2H6FA

Protein farnesyltransferase complexed with a farnesylated ddptasacvls peptide product at 1.5a resolution
Total Genus 134
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
134
sequence length
315
structure length
315
Chain Sequence
FVSLDSPSYVLYRDRAEWADIDPVPQNDGPNPVVQIIYSDKFRDVYDYFRAVLQRDERSERAFKLTRDAIELNAANYTVWHFRRVLLKSLQKDLHEEMNYITAIIEEQPKNYQVWHHRRVLVEWLRDPSQELEFIADILNQDAKNYHAWQHRQWVIQEFKLWDNELQYVDQLLKEDVRNNSVWNQRYFVISNTTGYNDRAVLEREVQYTLEMIKLVPHNESAWNYLKGILQDRGLSKYPNLLNQLLDLQPSHSSPYLIAFLVDIYEDMLENQCDNKEDILNKALELCEILAKEKDTIRKEYWRYIGRSLQSKHST
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Conversion of protein farnesyltransferase to a geranylgeranyltransferase.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords Protein farnesyltransferase/geranylgeranyltransferase type I
total genus 134
structure length 315
sequence length 315
ec nomenclature ec 2.5.1.58: Protein farnesyltransferase.
pdb deposition date 2006-05-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01239 PPTA Protein prenyltransferase alpha subunit repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.120 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Protein prenylyltransferase 2h6fA00
2H6GA 1D8EA 4GTQA 1TNYA 1NL4A 1FT2A 2H6IA 3Q7AA 4GTMA 3Q73A 3HXCA 3PZ4A 1N9AA 1TNBA 3EUVA 3E32A 3EU5A 1TNUA 1KZOA 1TNOA 3Q78A 1S64A 3HXEA 3DSTA 1DCEA 1JCRA 3DPYA 1N4QA 2R2LA 3E33A 4MBGA 1LD8A 1TN8A 1TN6A 3DSSA 2F0YA 1MZCA 3C72A 1FT1A 4LNGA 3Q79A 2H6FA 4GTRA 1TNZA 1LD7A 2ZISA 1O5MA 3E34A 3DSVA 1O1RA 2BEDA 1N4RA 1N95A 4LNBA 4YDOA 3E30A 1N4PA 3PZ1A 1N94A 1SA5A 3Q75A 4GTPA 3PZ2A 3PZ3A 3DSWA 1SA4A 1X81A 1FPPA 3DRAA 4GTTA 1KZPA 4L9PA 3SFXA 3HXBA 1S63A 1NI1A 1JCSA 3KSQA 3Q7FA 3HXDA 3DSXA 2ZIRA 1QBQA 4YDEA 3E37A 2IEJA 1O1SA 1N4SA 2H6HA 4GTOA 1LTXA 1JCQA 3KSLA 4GTSA 1D8DA 1O1TA 4EHMA 3SFYA 3DSUA 3HXFA 4GTVA 1TN7A
chains in the Genus database with same CATH superfamily
4G26A 4CZ2D 1KLXA 1TNYA 1PAQA 5EN5D 4EBAA 4G1TA 2RFAA 2CFUA 3LS8A 4NIKA 5B1AE 3D9JA 3S7FA 4K5AB 2KZTA 4MS6A 3R9AB 4GB9A 1BPOA 5CBNA 1TN6A 1OXJA 2J4DA 4EZKA 3U9WA 1HO8A 5EIDA 2WXJA 4HOSA 4I9EA 2CG2A 4QFVA 4APOA 4J0UA 2AWIA 5CCMA 5KCMA 1N95A 3HVEA 1MQSA 1WG0A 1UG3A 1DCQA 3JQ1A 1KPSB 3LY7A 4L2YA 5FT9A 4HORA 4UWKA 2CFZA 1K1AA 4AY5A 4L2LA 2HE0A 3D9OA 5EYLA 2WXMA 2KATA 5BXOA 5C1DA 4I43A 4YVQC 4FHJA 2R59A 3DSXA 2GROB 3D9NA 4GMRA 3CSFA 3TJPA 2IU1A 2PM7A 4UQXA 3GZ2A 2E2EA 5JJ6A 4Q96A 3GZ1A 4I2WA 4CDNA 3CVLA 1A5EA 4I17A 4ILGA 1HF8A 3C3RA 3RO3A 3IHVA 3UT4A 4RQIA 4XI0A 3TWWA 4FHKA 3RSEG 3ZFWA 2ILRA 2BF0X 3VLFA 1E90A 3UXGA 2J8SD 2VJ8A 4K5BA 4FULA 3TGOA 5FJYA 3UUXA 1HXIA 4MBGA 3WG7E 1E7UA 2LO6A 3OXFA 1E8ZA 3FDHA 1OT8A 4KBQA 5FQ6A 5T8IA 2HM8A 2KCLA 2BTDA 4K5CA 3FU3A 3X2QE 4C48B 4WNGA 3WXXA 3D3MA 4KZCA 4W9RA 2WQ7A 4DX6D 3UKRG 5HI7A 2NSZA 4LERA 1E7VA 2QYUA 3QOUA 4HI8A 2WB2A 3FU0A 3FUKA 4DK5A 4C0MA 3LDZA 4BTAA 2XGOA 5DIZA 2R17C 1EDUA 1OUVA 3I4RB 3ML8A 1MYOA 4JHRA 5ENQD 1LTXA 1JCQA 1O1TA 2GRQB 4KT6B 2VTBA 4G11A 4HRMB 3OTNA 3PNTB 4HOTA 2WQ6A 4UI9C 3Q7AA 4H7YA 4JD2G 3UPVA 2WXFA 1YA0A 5LCWJ 4PS8A 2X6IA 1N9AA 1MX2A 1TNUA 4J8FA 2P9PG 2GGFA 3AG4E 4BY6A 3DSTA 4CT4A 2XRYA 3R7QA 4JZYA 4LRZA 1OWOA 1UJKA 3CV0A 2OV8A 5HS0A 4EECA 4LG6A 1HE8A 1QZ2A 2ZISA 5ENTD 4C9BB 4BX9A 4G8LA 4K03A 1K3ZD 3E30A 3ZIMA 3PVLA 1ELWA 3EIJA 1VDYA 2KC7A 4GTPA 2X3MA 1W3BA 3APCA 2VTBB 1SA4A 4GZCA 4G24A 1ZBPA 2L9BA 1U3CA 4WNEA 3ASOE 3LVRE 2V5QC 3SBSA 2AVPA 1N4SA 2GW1A 2H6HA 3EDTB 3MKQA 4JA9A 4CDMA 4PS3A 3EU9A 2YHCA 2V8SE 3ASNE 2VQ2A 3EHNA 3SNXA 4BERA 2I2OA 1L5JA 4GTQA 2WM9A 3ULEG 2DZOA 5BXUA 5KBAA 2HYZA 3V31A 2WXKA 1HZ4A 3J5QB 2VSYA 3HXEA 4J6IA 4XIFA 4O1PA 2IONA 3RKVA 3OXLA 4URKA 3JXIA 3CEQA 1B89A 5JA4D 2WXOA 4BEPA 3EHQA 4GTRA 3LPZA 3L82A 4TUUA 3TWTA 1HU3A 5LP0A 2WXQA 2NXPA 1N4PA 2QC9A 2XCBA 3QNKA 5M72A 3PZ3A 4J8SA 3LEWA 3V30A 1TR4A 3LKUA 4TXQA 4A3TA 4GMLA 4GA0A 2GRLA 3MX3A 2VSNA 3QJZA 2X6FA 2ZIRA 3CHSA 1KT1A 3UM0A 3PH0C 2MHKA 5CEDB 2KCVA 4B94A 1Z3YA 4JXTA 3LVQE 1E8WA 1H6PA 2B6CA 4IYPA 3SBTB 3R7RA 2IJGX 4JVSA 3FEXA 2FO1E 4TRQA 5A23A 2WXGA 3E32A 2FULA 2LXLA 1IHGA 4Q94A 3CK8A 1FVFA 2YQ8A 1AP7A 3ZUVB 2VSXE 2RFMA 3TWSA 3V79K 4TXPA 2QFCA 3JYSA 5JHBA 3PUKA 4I1OB 2WXNA 3L54A 1UN9A 2F37A 4JC8A 4ANWA 1FT1A 2J08A 4U0ZA 4NQ0A 4APFA 2C0MA 2P58C 3ZGQA 3VTYA 3U64A 3Q47B 3FH7A 4HQDA 4BT8A 3B13A 3NAWA 3UKUG 2XGMA 4E85A 3PZ2A 4LUNU 3SZ7A 3AG2E 4DLQA 1A17A 5G05J 5C2YA 2IOLA 1OWPA 3ZYMA 2BKGA 3ENEA 2EINE 3ISMC 5KJNA 3FTUA 3ONKA 2IEJA 2XS1A 1U3DA 1BU9A 5A6CA 3ULQA 1IKND 2ETBA 4HOQA 1ZU2A 3CVWA 1V54E 4J7WA 1JUQA 4ATGA 3ABKE 3KAEA 2AXUA 3PREA 5CBOA 3AS4A 1TYQG 4KYOB 3FEYA 1EYHA 4ILIA 1TNOA 1S64A 1E8YA 4OYSA 3CLJA 3D9HA 1N54A 3Q15A 2C2LA 2WXRA 2DIWA 2WXHA 5J90A 3LY8A 2X6JA 5EX3A 5ENRD 5FTPA 2AXZA 1MZCA 3EHMA 4MLPA 4RSYA 1LD7A 3AAAC 3DSVA 3FFLA 2LAIA 4YDOA 5ENPD 5G04J 3SQVA 2UWJG 3Q9UC 1NFIE 5BT1A 5HQ8A 1N94A 3NOGD 3ZHEA 2WVIA 5AQ7A 1NA0A 4U96D 2V5FA 1N0QA 5CEAA 1S70B 3U4TA 3DRAA 2OCCE 5ENOD 3SHFA 4M3OA 4PS7A 5EILA 1MHQA 1OWLA 3ULYA 3CQCB 4N39A 2PQNA 4CT0A 3CKCA 4TXRA 4JEHA 4RLYA 5ARGA 3FTSA 3LCAA 4EHMA 3Q5MA 3FTWA 5E75A 5AENA 3LYAA 5D0QD 5KWDA 4GTVA 3Q49B 2H6IA 4A1SA 3HG0D 4XEIG 3CIAA 3FWVA 5FZSA 5LX8A 2B0OE 3NF1A 3UI2A 5LOZA 4GU5A 2P9SG 1DCEA 2M63A 3D9IA 4XX5A 1E96B 4LSZE 1TN8A 1GW6A 4N2QA 3ZRHA 3ZW3A 3DPDA 3PNLB 2LXMA 3ML9A 3QK0A 3P2BA 1RZ4A 2P9LG 4PUCA 3C3OA 1IHBA 3L16A 5KNHD 3L17A 4R7LA 4J8DA 3CHRA 4HXIA 1YYHA 2P2CP 4GTTA 3DXKG 5FZQA 4HOUA 5CRUA 4EZLA 3HXDA 2VGXB 1WM5A 3E37A 2MYOA 3KS2A 5JJ7A 1O1SA 2Y69E 4UWLA 4O6FA 2WQHA 1LF8A 3LJ3A 4MRUA 5FQ4A 3FUEA 3I4GA 4F7AA 1TN7A 4N5QA 5IY5E 3FULA 2WXIA 5H7PA 3QDNA 4GYYA 4GTMA 4ANXA 5EIBE 3Q73A 3K9IA 2JLBA 3G2UA 5A7DB 4CEMA 4BESA 3QWVA 3PS6A 4A63B 1K1BA 5ITZF 1HG5A 3FH8A 2L0IA 2YHEA 2AJAA 4N5CA 4NURA 3RRUA 3ZNGA 2LSUA 2DBAA 3TWUA 3FUFA 3LY9A 3U66A 5CHEE 3C72A 1H2TC 5T4YA 3BQOA 2J07A 3RAUA 1SW6A 3E34A 2QYJA 1H0AA 3IEGA 3NBNB 4HS2A 2AW6A 2WMOA 2RD0A 4F1SA 5AQ9A 3C3QA 1DNPA 1N11A 4AY6A 4I9CA 3V2XA 3JXJA 3ONLA 5BV0A 3FUIA 4U0UA 4WNFA 4K0RA 3UQ3A 4YVOA 5E76A 1IXVA 5HKPA 2V0PA 1E8XA 1G3NB 3P1UA 2R05A 1D8DA 2VGYA 4HRNA 2ZU6B 1SVXA 4FLBA 4B0ZA 4HLLA 4A3VA 3FUDA 4DRXE 3SGHA 2A5UA 3NQPA 3O4ZA 4F6RD 3KEZA 2H6GA 1D8EA 3CR3A 3TXMA 3O48A 4EPZA 2IO2C 4UI9J 5D2MC 2V4LA 3FU5A 4ME2A 4BETA 2I6HA 3NZSA 3JCKC 4LEUA 1XNFA 1N4QA 4LCTA 4FA6A 3APFA 3SY2A 3FP3A 3DSSA 5LCWC 3MCXA 1HH8A 4EBAG 4E6HA 3UIOC 5FIOA 1Y8MA 1IQUA 3CQGB 4ZFHA 2CHZA 3MV2B 4YDWA 3EJNA 5CCLA 3QB2A 4IN3B 4NACA 4UQYA 4PDXA 4ANVA 1QNFA 4JW1A 3VLDA 2MOWA 4UQZA 4G23A 3CHQA 3UT8A 4AJWA 1PC2A 2GRPB 1HG2A 5AARA 2XGSA 3JUIA 4AVXA 4U07A 1TJCA 3F6QA 3W9FA 1H6KA 4BX8A 2FF4A 3SFYA 2XEVA 3ASGA 3MKRA 2IO3C 4IULA 5HRYA 4ABNA 4UWHA 3RRNB 3I5PA 2VGXA 3MEKA 1ELRA 3EIQC 4HVBA 4B8AA 3EUVA 3FTXA 5CRVA 2JABA 4GZDA 3EU5A 3HHMA 2BKKB 4TV3A 4XZ4A 2IQCA 5AAOA 2XPIA 3KD7A 3S2AA 3LJNA 3ASFA 3B7TA 3BUAA 4DX1A 3ASHA 4B89A 5J08A 3C5RA 4LNGA 3IKOB 1KT0A 2RKKA 5B1BE 2XRZA 4OVUA 2XEEA 5KJKA 5AN8A 3AS8A 3CKBA 2ONDA 4KVOA 3ZXPA 4JEUA 3J5PA 2XEHA 2Q7FA 1OCCE 4HI9A 4GCNA 4FU3A 4L7TA 4CCAA 4CYMD 3SFXA 3NOCD 1NI1A 5AQBA 3APDA 3CK9A 4YDEA 3FTZA 3BEEA 2XPYA 4H7XA 3V2OA 3NZUA 4J8EA 4DUIA 4RG9A 2IY0C 3LXUX 3D9MA 4FC8A 5CMYA 4U7EB 2XZDG 3PE3A 5ANRA 4Y6WA 1H6OA 4UI9K 1MX4A 1NL4A 1FT2A 1OWNA 2ETAA 1UW4B 2A4ZA 3B7RL 5EX0A 4PH4B 4GMJA 3ABME 4ILHB 3UX4A 1TNBA 4A1GA 4O60A 1EF1C 3FUMA 3OXGA 2HR2A 3RU0A 1OCZE 4HBDA 3G2WA 2IFUA 3G2TA 3UM2A 4XE0A 5JJTA 2EIJE 2DYSE 5FWQA 2H6FA 2OVFA 4JA7A 3ZYKA 4B93B 3CK7A 3JUEA 4ANUA 4YDYA 2EQXA 4WNDA 3AJIA 4JHJA 5T3RA 1V55E 1N0RA 1AWCB 2LAHA 2I1JA 3FY4A 1INZA 4I6GA 4UUCA 1UOHA 2X6KA 3OAWA 3S7DA 2P9NG 5FQ8A 3QWPA 2XCCA 4KZ0A 3B7SA 2L6JA 4I2ZA 5BV1A 3ESKA 3UTMA 4XKBA 4G25A 4N2SA 4GPKA 5JMND 1EPUA 3CSTA 3U3WA 2LSVA 4FJZA 3MA5A 4WUYA 3HIZA 3Q78A 5ARFA 3TXNA 1JCRA 3QWWA 1LD8A 2VSOE 3C98A 2GRRB 3CHMA 3ZXSA 3RJVA 4DJAA 3PEVB 3D9LA 4TUMA 4GZ3A 1BI7B 2FI7A 3TWVA 3AG1E 3MKQB 1ZB1A 5G05C 4FADA 3ESLA 4U8HA 3N71A 3QC1A 3W9GA 2Y4TA 1D9SA 1RW2A 3TWXA 4O1OA 3DEPA 5B3SE 3ZPJA 2FEZA 1S0PA 1X5BA 2ZGDA 3IXEA 2IOSA 5ANLA 4GYWA 1KZPA 4A55A 2OEVA 3Q4AB 4BSXA 4C0EA 3HXBA 1S63A 3BG0B 4WWPA 1K8KG 4UWGA 5EDSA 3RO2A 3UMVA 2ZXWE 2X6HA 3B95A 3TAXA 3B7BA 2C0LA 2WPVA 3T8MA 3PZDA 3VTXA 5EYPF 2DVWA 1TEZA 3FUNA 3DSUA 4U63A 5AJDA 3HXFA 4Q69A 4GAAA 1DVPA 3BU8A 4OAVB 3SD5A 2Y1LE 2EILE 3ZYQA 3PRZA 5JHAA 1N52A 2E0IA 3RRMB 4AIFA 1KZOA 3SI5A 4CGWA 2KXPC 3I3NA 5EKQD 1H2UA 2KM4A 2J09A 5DBKA 2I9CA 2R2LA 3SF4A 4GA2A 5AYWD 2A5EA 1YMPA 1NZNA 3HVEB 4GA1A 4AEZC 4MKTA 3CGHA 3ASDA 4GZ6A 2V4HC 2UY1B 3Q79A 4LNUD 1HX8A 1WAO1 2PQRA 4WWNA 3KEAA 3UM3A 5BW8C 4JPSA 2EIME 1JWFA 4DPRA 2J9QA 4DI3A 1OY3D 3NB2A 3Q75A 2FBNA 4FP7A 4EQFA 3T9KA 3B7UX 2RG8A 3CVXA 3PDNA 5AJLA 5BUZA 4RVBA 4I1MA 3URZA 2X38A 4AV7A 4U8VD 2LUHA 1JCSA 2CHXA 4BFRA 1SZAA 2FO7A 4GYOA 4AOFA 2WXPA 3GYZA 3CHPA 3KSLA 3QAQA 4F3VA 3ZU7B 2PL2A 4HRLA 4N3CA 3FUHA 3PEUB 5ENSD 3AG3E 2XS8A 2F8YA 3RK6A 2CG3A 1UJJA 3E4BA 5CMWA 4XKCA 4M7CA 3PZ4A 2MRIA 5LFAA 3MV3B 2I1KA 4J8YA 3AU4A 4V3IA 3L6AA 2AXVA 2WMNA 1ELKA 4ACKA 3HRAA 3RIBA 2R02A 3E33A 4RG6A 3HYMB 3ZVVA 2Y0BG 2R5SA 2NYJA 4F1PA 4DX5D 3CVYA 1HFAA 3TWRA 2F0YA 4AXHA 3FTYA 3FHEA 1FCHA 2VYIA 2YNQA 4Z68A 2KBXA 1TNZA 4JHKA 5CECB 3PE4A 1O1RA 1N4RA 3IHYA 4LNBA 2Y3AA 3JQ0A 3GW4A 3ZHEB 3PZ1A 3G2VA 4JL0A 4U95D 1SA5A 4HFGA 4N3AA 4HNAD 4NRHB 3D9PA 2PNNA 4DLOA 3L13A 3DXMG 3DWLG 3ABLE 5G55A 2XENA 3MZLB 1JPLA 1NP7A 4GPMA 4KMOA 5D66A 2QZAA 2XHEA 1IYGA 3UIPC 3UM1A 4X8QA 1Z6TA 1MX6A 4WAFA 2CHWA 4DX7D 3D9KA 2J49A 4ACLA 4KXKB 5BNWA 1SZ9A 5FZRA 4BTBA 1FVHA 3HXCA 2XZTG 2PM6A 3MGBA 2NC9A 2VGEA 4KVMA 1U2VG 3FUJA 4N3BA 1BLXB 2XQ0A 1JWGA 4DX2A 3S7JA 2IF4A 3UT7A 3PUJA 3DPYA 4EZJA 5KJLA 3QARA 2PZIA 2P9KG 3IBEA 5ENNA 5G04C 4HLEA 4FJYA 3AS5A 5AQAA 2OOEA 4CDRA 5AIJA 1MJ0A 3SFZA 4YNDA 2GRMA 3ZEFA 3FU6A 3TWQA 3SO8A 3CVPA 1BI8B 2LNIA 1QQEA 2BEDA 1OCRE 3HDXA 3GZSA 1OCOE 4I6JA 2GRNB 1BD8A 4QQIA 1DC2A 2L0TB 1Y6IA 4AM9A 3DSWA 2UY1A 3MJWA 4I1AA 2JEKA 1X81A 2YINA 4DI4A 4L9PA 1P5QA 1NA3A 1Q2ZA 3KSQA 3ZKJA 1QBQA 4BSZB 1Z3XA 2DYRE 2EIKE 4P29A 3CVUA 1SQMA 4GTOA 5CERB 4G8KA 4BT9A 5KNGA 2F8XK 4GTSA 4UWFA 2DZNA 3IV0A 3T8KA 2R03A 2OEWA 2KCKA 3DEOA 4GCOA 4U04A 3UINC 1WDYA 5D0OD 1QYMA 5BPPA 4D10C 1OWMA 3T5VA 3CVVA 2P9IG 3L9TA 3EHRA 5KJMA 4B8CB 1H19A 3DBSA 4WWOA 4OVVA 3AU5A 4L1BA 3CHOA 2J4BA 4XI9A 2XPZA 4ATZD 1UN8A 5G2NA 4U0SA 4GZ5A 3S7BA 4AP2A 3ZYLA 1TJFA 4BWRA 3TG5A 5FINA 1O5MA 4Y6CA 1IQRA 1WY6A 2QY7A 4CRWA 4FLHA 4G2VA 4OAUC 2ETCA 3L08A 3CVQA 1XGWA 1Z5SC 1YCSB 2KZTB 3BG1B 2Y4UA 2P9UG 2HO1A 2OVBA 3FTVA 4IRUA 1FPPA 3T5XA 3ZN3A 3G2SA 3L22A 4HB5A 4I6EA 3FH5A 3Q9NC 4F53A 4U8YD 4L23A 2L6BA 3MYVA 3Q7FA 2ZGGA 3TL5A 4JB8P 2DWZA 3TG4A 2WXLA 3R9MA 3CVNA 1HS6A 4ZHBA 3VLEA 1H2VC 5FQ7A 2DCPA 4CGVA 2BUGA 1PY1A 3QKYA
chains in the Genus database with same CATH topology
2H6GA 1D8EA 4GTQA 1TNYA 1NL4A 1FT2A 2H6IA 3Q7AA 4GTMA 3Q73A 3HXCA 3PZ4A 1N9AA 1TNBA 3EUVA 3E32A 3EU5A 1TNUA 1KZOA 1TNOA 3Q78A 1S64A 3HXEA 3DSTA 1DCEA 1JCRA 3DPYA 1N4QA 2R2LA 3E33A 4MBGA 1LD8A 1TN8A 1TN6A 3DSSA 2F0YA 1MZCA 3C72A 1FT1A 4LNGA 3Q79A 2H6FA 4GTRA 1TNZA 1LD7A 2ZISA 1O5MA 3E34A 3DSVA 1O1RA 2BEDA 1N4RA 1N95A 4LNBA 4YDOA 3E30A 1N4PA 3PZ1A 1N94A 1SA5A 3Q75A 4GTPA 3PZ2A 3PZ3A 3DSWA 1SA4A 1X81A 1FPPA 3DRAA 4GTTA 1KZPA 4L9PA 3SFXA 3HXBA 1S63A 1NI1A 1JCSA 3KSQA 3Q7FA 3HXDA 3DSXA 2ZIRA 1QBQA 4YDEA 3E37A 2IEJA 1O1SA 1N4SA 2H6HA 4GTOA 1LTXA 1JCQA 3KSLA 4GTSA 1D8DA 1O1TA 4EHMA 3SFYA 3DSUA 3HXFA 4GTVA 1TN7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2H6G A;  1D8E A;  4GTQ A;  1TNY A;  1NL4 A;  1FT2 A;  2H6I A;  3Q7A A;  4GTM A;  3Q73 A;  3HXC A;  3PZ4 A;  1N9A A;  1TNB A;  3EUV A;  3E32 A;  3EU5 A;  1TNU A;  1KZO A;  1TNO A;  3Q78 A;  1S64 A;  3HXE A;  3DST A;  1DCE A;  1JCR A;  3DPY A;  1N4Q A;  2R2L A;  3E33 A;  4MBG A;  1LD8 A;  1TN8 A;  1TN6 A;  3DSS A;  2F0Y A;  1MZC A;  3C72 A;  1FT1 A;  4LNG A;  3Q79 A;  2H6F A;  4GTR A;  1TNZ A;  1LD7 A;  2ZIS A;  1O5M A;  3E34 A;  3DSV A;  1O1R A;  2BED A;  1N4R A;  1N95 A;  4LNB A;  4YDO A;  3E30 A;  1N4P A;  3PZ1 A;  1N94 A;  1SA5 A;  3Q75 A;  4GTP A;  3PZ2 A;  3PZ3 A;  3DSW A;  1SA4 A;  1X81 A;  1FPP A;  3DRA A;  4GTT A;  1KZP A;  4L9P A;  3SFX A;  3HXB A;  1S63 A;  1NI1 A;  1JCS A;  3KSQ A;  3Q7F A;  3HXD A;  3DSX A;  2ZIR A;  1QBQ A;  4YDE A;  3E37 A;  2IEJ A;  1O1S A;  1N4S A;  2H6H A;  4GTO A;  1LTX A;  1JCQ A;  3KSL A;  4GTS A;  1D8D A;  1O1T A;  4EHM A;  3SFY A;  3DSU A;  3HXF A;  4GTV A;  1TN7 A; 
#chains in the Genus database with same CATH topology
 4G26 A;  4CZ2 D;  1KLX A;  1TNY A;  1PAQ A;  5EN5 D;  4EBA A;  4G1T A;  2RFA A;  2CFU A;  3LS8 A;  4NIK A;  5B1A E;  3D9J A;  3S7F A;  4K5A B;  2KZT A;  4MS6 A;  3R9A B;  4GB9 A;  1BPO A;  5CBN A;  1TN6 A;  1OXJ A;  2J4D A;  4EZK A;  3U9W A;  1HO8 A;  5EID A;  2WXJ A;  4HOS A;  4I9E A;  2CG2 A;  4QFV A;  4APO A;  4J0U A;  2AWI A;  5CCM A;  5KCM A;  1N95 A;  3HVE A;  1MQS A;  1WG0 A;  1UG3 A;  1DCQ A;  3JQ1 A;  1KPS B;  3LY7 A;  4L2Y A;  5FT9 A;  4HOR A;  4UWK A;  2CFZ A;  1K1A A;  4AY5 A;  4L2L A;  2HE0 A;  3D9O A;  5EYL A;  2WXM A;  2KAT A;  5BXO A;  5C1D A;  4I43 A;  4YVQ C;  4FHJ A;  2R59 A;  3DSX A;  2GRO B;  3D9N A;  4GMR A;  3CSF A;  3TJP A;  2IU1 A;  2PM7 A;  4UQX A;  3GZ2 A;  2E2E A;  5JJ6 A;  4Q96 A;  3GZ1 A;  4I2W A;  4CDN A;  3CVL A;  1A5E A;  4I17 A;  4ILG A;  1HF8 A;  3C3R A;  3RO3 A;  3IHV A;  3UT4 A;  4RQI A;  4XI0 A;  3TWW A;  4FHK A;  3RSE G;  3ZFW A;  2ILR A;  2BF0 X;  3VLF A;  1E90 A;  3UXG A;  2J8S D;  2VJ8 A;  4K5B A;  4FUL A;  3TGO A;  5FJY A;  3UUX A;  1HXI A;  4MBG A;  3WG7 E;  1E7U A;  2LO6 A;  3OXF A;  1E8Z A;  3FDH A;  1OT8 A;  4KBQ A;  5FQ6 A;  5T8I A;  2HM8 A;  2KCL A;  2BTD A;  4K5C A;  3FU3 A;  3X2Q E;  4C48 B;  4WNG A;  3WXX A;  3D3M A;  4KZC A;  4W9R A;  2WQ7 A;  4DX6 D;  3UKR G;  5HI7 A;  2NSZ A;  4LER A;  1E7V A;  2QYU A;  3QOU A;  4HI8 A;  2WB2 A;  3FU0 A;  3FUK A;  4DK5 A;  4C0M A;  3LDZ A;  4BTA A;  2XGO A;  5DIZ A;  2R17 C;  1EDU A;  1OUV A;  3I4R B;  3ML8 A;  1MYO A;  4JHR A;  5ENQ D;  1LTX A;  1JCQ A;  1O1T A;  2GRQ B;  4KT6 B;  2VTB A;  4G11 A;  4HRM B;  3OTN A;  3PNT B;  4HOT A;  2WQ6 A;  4UI9 C;  3Q7A A;  4H7Y A;  4JD2 G;  3UPV A;  2WXF A;  1YA0 A;  5LCW J;  4PS8 A;  2X6I A;  1N9A A;  1MX2 A;  1TNU A;  4J8F A;  2P9P G;  2GGF A;  3AG4 E;  4BY6 A;  3DST A;  4CT4 A;  2XRY A;  3R7Q A;  4JZY A;  4LRZ A;  1OWO A;  1UJK A;  3CV0 A;  2OV8 A;  5HS0 A;  4EEC A;  4LG6 A;  1HE8 A;  1QZ2 A;  2ZIS A;  5ENT D;  4C9B B;  4BX9 A;  4G8L A;  4K03 A;  1K3Z D;  3E30 A;  3ZIM A;  3PVL A;  1ELW A;  3EIJ A;  1VDY A;  2KC7 A;  4GTP A;  2X3M A;  1W3B A;  3APC A;  2VTB B;  1SA4 A;  4GZC A;  4G24 A;  1ZBP A;  2L9B A;  1U3C A;  4WNE A;  3ASO E;  3LVR E;  2V5Q C;  3SBS A;  2AVP A;  1N4S A;  2GW1 A;  2H6H A;  3EDT B;  3MKQ A;  4JA9 A;  4CDM A;  4PS3 A;  3EU9 A;  2YHC A;  2V8S E;  3ASN E;  2VQ2 A;  3EHN A;  3SNX A;  4BER A;  2I2O A;  1L5J A;  4GTQ A;  2WM9 A;  3ULE G;  2DZO A;  5BXU A;  5KBA A;  2HYZ A;  3V31 A;  2WXK A;  1HZ4 A;  3J5Q B;  2VSY A;  3HXE A;  4J6I A;  4XIF A;  4O1P A;  2ION A;  3RKV A;  3OXL A;  4URK A;  3JXI A;  3CEQ A;  1B89 A;  5JA4 D;  2WXO A;  4BEP A;  3EHQ A;  4GTR A;  3LPZ A;  3L82 A;  4TUU A;  3TWT A;  1HU3 A;  5LP0 A;  2WXQ A;  2NXP A;  1N4P A;  2QC9 A;  2XCB A;  3QNK A;  5M72 A;  3PZ3 A;  4J8S A;  3LEW A;  3V30 A;  1TR4 A;  3LKU A;  4TXQ A;  4A3T A;  4GML A;  4GA0 A;  2GRL A;  3MX3 A;  2VSN A;  3QJZ A;  2X6F A;  2ZIR A;  3CHS A;  1KT1 A;  3UM0 A;  3PH0 C;  2MHK A;  5CED B;  2KCV A;  4B94 A;  1Z3Y A;  4JXT A;  3LVQ E;  1E8W A;  1H6P A;  2B6C A;  4IYP A;  3SBT B;  3R7R A;  2IJG X;  4JVS A;  3FEX A;  2FO1 E;  4TRQ A;  5A23 A;  2WXG A;  3E32 A;  2FUL A;  2LXL A;  1IHG A;  4Q94 A;  3CK8 A;  1FVF A;  2YQ8 A;  1AP7 A;  3ZUV B;  2VSX E;  2RFM A;  3TWS A;  3V79 K;  4TXP A;  2QFC A;  3JYS A;  5JHB A;  3PUK A;  4I1O B;  2WXN A;  3L54 A;  1UN9 A;  2F37 A;  4JC8 A;  4ANW A;  1FT1 A;  2J08 A;  4U0Z A;  4NQ0 A;  4APF A;  2C0M A;  2P58 C;  3ZGQ A;  3VTY A;  3U64 A;  3Q47 B;  3FH7 A;  4HQD A;  4BT8 A;  3B13 A;  3NAW A;  3UKU G;  2XGM A;  4E85 A;  3PZ2 A;  4LUN U;  3SZ7 A;  3AG2 E;  4DLQ A;  1A17 A;  5G05 J;  5C2Y A;  2IOL A;  1OWP A;  3ZYM A;  2BKG A;  3ENE A;  2EIN E;  3ISM C;  5KJN A;  3FTU A;  3ONK A;  2IEJ A;  2XS1 A;  1U3D A;  1BU9 A;  5A6C A;  3ULQ A;  1IKN D;  2ETB A;  4HOQ A;  1ZU2 A;  3CVW A;  1V54 E;  4J7W A;  1JUQ A;  4ATG A;  3ABK E;  3KAE A;  2AXU A;  3PRE A;  5CBO A;  3AS4 A;  1TYQ G;  4KYO B;  3FEY A;  1EYH A;  4ILI A;  1TNO A;  1S64 A;  1E8Y A;  4OYS A;  3CLJ A;  3D9H A;  1N54 A;  3Q15 A;  2C2L A;  2WXR A;  2DIW A;  2WXH A;  5J90 A;  3LY8 A;  2X6J A;  5EX3 A;  5ENR D;  5FTP A;  2AXZ A;  1MZC A;  3EHM A;  4MLP A;  4RSY A;  1LD7 A;  3AAA C;  3DSV A;  3FFL A;  2LAI A;  4YDO A;  5ENP D;  5G04 J;  3SQV A;  2UWJ G;  3Q9U C;  1NFI E;  5BT1 A;  5HQ8 A;  1N94 A;  3NOG D;  3ZHE A;  2WVI A;  5AQ7 A;  1NA0 A;  4U96 D;  2V5F A;  1N0Q A;  5CEA A;  1S70 B;  3U4T A;  3DRA A;  2OCC E;  5ENO D;  3SHF A;  4M3O A;  4PS7 A;  5EIL A;  1MHQ A;  1OWL A;  3ULY A;  3CQC B;  4N39 A;  2PQN A;  4CT0 A;  3CKC A;  4TXR A;  4JEH A;  4RLY A;  5ARG A;  3FTS A;  3LCA A;  4EHM A;  3Q5M A;  3FTW A;  5E75 A;  5AEN A;  3LYA A;  5D0Q D;  5KWD A;  4GTV A;  3Q49 B;  2H6I A;  4A1S A;  3HG0 D;  4XEI G;  3CIA A;  3FWV A;  5FZS A;  5LX8 A;  2B0O E;  3NF1 A;  3UI2 A;  5LOZ A;  4GU5 A;  2P9S G;  1DCE A;  2M63 A;  3D9I A;  4XX5 A;  1E96 B;  4LSZ E;  1TN8 A;  1GW6 A;  4N2Q A;  3ZRH A;  3ZW3 A;  3DPD A;  3PNL B;  2LXM A;  3ML9 A;  3QK0 A;  3P2B A;  1RZ4 A;  2P9L G;  4PUC A;  3C3O A;  1IHB A;  3L16 A;  5KNH D;  3L17 A;  4R7L A;  4J8D A;  3CHR A;  4HXI A;  1YYH A;  2P2C P;  4GTT A;  3DXK G;  5FZQ A;  4HOU A;  5CRU A;  4EZL A;  3HXD A;  2VGX B;  1WM5 A;  3E37 A;  2MYO A;  3KS2 A;  5JJ7 A;  1O1S A;  2Y69 E;  4UWL A;  4O6F A;  2WQH A;  1LF8 A;  3LJ3 A;  4MRU A;  5FQ4 A;  3FUE A;  3I4G A;  4F7A A;  1TN7 A;  4N5Q A;  5IY5 E;  3FUL A;  2WXI A;  5H7P A;  3QDN A;  4GYY A;  4GTM A;  4ANX A;  5EIB E;  3Q73 A;  3K9I A;  2JLB A;  3G2U A;  5A7D B;  4CEM A;  4BES A;  3QWV A;  3PS6 A;  4A63 B;  1K1B A;  5ITZ F;  1HG5 A;  3FH8 A;  2L0I A;  2YHE A;  2AJA A;  4N5C A;  4NUR A;  3RRU A;  3ZNG A;  2LSU A;  2DBA A;  3TWU A;  3FUF A;  3LY9 A;  3U66 A;  5CHE E;  3C72 A;  1H2T C;  5T4Y A;  3BQO A;  2J07 A;  3RAU A;  1SW6 A;  3E34 A;  2QYJ A;  1H0A A;  3IEG A;  3NBN B;  4HS2 A;  2AW6 A;  2WMO A;  2RD0 A;  4F1S A;  5AQ9 A;  3C3Q A;  1DNP A;  1N11 A;  4AY6 A;  4I9C A;  3V2X A;  3JXJ A;  3ONL A;  5BV0 A;  3FUI A;  4U0U A;  4WNF A;  4K0R A;  3UQ3 A;  4YVO A;  5E76 A;  1IXV A;  5HKP A;  2V0P A;  1E8X A;  1G3N B;  3P1U A;  2R05 A;  1D8D A;  2VGY A;  4HRN A;  2ZU6 B;  1SVX A;  4FLB A;  4B0Z A;  4HLL A;  4A3V A;  3FUD A;  4DRX E;  3SGH A;  2A5U A;  3NQP A;  3O4Z A;  4F6R D;  3KEZ A;  2H6G A;  1D8E A;  3CR3 A;  3TXM A;  3O48 A;  4EPZ A;  2IO2 C;  4UI9 J;  5D2M C;  2V4L A;  3FU5 A;  4ME2 A;  4BET A;  2I6H A;  3NZS A;  3JCK C;  4LEU A;  1XNF A;  1N4Q A;  4LCT A;  4FA6 A;  3APF A;  3SY2 A;  3FP3 A;  3DSS A;  5LCW C;  3MCX A;  1HH8 A;  4EBA G;  4E6H A;  3UIO C;  5FIO A;  1Y8M A;  1IQU A;  3CQG B;  4ZFH A;  2CHZ A;  3MV2 B;  4YDW A;  3EJN A;  5CCL A;  3QB2 A;  4IN3 B;  4NAC A;  4UQY A;  4PDX A;  4ANV A;  1QNF A;  4JW1 A;  3VLD A;  2MOW A;  4UQZ A;  4G23 A;  3CHQ A;  3UT8 A;  4AJW A;  1PC2 A;  2GRP B;  1HG2 A;  5AAR A;  2XGS A;  3JUI A;  4AVX A;  4U07 A;  1TJC A;  3F6Q A;  3W9F A;  1H6K A;  4BX8 A;  2FF4 A;  3SFY A;  2XEV A;  3ASG A;  3MKR A;  2IO3 C;  4IUL A;  5HRY A;  4ABN A;  4UWH A;  3RRN B;  3I5P A;  2VGX A;  3MEK A;  1ELR A;  3EIQ C;  4HVB A;  4B8A A;  3EUV A;  3FTX A;  5CRV A;  2JAB A;  4GZD A;  3EU5 A;  3HHM A;  2BKK B;  4TV3 A;  4XZ4 A;  2IQC A;  5AAO A;  2XPI A;  3KD7 A;  3S2A A;  3LJN A;  3ASF A;  3B7T A;  3BUA A;  4DX1 A;  3ASH A;  4B89 A;  5J08 A;  3C5R A;  4LNG A;  3IKO B;  1KT0 A;  2RKK A;  5B1B E;  2XRZ A;  4OVU A;  2XEE A;  5KJK A;  5AN8 A;  3AS8 A;  3CKB A;  2OND A;  4KVO A;  3ZXP A;  4JEU A;  3J5P A;  2XEH A;  2Q7F A;  1OCC E;  4HI9 A;  4GCN A;  4FU3 A;  4L7T A;  4CCA A;  4CYM D;  3SFX A;  3NOC D;  1NI1 A;  5AQB A;  3APD A;  3CK9 A;  4YDE A;  3FTZ A;  3BEE A;  2XPY A;  4H7X A;  3V2O A;  3NZU A;  4J8E A;  4DUI A;  4RG9 A;  2IY0 C;  3LXU X;  3D9M A;  4FC8 A;  5CMY A;  4U7E B;  2XZD G;  3PE3 A;  5ANR A;  4Y6W A;  1H6O A;  4UI9 K;  1MX4 A;  1NL4 A;  1FT2 A;  1OWN A;  2ETA A;  1UW4 B;  2A4Z A;  3B7R L;  5EX0 A;  4PH4 B;  4GMJ A;  3ABM E;  4ILH B;  3UX4 A;  1TNB A;  4A1G A;  4O60 A;  1EF1 C;  3FUM A;  3OXG A;  2HR2 A;  3RU0 A;  1OCZ E;  4HBD A;  3G2W A;  2IFU A;  3G2T A;  3UM2 A;  4XE0 A;  5JJT A;  2EIJ E;  2DYS E;  5FWQ A;  2H6F A;  2OVF A;  4JA7 A;  3ZYK A;  4B93 B;  3CK7 A;  3JUE A;  4ANU A;  4YDY A;  2EQX A;  4WND A;  3AJI A;  4JHJ A;  5T3R A;  1V55 E;  1N0R A;  1AWC B;  2LAH A;  2I1J A;  3FY4 A;  1INZ A;  4I6G A;  4UUC A;  1UOH A;  2X6K A;  3OAW A;  3S7D A;  2P9N G;  5FQ8 A;  3QWP A;  2XCC A;  4KZ0 A;  3B7S A;  2L6J A;  4I2Z A;  5BV1 A;  3ESK A;  3UTM A;  4XKB A;  4G25 A;  4N2S A;  4GPK A;  5JMN D;  1EPU A;  3CST A;  3U3W A;  2LSV A;  4FJZ A;  3MA5 A;  4WUY A;  3HIZ A;  3Q78 A;  5ARF A;  3TXN A;  1JCR A;  3QWW A;  1LD8 A;  2VSO E;  3C98 A;  2GRR B;  3CHM A;  3ZXS A;  3RJV A;  4DJA A;  3PEV B;  3D9L A;  4TUM A;  4GZ3 A;  1BI7 B;  2FI7 A;  3TWV A;  3AG1 E;  3MKQ B;  1ZB1 A;  5G05 C;  4FAD A;  3ESL A;  4U8H A;  3N71 A;  3QC1 A;  3W9G A;  2Y4T A;  1D9S A;  1RW2 A;  3TWX A;  4O1O A;  3DEP A;  5B3S E;  3ZPJ A;  2FEZ A;  1S0P A;  1X5B A;  2ZGD A;  3IXE A;  2IOS A;  5ANL A;  4GYW A;  1KZP A;  4A55 A;  2OEV A;  3Q4A B;  4BSX A;  4C0E A;  3HXB A;  1S63 A;  3BG0 B;  4WWP A;  1K8K G;  4UWG A;  5EDS A;  3RO2 A;  3UMV A;  2ZXW E;  2X6H A;  3B95 A;  3TAX A;  3B7B A;  2C0L A;  2WPV A;  3T8M A;  3PZD A;  3VTX A;  5EYP F;  2DVW A;  1TEZ A;  3FUN A;  3DSU A;  4U63 A;  5AJD A;  3HXF A;  4Q69 A;  4GAA A;  1DVP A;  3BU8 A;  4OAV B;  3SD5 A;  2Y1L E;  2EIL E;  3ZYQ A;  3PRZ A;  5JHA A;  1N52 A;  2E0I A;  3RRM B;  4AIF A;  1KZO A;  3SI5 A;  4CGW A;  2KXP C;  3I3N A;  5EKQ D;  1H2U A;  2KM4 A;  2J09 A;  5DBK A;  2I9C A;  2R2L A;  3SF4 A;  4GA2 A;  5AYW D;  2A5E A;  1YMP A;  1NZN A;  3HVE B;  4GA1 A;  4AEZ C;  4MKT A;  3CGH A;  3ASD A;  4GZ6 A;  2V4H C;  2UY1 B;  3Q79 A;  4LNU D;  1HX8 A;  1WAO 1;  2PQR A;  4WWN A;  3KEA A;  3UM3 A;  5BW8 C;  4JPS A;  2EIM E;  1JWF A;  4DPR A;  2J9Q A;  4DI3 A;  1OY3 D;  3NB2 A;  3Q75 A;  2FBN A;  4FP7 A;  4EQF A;  3T9K A;  3B7U X;  2RG8 A;  3CVX A;  3PDN A;  5AJL A;  5BUZ A;  4RVB A;  4I1M A;  3URZ A;  2X38 A;  4AV7 A;  4U8V D;  2LUH A;  1JCS A;  2CHX A;  4BFR A;  1SZA A;  2FO7 A;  4GYO A;  4AOF A;  2WXP A;  3GYZ A;  3CHP A;  3KSL A;  3QAQ A;  4F3V A;  3ZU7 B;  2PL2 A;  4HRL A;  4N3C A;  3FUH A;  3PEU B;  5ENS D;  3AG3 E;  2XS8 A;  2F8Y A;  3RK6 A;  2CG3 A;  1UJJ A;  3E4B A;  5CMW A;  4XKC A;  4M7C A;  3PZ4 A;  2MRI A;  5LFA A;  3MV3 B;  2I1K A;  4J8Y A;  3AU4 A;  4V3I A;  3L6A A;  2AXV A;  2WMN A;  1ELK A;  4ACK A;  3HRA A;  3RIB A;  2R02 A;  3E33 A;  4RG6 A;  3HYM B;  3ZVV A;  2Y0B G;  2R5S A;  2NYJ A;  4F1P A;  4DX5 D;  3CVY A;  1HFA A;  3TWR A;  2F0Y A;  4AXH A;  3FTY A;  3FHE A;  1FCH A;  2VYI A;  2YNQ A;  4Z68 A;  2KBX A;  1TNZ A;  4JHK A;  5CEC B;  3PE4 A;  1O1R A;  1N4R A;  3IHY A;  4LNB A;  2Y3A A;  3JQ0 A;  3GW4 A;  3ZHE B;  3PZ1 A;  3G2V A;  4JL0 A;  4U95 D;  1SA5 A;  4HFG A;  4N3A A;  4HNA D;  4NRH B;  3D9P A;  2PNN A;  4DLO A;  3L13 A;  3DXM G;  3DWL G;  3ABL E;  5G55 A;  2XEN A;  3MZL B;  1JPL A;  1NP7 A;  4GPM A;  4KMO A;  5D66 A;  2QZA A;  2XHE A;  1IYG A;  3UIP C;  3UM1 A;  4X8Q A;  1Z6T A;  1MX6 A;  4WAF A;  2CHW A;  4DX7 D;  3D9K A;  2J49 A;  4ACL A;  4KXK B;  5BNW A;  1SZ9 A;  5FZR A;  4BTB A;  1FVH A;  3HXC A;  2XZT G;  2PM6 A;  3MGB A;  2NC9 A;  2VGE A;  4KVM A;  1U2V G;  3FUJ A;  4N3B A;  1BLX B;  2XQ0 A;  1JWG A;  4DX2 A;  3S7J A;  2IF4 A;  3UT7 A;  3PUJ A;  3DPY A;  4EZJ A;  5KJL A;  3QAR A;  2PZI A;  2P9K G;  3IBE A;  5ENN A;  5G04 C;  4HLE A;  4FJY A;  3AS5 A;  5AQA A;  2OOE A;  4CDR A;  5AIJ A;  1MJ0 A;  3SFZ A;  4YND A;  2GRM A;  3ZEF A;  3FU6 A;  3TWQ A;  3SO8 A;  3CVP A;  1BI8 B;  2LNI A;  1QQE A;  2BED A;  1OCR E;  3HDX A;  3GZS A;  1OCO E;  4I6J A;  2GRN B;  1BD8 A;  4QQI A;  1DC2 A;  2L0T B;  1Y6I A;  4AM9 A;  3DSW A;  2UY1 A;  3MJW A;  4I1A A;  2JEK A;  1X81 A;  2YIN A;  4DI4 A;  4L9P A;  1P5Q A;  1NA3 A;  1Q2Z A;  3KSQ A;  3ZKJ A;  1QBQ A;  4BSZ B;  1Z3X A;  2DYR E;  2EIK E;  4P29 A;  3CVU A;  1SQM A;  4GTO A;  5CER B;  4G8K A;  4BT9 A;  5KNG A;  2F8X K;  4GTS A;  4UWF A;  2DZN A;  3IV0 A;  3T8K A;  2R03 A;  2OEW A;  2KCK A;  3DEO A;  4GCO A;  4U04 A;  3UIN C;  1WDY A;  5D0O D;  1QYM A;  5BPP A;  4D10 C;  1OWM A;  3T5V A;  3CVV A;  2P9I G;  3L9T A;  3EHR A;  5KJM A;  4B8C B;  1H19 A;  3DBS A;  4WWO A;  4OVV A;  3AU5 A;  4L1B A;  3CHO A;  2J4B A;  4XI9 A;  2XPZ A;  4ATZ D;  1UN8 A;  5G2N A;  4U0S A;  4GZ5 A;  3S7B A;  4AP2 A;  3ZYL A;  1TJF A;  4BWR A;  3TG5 A;  5FIN A;  1O5M A;  4Y6C A;  1IQR A;  1WY6 A;  2QY7 A;  4CRW A;  4FLH A;  4G2V A;  4OAU C;  2ETC A;  3L08 A;  3CVQ A;  1XGW A;  1Z5S C;  1YCS B;  2KZT B;  3BG1 B;  2Y4U A;  2P9U G;  2HO1 A;  2OVB A;  3FTV A;  4IRU A;  1FPP A;  3T5X A;  3ZN3 A;  3G2S A;  3L22 A;  4HB5 A;  4I6E A;  3FH5 A;  3Q9N C;  4F53 A;  4U8Y D;  4L23 A;  2L6B A;  3MYV A;  3Q7F A;  2ZGG A;  3TL5 A;  4JB8 P;  2DWZ A;  3TG4 A;  2WXL A;  3R9M A;  3CVN A;  1HS6 A;  4ZHB A;  3VLE A;  1H2V C;  5FQ7 A;  2DCP A;  4CGV A;  2BUG A;  1PY1 A;  3QKY A; 
#chains in the Genus database with same CATH homology
 2H6G A;  1D8E A;  4GTQ A;  1TNY A;  1NL4 A;  1FT2 A;  2H6I A;  3Q7A A;  4GTM A;  3Q73 A;  3HXC A;  3PZ4 A;  1N9A A;  1TNB A;  3EUV A;  3E32 A;  3EU5 A;  1TNU A;  1KZO A;  1TNO A;  3Q78 A;  1S64 A;  3HXE A;  3DST A;  1DCE A;  1JCR A;  3DPY A;  1N4Q A;  2R2L A;  3E33 A;  4MBG A;  1LD8 A;  1TN8 A;  1TN6 A;  3DSS A;  2F0Y A;  1MZC A;  3C72 A;  1FT1 A;  4LNG A;  3Q79 A;  2H6F A;  4GTR A;  1TNZ A;  1LD7 A;  2ZIS A;  1O5M A;  3E34 A;  3DSV A;  1O1R A;  2BED A;  1N4R A;  1N95 A;  4LNB A;  4YDO A;  3E30 A;  1N4P A;  3PZ1 A;  1N94 A;  1SA5 A;  3Q75 A;  4GTP A;  3PZ2 A;  3PZ3 A;  3DSW A;  1SA4 A;  1X81 A;  1FPP A;  3DRA A;  4GTT A;  1KZP A;  4L9P A;  3SFX A;  3HXB A;  1S63 A;  1NI1 A;  1JCS A;  3KSQ A;  3Q7F A;  3HXD A;  3DSX A;  2ZIR A;  1QBQ A;  4YDE A;  3E37 A;  2IEJ A;  1O1S A;  1N4S A;  2H6H A;  4GTO A;  1LTX A;  1JCQ A;  3KSL A;  4GTS A;  1D8D A;  1O1T A;  4EHM A;  3SFY A;  3DSU A;  3HXF A;  4GTV A;  1TN7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...