2H65A

Crystal strusture of caspase-3 with inhibitor ac-vdvad-cho
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
140
structure length
140
Chain Sequence
b'NSYKMDYPEMGLCIIINNKNFHKSTGMTSRSGTDVDAANLRETFRNLKYEVRNKNDLTREEIVELMRDVSKEDHSKRSSFVCVLLSHGEEGIIFGTNGPVDLKKITNFFRGDRCRSLTGKPKLFIIQACRGTELDCGIET'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords caspase-3, p17 subunit
publication title Structural and kinetic analysis of caspase-3 reveals role for s5 binding site in substrate recognition
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/hydrolase inhibitor
total genus 49
structure length 140
sequence length 140
chains with identical sequence C
ec nomenclature ec 3.4.22.56: Caspase-3.
pdb deposition date 2006-05-30
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1460 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2h65A00
1GQFA 4NOMA 5H0IA 5LUBA 3NKFA 4FXOA 1F9EA 2C2OA 1NMEA 4LSZA 4NBLA 2J33A 5IASA 5IC4A 5IARA 4PS0A 2QL9A 1M72A 4ZVPA 2XZTA 1SHLA 3KJQA 4NBNA 1K88A 2FQQA 2DKOA 4FEAA 2Y1LA 1RE1A 4QUAA 2XYPA 3H11B 1QTNA 2C2KA 2CNKA 2J31A 2H5JA 3V4LA 2FP3A 1SC4A 5IC6A 4IYRA 4I1PA 1SC1A 4QUHA 4NOKA 1PAUA 1K86A 3R7SA 1PYOA 4EHDA 1RHQA 4EHNA 2XYGA 3R6LA 2H51A 2H54A 3DEHA 4N7JA 4NOLA 3UO8B 3DEJA 3IBFA 4QU8A 5LU9A 3E4CA 4AWBA 4QU0A 4ZVQA 4JQZA 4PRYA 1SC3A 4EHAA 2FUNB 3P4UA 1SHJA 4JR2A 2CNNA 4IEFB 1NW9B 2NN3C 3NS7A 4EJFA 4D3XA 3R6GA 4JR0A 3OD5A 3BIJA 4ZVRA 4ZVSA 2CNOA 2K7ZA 4AWAA 2QLFA 4M9RA 3V55A 3UOAB 3V6MA 1GFWA 3DEKA 3K7EA 4D3ZA 4EHHA 4QUIA 4EHKA 2J32A 1RHUA 3EDQA 3R5JA 5JFTA 4QTXA 2C2ZA 1RHRA 1KMCA 4N5DA 1RHJA 2AR9A 2P2CA 4ZVTA 4JJEA 3PD1A 5IANA 4HQRA 4JJ7A 1RHMA 2CNLA 3RJMA 4N7MA 4QUGA 3P45A 2HBYA 4ZVOA 1I51A 1QX3A 3H13A 5I9BA 4I1RA 3D6HA 3KJNA 1RWMA 4PS1A 4QU5A 3H1PA 2H65A 1RWOA 1RWVA 5IBRA 4N6GA 5IABA 3R7BA 1BMQA 4JB8A 1ICEA 3V3KA 3EDRA 2HBRA 3H0EA 4EHFA 1RWKA 5I9TA 3GJTA 3KJFA 1QDUA 5LUAA 4JQYA 1F1JA 4JR1A 4D3YA 4DCJA 5IAGA 2C2MA 3H11A 2CJXA 2QL7A 4N6OA 3V4OA 1CVRA 2QLBA 5IBPA 2XZDA 3IBCA 3S8EA 2HBZA 3GJRA 3NR2A 5IAJA 3SIRA 1RHKA 4FGUA 4DCPA 1I3OA 2QL5A 5IAEA 3DEIA 3QNWA 2Y0BA 2H4WA 1JXQA 1I4EB 2C1EA 2XYHA 3PCXA 4NBKA 3SIPA 5IBCA 4QUEA 4QTYA 5IAKA 4QUJA 2H5IA 1I4OA 3S70A 4QU9A 4ZVUA 3R5KA 2WDPA 4HQ0A 1IBCA 4QUDA 4QUBA 4HVAA 5LU8A 3GJSA 2HBQA 2J30A 1RWXA 3GJQA 3PD0A 4FDLA 3V6LA 3D6MA 2QLJA 3ITNA 4AW9A 4NOJA 4EHLA 2H48A 3D6FA 4QULA 4JJ8A 1RWNA 5K20A 4PRZA 1RWWA 4DCOA 1RWPA 2CDRA 2CJYA 1CP3A 3R7NA 1NMSA 2H4YA 1NMQA 4N6NA
chains in the Genus database with same CATH superfamily
2ZATA 2A0KA 3JQAD 3UF0A 1X87A 2V7EA 3GCGA 5JD4A 2VDKB 4O2LA 4PS0A 2H1CA 1K68A 2Z98A 3JARA 3A58B 2ZWIA 3ZGVA 1E4OA 1YRWA 4P3YA 5AHXA 2QA5A 3DFFA 4OHMA 2XXAB 5HWSA 5IDQA 3MQFA 1SKYB 3DBLA 4FOLA 1LJUA 1YL6A 2A84A 4P53A 4ZA2A 3AL2A 4N0EA 1UKCA 3GEHA 4JEIA 3R7LA 2V4ZA 1CW2B 4NENB 3WGTA 1U3WA 2BONA 3P2EA 4S0XA 4IL5A 2QEQA 5G2OA 3TLCA 4I1PA 2ZI3A 3ROFA 3V80A 4DL9A 1QO7A 2J08A 3UJCA 4CM6A 1V11A 3KKLA 3I9JA 4MRSA 1DADA 2X42A 3BMQA 4HG2A 1C1XA 1P80A 2FLWA 3GVPA 4UVHA 4DR1B 5E6UA 1C2YA 1JKMA 1KPIA 3VTFA 3U49A 2ZBFA 1P2VA 2O8BA 4FHZA 4GE3A 4N3BA 4BMCA 1R6XA 5E0OA 5FJIA 3OPYA 5U9CA 5CLQA 3UOWA 1OWMA 1MQ8B 1OJLA 1T9GR 2Y67A 3ORSA 2ZJBA 4K9NA 2KPOA 4UOQA 2IV2X 2Q2QA 4AWAA 2DHCA 3IAXA 5H3LA 3H6GA 2YY5A 3IUSA 3VVBA 4F5WA 1EUQA 1NVVR 4ZREA 3HBNA 1XU7A 2R4TA 1SBNE 1X8JA 3H0CA 2N1BA 3VJRA 3LA6A 3EGDB 3TAXA 1B0AA 3AFOA 3D7NA 3ELUA 3EOBI 4RBNA 1IMOA 2IXFA 2GAOA 5DM4A 5BN4B 1UKVY 1U2TA 4ZAZA 3ZVRA 2HW8A 3FGPA 3S2GA 3PFGA 1HT1E 4L85A 1DIBA 4XWTA 4BN5A 1JFTA 3GFRA 1V47A 2K6GA 4CT5A 1H4QA 5AW4A 3WLRA 3H1FA 3SBDA 3MS4A 3GDGA 2BZ1A 2ZTHA 3SSNA 2BMAA 4EHFA 1NN5A 2AOTB 1XNHA 3GA5A 4L6AA 3U7EB 3NUZA 1SZJG 1FS5A 1I1NA 1UF9A 2PKQO 3D8SA 3BWVA 1NP3A 2H59A 2Y3IA 1YV9A 3E1SA 3LBIA 3YASA 3UJNA 1EBBA 3L0PA 1PV1A 5BMVA 1R16A 3DTYA 3VAYA 4BNGA 1EHCA 1LV7A 1MPTA 2MSEB 3FNHA 3N8DA 2UXDB 1I3MA 4S1WA 3DOUA 1ZVVA 4D7AA 2PMCA 2VYVD 1RZVA 3KUKA 4UEQA 3URKA 5ENVA 1X1SA 3EZ6A 4FGUA 1FX1A 3R3SA 3ABSB 3C5WP 3OE5A 1AH2A 4ARCA 1ENZA 2EBFX 1YI1A 3GIWA 3EZLA 3KJZA 1HLPA 3AEQA 1RRGA 3FWYA 2YZ2A 5JARA 4B6PA 1IPEA 4G0UA 1N5DA 4C07A 4D96A 3W5VA 3OKCA 3E84A 4YJGA 4HZUB 2BFAA 1RW4A 3QVUA 4MWGA 5ALPA 4EMBA 1QUFA 3K0CC 5TDHA 3S70A 6Q21A 1EFAA 2V58A 1GA4A 3GLQA 1Y6ZA 3ZHQA 2O07A 5IVHA 3ZCQA 4NFYA 2WT4A 2FXVA 2AJCA 1ZGJA 2ZRNA 2H17A 3VSDA 2Z9DA 3BG5A 3RUCA 2PR2A 1U28A 5MFPA 2JAWA 2NUAA 1ZDMA 3D6MA 3I8XA 1I01A 3N2IA 4UQOA 3SSOA 1JDNA 3EVEA 3T7TA 4F21A 2IP2A 3WLJA 3OZFA 1RWNA 4S1PA 4JN6B 1I2ZA 3WGZA 3B5JA 4YUXA 1YF3A 3NNNA 3T1YB 3ZDQA 4EW6A 4M8SA 5C4IA 1G66A 2LP4Y 1D2EA 4BO3A 2O8CA 3K71B 1KI3A 2I6GA 2ZWPA 1NV8A 1SBQA 3BX1A 3HJCA 2EKLA 3NH6A 3UJBA 3COWA 2W58A 3U3ZA 3P5SA 1CS0A 1BE0A 2RI1A 4WNAB 3ZIAA 1DTWB 3FYUA 1Y37A 5T4FA 4I4TB 1KNXA 2O05A 2VQFB 3O94A 1YSCA 3SJBA 3DDCA 2J5XA 4URXR 5JAMA 3CF4G 2PWZA 1OIVA 2VJCA 1NSTA 4GI1A 1XWIA 2PY6A 1G8HA 2A78A 2WSBA 3CBQA 1XDDA 5K09A 2TMKA 4MMYB 4RIGA 3FCAA 4DSNA 3ZBQA 4FNAA 5KVCA 1ESEA 4OQEA 2Q2OA 2OBFA 4CCWA 3O8BA 4MVJI 1G8MA 4U3JB 2CWWA 3DV9A 4Z99A 3ZGLA 4DDTA 1JDPA 4MVXA 2GJ4A 3AVUA 2QIOA 4OBWA 2QVGA 3A9TA 4P2GA 5AI5A 5FWYA 1SCUA 4P4NA 4JR2A 4JX8A 1XLWA 4XM2A 3SHVA 5CA0F 5KJCA 4DV1B 2OL4A 3AWIA 2C9OA 5LDGA 1LGYA 1UP4A 3ZY5A 4YQFA 1UKYA 1MIOA 3GU3A 4U7TB 4D92A 4FHGA 2Q4BA 4KXLA 4LPSA 4WBSA 1XMQB 2DPXA 3U09A 3C8MA 1K4KA 5EQTA 4X7MA 2JLBA 1Q0LA 4RUKA 3RG2A 1XN4A 4EBBA 3CUKA 3BF8A 3R0QA 4H27A 1EQAA 2OGSA 2P90A 3L92A 3IEXA 1J56A 1TMOA 3IJRA 4G9EA 1ZRHA 4U7JA 2GM5A 3L8GA 1U0TA 2RGGA 3GGSA 2WA1A 1JGTA 3LUCA 1P1CA 3GZNB 3OOJA 2QP4A 4D2IA 1UQRA 2AR7A 1E1MA 1YB5A 4J1TA 4J8PA 1S4QA 2PLAA 1GLNA 1VL2A 4E1VA 1EK6A 1LFDB 1HORA 1US8B 2R8ZA 3BH6A 4I7EA 4N6GA 5D84A 3KJEA 1E6CA 1P4JA 5GMOA 4QZVA 3FI0A 3C5CA 3EARA 4MPDA 4N3AA 2C7GA 1FMTA 3AEUB 4NDNE 4Z1MD 3CB2A 4ROSA 2B1QA 4B82A 1P4HA 1ULSA 3IHLA 4MVJE 1G19A 1SBCA 2JIQA 2WYOA 3HB9A 3JWGA 3T3MB 1ZM3A 1G6OA 4TT3D 3N28A 5GAJA 5DULA 1ZEMA 4Z4HA 4MI1A 3HM9A 1QQAA 3ICPA 1YJCA 3DMRA 5LWHA 1N8TA 3PXEA 4YP5A 2H1OA 1BX0A 2NU9A 3F8SA 2KX7A 3OZEA 4PBTA 1U9YA 3QTLA 2ONJA 2QBYA 1C4OA 2R7LA 3ZHSA 1QOZA 2H5LA 4B3SB 3E9NA 1G7TA 2WF8A 3HXTA 3IDQA 1YIOA 2Y66A 3B70A 3ORHA 3I6IA 1RJDA 1V39A 4EW3A 1CB7A 1EM6A 1JXQA 3TQQA 3WWDA 4E4TA 3GLFE 3AZPA 4DIMA 3M6AA 1HLGA 4BLQA 5CJPA 1YA6A 2ZZMA 1D5WA 1YJXA 4NZMA 3S28A 1BX3A 3WKAA 3T94A 2QUIA 1FRQA 4REOA 1GRCA 3LFUA 4DZRA 5H80A 4CMJA 1IBLB 2I1QA 1MC5A 2WAYA 3LGAA 1N9GA 1JR3A 2HDNB 2PA0A 4R5HA 3LDFA 1NT2A 5CD9A 2MSCB 1XRRA 3GLGB 5JJCA 5JW6A 3FUXA 5A5DA 4R1QA 1EFTA 4ND1A 3WBFA 3F5SA 1EVJA 1P19A 3OJXA 2H16A 4DF3A 1Y8RA 4AZSA 4HAZA 4WPGA 3H1TA 4GFDA 3MRXA 3I2IA 2ECQA 1AJEA 4MZDA 4JASB 1KRWA 2Q2WA 1J0CA 4J49A 2Q7DA 5T3YA 1X7YA 1G2IA 2FHSA 4P81A 2X7JA 2RGUA 1P1HA 5KOHB 1I0IA 3LW7A 2CHUA 2GBCA 3UPDA 2QRHA 3RROA 4CDMA 4GQAA 1HT3A 2XY4A 3R0VA 4RLQA 1O9GA 2B35A 2OORA 4BNDA 4XWOA 4AO8A 4RPKA 3R0ZA 3IALA 4EQZA 3EC1A 4JLPA 1DUVG 2BPOA 1RMTA 3HBJA 4LNAA 3SHQA 1T8TA 2R1VB 3U3JA 3CO5A 4G1MB 3JTEA 5DLPA 1FNBA 4JL5A 2NUPA 4EFMA 3ZX4A 4G4SP 2Z2JA 3GDHA 1YB7A 2IYNA 4C7JA 5I48A 1XEFA 4XGQA 3CX3A 1K0UA 2JCVA 3KTAB 4A8PA 4RK5A 4Z9FA 3AW8A 4ZYTA 4PG8A 1H2ZA 3HN2A 1GUBA 4HF7A 5ANRB 5KYUA 2CMHA 4EFKA 2DWUA 1TTHA 3PQ6A 3C8UA 4AZTA 4G85A 2DP4E 2VJMA 2Z04A 1LPOA 3D4PA 1U3VA 4Z8XA 1KI9A 4UM9D 5UKDA 1R8QA 1IJFA 2BGMA 3PC3A 4G1CA 4BV9A 1DHTA 2G1UA 4DT1B 2AF3C 1BSVA 2HJ9A 3PR2B 4DIFA 2HRZA 1MO3A 1VCOA 2QS9A 1VG8A 2X5JO 3P1JA 4RLHA 1R2QA 2WVGA 1F2TB 2MOKA 4K3UA 2IU6A 3S1AA 1GKIA 4EG3A 4QT4A 1QS0B 4ARVA 3KB6A 4CM5A 2C7QA 1QFXA 4MQFB 1M34B 2M2IA 1HE2A 1LVHA 3HI4A 4XJVA 1Y8QB 1YASA 1U3DA 1A2KC 1E5TA 3EA5A 1T9CA 3MJTA 3DBVO 1MA0A 1UFVA 3CTPA 3U4IA 3CJTA 2H0AA 3EVNA 3O38A 1CY0A 2A14A 4Z3KA 1OFTA 4EB0A 1N0UA 5T8KA 4EMSA 3OIDA 4PYOA 4WGGA 1SXJD 3DCYA 1T6ZA 4QE3A 4RTQA 4L4XA 1OXTA 2O3QA 4DQLA 5KU7A 3LT0A 2AI3A 3VYSB 2P78A 2Q4EA 2KHZA 3K4HA 5JRJA 3H8SA 3ON5A 1CUGA 4D4HA 5K3OA 3FKSD 1MV8A 4KVGA 4GR5A 4PZ9A 5IAEA 4F06A 3GPIA 2QRPA 1T2NA 3TCKA 4Q00A 4M8LA 3BQ9A 1ONSA 1DELA 4Q9HA 4KRFA 1DQNA 1OAAA 3GLIE 3FYUC 1U3CA 5A4DA 4NTZA 4PYLA 4WY8A 4KREA 3USCS 4TMXA 1TT5A 5LB2A 4BVHA 5JTUA 3BOSA 3ZV3A 1XPOA 4RJKA 1S6YA 2FTKE 2R8EA 5LQKA 3GJ6A 2GZ1A 1MW8X 3I1IA 1EVQA 1KP2A 5EKTA 1KJYA 1KEVA 4IHJA 1P2FA 4OH1A 3AKDA 4DQXA 4MWEA 3IP9A 1MGOA 1VPVA 2H48A 4ZEOA 1ADFA 1HGXA 1V11B 3PUHA 3QY9A 1T10A 3F2VA 5T4EA 1CUXA 3BMQB 4NNJA 3X43A 5KWEA 1WLYA 3U56A 2IE8A 1DL5A 5I51A 1I3LA 4OK5A 3JVUA 4Y1RA 6REQB 1I5RA 2YZGA 1SVNA 1J1ZA 2O8BB 1T4GA 2RHLA 1IUNA 4UUAA 1BS2A 3MN1A 1SD5A 4F92B 2ZJZA 1R9JA 1R6DA 3OCCA 3QPCA 4K9RA 3LIIA 2D5AA 3IV7A 2NMVA 3VGPA 4UDYX 4FN5A 2REXB 4G89A 1YRLA 4ZT6A 1DO8A 3QYPA 4TX1A 1C7IA 2D5BA 3K9GA 1WLSA 1E2EA 3O73A 5K6RA 3WFIA 3PJRA 4TLMB 4H7EA 3WSWA 4NONA 4HK4A 4YK7A 3ZCSA 3WNBA 1QIGA 3H8VA 3TNDA 3RADC 3QMWA 4WKOA 1GKYA 2HK8A 3FTCA 3KU4A 4AQDA 2ZUEA 5JVDA 3H86A 1DDOA 1GZ6A 5AW7A 1AO0A 4UBLA 5TXGA 4NC9A 4YUWA 3DL0A 2EWMA 4DA6A 5KI6A 5ITZA 5E95A 5A7FA 5BWNA 2I2BA 4AUEA 4KKVA 1JJVA 2OFWA 4GI2A 2PZKA 2PRJA 3JYPA 4AMVA 4DYHA 1GFZA 4E5UA 3P9YA 4MS1A 3GMIA 2NPFA 2K4MA 4O4IF 3UJAA 3WADA 4IV8A 2RI6A 5M7EA 1ZJ4A 2PT5A 2YJZA 3FJOA 3GNLA 2SHKA 1X7GA 5GV8A 1DG1G 3FHLA 1EHYA 1UL1X 3V8RA 3N3AC 1IHUA 1W8IA 2J3MA 2D1YA 2F1HA 3HA2A 3OEED 3UCXA 2NNLD 3P52A 2DLNA 2C4TA 5CFOA 3NHPA 3OIUA 1I3CA 1HNWB 3WJ7A 4YUAA 3U1BA 2BHNA 2MYNA 3C24A 3HVIA 3SICE 1QF7A 2VJPA 4ZYXA 1Z13A 1XL0A 2FZLA 2Z1DA 3F3SA 4RKFA 1ZH0A 3IE0A 2I2FA 4K6MA 4RL6A 4YJ3A 2GDZA 5ALTA 3ZCPA 1ZAYA 2AZDA 3V9AA 2X8LA 2QZZA 1BMQA 4YJGB 2VIIA 3M8KA 4RK0A 1BS1A 3BERA 4EPYA 4P4GA 5LYJA 1UM8A 2EWWA 3EAQA 5DNUA 5J4LA 3LPLA 1SUDA 3KQMA 3H18A 4YAFA 5EHIA 5LXTF 4AF8A 5KYNA 2CJXA 1GNRA 1PW7A 2F43A 3K5IA 1IBKB 1YA8A 1ACMA 4MSUA 2PX0A 4UU1A 1QONA 1WPGA 4Q02A 2NUAB 3CJQA 4Q9LA 3WLIA 2N75A 2W2NA 4W6ZA 3OP1A 2Z5LA 1GPBA 3QU5A 5CFRA 2V7XA 2O8CB 5AUOB 3JQ8B 1O4WA 4D9MA 4PAQA 3A25A 4B3XA 2I66A 3CX8A 3NQ41 3PNQA 4RTLA 1WJGA 1QFSA 1GKUB 1LCIA 1ND6A 4UDXX 2ZSIA 4W9NC 1OIWA 4JD5A 1GSIA 4HAOA 4P7GA 4Y2QA 5DH9A 1F6WA 1YMVA 1MOSA 1H8ED 5IAKA 4QFCA 5PNTA 3HZRA 3SIXA 3ZE1B 1QNLA 1NNEA 3N0VA 2OMEA 1JVSA 1AF7A 5KNCH 1X8KA 2R8OA 3M2PA 4RXMA 4JKOA 1P9NA 1UXGA 1ISFA 1XZIA 2A9FA 2D74A 1EZZA 2DUMA 2QMYA 2Y71A 1N6OA 4HFRA 4RKWA 2PSHA 1F8XA 5E1BA 4BTLA 4BP8A 2JLZA 2BI7A 2JFNA 2RHMA 4LISA 5CTJA 3F6EX 3K5PA 2JFWA 1QP4A 3WVNA 2VUSA 3C41J 3ZE0B 5LNK6 4EJSA 1NMEA 4QFBA 2P3OA 1Q1BA 3JY6A 1EFDN 4HRAA 1BN7A 3R9XA 1A5AB 5LIPA 3QU2A 2CW5A 1AK2A 2IYLD 1KI2A 3GRVA 1SCUB 4H6WA 4X5OA 5FWYB 2WBLC 1G8FA 2VP6A 2P4HX 3MYYA 2W6JA 3SVLA 1MQ9A 1Q7BA 5MN5A 5FP0A 1Y7IA 5CT6A 2ZIVB 1UXIA 4OQXA 3ICQB 3G89A 1MB9A 1M67A 1QG0A 1YK0A 4G1UC 3TQSA 4PYKA 5JAUA 1CUZA 2P40A 3L0SA 2XOKD 4GR9A 5I7HA 3G59A 1OLXA 1SELA 2GFIA 4ZQFA 2OBNA 3IOBA 5FTKA 2XCTB 2J8ZA 2F4VB 3EZYA 5HW0A 4FR5A 4QU8A 1LLFA 1OPRA 3DTVD 4F1WA 5KTYA 2HCJB 2O8DA 2IPAB 3PSAA 1ZR4A 2J4FA 1KXZA 4RFLA 5DP2A 3GLFA 4RDHA 2YJ6A 4EO9A 1RI3A 3PVZA 2IHTA 4MJ3A 3CH6A 1KFBB 1DIRA 1VB3A 1VJ0A 2D54A 3KL4A 4HHEA 2HK9A 2ZRGA 1ZO8A 4IH4A 5EN4A 1SBYA 1ORRA 3L1VA 1EE1A 2H08A 2H00A 3EH1A 3O9VA 3RGGA 3UG7A 1PT5A 2QG4A 4YNBA 3H99A 3GXBA 4H0NA 1PR2A 4YO7A 4MJLA 3STUA 5K0FA 3Q2OA 4KQJA 1NL3A 2WNHA 4CKBA 1Y8AA 4HXEB 4MP8A 2P7IA 1KMQA 2J87A 4D4KA 3LNTA 1ZXBA 2BCEA 3DB2A 3SHOA 3THWB 5L53A 3UENA 3A1DA 1ZIXA 2ZSKA 1JPNA 1X7DA 3CW9A 3EQ7A 3LDUA 3IIIA 4LGVA 4O2AA 1CDZA 4PX2A 4XDHA 5JBQA 3WBBA 4X3PA 2DVMA 3B7GA 2YHUA 3G2KA 3I52A 4RAQA 5DRTA 2HADA 1GUFA 1BNCA 1KSGA 1TM2A 5DHQA 4YAIA 1V8BA 4EDHA 1G0OA 4EELA 2WLTA 3TB6A 4HYEA 1J90A 2FX2A 3GZJA 2R7AA 4WK2B 4G0YA 3RT9A 5IYZA 5EP3A 2V98A 3VPFA 2HQRA 3F5MA 4FCWA 3PU6A 4DMFA 3NWBA 2JJ1D 1V16A 2EBWA 1UMCB 5CW2A 1NBIA 3D1LA 2BKUA 5HPYB 1SKBA 3DUWA 4ZXFA 1Y89A 3TW8A 5AI0A 3WDKA 4KWTA 4QD3A 4C6TB 1SVSA 3VA7A 1TJ3A 1Y8RB 1HNZB 1HFJA 2H4FA 4NH0A 4Z54A 1EWRA 2G5PA 3FOCA 1WVIA 4JU8A 3HMQA 1VZ2A 3NDRA 4EFDA 3HB7A 2JVKA 3DOFA 3CVXA 4WNCA 4XIFA 1E5LA 1X7YB 1SEPA 1VMIA 4GD3Q 3TLMA 6NULA 3OPQA 4JX9A 2C5AA 4CLOA 5I8WA 2OGTA 4LQLA 4NH4A 4DWJA 4RPGA 3FOWA 4NU6A 2AQIA 2D2IA 3VSAA 1L8XA 3HCBA 2GN6A 4EUEA 4DCOA 4ZI2A 2YJ5A 5DFAA 3EXIA 5TV2A 3ZW7A 3W2EA 1OKKA 5DHPA 5ALKA 5PGMA 3RASA 4IX9A 1L4GA 4AC9A 3FYCA 5DCYA 4A8TA 1CS4C 3LLVA 4LS3A 4Y1FA 3EIWA 5A04A 2HPZA 2OVBA 3AHJA 1G8YA 4A36A 2H29A 4HVLA 1WMSA 3LRXA 4E5YA 3KOZA 4E32A 3W8NA 4H77A 2CLMB 2H31A 1AHHA 4TTAA 5IT5A 4QXOA 2JIPA 4CR7A 2XJ4A 5KYUB 4GZ5A 4B4VA 1NUAA 3QWAA 1M6VB 4DR2B 3V8BA 1C7ZA 1T91A 4LEIA 1YS7A 4D0GA 1EAYA 3F78A 5EINA 2H1HA 2WILA 1U7WA 3BJIC 1UAYA 4KLCA 4IZHA 1OU4A 4N8EA 5KJFA 2NADA 3GOQA 3HJTA 1I7DA 4ZQIA 2E4VA 2JI8A 3ND9A 3NOVA 3IPXA 3QPBA 4KQCA 3S1AB 2G4LA 4JJKA 4ER7A 3PNMA 3T7EA 1Z2NX 5JQGF 1HEIA 1KJ8A 2Q29A 3DPUA 3SQNA 1VBFA 4C3UA 2CVPA 1NVKA 3STYA 5JMPA 1NJSA 1G3UA 1PJ8A 5FADA 3VVCA 2QMQA 1E7QA 2V8OA 1OA0A 2CBXA 4KL8S 3N2YA 4X65B 3VQTA 5AVSA 4W99A 4YBZA 3EBPA 3P94A 1GTRA 3AI1A 4RTOA 1LZLA 2PGJA 1I3KA 3BRWD 4PXYA 1KY3A 4Q1VA 4RFVA 4MB0A 2DE0X 5JPIA 3CKMA 4EZBA 2REOA 2H4JA 2Y2UA 1E6KA 3PPYA 4CG0A 1IDOA 2XBMA 2VLIA 5I5GA 4QBFA 3HADA 5CT5A 2E6KA 1SHTX 4R0VA 1GTZA 4Y2RA 1DU4A 1CZRA 4FOPA 4KMMA 4NCXA 4B73A 2C3UA 4WKBA 4YGYA 3G1UA 1LPMA 2EU8A 3STVA 3GLVA 4D3DA 1HUQA 2D62A 4HY3A 1TW2A 3EDRA 2COKA 1XSEA 3EDMA 2WTBA 2ZQZA 3L7YA 4P80A 2EZTA 2QZSA 3C5EA 1JWAB 3H7AA 3UY4A 3NNDA 3N2LA 1II9A 3QJYA 3FLBA 4UPVA 1XL1A 2GAJA 2ETVA 1P2UA 3HJGA 4ZN6A 2A5LA 4NS4A 1C5KA 4NYIQ 2B6NA 1C7FA 5DTQA 5LOVA 5AQ1A 3MTDA 3U3MA 3ZZMA 2FGJA 3CWCA 4RVDA 1C3VA 3U17A 2BH2A 3FWKA 4KW7A 1X14A 2DWCA 3CNBA 2I7DA 1W96A 3NO4A 4Y1RB 4XX0B 5E38A 5BV1A 4LFAB 1BGXT 2J5RA 1C0PA 1ID1A 1S3IA 1UFKA 1G20E 2Y93A 4ZOAA 1DX6A 1G41A 2DBQA 4IGAA 3FD8A 3CLRC 4PHTA 3K70B 3QXHA 2BKXA 3R5KA 2YMMA 4D6PA 2QRLA 5EIAA 1WOYA 2PZFA 4DQUA 2PNFA 4J0QA 2JH3A 5KOYA 4KDEA 2BZGA 1SY7A 2O2GA 4LMAA 3RRJA 4YRZA 5J9FA 1M1ZA 3P9QA 4J2HA 3HXQA 4D43A 4WFIA 3BJRA 2B34A 3FR7A 1UDBA 3WP0A 2QMZA 4BBJA 4YMIA 3ANMA 2ZGVA 1V5WA 5JVDB 1VSQA 2PFGA 4ENQA 3SD7A 1FFSA 2ZVDA 3P9RA 2XITA 2CL7X 4JHLA 4P7JA 1W4RA 2R6GA 4N4AA 3PQ3A 5ESXA 1SU7A 1XRSB 1I7SB 3AR5A 4MS1B 4L9WA 1T1EA 2YV2A 4DEXA 3TKYA 3DULA 3TRJA 1L7RA 2E3JA 2ORVA 3OKFA 4RDXA 9ABPA 5HRCA 4DUZB 2BGKA 3MMXA 4ZGGA 1RXEA 1S8NA 4BXOA 2C2KA 3HJFA 1BVUA 5I9IA 1SB8A 2CHGA 2OEPA 1Z0IA 2NW6A 4U00A 5KKAA 4CMKA 2JHGA 3EVAA 1QBKC 1K86A 1DAGA 1VHLA 2HXYA 3A1FA 1KU6A 1F3OA 2H51A 3I72A 3FYDA 3H2HA 3ND5A 1FYXA 1PJ4A 2QZ9A 5IEJA 3K0SA 3LT2A 4DLTA 1E7YA 2IJGX 1G1MA 2QRUA 1X9IA 2QRJA 5TMDA 4NAHA 5AK4A 3H8WA 1UIMA 2B6HA 3EISA 4IAOA 4ETIA 3R8FA 4EJFA 3EY9A 4JGIA 1JDJA 3LTNC 4BO2A 5E7IA 1T0UA 4BNTA 1A9PA 2E55A 2NV2B 5L3SB 2GXAA 1KMHB 3VBEA 1Q6YA 2I2CA 2XADA 3LHKA 1N8SA 1IVNA 2QVXX 4HFJA 3TLJA 1KFJB 1GAEO 3QVJA 3X44A 4Q3KA 4DLBA 5HQTA 3IPRA 2VDOB 5IKXA 4EUFA 2YVLA 1DZ3A 3DKVA 4KFSA 2GJ8A 4X24A 5G1OA 2VWPA 2JFBA 4MICA 3KE9A 4KN5A 1RZ3A 3MGCA 4U6QA 3ZWPA 1EEHA 3G8DA 4L8WB 1QTQA 4Q3AA 3VSEA 1YZVA 1QH1A 3Q0EA 4G1VA 3F7OA 1NI5A 4JLNA 2WHPB 1GCIA 2PKQP 3KV1A 4YRCA 1FP6A 4I3FA 5HZGA 1R6UA 1RWMA 4L3WA 4MCAA 5ARBA 2C84A 2XMQA 4Z4IA 1V35A 2W2KA 4HSGA 2O8FA 3Q3JB 3G0CA 1EQUA 2BBTA 1RVV1 1ZBQA 2YH2A 1O94C 2RC5A 2VA9A 4J7CA 4R8SA 3AHDA 1Y6JA 1JHDA 1L5RA 1QIKA 2WW8A 3HBLA 3MIIA 3R6WA 1VRWA 3I9MA 4F2GA 5I7VA 4RL4A 5TR9A 2RIPA 4LGMA 2QY6A 4EL5A 4LWQA 2QJFA 2A59A 2AMFA 3G5MA 4NU0A 1GVNB 4QDJA 5HTOA 2RHDA 4NU8X 1PGPA 5IJZA 2OD7A 1NVUQ 1ISPA 4EJSB 3MINA 3ZLUA 4FWTA 3PS9A 2GCIA 3ANSA 5JV5A 1Y5RA 1P1RA 1PK7A 2RJ3A 3L02A 3PYXA 4TVKA 1X9GA 1OHHD 1NOJA 2CNDA 1A2BA 4EF4A 4QTTB 5G3YA 4QBHA 2JIZA 4ZCMA 5J58A 3IMEA 4MKIA 1C9YA 3A9CA 5KTKA 2CNWD 3U3RA 5D85A 5K8UA 4OL9A 2XUAA 5DYIA 3VC7A 3V4FA 3EUFA 4ILKA 4MB2A 4QYIA 3PZRA 2L18A 3ZLBA 4I08A 4FYYA 1XHFA 3HP4A 4QRDA 1O6CA 1UBKS 5MDHA 1ZCJA 2OG1A 2OM2A 3TI9A 4C0BA 4AW9A 1TAGA 1H5NA 1FYFA 3ADKA 3QP9A 4IIVA 4MINA 3HQ4O 3ZD6A 4TUYA 1XZMA 3PJGA 4BB6A 3ONVA 2OECA 2X58A 2YL2A 5D7NA 1T3TA 4ER5A 3C6ZA 2IYZA 2X4GA 1IN5A 3PICA 4NOMA 1H0KA 2E37A 4D4LA 4AUKA 2Z8YA 3K1YA 2OYSA 3GLFB 1ZVJA 1D09A 1KETA 3H2YA 3KEFA 4RGBA 1Z6XA 5F12A 3FG9A 3IR6A 5L95A 5DLQC 4AI6A 2Z4TA 2V9ZA 3L18A 1E2LA 1COWD 1ZI8A 4KFUA 2FEPA 2VNIA 4YEDA 4MDEA 2EGGA 5KTTA 3KXDA 1Q15A 3IODA 4QXMA 2XLBA 4TKMA 3WK9A 5JNRA 3FMFA 3IDAA 4K6KA 4WCDA 5LIRA 1GSOA 1T6XA 2FCAA 2XJ9A 3QA9A 4JYCA 3SI7A 1IN6A 2ILTA 4XJSA 3ZGXA 3OOWA 3R9IA 2I3BA 1E3MA 3MSXA 2JLWA 1OVGA 3O21A 4MV5A 2RFLA 1TU0A 3HN6A 4S1OA 4KIFA 4YCBA 1E3TA 3T9DA 4EPTA 4ZYWA 2BUAA 6LDHA 1NQWA 4GU5A 4R81A 4OFBA 4OKNA 5SY4A 1J0XO 1G7CA 3THXA 1NPTO 4QYSA 2VHTA 2ICAA 2CNNA 1O97D 1Z2EA 2V54A 4LDNA 1RPAA 4O2AB 5FR1A 3ETCA 3HB4X 1DX4A 4PFSA 2EGUA 2I8LA 1TJ5A 1GL9B 2OK7A 4YAJA 3CR8A 1KBZA 4XJXA 5ALOA 1VYTA 4QUIA 1H2FA 1T9KA 3TR0A 4D99A 3A6PC 3OHPA 2UZ4A 1NLZA 3UKOA 4L9RA 2IS1A 4MAMA 4FU0A 1GLVA 5K51A 2BMEA 1V16B 2IZ6A 3TTYA 2JKZA 2VBFA 3VSCA 5BUSA 5H3CA 2BMJA 1XN1A 1L5WA 2XD9A 4GOLD 1RPJA 2OZVA 1UOQA 5EIBC 1QZTA 5J4VA 2PJRA 3TW8B 5MGNA 1NSFA 5TNXA 3QLEA 3WBKA 2Q5QA 3A4YA 2AYZA 3KQVA 2J9RA 2OO5C 2XT0A 3VR2D 4UASA 1JDZA 1XDBA 1N34B 2DZDA 2JIOA 3SPXA 3VU3A 3WRXA 2LKDA 2X23A 4J4HA 4WBNA 3D0QA 4CLOB 3GFGA 3HXMA 4BV3A 3RIMA 3I1YA 4HCJA 2BFEA 1D2HA 2IUEA 3AUKA 2AZXA 3KZNA 3KPJA 1PDWA 2I6QA 2ZI7A 1Z4LA 2HAEA 4JJ6A 4AMUA 2F6RA 2OQIA 3ZGNA 1JG3A 2QMUA 3D6AA 3TRHA 2EJVA 1MAVA 2C4MA 1X7ZA 2N47A 4TVBA 1N6NA 3EXIB 1AD2A 3FPJA 4JUCA 4X20A 4YT5A 2GBGA 3HYRA 4QNRA 1XTSA 3VJLA 4LXXA 5LVAA 2XEDA 4NDZA 4U5XA 4INZA 4H4EA 4JA2A 4NCKA 2I67A 2IX9A 4ZALA 3TM4A 4IJUA 3W2FA 1V25A 1WY5A 3I2HA 1GRRA 4M0DA 3CZMA 1BMFA 4HQ0A 5BXQC 4N54A 1YVEI 2CYCA 4JT9A 5GONA 5B6PA 3I05A 1CQWA 1MFZA 3MGBA 2DX7A 4DR7B 5JCOC 1X15A 5K0GA 1VJGA 1YC2A 5FFNA 4PICA 1QIEA 3U7QA 2PS0A 2WYVA 3L0IB 3E18A 1LBIA 3FKJA 1TKCA 3D8HA 4YRPA 1NIJA 4R1OA 5L3ZA 1LQTA 2KB0A 5TB5A 3AK4A 3PBKA 3QV2A 3UMCA 1WBBA 2BE9A 3IKJA 3S2FA 1Q7GA 5IVPA 4F93B 1DEAA 1MCZA 5I4CA 4NV1A 3UMRA 3RBXA 3GLIB 3ANTA 3FHOA 2Q9CA 4G0WA 1LF0A 2FY8A 3OICA 5LMNB 1Q21A 3AY0A 1W8DA 2PS3A 3PL1A 5KNBD 3U19A 2ZRKA 3L7IA 4EVRA 2Q50A 1N3YA 4JYPA 5AJWA 3FUWA 1U5AA 1APBA 1PWEA 2QAJA 2C7RA 1SC1A 3TRIA 1GCUA 3EUAA 4HNHA 5L4LA 1I4DD 2R5NA 3AJ8A 1LSJA 2B83A 3ABOB 3IULA 1P81A 3NDIA 4ZOLF 4I2VA 3E6AA 4CUZA 4X1IB 4ERNA 1T0HB 3OQNA 3RSLA 4GM0A 1CUVA 1U0BB 3FCOA 3KWLA 1FPQA 1C9EA 2FFJA 2C0PA 2PS1A 3F5FA 4L08A 1RRKA 4AD8A 3GJ5A 1O95C 1NWCA 3R0IA 5FXMA 3ZLJA 5H8WA 1PJBA 2FI1A 4UDOA 1K4MA 3CWQA 1Z0UA 4E3ZA 1H23A 3H6KA 3FPGA 4V24A 3I6ZA 1KVSA 3NGMA 5DBEX 4FB5A 2K7ZA 3GAAA 4EQ6A 4O6VA 3OX4A 1WP9A 3DV0A 2XXBA 1RKXA 2G88A 3JQGA 2FUKA 2CF6A 1G17A 4KAXA 2G9UA 1IY2A 3BJEA 3PFIA 1ESCA 3QVKA 1I2MA 1KE2A 1CQJA 1RHRA 1Y6QA 5E3IA 2C9DA 2O48X 1IONA 2OBXA 1ZH4A 5LOVB 3BE8A 3LZCA 5EKXA 1Z62A 3FNRA 3THSA 4MW6A 5TPWA 1I51A 5G53C 1TADA 3VMMA 2PMFA 2VEOA 1H2AS 5E9WA 1XLUA 2CLCX 3SNKA 5KCZA 1PNVA 4HBZA 1ZN8A 2NVWA 2WMYA 4J94A 4EGCB 1MLDA 4IKEA 1JG6A 3DHEA 4QODA 4TYYA 1GDDA 3MAAC 1JDBB 1SOUA 3K0HA 5HYVA 1RE0A 1D03A 2B4TO 4K6GA 3AB8A 1WHTA 2GETA 2X15A 1T3SA 1Z33A 2IEGA 3T06B 3A37A 3O84A 3PPXA 3M9XA 4NV0A 3IBTA 3OSZA 1EINA 3ZHRA 3S8EA 2GJKA 3CF2A 4ZDWA 3B6JA 3KYCA 2WHEA 4O1IA 1RJWA 4PX9A 3LLSA 3VVMA 1Z0ZA 3GI1A 3I9LA 4JI3B 3W6ZA 1VG9B 1SRRA 1V1MA 2IOHA 4B3RB 1ZZEA 5CLGA 2VS1A 3MC1A 4GLLA 4I6EA 4OQPA 1VFNA 4NHEA 4RABA 3I9OA 2JKVA 5IKOA 3QKWA 3VYWA 3T1TA 4QOFA 3B2NA 1U3TA 4IH1A 5JATA 5JMOA 2WU1A 3DFMA 4NEHB 1X39A 1CJMA 2PX3A 5HF5A 3ZEIA 5LLSA 4PZEA 5A62A 4YBRA 4PSKA 1MX1A 4RVFA 3PXAA 1JXAA 1ZK2A 3EOZA 1DKPA 1Z6TA 4HVAA 2ISSD 1A1VA 2BHLA 1MDBA 2OD2A 1MENA 3Q9NA 4NR0A 1CTQA 5CH8A 3SXUA 5CLJA 1ZOPA 4K87A 4EDFA 1R12A 4NOJA 2P0YA 2H7CA 2PJZA 2R8YA 3HU1A 3VKHA 2D2VA 4F91B 3L7JA 2ZP1A 4AMGA 4XSVA 4EHDA 5TMPA 4TL8A 5LD2C 4UUOA 2QDXA 5D1HA 3ZXUB 1GTVA 3ZWVA 1FDTA 1MW9X 4V03A 1UP7A 3L4BC 3CLSC 1R1DA 1SIUA 4MWDA 3E9MA 1JJBA 1YB2A 2AMYA 3WL7A 4Q4CA 3ER6A 4JH0A 2XE6A 2Y2VA 4YAWA 3LUHA 1KS9A 2ODBA 5CA1A 1F06A 4XGNA 2GZ3A 4UHKA 1VE7A 3QUTA 5ILOA 1IHPA 4ZOCA 3SMQA 4B3CA 4B6SA 3MEQA 1PBTA 1NJ2A 1TE2A 5BVGA 4I50F 1FTWA 3UUWA 2J48A 2JGDA 1GGMA 2QN9A 3JQDA 4UVEA 5E1DA 1KSFX 4G0QA 3VO8A 2G9QA 4DXAA 3WL6A 4AG5A 1TQ6A 2O2XA 4OKSA 1WB5A 3HB0A 2AN1A 4BQRA 1QH1B 1NHGA 1FFHA 2E87A 2PHZA 4RV5A 1XA0A 3NMUF 2AN4A 1M66A 1M6NA 4GRIA 4DNOA 2ZYSA 3FHCB 3OZUA 2ZYRA 5FWXB 2W6ID 3LFHA 2W2KB 2J67A 2B2NA 4UHBA 4NPCA 1NJ8A 1SU4A 3NGLA 4G86A 5A3SA 1G2QA 2JZNA 1E7RA 3I2YX 2WOOA 4BX2A 3L7KA 4ZKDA 3ELYA 2Z8YM 3QFCA 1JHXA 2DRIA 1Z34A 2VP4A 4N9QA 4CYMA 4ED9A 5LMCA 2LVBA 2VJBA 3CUYA 1T1IA 2GRUA 2RKOA 2AQKA 4US1R 2GK6A 4D9GA 4MRRA 3WQHA 5K8VA 2ZW9A 4A0GA 5IANA 5KYYB 3OZTA 4G2NA 1VSUA 1VL6A 2FUEA 4LJ9A 5H4HA 2JLXA 2YIMA 2C0CA 1Z37A 1C9NA 1Z74A 2X9NA 1V4BA 3KJNA 2G63A 1TUBB 2PBFA 1EB8A 3A28A 4GXNA 2HSEA 1D4OA 1GNLA 1RWVA 2CYBA 3T3IA 3H5NA 3CMCO 1EM8B 2UAGA 4QQKA 4PLTA 4Z4EA 4FC7A 3NT2A 1ORVA 1LC0A 2IUTA 3BKXA 3ONWA 4W4TA 1ADJA 1USKA 2WEKA 1K5HA 5FL3A 4AO6A 5AM3A 4MV9A 4QYIB 5E7MA 5J4KA 3AVQA 4RELA 4UCFA 3UTDA 4PZCA 4C43A 4L6IA 4RK4A 2HWWA 3A6JA 4TUYB 4BKRA 4BV8A 3HR7A 1LBQA 4RD3A 3V46A 1N6HA 3VX3A 2B20A 4YV7A 4EG1A 5I47A 2CNBA 3CEPB 2QL5A 3ETDA 5AVVA 3ZHZA 1D1QA 3PGXA 2V4UA 5K8IA 4RTSA 3CVJA 1XOIA 1CP2A 1MVLA 1NNSA 5T41A 3BGSA 2V6BA 5SYMA 5INTA 2ZULA 2QW0X 2JHCA 3C3PA 3NIBA 3NTVA 4W5OA 4JXXA 1TKRA 3DZ8A 5H59A 3ZGYA 1J8MF 2VRWA 3MMSA 2B36A 2JPDA 4I9UA 1FUKA 2R11A 4BZPA 3WBJA 4P35A 2ZZNA 1NC3A 4EYSA 1M2OA 1XVTA 5CNKA 5HGJA 4XZ3A 1T2UA 3R3VA 4CTJA 5BN3A 3PB3A 4QHYA 3IEVA 1Y42X 4F12A 4LXUA 1N4AA 3AETB 3UUFA 3U1VA 4ENVA 16PKA 1UWCA 3O1IC 2QWXA 5L6MB 4E2FA 2IZOA 1ECPA 1O5OA 3FPKA 5J2UA 3ZHYA 3LG2A 3TDMA 5HE9A 5A4KA 2P6RA 1X80A 2B7BA 2AI1A 2QVZX 2VK8A 3E9CA 1HZZC 3N0RA 4L15A 4J4TA 4MIOA 4AT1A 3CX6A 3DR3A 3KHKA 4B9AA 4BWGA 2A57A 2YWEA 4JMLA 4TQAA 3ZZUA 5LP6B 1DB3A 2QG9A 3UWKA 1IOWA 3BBPA 1ACJA 3DDSA 4URFA 3VXKA 4C0SA 3BT7A 3OEWA 3ONDA 3RFTA 3KOXA 1ES9A 2XXJA 3GD5A 3LK7A 1TYDE 3UK0A 5DLEA 4CF4A 4RKRA 1QAQA 1A88A 2COEA 3VX4A 2EL7A 3HU2A 4RMNA 3TOXA 3V2GA 1UZUA 1EUCA 1T15A 1UZLA 3COJA 3K9HA 3AOEC 2QRQA 1SC9A 1YRYE 4AVYA 4ZOEA 3P9XA 1VJCA 1Q12A 4YUVA 1NJ1A 2A4KA 4KQ1A 4NV3A 2IPXA 3RRFA 4TTRA 4K9LA 4UAJA 1Q91A 4DJJA 4WOJA 2W8ZA 2A0FA 2HDWA 4RE5A 1Y9JA 4ZTUB 3IMGA 1FMLA 3R4VA 4OJTA 4RD2A 4Q9DA 5B58T 3EF1A 4NYIR 3OBBA 5D5QA 1LWNA 2BFEB 2P2GA 4UCQA 3LY7A 3KXPA 3P0RA 1UK7A 3SDBA 4BX8A 1RYMA 3QX3A 3INYA 4DSUA 1QHYA 2BGIA 3NEYA 4I55F 4NYJQ 2BFMA 2CNLA 3BFKA 4HT3B 1MJHA 4JI1B 1OF1A 1H6BA 1IZ0A 1RC0A 1IYZA 2HLDA 1Z2CA 3AHGA 3FLEA 3NV9A 3PKZA 1KAOA 1K8XB 2AXPA 3II6X 4RETA 5FBVB 3TFOA 1MEOA 4YJFA 3H1PA 4IQ4A 4LDJA 4GDMA 1Y48E 2FMKA 2HCFA 4MLDA 2ZR8A 5IJ9A 3VU1A 4DZZA 1EI9A 1XZQA 1XZPA 3ZDCA 2XMCA 2W9XA 4I1SA 4PFQA 4EAQA 5GONB 5TGTA 3CUVA 1EFRD 4ENUA 4JGGA 1TK2A 3FRJA 3NHYA 2YXLA 3Q5GA 4NAUA 1Z6PA 2Y1KA 2DUUA 5BYBA 4TT8A 5DYGA 3JZAA 3U7QB 4E6PA 3CLVA 4V0MA 2H9YA 1FLNA 3C8ZA 1P5FA 4IO1A 1ZFNA 3SM9A 4P33A 3MLAA 1L5NA 1JEOA 1DAOA 4S0ZA 3F96A 3FFTA 1EG2A 2CE2X 4B6EA 1JB9A 4LBVA 3GJ8A 3PHBE 2ODEA 1ZD2P 3ROQA 3N87A 4O1MA 4XTCS 3U7FB 3V4VB 1JE0A 1XIVA 1DWOA 4D46A 1KPHA 4D5EA 5IWCA 3VJKA 3DT9A 3IXLA 1YI0A 3OOYA 4Q7EA 2HA2A 4RVNA 5AM0A 5E1MA 3DD1A 4D57A 4BE9A 3AR8A 2PKEA 3D8BA 4NBVA 4QIHA 5C31A 3UAZA 3V3TA 2O59A 2FQXA 3TLBA 3DHVA 4Z9XA 5KYTA 3LYLA 2WWVD 4Z9YA 1WZEA 3B1YA 3EIEA 1ZJJA 1UBRS 5JNSA 5IM5A 5FBWB 4KIWA 4B83A 2O6LA 2OQ2A 3IQZA 5DX8A 2J0VA 3F98A 5EE9A 3VBCA 2JIRA 1QVWA 1J00A 3OIYA 3VR3D 5JU6A 1FUYB 2QROA 3B8HA 4I46A 4L7VA 1T0JB 5FL7A 5CDSA 6AT1A 5L9AA 5FPTA 1HTBA 3KWFA 2W4QA 5C37A 1FOEB 1QH9A 1AKTA 2D2XA 1DDIA 2H2FA 3MJHA 3V8PA 5JASA 3LQFA 3WJAA 4G1EB 4UNQA 3VPXA 2O2SA 1K6IA 4U1RA 3JQGB 4MYUA 1A97A 1YQEA 1FRZA 5FHQA 4C89A 3U16A 4JDUA 1CQJB 3AVTA 5DBOA 2ONYA 4F7WA 3BK1A 1VP3A 1X9HA 2PKXA 3LQQA 4LHSA 4MUMA 2XWSA 4LF4B 1ZIYA 4B6OA 1JZQA 2H54A 3MD9A 4RK7A 3I1JA 4M0UA 5E2IA 4CLHA 5TPWB 3O91A 2JRCA 5KAPA 3ORFA 5TF0A 2QX4A 1B8VA 2J0EA 1TK9A 2R87A 1M7GA 3BH7A 1VSTA 3HDYA 4I1IA 5EQJB 4DZTA 2O1EA 3W7AA 5JC8A 2C58A 5JQWA 4FI3C 3MGGA 1XZFA 4FFBB 5ELXA 3HGMA 4KPUA 2CZCA 3RU2A 1SULA 2VP0A 1SVMA 2DKNA 1GG5A 2AN9A 1M2NA 1ZNXA 1NDUA 4ZPXA 3D54D 1WHTB 2XTMA 3VMFA 4M7RA 2A9JA 3IUYA 5K01A 4ZQBA 3TD6A 1WIWA 4FR0A 5JZVA 3ZDZB 3AB7A 4R54A 4P0QB 2D59A 3HXKA 4G63A 1DGQA 2FUCA 3KYCB 4YECA 1FYDA 2WFLA 4AK9A 1QX3A 2VNHA 1EFPA 1QHGA 1NJ6A 1OX4B 1V1MB 1FY2A 4G37A 1N7IA 2PAAA 2ZDHA 3CLHA 3QV1A 3K35A 5FYQA 3TLAA 1OZAA 2XUFA 2Q4RA 5AOAA 1VKOA 2XMBA 1JJAA 4NU5A 4LZOA 3C6QA 2Q5JA 1IULA 2CL5A 4INOA 1YAHA 1I30A 3OAAD 4X00A 1W6RA 1VLMA 1X77A 3AUFA 3L8DA 2PD6A 2PMBA 1ACLA 2FWNA 4QVKA 3SXUB 5C1BA 2AKEA 5FBQB 2UZ1A 1J9GA 2CXTA 1NF9A 5AIBA 4CMGA 2DM6A 3S3TA 1S96A 1UBCA 3VHQA 4G24A 3SIRA 2NPOA 3PK0A 3ZDFA 3TX2A 4GEGA 3TXXA 1XDSA 1TVMA 5LFAA 4KBFA 3NP7A 4BNZA 2XWPA 4X6UA 3L7LA 3SKXA 4RY9A 2R7NA 3GFBA 1Y63A 4PLZA 3PFFA 5AHKA 3RUDA 4DBZA 1RACA 1OQAA 2CXUA 4G9BA 4BNFA 4PO9A 2D8MA 4PF1A 4TTJA 5CA1B 2PX6A 3ENZA 1K1EA 3IUQA 5M04A 2NTYC 1SXPA 4QUDA 2FB9A 3CIOA 1L7DA 1UM9A 2BSAA 3BH0A 4Q7MB 4Q4JA 4P38A 4R8KA 2V65A 3EFOA 5D5PA 5E4TA 5HQJA 3ZWDA 4AFNA 1PLLA 4DA7A 3EZ9A 3EW9A 2CJPA 2JGDB 4LNUA 2FFRA 5FNVF 1ZGCA 1NVAA 1R8YA 3K31A 1C50A 4LYYA 5TC4A 4X8LA 3U7RA 3WWCA 4IWNA 2VSQA 4BLOA 4ANFA 1W19A 4ALKA 5KB3A 2C31A 2F9LA 4AKIA 4Q9AA 3KO8A 1C0KA 1A9TA 1E64A 4JXZA 2XQGA 2QY9A 4D5GA 1CEXA 4NATA 3C16C 5K2OA 3OOHA 3ILSA 1VIVA 3JRNA 4L2IA 1Y6RA 2UYYA 1LRJA 3M1AA 3LQKA 3WGLA 4TWZA 4CG2A 2XGGA 2BR3A 3FCEA 2AX3A 3H5AA 1D9ZA 4R1SA 1XKLA 2Z30A 1W35A 3FOEC 1LVUA 3RSOA 3VNVA 3R9KA 5A06A 1OYVA 5KYWB 2RHJA 5SYAA 4HFNA 3H11B 1ZD9A 3I39X 3FTNA 2VJOA 4AS2A 2DKFA 5CRIA 1O03A 4Q9NA 1N2XA 1G7SA 2HJRA 4GLFA 3OQBA 1GTJ1 5ALJA 3WY9A 3AM3A 4RC9A 1ZOIA 1T8RA 4EI8A 2N0SA 1ST2A 3DEJA 1J99A 1N2JA 3TEMA 4YCCA 3FMIA 4IIXA 5JYCA 2E48A 1NVXQ 2RBEA 3QNUA 1JIQA 1EVEA 2AZ4A 2Q8NA 1KOFA 1M8KA 1UJ5A 3EEIA 3EPRA 1OH7A 1KJIA 2IXDA 2WZBA 1POWA 3IELA 1CVLA 1F3LA 4FXPA 2GESA 3NP9A 4XQGA 4IF4A 2X6RA 1CB0A 1MJNA 1PYGA 1YR6A 2V9PA 3B6MA 3P4XA 4QAJA 5FNZA 5DNYB 5F9MA 4M7OA 2B4RO 3HDJA 4J7XA 3R7WA 4S1NA 1XR3A 3U5TA 4ZVVA 3CNEA 4CR6A 2VUUA 4ND6A 2OCDA 1FXWA 1ZNQO 2FN3A 3KP1A 4N5DA 4QQRA 2VDNB 2FG6C 1CJVC 2QYHA 1HNXB 2PRYA 2PO7A 5LJLA 1N5RA 3CIFA 2XB4A 4M1WA 1G5TA 1PD1A 1JQBA 2JIDA 3IE1A 1JFFA 2VYNA 3LYUA 3PNBA 1QHHB 3N9IA 1G9SA 3V3KA 3AM5A 2BFWA 3LUPA 4RDCA 5E6RA 2OGZA 3ZE7A 5FR2A 4BO9A 2Q5FA 2IHBA 4H1UA 4I5GA 1MRNA 4QOIA 3S0JA 1N2BA 4BQEA 5JSUA 1NFRA 1E2JA 3Q5DA 2RD2A 3KB8A 2EKDA 4B0OA 1JLHA 1X1RA 5DE3A 1PR1A 1HDCA 4WY5A 2VZ0A 1FSPA 3UV3A 4HVCA 3WHPA 1RIIA 3M34A 3AIIA 1ILWA 1EHIA 3HPRA 4ZO4A 1U5BA 2XA1A 4G81A 2NXJA 1XVIA 5LQDA 2E5LB 2ZYGA 5KQMA 1NVGA 2OA0A 1AQLA 5DV9A 4ZAWA 1TLFA 3AYZB 2QTVA 5AM5A 4YV1A 3PRYA 4OOFA 5EOVA 3BHMA 2J9FB 1TVCA 4ZC1A 4JFRA 1FTQA 3OQ6A 4NBKA 3C5VA 3S6JA 2I03A 3C4VA 3R5HA 4HP8A 2QX8A 5JFGA 1Q0RA 2AQ8A 4E0BA 1EDZA 2PZAA 3VR1A 5IXSA 2HLHA 1N78A 5ALXA 2F67A 1EG7A 2P9GA 3DKKA 1RPTA 1T4CA 2H1VA 1KIFA 3JAKB 4LXGA 4MA5A 4A16A 3A4IA 1GD1O 1IQRA 2H1RA 3UCEA 3EGOA 4DMCA 3D4NA 3C5HA 3I6YA 2VA8A 5B1EA 3TN7A 1TA9A 3E5RA 4QOGA 4RZIA 5EKUA 1EUCB 5LZ9A 3DD5A 1ZHFA 1K5GA 4I8IA 4D42A 4R16A 5H5JA 4BB5A 2FOLA 4UMDA 2EJCA 4LQCA 3A6LA 3Q10A 4GGOA 4BYMA 2DTEA 2JK1A 1E9BA 1E98A 2AEFA 2REBA 3HV2A 3ESCA 4JU9A 4MEAA 5EUMA 3SU8A 4I1OA 1ZHHA 1WP4A 5F4BA 2HV9A 3LUAA 2VK1A 3CUWA 5AR1A 2W0MA 3RHTA 3QU9A 1U31A 4Q6WA 1KDZA 3IP7A 1XT6A 3X2SA 2DKOA 2I8AA 2HPVA 2Y1LA 3JQBA 4X41A 3C7AA 1TF2A 3MK31 3UMYA 4U6NA 2VATA 4GPZA 2GEFA 4JUFA 4LDZA 1B2RA 1L5FA 3I9KA 1FUUA 3NIFB 4JIGA 2HUPA 1SUFA 1H9AA 1Z5PA 5F2KA 2X7HA 3T41A 4B6FA 4A1OA 1F51E 1LFAA 3G8BA 1YHZA 1HG0A 2WWGA 1OFHA 3JVDA 2I7VA 2UVDA 5JJKA 2PLRA 4BBZA 2VOEA 3N0TA 4NZYA 4YJFB 5J43A 1W9MA 2GXUA 1M5UA 1ZD8A 5LZ4A 2RGYA 3B1ZA 3QOYA 1GZ5A 3FVWA 3KSRA 3DONA 3TL6A 4GMHA 2Q9AA 2ZWOA 4ZEVA 2WSMA 1L5HB 3LZ6A 4AQ7A 1I2BA 3VKWA 4M9RA 3KR2A 4IDEA 4QPDA 1IK4A 3PWTA 4QYTA 4OXKA 3ERCA 3SS8A 1CT9A 3SR3A 1Z4MA 2AUTA 2X5KO 2AS0A 4NPAA 4Y98A 1LQ2A 2M6LA 1FJ2A 4WWHA 5U4XA 4JAVC 2NXWA 1CKEA 1ZI9A 2ZUDA 4M0FA 4O4LA 1ZSNA 3F74A 3U61B 5K0TA 1IH8A 4NWIA 1X3LA 2WT9A 4WCFA 2DR2A 5TE9A 2AG5A 4KC0A 5HKOA 3DLTA 2BHRA 1XD2A 3TZBA 1BXKA 4HD8A 4ASUA 3K6KA 3PTAA 3KPWA 5FL7D 3REGA 2BR5A 4FGJA 2Z6AA 1CULC 1Y4UA 3N05A 4V0LA 4F6RA 621PA 3M6FA 3MBIA 3SJUA 1JRLA 3FM9A 1CZNA 1KSJA 4MWSA 2PSFA 1GGFA 3DT8A 1FUEA 1JAXA 2VF2A 4N6OA 5HZKA 4FR2A 3EEQA 2Z3ZA 1E9AA 4IJ6A 3RRZA 1HPLA 2YV5A 4D98A 2XQIA 3QQ5A 2JFPA 1CR2A 4IJMA 1W87A 4PTLA 5AXCA 3VTZA 3PXBA 4HLDA 1UMKA 3OBIA 5EIOA 5F2EA 4Q3OA 4MTLA 3FWZA 1SKMA 2FSGA 4R9VA 1RLTA 3FE2A 1LW6E 4S12A 1RLIA 1ODIA 1B4DA 4BGIA 2YIVX 2A1IA 2EF1A 1SQ6A 3KFVA 3JR7A 1F2DA 4IGEA 1YNSA 2YZKA 1W94A 1JTVA 2I2DA 4QLBA 1JQJC 4YUZA 5KO2A 4X1KB 3DLBA 4KLZA 1P39A 3HPQA 1U2DC 4XARA 5C1IA 1V8FA 1JHQA 1GPH1 5ICMA 3O26A 3Q2KA 1R0BA 1Z5NA 2H1SA 2A7XA 4YRAA 1MRSA 5AW1A 1USUA 2J5QA 3PNLA 5EHXA 2CDRA 2V6JA 2B78A 1NMSA 4OGLA 4QJ3A 1YKFA 2QM0A 4AB1A 4N82A 5F7XA 4EFNA 5KJEA 1KQGA 3VHRA 1ZI6A 4CIVA 1KY2A 3OEYA 4PGMA 1M8JA 1V95A 2ERYA 3E0XA 2OHIA 3G8CA 1WCYA 2OV8A 4JA0A 1HQKA 3HKBA 4HSEA 2XOXA 4KPUB 4NY1A 5ALHA 2F3QA 1W36C 2X8AA 2JZCA 3EGWA 2VHUA 3WYDA 1Z08A 4DA8A 5AQEA 2VZLA 1Z4QA 4QQNA 1CDEA 4WRRA 3V97A 3FI9A 3H5WA 4JQOA 4NJMA 3IAHA 3QZUA 3DV2A 5HEKA 1UFRA 2APJA 4QWWA 3WLHA 1XCOA 1YUBA 5AUPB 3WP1B 5CR9A 4YRJA 5BMVF 2WFLB 4J4BA 5F64A 1MAAA 3FNGA 2J3IA 2NPIA 3LDAA 4N7RA 1Z4JA 5BUZA 4XWGA 4EUHA 3J7TA 1WQ3A 2HC9A 4OHRA 4KUEA 3M1IA 1TZKA 3D8TA 4XUDA 1M1NA 4BVEA 5ITWA 2D0DA 1RC1A 4RSHA 1QP0A 3F9RA 4JYZA 2QOEA 2XODA 5C8YA 3TH5A 1AGNA 1MQSA 3BD6A 4UBIA 2QXTA 2GEKA 1TGYA 4PANA 2X0JA 3TZKA 3PZBA 4EZIA 1O6ZA 4Q4HA 4A27A 2YZNA 4KZPA 5J47A 4GYYA 2WB2A 4DJDC 1P9OA 1K3TA 2VHZA 4PSUA 2QUJA 5G0VA 1TOAA 1JN0A 2WINI 4HEA1 4L8YA 2EW1A 4LBWA 4IG4A 4FT4A 5K3BA 5EJ9A 2AZMA 2JH9A 2OAQ1 3OLZA 5CH5A 5FB3A 2HHHB 3I5XA 4GMGA 5REQA 3I8OA 5CA0A 1G21E 1RAEA 3F4LA 4CF3A 1VI2A 2GILA 3Q7IA 1SCNE 4JLKA 4XIYA 1K2WA 1K9SA 1PBNA 2XNDA 3G6KA 4AF6A 4LUCA 4OI1A 4MQUA 3GEBA 3OF5A 5EXPA 1J5XA 3CXRA 3NTRA 4JSTA 4BNUA 2QYOA 4FVTA 2RJOA 5HUHA 5AW9A 5JXIA 3VOTA 5ITVA 2QJTA 2QRVA 3MCTA 4PVCA 2SKDA 5KTMA 4ZT3A 1Z4KA 1OXUA 2QIPA 3LT1A 1ZWLA 5CHYA 1UM9B 1U8FO 3F71A 3HRIA 4L4SA 4N5IX 4Q4JB 2LIVA 3EFOB 2Z8XA 5JS2A 3W6NA 2ZUWA 4CXMA 1P33A 4Z4CA 4BCCA 3UBTA 3PE6A 3E7XA 4LNUB 2V7PA 2A3RA 1AK9A 3GGJA 3W3AA 2HF2A 4QPJC 1P61B 5AKJA 3SIWA 4A91A 2V7VA 1CF2O 5I4KA 2R85A 3MTIA 4L8FA 1PQWA 1DRJA 1YI8A 3BD8A 3FCYA 4KYUA 3S2UA 4EB6B 3ABRB 3IPCA 3JTMA 4L8LA 1Y1QA 4QELA 2F1OA 3SJCA 1FJHA 1H2XA 2BZSA 3KV3O 4XB2A 1DP4A 1ZKDA 2QNIA 4J16A 4AO7A 2DPLA 3T9FA 5HM8A 1OYOA 1OH5A 4F3TA 5TQ2A 4EG4A 4W9MC 4OI0A 1U02A 3NWOA 3HB5X 2AZTA 2HJWA 2NZVG 3CRRA 3WS7A 4CEJB 1KRXA 4LE0A 4Y67A 4QYXA 2VVTA 1JFLA 3HVUA 3TKLA 1G8KA 3LS2A 1EGHA 1LUAA 1LPSA 1PL0A 3L8CA 4UQPA 1PZGA 1FJGB 5IMSA 3JQEA 4IG9A 1ODLA 3NYQA 3D43A 5CBPA 1N2EA 4Z53A 4W6QA 3IE2A 2F17A 1N33B 3DF9A 1XQ9A 1HSOA 4HOYA 2FEMA 1OLOA 1FU7A 3LXUX 1VL1A 4J75A 1YOBA 5AKIA 2XCIA 1RQXA 2VT6A 2EL9A 4R3NA 3KFLA 5FBKA 4XWKA 2BHTA 2GZMA 2ODPA 2ZS8A 3ASZA 2EARA 3HLYA 4W1RA 4ZVPA 4DBLC 1IRIA 2JBAB 3TEFA 4OQZA 3T7DA 3VZDA 4MW2A 2QQFA 2GKOA 4YQYA 5D6OA 3RC2A 4DDMA 3N2EA 2IOFA 5AIAA 3EZNA 4ZRDA 3UV7A 2ZRQA 1E2GA 4AN0A 4C22A 1QG6A 3FRIA 1SHKA 3DHWC 4HVTA 3ICEA 4NYJR 3VR5A 3OU2A 4XWAA 2DB3A 5EC8A 3FVQA 4FOTA 3WYGA 4C76A 1JIJA 2I55A 4ND7A 3UVEA 1EP9A 1QE5A 4HTAA 2VHVA 2FZ5A 1P5RA 2OGUA 2QU7A 3ETHA 3GLSA 4C4XA 5GIPE 5LA6F 4AJ9A 3E1KA 1QLHA 3AI7A 3VR6D 1L7EA 2ZJ8A 1NUUA 1JFFB 3NTOA 4RO0A 4EMTA 1N36B 3DFUA 4PGFA 3ZN2A 4EK9A 5LQCA 4RPCA 2PS9A 5E6RB 5C1OA 1ZY2A 1E2UA 3ACBA 4XA8A 4ESEA 2PUJA 1I9GA 1S3FA 5C80A 4D3SA 4KOEC 1BROA 3VO1A 3WK7A 4JJZA 3IVAA 2DFNA 4F85A 1RM5A 4EHKA 2RH5A 4ETNA 3TUZC 3F97A 2M1ZA 3OQIA 5EJFA 1E1YA 3EDCA 4I2NA 4DLZA 1Z17A 3OSUA 4JWTA 1GKLA 3LHIA 4G56A 2XRZA 1CY1A 1U5BB 3HB1A 1JHRA 3A1WA 4BJ3A 1HG1A 2VSYA 4KJZA 1A9ZA 2JD0A 1HEUA 2PRIA 4Y2JA 2NZJA 4HBGA 1QIFA 2FQYA 2WUDA 1KH1A 3KZVA 4CMCA 3TIFA 3E15A 3TSOA 1VPDA 1NBWB 4J1SA 3DFZA 4JT8A 2VQ3A 5MFZA 1U9JA 3SR4A 3O2NA 3TIXB 3JQAA 1YIAA 4Q4AB 3WL5A 3ZS8A 4D45A 4IDQA 3L8YA 3MD0A 1DWQA 4EYGA 4NK4A 2VJQA 3NM5A 3BJZA 5DOZA 2Q6VA 3VPDA 3LCJA 3T9AA 3E9RA 3BD7A 4HDRA 3MCZA 4XLLA 5EXXA 5ICFA 3ZE8A 4Q1BA 3BTUA 4K0RA 1LSUA 1GRVA 1OC4A 1CUAA 4OU4A 4C3OB 4MHTA 4QVGA 3IHKA 4KZKA 3B36A 3DE4X 4CIAA 3UB3A 2C7BA 3EG9B 4G0MA 3ZGZA 4MB6A 3M4XA 4QGGA 4CHGA 3CEJA 2DHDA 5EKSA 1M2JA 4YO8A 1Y82A 1QB8A 3EYWA 5L8VA 2C9CA 1NOKA 3B3FA 2W4IA 1M6YA 1D6SA 3ITKA 2Y0BA 3COYA 4ZCQA 2W2LD 3OQHA 4R7TA 4GM4A 3BCUA 4OFWA 2A0UA 2I1LA 4FMDB 3PENA 1NMYA 1AN9A 2HDOA 4US2R 1ZR2A 2GAAA 2PAFA 4URZR 1NF3A 4XEUA 4YJDA 5ALQA 3BXOA 1XZBA 4RFSA 3RH0A 3ENWA 5JZMA 4M7PA 1MO2A 3LSYA 3MERA 1AMUA 3QX8A 1RTKA 5IUNC 2XTZA 4WL0A 1KI4A 3LUKA 5AOVA 4IR7A 1SKQA 1U63A 2ZM5A 4RPLA 2I4NA 2PUWA 1W93A 2DWPA 2ZDQA 1SQFA 1G5FA 4CM3A 5JIBA 1U98A 1N0IA 3IAS6 3KKEA 3COZA 3KSDO 4FW8A 1I5EA 4PTZA 1V4VA 1L9XA 3LQRA 4UHEA 2A5YB 2ZJFA 5BORA 5IRCD 1UJ4A 3TYXA 2RARA 3I83A 1EXMA 3IIKA 1IQ0A 4I81A 1LDNA 5J5AA 3UXYA 1I4LD 2XZTA 1XJ5A 3IAEA 2VDJA 3KJQA 4GNKA 5GJVC 1D7OA 4G25A 5TIIA 2Z2YA 1DRWA 1T1GA 3GA7A 3COPA 3GRAA 1QPGA 3G7SA 1Q1GA 3JATA 5F33A 3RABA 4F5DA 2N42A 3PJFA 1RLMA 3G82C 3PLRA 1RXSA 1T6NA 5LZ8A 2QRGA 5LKRA 1H22A 1XV5A 2QUZA 2AJTA 4OSEA 2HWKA 2WJPA 5B7NA 5JNWA 3ZJTA 1TEVA 3OCJA 5B2ZA 4WCFB 4OXIA 3K05A 3WLOA 1XD2B 1B8OA 4ZVKA 3ZI7A 4IEEA 1CRLA 1J4AA 1X7HA 2EW2A 2VYVA 3K0FA 4Q9JA 1VLHA 2WA2A 3KE8A 5J40A 4AY4A 4KGVA 3Q8KA 2QMEA 2CFCA 3OTIA 4F6RB 2E4AA 3RU7A 2XTNA 4G26A 2QZJA 4GPAA 4OUKX 2OBBA 3A11A 3CZAA 2QQ0A 4GL4A 4ZPJA 4C6SA 5CFMA 5HX7A 2AG0A 3G9QA 4AKSA 1MX9A 5TY0A 5EMMA 2ZDGA 3LHDA 3DAYA 1W1IA 3N8KA 3R5JA 4R84A 1VXRA 1JBEA 4I4NA 1KO5A 1A2QA 1U2QA 1XXHA 1TEXA 1K4YA 2R6CA 1KMCA 3BSWA 3KQWA 3TZCA 2QTBA 2P4SA 2YUTA 1GYPA 1B74A 1C8LA 2QTLA 4IHJF 4OBBA 2LDXA 3FMGA 1N92A 4FDTA 5DLYA 2HBYA 3WA6A 1Q0UA 1TM7E 2IKQA 1GTL1 4KH0A 4O4IA 2FK8A 1KMIY 4DN6A 3HR8A 1HA3A 3PGVA 2WB4A 3O2JA 5D3ZA 1Z06A 4N1AA 4Q1CA 2NYUA 3SYMA 5IVKA 4CM9A 3NFYA 2JDID 3NGXA 2GARA 1YGYA 2FAXA 1V45E 1XD9A 2O50A 4MCJA 4PPFA 4Z7JA 2OG2A 1E59A 4AJEA 1YL5A 4QNMA 5TT0A 1YOVB 1NRJB 1P3JA 4RQUA 3UEOA 1GTG1 1A0OA 1NIPA 1NNUA 1U0JA 3FVTA 4RZXA 4ZRMA 3IA2A 3SEQA 1KI1A 1T1SA 3QX7A 3VH1A 1I0LA 1VGVA 1Y7PA 2C4WA 3DKPA 5CUQA 4RMHA 5CVDA 1UBHS 5AI8A 1M2GA 5AJHA 3IBCA 3OPVA 3S55A 3Q41A 1E3DA 3PFCA 1XVVA 3FFWA 4J3NA 3WJ2A 4EP1A 2VAVA 1AHIA 4E12A 3T15A 3U48A 1HRKA 1T29A 3E2PA 2PLNA 4PN3A 1I1OA 2R4QA 1FTYA 2VR1A 1SBIA 1R6BX 1LWOA 2IQ5A 1EJ2A 5JVDF 2H4HA 1RXIA 3GLRA 3KOUA 4HKTA 1QF6A 4U2KA 2XF8A 1ZITA 2YQ4A 2DQ4A 1N2HA 3WK5A 4MYCA 3F4BA 5EMHA 1LB1B 2C2XA 2P9HA 2GDJA 2GBLA 2VJLA 2XMZA 3Q40A 5EIBD 5C7YA 4C0KA 2YXPX 4NP6A 2AJLI 3GJQA 3WXMA 1LC3A 3AL0C 4XIGS 2CBZA 2R4UA 3ZCXA 5IKMA 5JEEA 5EP1A 2G7ZA 5CFNA 2HRBA 5FPKA 3BIOA 1NR7A 5KSWB 4NJMB 2XNKA 2PMEA 1NRIA 3FSGD 4EI7A 3N2GB 4JB2A 3TCNA 5HNKA 5DHFA 4B3JA 3V4RA 1NGSA 1KY5A 4WKPA 3HNRA 3PWZA 5DTEA 2QU8A 5CX1A 3H75A 2A88A 4C30A 3HCWA 1W0KA 4NBLA 1VGQA 4YC7A 2XA9A 4LGYA 4H31A 1M1NB 4KV9A 4MGZR 1KMMA 4OHVA 4OB6A 4YJ3F 3EPHA 2A9KA 2GKGA 4OH7A 3AI3A 4WVFA 1DRVA 1AQ6A 2ZM6B 1X1QA 1JS1X 2BEVA 4RAOA 2YIDA 4Q4HB 2W43A 1BU8A 3GBPA 2QD2A 5LYJF 2HTEA 2B21A 2QGFA 2QMOA 4X6YA 1JIVA 3KALA 3OCYA 2W6CX 3CH7A 4ZMSA 2DU8A 1WX1A 3COVA 2O54A 3RFFA 4TT3A 1ESMA 1ZP6A 5K3FA 3IBSA 3CXUA 1UBNA 5KIAA 4OLHA 5REQB 1L5SA 5CA0B 1LDBA 1QFZA 5A0VA 3OC0A 3TI7A 2DBZA 2CXXA 2R1TA 3DDWA 3F47A 1CK4A 3H5OA 3Q15C 4KLNA 3WGHA 2F7SA 5JCPA 4UUMA 1DCKA 2G1KA 4L8GA 3H2ZA 1OILA 1KFCB 4PZ0A 3L1HA 4C3ZA 1IVYA 4TMFA 4TWJA 1LNZA 1SU6A 1Z22A 2MR6A 4ZVRA 3NWEA 2REQA 4XRGA 4PW0A 4UXIA 4LRYA 2VOJA 2G9RA 4I1YA 1QZUA 3RF7A 1YCGA 1L3CA 3QU4A 4GOJA 4HLUA 4RZSA 4DDWA 2HK7A 2NXCA 4R1MA 4NJOA 4KQ9A 5C0OE 1YR1A 2FA9A 3FKQA 4ZCIA 2EG9A 5CYOA 5MGBA 5MHTA 3IP5A 2MJLA 3RRNA 3C1TA 4EITA 4JP3A 4ZXPA 3W5UA 5HUJA 3IP6A 2CFRA 1G291 4YB8A 3RBZA 5IULC 4IGKA 1AA9A 3S2YA 2RGXA 3ID6C 4DNQA 1PQUA 1QO9A 3JQ7A 4CHTA 3MAJA 3TNLA 1FNCA 3EFHA 3NDJA 4MAFA 1U0FA 3TRDA 2VAXA 2VXOA 1HYBA 3X3HA 4G0NA 3W1WA 1RXVA 3BAZA 5ALUA 3Q8XB 2ZETA 721PA 4LWOA 4GLOA 4KHZA 2HJGA 3NJ8A 2OY0A 3Q2IA 3Q7QA 3V5NA 2ZQYA 2J9YB 1FLVA 1ZMRA 1JP7A 3DDOA 4QC2A 1E6UA 4PCUA 5IZCC 1Y1SA 1XP8A 4GMFA 1ZK4A 4QEDA 3VV3A 2EW8A 5DN6D 3LRTA 1WETA 1J09A 3Q5EA 1BZYA 4AAYA 2PUTA 2VTVA 5CBPB 4TXLA 2BEUB 2WFZA 4MULA 2WM2A 1KJWA 3OJLA 1R10A 3RAGA 1HR0B 2AMVA 3WWYA 1P2BA 2PCLA 2J9XB 2ZEJA 3QMVA 4LJYA 4OQQA 1V9CA 1RXCA 2VQSA 5SICE 1Q0TA 1SVOA 2RGWA 3LO8A 3RVPA 3VFDA 3DWEX 3JD2A 2V3WA 1UDCA 1YR9A 1AQNA 2XUIA 3TCXB 2RB4A 1QH0A 3L0CA 3HUUA 1V26A 4OX9Y 3OZCA 3WKDA 1FIUA 5JC1A 3FUVA 4ESVA 2OHVA 3DZIA 4QUBA 2A5FA 1OASA 5I7UA 3ME5A 1IJKA 2WWHA 5LMZA 2BCGY 3O3NB 4MX8A 4WUVA 1CLEA 1W49A 1YGPA 5K3AA 4GPD1 3GRCA 1BFDA 2ZT7A 3W5BA 3DM9B 3OKAA 4EA7A 3NOOA 3K8ZA 2BF4A 2EDCA 3FB1A 4TSFA 4IZ6A 3RS3A 2Y4NA 2E5WA 4PZYA 3C3CA 5IJ0A 2XT9A 2C2OA 2W00A 2YWHA 4AURA 5CDTA 8ABPA 4KWCA 2NSDA 4GYJA 4UFNA 4W1SA 3LC0A 1ST3A 3IUNA 1NLMA 1T2VA 1ODTC 1B8PA 3OCZA 3O9ZA 2G70A 2HF8A 1G3IA 3FN4A 4O2AF 2FEOA 4LY6A 4X91A 4GGPA 1RE1A 3HVHA 4KYIB 3UAOA 3ZEAA 2DSNA 1M6WA 1JF8A 3PHGA 5FA6A 2GD2A 4IYRA 1KQPA 3IT2A 3V1YA 4C0JA 1GGNA 5TQ0A 1P9RA 4DG5A 1IAVA 5IYZF 4FFVA 1VMEA 4J0KA 5FV7A 4OQLA 5LPNA 4OA5A 4F5ZA 1GADO 2GJSA 2FEAA 1SXJA 2ENWA 2IIVA 3JRXA 3DC7A 3GLHE 1GZSA 2JS7A 1RCTE 3HCEA 1UFOA 4H7FA 5LKAA 5LN1A 2ZJ7A 5LQAA 2CV0A 4BNVA 1HWYA 1JU9A 3OTQA 1OB5A 3C3AA 1JXMA 5CFPA 1A7AA 4PYJA 5CD1A 1KO1A 5BQ5A 1P8JA 3JQAB 3MTEA 3QWHA 2C78A 2VPPA 5CNIA 4QATA 3HFRA 3I28A 5JZSA 1NTOA 3F7MA 4G8DA 2C57A 1TQ4A 2V7UA 3E0QA 2YVQA 3BCSA 2I4OA 1QVAA 3CLSD 4KN6A 4PY2A 4AX4A 3AKZA 3TEJA 1L7MA 3BDVA 1NOIA 1CY8A 3VUFA 3AEKA 4L4RA 4N7MA 3SOZA 2D2FA 3NAZA 5JQGA 1GZHB 1A7KA 1T2AA 3TR6A 1MUUA 5K0JA 4YHHB 1JE1A 4X1YA 1NN1A 3IQDB 4FEGA 1RLJA 3BWCA 3D9QX 3K1ZA 2CK3D 2WJ3A 4WZ6A 4LJKA 2WKQA 2JI6A 2OHOA 2B4AA 2WFMA 3F49S 1CUFA 3IYLW 3MG9A 4UM5A 5TX7A 4MWTA 3KQPA 3G2OA 1NRXA 3JD1A 4AYTA 5A4IS 4RV9A 2WPDD 4RK6A 3SVZA 1TYAE 2R3SA 3D3NA 4A6DA 4B40A 1N5OX 1IY0A 2GCPA 3BSFA 1MB4A 5DYWA 4IQGA 5AVKA 2CEKA 3OX3A 2P9EA 2BM1A 5C9ZA 1PCXA 2YX1A 1EX7A 4U5QA 5EUQB 1SXHA 2C03A 1MT3A 4ZD6A 5J5CA 1M1UA 3U39A 3WV5A 4GDFA 5I8PA 3O8QA 1NPDA 4E1AA 4YCMA 1O0CA 2FRDA 2AD5A 4MYSA 3HHPA 3NBAA 3FPLA 4YWHA 3G0HA 5FI5A 4TQGA 5EZ6B 1JALA 3L0ZA 3TXYA 1G42A 1OXKB 1RAIA 1CIPA 3I6MA 3L1KA 5EHQA 2IYSA 1QHXA 3KZKA 4FYHA 3PT9A 4JLOA 2DQKA 2QN6A 4QQFA 4X45A 1AN0A 1CU1A 5FA5A 3VPBA 3VDQA 1CR4A 1TRHA 1KI6B 2OC9A 2FPWA 1W5TA 3M0EA 3PD0A 4BFVA 2GD6A 3JATB 2V5VA 3T99A 1F7UA 4FE3A 4RYDA 1YTUA 4MH0R 1GNQA 1GA1A 5BOSA 4B34A 3VYUB 1WPQA 5HMMA 4HGZA 5SZIA 3UWMA 3I30X 2ZJAA 3BGVA 5IP5A 4JJFA 1C1HA 4WXHA 3JQPA 4KO8A 3B7PA 4HNRA 2GZ2A 3QU7A 1IXSB 2DPHA 4FXOA 4MR7A 2HYIC 2H57A 2GO7A 3K0FB 1TIKA 4PXAA 4IDCA 5IARA 1W7AA 1UDWA 1U2GA 4S35A 4J3FA 3MS7A 4UNSA 2E82A 2NU8A 2R00A 3RS4A 3CRVA 4FFLA 3TLEA 1SQGA 2BL4A 1KXJA 2AN3A 3QELA 4W9RA 2IDKA 4PG5A 2IBSA 3R3HA 2JAUA 4JP2A 3RSGA 3W3ZB 2WHYA 2P5UA 3AFIA 3DYVA 3KWMA 1BDBA 2GF2A 5F4ZA 5BW6B 2BP7A 1XXHB 4JUIA 3TQTA 1I80A 1OXBB 1L7BA 2JEOA 3MGKA 1U2ZA 4GKBA 4LJ6A 3SE7A 2J3EA 1V1RA 2GFHA 3HWSA 2V6FA 3AP1A 1GL7A 3SC2B 1GO2A 3HI6A 4P08A 1DOZA 1CCWA 1W25A 2FSPA 2LZ0A 3IAM6 4MHSA 5AHRA 4AG3A 1DAEA 1XZCA 5CM9C 4O4IB 5K0ZA 4EARA 5JSZB 4Y6QA 1L4YA 1N2CA 5FUXA 7YASA 3PLAE 5HFAA 1LI5A 2Y0CA 4W1PA 1PDVA 2XQJA 4OMFG 4LBYA 5M3BA 1IL0A 3L93A 1OAOC 5I01A 3D0KA 3MJRA 3R3JA 4OYHA 3T6KA 1N6KA 4U8HA 4Y2YA 5DLDA 4QSHA 1NRWA 2HREA 1XRQA 3NHAA 1IK6A 2WKSA 1H8EA 1TCBA 1YU9A 2I29A 5AVRA 1OX5A 4D8YA 5JFTA 1JKIA 2DLDA 4LY9A 2P5YA 1RHJA 1QVRA 1MB0A 2FX5A 2R6FA 2JA2A 4EYEA 1PFKA 1V3VA 4IRXA 3AHFA 4XGRA 3L8ZA 4GUDA 2I65A 3ZOKA 2QI9C 3PTZA 4I1RA 1AUOA 4CNBA 5B5SA 3PQFA 5KYWA 2ORED 2DFPA 2IP1A 2G25A 3PF8A 3TL2A 3W5AA 5AXBA 3E9YA 3P9SA 1FLDA 4QLOA 5E8JA 1CNEA 4AP9A 5LXTB 4TRNA 1M0WA 5IU6A 4AJKA 3OE7A 3GC6A 3A1CA 1VE5A 1A4RA 1GGVA 2X76A 3QY0A 4OGKA 5IUJC 1C9KA 1WV0A 3A4NA 4WE3A 5LP1A 1ZJWA 1ZA1A 2W71A 2YV1A 3KSUA 3NCTA 2C4NA 4J0GA 1Y3AA 2QRMA 3QVOA 5EERA 5LP6C 3RSCA 4ACAA 4DTIA 4DRXA 1P4GA 3V4OA 3WL4A 4CM7A 5JDIA 1FMCA 2OZEA 3V4PB 5JJ5A 4RPJA 2H18A 1VM6A 1IWPB 3RUHA 1G21B 5G0UA 4EW2A 4OQDA 3E48A 5HKLA 3CZ9A 1KQFA 2DPYA 1Q7RA 2YASA 4QG7A 4IFTA 4X60A 5CX1B 5D6NA 2BFNA 2ID7A 3DLHA 1SVUA 4XGKA 1IZ8A 2FNAA 3WLFA 4HGNA 4WEOA 3JYOA 4LKRA 4Q9IA 3UANA 3MWEA 5B7QA 3DTVA 4CCYB 2CFSA 3IA7A 1ZW1A 1TYBE 3DXYA 2CCKA 2G71A 3AVOA 3E03A 5AXDA 1R5OA 3FX2A 4P84A 5GOZA 4DV5B 3A8TA 3M6UA 3E7WA 1X1CA 3BEOA 2II6A 4YT2A 1NQ5A 2EFYA 3RBVA 4NJEB 2QXYA 8ADHA 3SGLA 4LXQA 3K6RA 3AHHA 2BAGA 4Z9BA 4M1OA 5T57A 8LDHA 3K94A 4AKTA 4BVKA 1Z7YA 3FGNA 5TPZA 5K3FB 5LQNA 1YVPA 4LF7B 1E2FA 3DXXA 2FWPA 4Z4GA 3MLBA 1TVEA 3W6PA 3FMVA 4Q9KA 2R1TB 4X85A 1NU6A 1NUQA 2J3QA 3SZOA 1Z5GA 1L7NA 4N41A 4FTWA 4X90A 4AP6A 1HMPA 3ECSA 3WX0A 4AZVA 5L45A 1E79D 1C3OA 1OLSA 1MAWA 4MDYA 1NVDA 1CR0A 3A6ZA 3BE4A 4Z3OA 5GGXA 2A0XA 1AKEA 1U6JA 3KVVA 1ECCA 4EF6A 3W2HA 3MRSA 2JGEA 1W1UA 1PFQA 2VXYA 3RLIA 2ODTX 1E5VA 3GG9A 3RK0A 1B14A 1HK7A 4CV3A 3DZBA 1VHDA 2YV4A 3AF3A 1KI8A 1T5BA 1VHQA 2CD9A 2PZMA 5BRAA 1KHHA 2IOFK 3VZRA 2MINA 5EJ8A 3ET4A 1S2NA 2VK2A 4PLCA 2XGJA 1TO2E 3QXSA 2I33A 1CUDA 1P2GA 1R00A 3FGZA 3H4MA 3A26A 4IOKA 5FPPA 1L1FA 4EEKA 1GR0A 5EIEA 5HSGA 2JJ1A 1WCWA 3AJRA 2ZVQX 4HYTA 1ANKA 3MUFA 5HCIA