 1OW5A 2OTLA 4KMUA 1EY4A 3U6SA 1I3QH 3I4MB 2I7NA 4UN2B 4F4WA 4KLGA 2KIWA 2JA8G 3SI8A 5IYCH 4JI4L 2CWAA 1VQGA 1TWGH 3L4PA 4DV7L 2VY3A 1QILA 2N1RA 1KBUA 4ZCKA 4UAIA 3K57A 3MDCA 1OIPA 1QANA 1A76A 4X3TA 1S76D 1QH9A 4A3JB 3AMZA 3CAMA 3HWTA 2CHGA 4QZBA 4CKEA 3LWMA 1G51A 2MHVA 4A3JG 4EVOA 4DAYB 5IWAQ 2A1JA 4W5WA 2PCFB 2EJGC 1BNPA 5J0SA 1L8LA 3NUQA 3QU2A 1SG9A 1K0SA 1MI2A 3Q8LA 4FP5D 1QG7A 1AUAA 2R46A 1J8IA 4KLQA 2LTUA 2KJXA 1K1QA 1UQVA 5DKWA 1J6QA 5K36H 2XY7A 1JB3A 2RGOA 4JI7Q 4PGQA 1EWHA 1N56A 3S1NB 2F5QA 2F1IA 3VCBA 2GO7A 2HSZA 4QZGA 3MA2B 1F4IA 2DNCA 3MK6A 1ASYA 1GM5A 3C2PA 1PTOB 1MJEA 3PUZA 1LT5D 4JI8M 5EOZA 3ZD9A 2NRTA 3SFZA 3CF6E 4Q45A 1LKYB 2I5MX 1RG6A 4C1NK 1N36Q 2EZXA 3ZCBB 3KHLA 1Q8IA 3GTOH 5KNBA 4DR6Q 5JEAJ 1YNXA 1KIXA 2CWPA 2IHEA 2Y0TA 4OEMB 4UASA 3OHXC 1I94M 1XPOA 3GLIE 8ICCA 3SD7A 4C7YA 3D8LA 1NOMA 2X6GA 4R4QA 3H3VI 3U61A 1EOVA 1N32Q 3JAML 1L0WA 1QAOA 1XJVA 2VQFQ 1HZAA 5IGFA 3ERQA 1WTVA 1Y1WB 2IWHA 5AI9A 4YIJA 2NV3A 1FNVA 2Z7JA 2B63G 1DK3A 4CDFC 4YD1A 3H0LB 2DZNB 2XSZA 1TT2A 8ICBA 1VQIA 1F9SA 2QEJC 1RXVA 2CV1A 2QB0B 1F44A 4AQYM 1PYSB 3ZD8A 1P3QQ 3PMNA 2MO1A 3DEEA 4XT3B 4IOCA 7ICQA 4LFCQ 1K5OA 1BXTA 1V34A 1VF7A 2V1CC 1XPUA 8ICQA 3C5FA 3AFQA 4YWKA 2M60A 2HDLA 4IUTA 2VA3A 3IM1A 4I2EA 3H3VH 2I5LX 4BJQA 4A3BH 1SNCA 1I4WA 5C44G 2IL8A 4XYQA 2JN4A 1JR3D 1SE8A 3SK5A 3D4RA 2LVOC 9ICBA 1VQ5A 4C3HH 2V9WA 1A0IA 3KHRA 1EOTA 2R6GA 4Z9CB 4NJ8A 2V6ZM 3LMMA 2JXMB 5GAGC 3J81c 2WAQE 2X49A 2Q8TA 1N33L 1O7YA 1SFOB 3MFIA 3WDNA 2PQAA 2IPKD 3G71A 5DM63 2NVXB 2K4PA 2VXWA 1MX0A 1PYWD 8ICTA 3D2QA 3E9SA 1X56A 1ZYRD 1ZQMA 4AH6A 4DQSA 5J2KA 1WYGA 1Q3BA 7ICEA 2C2RA 2SEBD 4MH0E 2EZYA 1QZHA 3A8KE 1WWVA 3GLGA 1LVHA 5IT9E 1SNOA 1E32A 2KD1A 3SXHA 3A54A 1BNZA 4R65A 3T5JA 3FKIB 5EQ0A 1Q39A 4YR2A 4KLIA 1KSFX 4GOPC 3R8FA 3FUVA 5KFHA 3LWUA 1J5EM 2WF5A 3FKIG 1NJYA 4KLJA 1GJXA 3MR5A 4Y7NB 1O03A 2W55A 4UB5A 4KI0A 4D80A 1QAQA 4WRDA 5I9OA 4NW2A 4DV2L 1HNXM 3I56A 1A2UA 1B8AA 4PZOA 1V9PA 1QVRA 2QQ8A 3CQZB 2O5RA 4ECVA 2IX0A 5FLMG 4ZYSA 1PHJA 2F0DA 1C48A 4N9PA 3LVWA 3QUBA 2HWJA 3OPXA 1Y88A 1QNUA 4F4ZA 3MVVA 5AKLA 3GV5B 2KV2A 5IGBA 1JR3E 4KMOB 4YMNA 3HKPA 4GLAC 4UP8A 1NHGC 4JV2A 4I5SA 4DR2M 2XY6A 1A15A 5KG3A 1BPYA 5AIBA 2WIIB 3TZDA 2LYAA 2XFTA 4ID6A 3TEHB 4JI6M 1NJFA 4K4IA 1TIID 2JK8A 2CVRA 4WJ4A 2EYHA 3BVZA 1RF2D 2Z6KA 1K8OA 3F5AA 3RRHA 1PTOD 1WOCA 3TP7A 3V76A 5DYIA 2WAQF 2JEFA 2ZM6L 5K5PA 4QHTA 3D6JA 3RB3A 4DOCA 1LTAD 4Z6DA 2NRZA 4NV0A 5C4JH 5ISRA 2L09A 5BOLA 5FLXc 1VMPA 3CHBD 4PQXA 1KDBA 4FF4A 4V0BA 1SV0A 2JUJA 3ZQJA 2F3IA 1KW4A 1A63A 1TWAH 4M0AA 3M4YA 4G4OA 3FUWA 1IQPA 1CHQD 1HCZA 1HNZL 1ESFA 2WFAA 5JJKA 2F0LA 3SK4A 2IX3A 4B3TM 4FD2A 1MU5A 1U4PA 2H3QA 3RH4A 2B3GA 1L3VA 3KTQA 4FF2A 1EU4A 4DV4M 2R61A 3BQ7A 5CEHA 4BBSB 3HOYH 1VDLA 5I6YA 5IYBH 5HNKA 5ELBA 4NXZA 1QLNA 3PX6A 4BBSG 3S2HB 2M5ZA 1JRPA 5H2FU 2XWJB 5FO7B 2QB1A 4NXNQ 3JAMS 1S9FA 2B2TC 1JOOA 3I70A 2XNAC 2RSNA 1SLJA 2KRUA 4DL6A 4DV1L 4IL6U 4X64L 3K6OA 2JA8H 1IIPA 1PVPA 2PW5A 4DUYL 1UEAB 2C22A 3I4MH 5AJ3Q 2B2YC 4DQRA 2EYFA 2Q2IA 4GZYC 2JSOA 4PJ0U 4YCUA 1DGSA 4NXMM 4IBDA 2GVAA 1T3TA 3BDOA 4DSJA 2O25A 2DJGC 1QUQB 3K1RB 4MIUA 4IQVA 4F4KA 1NK6A 1VQJA 3GFKB 3VK8A 3OOCA 4YQWA 1HR0M 4MFCA 2YTUA 4P0QA 3NTHA 4KLEA 3MC0B 5FTNA 4DEZA 4L5TA 1SNPA 2Z0SA 3I4YA 2KNZA 3RTVA 4NM2A 3L0OA 3QU4A 5CC4A 2V4QA 3A46A 1A6XA 4Q7JA 4ZUIA 3PO3B 4LF5L 4L6V6 4QQBX 4R4IA 1KTKA 1MQ2A 4I28A 2KZMA 2BPGA 2K4HA 2K4EA 3HT3A 3TN2A 2UUBM 1PZID 3URYA 4DFAA 3PIO3 4MF8A 3EIEA 4DLEA 2J6UA 5KFGA 2F5OA 4PMCA 1KC8C 4P0PB 4PZ6A 3EW9A 2KW0A 3OWEB 4J9SA 2LPEA 3RH6A 1M1KC 5C3WA 1DONA 3CCQA 3J81L 3SBJA 1PTOH 2C98A 2MAXA 4I8OA 1SJHD 2KNAA 2I46A 2QZ4A 4UAWA 3K7AB 1LTRD 2Z4HA 1WCNA 3IRUA 4WJWA 4A3IB 3QU5A 3PQIA 1ZETA 4CBVA 3PXGA 2HBKA 4CIZA 4NL9C 4J6HA 2LMRA 2K75A 5TZVA 2KZSA 3NBIA 1D8BA 4ECQA 1PRTB 4CKBA 4F72A 5KFRA 5ELCA 3HZJA 1N34L 2R4JA 3KW6A 3F2DA 1HHVA 2JRZA 4KLKA 3SMSA 1IXSA 4RNOA 3K0YA 1EWCA 2RCNA 5T14A 1CZWA 5GQOA 1Y1WH 5JTIA 4XYOA 3THGA 2DI0A 1ZD2P 2N3SA 2LSSA 4LFBQ 4AKGA 1EFWA 4ACOA 4IBKA 2KJ9A 2I6XA 3L7ZC 4OX9Q 3SASA 4QIWB 1VQNA 1OXJA 4LF6Q 1D1IA 4PHAA 2YX8A 2PZUA 3UMGA 2HIVA 1TK5A 1OO9B 3DM3A 2MO0A 2QPAA 5C3EH 2PFPA 3WU2U 1NK4A 1GUOA 1PZJD 4RQ7A 1JOKA 1O08A 5BR8Q 1QSLA 3T5LA 3KBGA 1ZQEA 2PMZB 4LJXA 5J8YC 1U48A 1CKOA 3SEIA 5G3LF 4JV5Q 5KFNA 4Q43A 1ED1A 1KN5A 3W3AA 2L12A 3NWLA 4QZ8A 1UNSA 3IAYA 2HKJA 3GLHB 1N2XA 3M85A 1IV8A 2AH5A 2VQEL 3TP8A 3RB4A 1F2LA 4DV3L 2CW0C 3T1HM 2KHHA 3DDHA 2W82A 1E0BA 3GPYA 1VEGA 4K2LA 2J4XA 5D3DA 5FKAC 1L0YB 3C2LA 3GU3A 3PSTA 2A74C 2V4RA 4R4TA 3OMCA 2JZ1A 1S8OA 5AKGA 5A2QL 2JY7A 4IRCA 4ZKBB 4G4RA 5FLXL 2H1RA 4DR1Q 2OM6A 1IBKQ 2C9CA 2LM4A 1SFOH 4POFA 3EPIA 3QE9Y 1SYGA 5KT2A 4LJ8A 2NVXH 4DV0M 2KZ3A 1S5LU 2FDRA 2JA7B 2LVAA 1R5LA 4MF2A 3I4VA 1BPZA 2F0JA 1L8QA 4ANRA 3BVGA 1I4QA 2JA7G 3WK6A 1XNRL 4C8LA 4QNMA 2R8JA 2GOLA 1SMXA 5ALOA 2EH9A 1TK0A 2PI5A 1U9RA 3WOFA 5IYDG 1KXLA 1V43A 1QTMA 2JGAA 3F5EA 2XZFA 3FKIH 1X3QA 2MPMA 4BBRH 1T3QA 3RH5A 5HGTA 3HJQA 1KAWA 3QB3A 3VA5A 4Y7NH 9ICRA 3STBC 3DUZA 2K6AA 4B08A 3N7RC 5ALKA 3NENA 4DLGA 3HW8A 4CF5A 3CQZH 3UXNA 4GC7A 2K4IA 1DV0A 2AMCB 3GRUA 2NYZD 2JA6B 3GIJA 2FOIC 3S2DB 1VQHA 2K0BX 3BXWA 5ALQA 1U45A 1M6YA 2JA6G 1VEJA 3TQYA 1O7ZA 2Y21A 4LZDA 3QYPA 2F0QA 3JPOA 4QUCA 1WGLA 1HZBA 2QDBA 3WKAA 4NOOB 3SVMA 2QSFX 4O0IA 2MUYA 2JY5A 3T1YM 3RZOB 3AQFA 3ONNA 9ICCA 1VQOA 1IYJB 4GXJA 2KQ3A 1Q3VA 1C4QA 1A3TA 4J9OA 2QHOB 2KZZA 1S5BD 4F92B 2RQ5A 2A6HD 2EDGA 3RJGA 3EUB2 5BPVA 1SIJA 1ZQUA 3PW4A 1Z19A 4I2DA 1W5TA 4L15A 1YJ9A 4DSEA 2DPIA 1N62A 2TSSA 3KSJA 3V2TA 1YE9A 3GLFA 2IOHA 3OW2A 2UXBL 2HD3A 3C46A 1VJ5A 4HTHA 1DGBA 2Y9UA 5ALEA 1PRTD 3ZDBA 2G5GX 2XCAA 3J81S 3S9WA 4ZH4A 2DWQA 2JEJA 3ZC7B 4Q8EA 4BY7B 1QWYA 3WK9A 1YITA 2NO4A 9ICAA 1SXJC 2G08A 3GLIA 4BY7G 4WP2A 1XC8A 4JI0Q 5ALUA 2MQHA 3S2HH 3DFZA 1VQCA 1ZQYA 5L1LA 1CKNA 2NRVA 2HDOA 3C1FA 3IRBA 4DFDA 5EE1A 4B3SQ 5JPNC 3I91A 5M5WB 3GQCA 4JI4M 1SAPA 2E76C 4IR9A 4JBMA 3MXNA 1E9RA 5CA7A 4JOIA 4DV7M 3D2NA 2MUTB 2ZIVA 5NUCA 4DAMA 5AM5A 5C0XJ 3M0EA 1YNJC 4DR7Q 1YEZA 4AP9A 2EQYA 1BPEA 4LK1C 4F5PA 2ZJQA 1VG5A 1TH3A 2UVWA 5LMUQ 2JEBI 2FS1A 4HR7B 1Z4NA 1XNQQ 3L28A 3RBEA 1C9OA 3S1MB 2GNOA 4Q0FA 2FMQA 1N32M 2KSOA 1QQ7A 4YHHL 8ICXA 4LF9Q 1SGGA 1BBWA 1L5UA 5EPJA 2LS01 3RBDA 3KFUG 1L2FA 1SYCA 1QDRA 1YUBA 4KLUA 3A5ZB 3CCJA 2VZAA 4C8NA 2KN7A 1DRGA 1TAUA 5IINA 1SKSA 4K6LA 4X62L 3H15A 4Y2XA 1KHIA 4NB3A 1HA6A 3PO3H 3RZDB 3M7DA 4F5NA 2NBFA 1BBUA 2VS1A 3VK7A 4KV6A 3GO8A 1OXSC 2F5PA 4QWAA 5BN3A 3BVMA 1C1KA 4BWMA 2VUMB 2UXCQ 4FCWA 2B6GA 5CRXA 1N60A 4H0LC 4EQOA 4IQUA 1L7NA 4UBCA 3GV8B 3EZ5A 3PIPA 1T3NA 1X6JA 2XN9C 2HHHQ 3BS5B 5M3FB 2HL7A 4QIWE 3UMCA 1X9NA 3HY5A 4EGVA 4PMWA 5KFXA 3SYZA 1B44D 1NBWA 2OEOA 5A2QS 1I6VC 3DMUA 5M3FG 3RMHA 3K7AH 3MEHA 4Y2TA 3D6CA 3NGDA 2W9BB 3EYZA 3U6QA 4DV5Q 1PH8A 4A3IH 4US9A 2IA6A 2B8GA 5KG5A 5J2EA 3MGIA 4X66L 1EY5A 2K14A 1PXUA 2PMZE 1H9MA 4A3LG 2G06A 1XXHB 1QVFA 2A6EC 1XU4A 2CFMA 4KLMA 1IW7D 4DXFA 3PW7A 4X3UA 2XTIA 5J2DA 4R8UA 4I2IA 1IY0A 4GKJL 4LJ5A 3RAXA 3HWSA 1ICWA 3KOZE 1XMQQ 2M9VA 3BBZA 4QHSA 4PG3A 2KHSA 3CTWB 5JI3E 1SYDA 1K3RA 3TWLA 3U58A 4IFDG 3OTOL 2E8OA 5A35A 2N8NA 2E75C 1VQEA 4IQWA 1XWIA 3AMUA 4KLHA 3GIMA 4EQPA 2UVRA 1GO3F 1RJTA 1IXRA 1Z47A 3UDXA 4II7A 3MMPA 1QUTA 3UGJA 5D4BA 2FMMA 2UUAL 1JROA 3R8BA 3AN1A 1E1OA 1QJOA 4G3OA 3U4ZA 9ICOA 3CMAA 3W1BA 1A2TA 1XMOL 4ZAIA 1I4HA 4PCZA 1KFTA 1BGXT 1XWLA 2PI2E 2KVSA 2HHSA 4DR3Q 2B29A 2X4AA 2KENA 4JI2L 1NY5A 2YB1A 5AM4A 7ICVA 1HH2P 3M9OB 2XRSD 2VF7A 4BGDA 3EN2A 5KT3A 4DUZL 1XX8A 1F9PA 2CUZA 3GIKA 1ZJNA 2ZXHA 2CEAA 3DHQA 1N33M 2F0EA 2YQEA 2FFJA 3MR6A 1QNKA 1Q3LA 4QIWF 4QWEA 4YY3Q 4HEOA 3GILA 3F1ZA 4Z8XA 2RRDA 1PH1A 4B9SA 3K4GA 3K59A 5H37D 4O42A 1KEJA 5J22A 1HQMC 1PM5A 3E21A 2LXJA 4FZMA 1AZQA 2J6SA 2PMZF 3SR6A 4CGZA 1FNWA 3J7YW 3D8BA 1IY2A 1WTXA 4XQQA 2CHBD 1UEBA 3SZ2A 5C4XB 3E6ZX 4C4RA 1ET9A 3CXCA 4O1NA 3G6VA 1HFGA 4YXJA 4ME3A 1AE2A 5E4XA 5C4XG 3WWVA 3LQRA 4DV2M 1I4PA 2Q2HA 4UHVA 2D62A 4M9HA 1PJQA 1JORA 2DY7A 4PZ8A 3NK9A 1IBMQ 1WYDA 2L5TA 3Q8GA 5KG7A 4IS7A 3HOXB 4HEDA 1PA6A 4KKTA 3NQTA 3H0RB 3FYCA 5D49A 2RDFA 3GP7A 5DBBA 3HOXG 3TP5A 4B9LA 1EY0A 2JA6H 4GHLA 1DZ1A 3QXGA 1ZQ9A 5AJ3L 4DSIA 3S2DH 4KY6A 2K04A 4IJLA 1Q46A 4FBTA 5KNIA 2PQAB 1DXMA 2B8FA 2BPFA 1NJIC 1FJGL 4YMMA 4DQPA 5EBCA 2F0KA 3R2IA 2R93B 3NWTA 8ICAA 3RZOH 2EZVA 3T13A 1ENFA 1B2TA 2R3ZA 1PVQA 3GLGB 2AHOB 4NMZA 2F0VA 4OJPA 2ZM6M 2XCPA 3O13A 1X3GA 4RQ1A 4XK8F 3S15H 4IC9A 1L3TA 3R2TA 4IUPA 1B50A 2E2DC 3PO2B 4KLFA 8ICVA 1YT3A 3ZDDA 2JNHA 4AYBC 1XO0A 4G3IA 3PW0A 1PRBA 2IMWP 3PO2G 2IOFK 2OCEA 3CCRA 4CJ6A 4DR4Q 4RKBA 2NZHA 4R3DA 1RYSA 4B9TA 2CWBA 1Z7TA 5E4WC 7ICMA 1NV9A 2J7NA 4I7ZC 4ZRZA 2CV2A 2DAKA 4ZPXA 3F2UA 2BKEA 1VDVA 1LABA 2QB0A 1PH6A 4QZDA 4KN7C 4QOSA 4GKKQ 1IHZA 4LJAA 2QGQA 1YZ6A 3CCVA 2I0QA 4F88A 3U4VA 2JEIA 3NASA 2BJVA 5EPLA 4UB6U 5EXPA 4JVZA 4P72A 3ZDCA 1DK2A 1BQQT 4BY7H 2VL6A 4NLGA 3UQ0A 3PF5A 3TANA 2KG5A 5DYGA 5J0RA 2ZANA 2EOTA 4LGYA 1RPLA 4DV1M 4X64M 3PW5A 7ICTA 5AKHA 3TMEA 4CGYB 5EKKA 3U6PA 3K81C 2DKZA 2DWNA 5DB8A 4KT0F 4DUYM 2BH8A 4NLBA 1KNAA 4ECYA 5CV6A 4LF8L 1ZKOA 1OAIA 3KOJA 5M5WH 2FH0A 5M3MB 2B2WC 1JJ2A 3I04M 4JV1A 5ALMA 5M3MG 2K01A 4A3GB 2EO2A 1H9JA 4MHEA 4DU9A 1B7YB 1NY6A 5FTLA 3Q8PB 1BCPB 2HIXA 2E3TA 1LT4D 4LF6L 3CKIB 1JUDA 4A3GG 2IOFA 3N6RA 2EUCA 3S1MH 3V96A 2KCTA 2KNVA 2X69A 3WK7A 2QEXA 3J80c 4LF5M 4QZ9A 1IN8A 2DHRA 8ICYA 2YMQA 2PNHA 1VQFA 1UUPA 2DY8A 7ICIA 2EKFA 3BQ2A 2HQEA 3NVVA 2UUCL 7ICGA 2CHQA 4IQZA 2XO7A 2KDLA 4U68A 3RZDH 2XSZD 4JI8Q 5EKIA 4EQ5A 3I3CA 1EL0A 5M9OA 2LHTA 1VQBA 4EZ9A 3EIHA 3GRRA 2VUMH 2G5IB 4IFDI 3RJHA 2O4XA 4RGOS 3PVSA 4J9KA 4UAYA 2VNUD 2RDJA 1X9WA 3MTSA 5CORA 1I94Q 3ALRA 2VA8A 5ITRA 4CF4A 3G6EA 3MABA 3NVZA 2MJ8A 5M3FH 3U26A 4QB4A 3OIQA 4RNAA 3X3MA 4G4QA 4DO9A 3GZFA 4M8AA 3C9PA 4YWMA 1SN8A 3PSFA 4Y2YA 2DUYA 1YJWA 3GD7A 4IPHA 4ILWA 1UA1A 1ZQGA 2ZJPA 3R9XB 2L9HA 2D7HA 5KAFU 4RQMA 2B2UC 1K3WA 2W9CA 4MEYA 1SE3A 4I2JA 2KHIA 1W6KA 2K28A 2ZG6A 5KG6A 2LBCA 2KBNA 2KVMA 4AQYQ 1T43A 4HSPA 2LM1A 2D8CA 1EZ8A 3HX0A 5DG7A 3H4DA 2Q2TA 4QCLA 4IFDH 4I2AA 3QNMA 4O5KA 2CH4W 4LF4M 4GS3A 2Z6BA 1TR5A 4N9TA 4OIJA 4HJ5A 3MGHA 3AL0B 1HFNA 4P74A 4EBEA 3I7FA 3I1YA 5IIOA 4BA1I 1G291 4TRDA 5HHIA 2DF4B 4TUQA 2ODGA 2ASBA 7ICLA 4ECWA 1M8AA 1TR8A 1BPDA 4NL4H 3RR7A 4JI5L 3SV3A 5AI4A 2AUJD 1CZGA 4M6WB 3N97B 5F2DA 1IM2A 5EWFA 1ILQA 2EAPA 2VQEM 5J1ZA 4JN6A 4ED3A 5D65A 4DV3M 1I4RA 3KF6B 3L2PA 4LZJA 5ITXA 4A3DH 4USAA 1NK5A 2OT2A 4K8JA 2X8AA 2XGNA 3CGWA 3PSIA 3TARA 3KZXA 5KFCA 4IBEA 2E5LL 2R44A 1XB2B 1TAQA 4C1NI 1AE3A 3J27B 1IXSB 2XIDA 1GLNA 3IHPA 1PJTA 3RAQA 2HCBA 4APVA 5ALFA 4K5WA 1XO1A 4C3JB 2F5SA 2YNMD 5JJIA 2BA1A 4IBIA 1U0LA 1CQVA 2CW0D 3TADC 1XNRM 2MROB 2RBMA 4G9BA 1J5EQ 2R7FA 4BUGA 2CRUA 3U6OA 4B3RL 5BN4A 4IBCA 3IDWA 5KT6A 4CJ0B 5T1GA 1HNXQ 1II3A 4I2FA 1R4PB 4DF7A 2ZIUA 4DR5L 3GLGE 1CI3M 1TU2B 2EXZA 5AKYA 1X55A 4XRHA 4QW8A 1BCPD 4TQUS 4DAVA 1EIJA 1IBLL 4DR2Q 4GHAA 5DM73 4P17A 3VDPA 1WCLA 2HOQA 3HOXH 4DKAC 3Q8QB 5L1JA 4JMUA 3ND8A 3MXGA 1GHJA 1IXZA 4RGMA 1ZQFA 4CRXA 5F3WA 1X3PA 4L78A 1WTRA 2R7ZG 4P0PA 2ZTEA 2DGYA 1LUZA 4JI6Q 4A3CG 2QDLA 5AKKA 1CSQA 5KFLA 3V7JA 3SYKA 1KL9A 3AB9A 3HP6A 4EZ6A 1A5TA 7ICJA 4QWDA 3PO4A 1ZJMA 2BCSA 2B0CA 5IP9H 1YBYA 1F2YA 1Q90A 1OXTA 2CH4A 3U5ZB 5B66U 4O3QA 3J80L 2R93H 2A8VA 3EBEA 1ZXTA 3HP3A 1WFQA 3BYYB 4HIOA 3GV6A 3T5HA 4R4CA 3U50C 3B74A 3OPOA 1TWHB 3RB6A 4FDBA 4FF1A 4GXKA 3PO2H 1PMRA 8ICRA 2BJWA 4Y2SA 3UDIA 4DFJA 5GTIU 1N63A 3THVA 3IG5A 1Y8GA 1D8YA 3FTEA 3IG8A 2B2VA 2UXBM 4B3TQ 4TUWA 4XT1B 1S0VA 2WKCA 1SRUA 3J7AV 3AFHA 3CCSA 3M4QA 4KKUA 4DV4Q 1SWWA 4EX5A 1L7MA 5CYUA 1EY9A 4DOBA 1EIFA 1AFPA 1G91A 4UB8U 4I4LA 3NVYA 4BXXH 8ICPA 2AGPA 1LTSD 2GVBA 1IN4A 3CU7A 4QW9A 3BG3A 3QX7A 2LVQD 2HHUA 3QWLA 2EYJA 3C2MA 1A8VA 2YTVA 3KLWA 2BQ3A 1C7YA 4GFJA 1H9SB 2JQOA 4U673 2NN6G 4KN4C 3EFXD 1XHBA 4PZ7A 1XWEA 3SAUA 5DLQE 3QWNA 5EE3A 2KCCA 1TDHA 2JWSA 5EPKA 1D6EC 4NXMQ 1Q82C 1ESRA 1FFVA 2Y0SB 3GLHA 2LNHC 3B0XA 5J2CA 4L8RC 3M9NB 2Y0SG 1Z1BA 1Q3UA 1HR0Q 4LZGA 1V1PA 3BZCA 2HQLA 1G41A 4AIMA 3MFHA 2WSFF 3QR8A 1AP0A 1R9TB 4AG6A 3TWMA 1VF5C 2QKQA 4D82A 4DGZA 3QU9A 4AW4A 4DK6C 1BVSA 4QJFA 2O01F 4A3GH 5DLFA 4YHHM 5LMNL 2YY6A 2L1BA 1DD2A 5IIIA 3GLFB 2ATWA 3FPPA 3PIP3 9ICHA 2UVUA 4BWGB 2GN5A 5KFSA 5KFKA 2WF6A 1DGGA 3RJJA 8CATA 1X40A 2UUBQ 1QVGA 5ALZA 3RLFA 1TY0A 3TL4X 4HIDA 4X62M 4ECRA 4REZA 2F0WA 1YNJD 1GHKA 2MGWA 3W2DA 1PJIA 3VKGA 2KA6B 3PX4A 2WB1B 4F8RA 5KYIA 3H8SA 2K33A 5T1IA 4JK1C 1G3IA 3EROA 3JAME 2UXDL 4DV6L 2FLNA 1X3EA 4RKUF 3MFGA 3FC4A 1D0KA 4XQJA 2KEDA 2O5IC 4NLKA 3G7LA 1D5XC 4DK1A 2R18A 3RNUA 3H0MB 2XEPA 2JZBA 2AU0A 1SKWA 1CKNB 2ES6A 2ZJ8A 2F0OA 2SDFA 3CYMA 3ILKA 1SV4A 3AOEC 2XZUA 5FK9C 4BXOA 4KODA 3HOZB 3UDFA 1VMCA 5ELFA 2JY6B 4DSFA 2K8BB 3HOZG 4X66M 2NRXA 1N48A 4F3OA 4O3MA 3RRGA 4DS4A 1LB2B 4S12A 4Z6FA 2QARA 5AM2A 2FLPA 1DGFA 2KSOB 2G3QA 1JWMD 1B9MA 4OD0A 4FWDA 4GKJM 1LM0A 2VDBB 2DZLA 5EE9A 2AHMA 3Q8XA 3VR2A 4X3KA 4AYBG 1L1ZA 5L9XA 2KUMA 2FINB 5EQTA 3MGVA 2F0PA 1GVNA 4ED8A 3X3NA 3OTOM 3W68A 3AU2A 5AIAA 3S17B 1TWCB 1DOMA 1NK9A 5JEAG 1CUKA 4J9RA 3T4AC 4UB2A 2AWNA 1HQCA 2WKDA 1CT1D 4JW0A 1NSFA 3CCMA 2XVSA 8ICIA 2UUAM 4FZNA 2WHEA 2UVVA 2HT1A 1ZQKA 3GDEA 5J0YA 4NRWA 2QW7A 3V05A 4RGNA 1NJWA 5CGKA 1HTLD 2I1QA 4KY7A 4QF4A 4RFBA 1JE5A 4IJEA 2R8GA 2BCQA 1IY1A 1XMOM 2ZXPA 1V1QA 3T1HQ 2V1CA 4RT2A 4JI2M 4JI1L 4DUZM 2KEYA 1YJNA 5L1IA 5KFDA 1LYLA 4GN5A 2OXOA 2H5XA 5KEEA 5AICA 1T94A 3J80S 1QSSA 3GTQH 3K5OA 4IPDA 4DV0Q 2EZZA 3BQTA 4FWGA 3M8RA 4G4NA 2PYKA 1Y8PB 3Q8DA 2FJ2A 3M9MB 2KFNA 3BDLA 4UAVA 3UPQA 2G5DA 3PUWA 4XQ8A 4C3JH 3RGSA 1V85A 4ITQA 1PK3A 1D7QA 3H3VC 4DCCA 1ZM