2H6FA

Protein farnesyltransferase complexed with a farnesylated ddptasacvls peptide product at 1.5a resolution
Total Genus 134
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
134
sequence length
315
structure length
315
Chain Sequence
b'FVSLDSPSYVLYRDRAEWADIDPVPQNDGPNPVVQIIYSDKFRDVYDYFRAVLQRDERSERAFKLTRDAIELNAANYTVWHFRRVLLKSLQKDLHEEMNYITAIIEEQPKNYQVWHHRRVLVEWLRDPSQELEFIADILNQDAKNYHAWQHRQWVIQEFKLWDNELQYVDQLLKEDVRNNSVWNQRYFVISNTTGYNDRAVLEREVQYTLEMIKLVPHNESAWNYLKGILQDRGLSKYPNLLNQLLDLQPSHSSPYLIAFLVDIYEDMLENQCDNKEDILNKALELCEILAKEKDTIRKEYWRYIGRSLQSKHST'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protein farnesyltransferase/geranylgeranyltransferase type I
publication title Conversion of protein farnesyltransferase to a geranylgeranyltransferase.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 134
structure length 315
sequence length 315
ec nomenclature ec 2.5.1.58: Protein farnesyltransferase.
pdb deposition date 2006-05-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01239 PPTA Protein prenyltransferase alpha subunit repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.120 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Protein prenylyltransferase 2h6fA00
3E30A 1LD7A 3EUVA 1JCRA 1TNZA 3HXBA 3E37A 1S64A 1N95A 1TN7A 1QBQA 3DSUA 1D8DA 2H6HA 1LTXA 3Q78A 3HXDA 4GTSA 1SA4A 1FT1A 1TNBA 1X81A 1JCSA 4EHMA 4GTVA 1SA5A 1MZCA 1NL4A 1KZOA 3C72A 1O1RA 3SFYA 3SFXA 3Q79A 1LD8A 4YDEA 1N94A 1TN8A 1N4SA 2IEJA 3HXFA 3DPYA 4GTMA 4LNGA 2H6FA 1FPPA 3DSVA 1TN6A 4MBGA 2BEDA 3DSSA 1N4QA 1TNOA 2ZIRA 2F0YA 3Q75A 4YDOA 3PZ4A 2H6GA 3DSTA 3HXCA 1FT2A 3DSWA 1S63A 3HXEA 1D8EA 4GTQA 1JCQA 2R2LA 4GTTA 3E32A 3PZ1A 1N4RA 3DSXA 1O5MA 4L9PA 1O1SA 1N9AA 1O1TA 1N4PA 3PZ2A 1TNUA 3EU5A 3DRAA 4GTRA 2H6IA 1NI1A 4GTOA 3E33A 3Q7FA 3PZ3A 3E34A 1TNYA 3KSLA 2ZISA 4LNBA 3Q7AA 1DCEA 1KZPA 4GTPA 3KSQA 3Q73A
chains in the Genus database with same CATH superfamily
4DX6D 5FT9A 3CHPA 5CEDB 4FJYA 1X5BA 3RRUA 2XGSA 2BUGA 2AW6A 2QZAA 2WXGA 5BXOA 3SF4A 4DJAA 1KT1A 4HLLA 4EHMA 5T8IA 2YNQA 3PH0C 2ILRA 2WQHA 1WAO1 3TG5A 4NQ0A 3MGBA 3SFYA 2P2CP 3EDTB 4KXKB 2KC7A 3HG0D 1YCSB 3ML8A 4HOSA 4TUMA 1A17A 4L23A 3CVPA 3LJ3A 3UT7A 3CVUA 1E8YA 2X6FA 3UINC 4I1MA 3L16A 4ANVA 2F8XK 4X8QA 3L08A 3Q4AB 5KCMA 4GZ3A 2XCCA 5G04C 1IHBA 2R2LA 2GRNB 5KWDA 2WXRA 2CG3A 1JUQA 2IO2C 3ONLA 1S0PA 3DEOA 1U3CA 3ABME 3LEWA 3EU5A 4LCTA 3MKRA 4WWNA 4P29A 1IQRA 1ZBPA 4HI9A 4FP7A 1MYOA 4WNEA 3VTYA 2RG8A 3D9OA 3ZFWA 4N3CA 4N2SA 1UOHA 4UWGA 5CEAA 4Q69A 1Z3XA 4N3BA 1Z6TA 4NIKA 2RD0A 3VLFA 3HYMB 1H6KA 1TN7A 3TWRA 2XQ0A 4G1TA 4FLHA 3FUKA 2GRRB 4I1OB 3X2QE 2JLBA 1TNBA 3UT8A 2KCKA 1PC2A 5ENQD 3FULA 3Q47B 3P1UA 4I43A 3I4RB 2EQXA 1IYGA 4FADA 4E85A 3FTVA 1SZ9A 3TWUA 4HRMB 2L6BA 4N5QA 3CR3A 3CSTA 2ZGGA 2WMNA 3RRMB 4KBQA 4ILIA 4YDYA 3SD5A 3SBSA 3CVVA 1OWPA 4J8SA 4F53A 3HXFA 4F3VA 2YHCA 4APOA 2VTBA 1JWGA 3OXGA 1FVHA 4O60A 3B7TA 2UY1A 3MEKA 4B93B 1HG5A 3HVEA 3B7SA 4AY6A 3U3WA 1HFAA 3AG4E 2WXNA 2MYOA 2XENA 2E2EA 4HOTA 4YDWA 1V54E 2CFZA 2VSYA 3AG3E 2L0TB 2VYIA 1G3NB 1O1TA 1N0QA 3CHQA 1OCCE 1MQSA 4JL0A 1K3ZD 3SGHA 2CHZA 3Q7AA 4J7WA 3IV0A 5EKQD 4K5AB 3NAWA 2VJ8A 4HS2A 5E75A 4TXRA 1GW6A 4OAVB 3UM1A 3RJVA 3R7RA 5LCWC 2DBAA 5AJLA 3ULYA 3D3MA 3MKQB 4BX9A 2KZTB 2FF4A 5KNHD 1DCQA 4FHKA 3QWVA 2X3MA 4GZDA 4BTBA 3ZXSA 1UJKA 1MX4A 1TN8A 5CMYA 1IKND 4CCAA 1TN6A 4UWKA 3W9FA 5FWQA 2LNIA 4RG9A 4O1PA 2ZIRA 4DLOA 3RO3A 1FT2A 3CHSA 3HXEA 2X6HA 3DWLG 5CECB 4BETA 2VGXA 2I1KA 1E90A 3D9MA 1N4RA 3ZVVA 3ESLA 2WXOA 2Y1LE 3PZ2A 4GYOA 2P9SG 3ASDA 3Q7FA 4J6IA 3E34A 2IF4A 2X6KA 3ABLE 4ABNA 4XX5A 4QFVA 4BX8A 4CDNA 4HNAD 5AQAA 2P9NG 3ML9A 3ULEG 2PM7A 2IJGX 3UX4A 4OYSA 3JYSA 4I17A 4JA7A 2GRLA 4U04A 3CHOA 3TWWA 3DSUA 1N52A 1D8DA 2X6IA 3T5XA 1BI8B 3ZW3A 3IXEA 4URKA 2XRZA 3T9KA 4C0MA 1KT0A 4I6GA 3ZN3A 1PY1A 4L7TA 4KVOA 3AS4A 4MRUA 4EECA 3C3OA 2DCPA 3QK0A 4U7EB 4AEZC 4AM9A 4V3IA 1BI7B 4U0ZA 1N94A 1DNPA 3UIPC 2VGEA 4UWLA 5AQ9A 4GTMA 3D9HA 3PVLA 4GMRA 3PDNA 1DVPA 4CGWA 1YYHA 4XEIG 2J9QA 1IXVA 1TEZA 1E8XA 3GZ2A 4DX7D 2HE0A 3K9IA 2WXLA 4JZYA 2DVWA 3CVNA 3IKOB 2FO7A 1HU3A 3ZIMA 4HRLA 2PL2A 4U63A 3FUMA 3E33A 4LUNU 4BEPA 1N54A 3UM2A 1BPOA 4YNDA 4LNBA 3NOGD 4JEUA 3VLEA 2GGFA 3D9NA 1OXJA 1SZAA 1RZ4A 4TRQA 5AAOA 1N95A 3ASGA 5ARFA 4BESA 4GCOA 3EIJA 1X81A 4MS6A 1KZOA 1QQEA 4MKTA 4BTAA 3ASNE 3WXXA 2MHKA 2WQ7A 5HS0A 1E96B 2LO6A 1H0AA 5HRYA 2FULA 5D0OD 3HRAA 3ZHEA 4ACLA 4CEMA 2IEJA 3UM0A 4D10C 4C9BB 4AVXA 5A23A 3ZYLA 3LS8A 4K0RA 4U95D 4MBGA 3FH8A 3Q49B 2F0YA 3CLJA 4PH4B 4E6HA 4G25A 5CHEE 3APCA 1OWLA 3FTXA 4RSYA 4JHJA 2FI7A 3TXMA 1K8KG 4U0SA 4ANWA 3PE4A 3CHMA 3UT4A 3L6AA 4PS3A 3ZKJA 5H7PA 4L9PA 4GCNA 3G2SA 3GW4A 2BTDA 1A5EA 2HR2A 4GZ5A 2DYRE 3ZPJA 2KXPC 4CGVA 2WB2A 3C98A 3B7RL 3Q73A 4ATZD 3CVXA 1JCRA 2Y4TA 3T5VA 1MX2A 3O4ZA 3RRNB 1XGWA 3LKUA 3NBNB 1QBQA 3AU5A 4GA2A 4K5CA 3CIAA 4G24A 3AAAC 3I3NA 4U8VD 1FT1A 3UPVA 5KJNA 4JHKA 3V2XA 5BUZA 4I9EA 2WXJA 1UN9A 3L13A 2I9CA 4ANUA 2R02A 1OCRE 5AENA 4C0EA 4DX1A 5HQ8A 1TJCA 3SBTB 1N11A 3UM3A 3CVYA 4AV7A 2R5SA 4PS7A 4BSZB 3L9TA 4CT0A 1K1BA 2H6FA 3DSSA 5IY5E 3MJWA 3BEEA 4I6JA 4KVMA 4H7XA 1TNOA 3DBSA 2KCLA 4O6FA 1HG2A 2X6JA 4NURA 1BD8A 3DPDA 1H2VC 3ASOE 3I4GA 4AXHA 1NA0A 3FUEA 2J49A 1O5MA 1O1SA 2YINA 3SNXA 3ZXPA 4GZCA 3JXIA 3JQ0A 4GTRA 3OXFA 4N3AA 3LY8A 1KLXA 2KATA 4N5CA 3U9WA 4RLYA 3RAUA 4DLQA 4I2ZA 4JC8A 3FWVA 2PQNA 4IN3B 3QKYA 4KZ0A 3E30A 1SVXA 3EUVA 2V4HC 5M72A 3ZEFA 5D66A 2V0PA 5FINA 3TWXA 4ILHB 2ZU6B 4L1BA 3V79K 3TL5A 4CDRA 1SA5A 4CZ2D 2GROB 1HXIA 4UWFA 2AXVA 4Y6WA 3FU3A 4GA0A 5G05J 4AP2A 5G55A 3SFXA 1S70B 5FQ8A 5BV1A 4BSXA 3PUJA 2C0LA 1YMPA 1PAQA 5C1DA 4M3OA 4GU5A 4RG6A 4HVBA 4EBAA 3C5RA 3AJIA 2RKKA 3ZUVB 1HO8A 3U64A 4N39A 1D9SA 4WNDA 3SHFA 5ENPD 5AIJA 2EIJE 3PRZA 3LY7A 4KZCA 3NQPA 2Q7FA 4UI9J 5AN8A 3SFZA 1EPUA 5BXUA 3DSWA 2R59A 2B6CA 5FQ6A 1S63A 5FQ4A 4U0UA 2HO1A 2Y0BG 3D9KA 5CRVA 5AQ7A 4F6RD 2NC9A 4UUCA 4K03A 4EZJA 1FCHA 4UI9K 2ETBA 3MA5A 3O48A 3JQ1A 3QC1A 4NACA 5EILA 3ISMC 1MX6A 3MYVA 4WUYA 2LXMA 1E7VA 1EF1C 1TJFA 4I2WA 4TUUA 3ABKE 3VLDA 1OY3D 2C2LA 2LAHA 3LXUX 2AXZA 2KBXA 2ETAA 5J08A 3PNTB 4I9CA 3D9PA 5ANRA 2JEKA 5JHAA 3FU0A 1E8WA 4GYYA 5B1BE 2P9IG 3Q79A 3TWVA 3UKUG 4GPKA 1LD8A 3Q5MA 5FZQA 3BG1B 2XZDG 4JB8P 3MKQA 3PEUB 4JHRA 1N4SA 2KZTA 4JA9A 4UQZA 3KAEA 4LNGA 4WWOA 4A3VA 2MOWA 2OEWA 4UWHA 3LY9A 1OCOE 3D9LA 3NOCD 4EQFA 1HF8A 4KMOA 3B7BA 2KM4A 2L0IA 4EZKA 5BNWA 2GW1A 4HLEA 3ONKA 4IYPA 5CMWA 4LG6A 4A1SA 4JVSA 3EIQC 3BG0B 3CHRA 5AJDA 3LJNA 3EHQA 2DZOA 4J8EA 3UI2A 3RO2A 2NYJA 2VSOE 3KSLA 2ZISA 5C2YA 4BT9A 1ZB1A 4RVBA 3ENEA 3B13A 5ENSD 1LD7A 4G8LA 2V4LA 3SY2A 1Z5SC 3C3QA 3E37A 1NZNA 4DI4A 3CVQA 5ARGA 1ZU2A 5T3RA 2LUHA 1AP7A 4UQXA 2QC9A 3CK7A 1MZCA 5EIBE 3B95A 3MZLB 2FBNA 2P9UG 3MX3A 2WVIA 3ESKA 3T8KA 2EIME 2XPYA 5LP0A 5CBNA 2R17C 2XCBA 3BQOA 3IEGA 1FVFA 4FU3A 3FUHA 5KBAA 3DPYA 5CERB 2X38A 2VGYA 2BEDA 1WDYA 5G05C 2I2OA 2L6JA 4YDOA 4I1AA 4GA1A 4YVOA 3OXLA 4W9RA 2YHEA 3D9JA 3CSFA 4K5BA 2UWJG 4CYMD 3FU5A 2WXMA 2CG2A 3PZ1A 2A5EA 4HQDA 1EDUA 1N4PA 2RFAA 4F1PA 4UI9C 5EX0A 5LOZA 5FZSA 5KJKA 3QWPA 3QB2A 1OWMA 3FDHA 4G11A 3Q9UC 2XEHA 4Y6CA 3JUEA 4ME2A 2FEZA 3KEAA 2R03A 3UQ3A 2WPVA 4DX5D 4Q94A 5DBKA 1OWOA 3HDXA 5FZRA 5G04J 2KCVA 3CKBA 4L2YA 3FEXA 3LVQE 1K1AA 3S2AA 4HOQA 3IHYA 4HFGA 4L2LA 3FTZA 2XPZA 3V2OA 3TWSA 2ZGDA 3QAQA 4HBDA 4J0UA 5A6CA 2WXHA 2J09A 3G2VA 3W9GA 1WM5A 3PZ4A 1ELWA 3G2WA 2LSUA 1IQUA 2J07A 3D9IA 5FQ7A 5HI7A 1U2VG 2JABA 1JCQA 2DZNA 3RK6A 3UUXA 5A7DB 2QFCA 3OTNA 3APDA 3NF1A 2WXKA 4OAUC 3ZYMA 4UQYA 3KSQA 4PDXA 1TR4A 2NSZA 4FHJA 1QYMA 3TWTA 2QYUA 2IQCA 4WNFA 5ENOD 2WXFA 2PNNA 2F37A 3GYZA 3FFLA 4FJZA 2AWIA 2VSNA 1QNFA 3TG4A 3S7JA 3ASFA 5LFAA 3G2UA 4M7CA 3V30A 5G2NA 2PZIA 4ANXA 4PUCA 2WXIA 1U3DA 5JA4D 5T4YA 3NZUA 3R9AB 2A4ZA 1SW6A 3EHNA 5AARA 4BWRA 2MRIA 4A63B 4G23A 3ZRHA 2H6GA 3LDZA 1TYQG 3DSTA 3RKVA 4WAFA 3PREA 4JEHA 3AG1E 3EJNA 3FUIA 2WM9A 3DSXA 2P9KG 3BUAA 3ZYKA 2XEVA 2DWZA 3AS8A 5BV0A 4XKCA 3UTMA 5HKPA 4DUIA 1RW2A 2WQ6A 3FUFA 2P9LG 2VQ2A 4G8KA 1E8ZA 4N2QA 1KZPA 2OVBA 4GTPA 3U4TA 2ETCA 1BLXB 5BPPA 3G2TA 3FUDA 2DYSE 2XS8A 3FUJA 1TNZA 2VSXE 5FTPA 3JXJA 2IOSA 4ZFHA 2XRYA 1SA4A 4DPRA 3HIZA 4EZLA 1NL4A 3C72A 4I6EA 3ZNGA 3C3RA 2E0IA 1H19A 2Y3AA 3U66A 4H7YA 5JJ7A 4OVUA 3CK8A 1V55E 3F6QA 4U07A 2R05A 3CGHA 4AJWA 2P9PG 3NB2A 3WG7E 2HM8A 5ENNA 4HORA 3GZSA 4BT8A 3FTWA 3IHVA 2XGOA 5ANLA 1W3BA 3ZGQA 4U8HA 2OVFA 4GZ6A 4U96D 2OEVA 5B3SE 3FTUA 1JPLA 5JHBA 3ULQA 5EIDA 4XZ4A 1OWNA 3EHMA 4FLBA 1DC2A 5AQBA 3QNKA 4ZHBA 4EBAG 4LEUA 2ONDA 2BKKB 1NI1A 4A1GA 4LNUD 3N71A 4U8YD 3PZ3A 1TNYA 3FH5A 3L82A 5CBOA 4YVQC 4ILGA 3HXBA 5BT1A 2A5UA 4HB5A 4IULA 3GZ1A 4CDMA 4FA6A 3EU9A 2C0MA 3OAWA 3HXDA 1L5JA 1OUVA 3HHMA 2VTBB 3E4BA 4QQIA 3MV2B 4J8YA 4GMLA 4TXPA 4KYOB 4XKBA 5D0QD 4DRXE 3FP3A 2IFUA 3R9MA 2UY1B 1BU9A 4YDEA 5CCMA 4OVVA 3CVWA 4JPSA 3FU6A 3HVEB 4Q96A 4CT4A 5BW8C 5CRUA 2EIKE 5DIZA 2OOEA 4GAAA 2IONA 5D2MC 4A55A 4R7LA 3QOUA 1N4QA 1ELKA 3TAXA 3KD7A 3MV3B 3B7UX 2F8YA 4B8CB 3RU0A 5EX3A 4C48B 3SI5A 3UIOC 5ITZF 3URZA 3LCAA 1HH8A 3QJZA 3E32A 3PUKA 4BFRA 1H6PA 2GRQB 1WG0A 1OCZE 2OCCE 3CQCB 3ZU7B 4GTOA 2XGMA 4HOUA 5JJ6A 3TXNA 3S7FA 3CKCA 4WWPA 2BF0X 5EN5D 4F1SA 2PQRA 5KJMA 2PM6A 1UW4B 1H6OA 3TWQA 1HE8A 2H6HA 3Q78A 1HX8A 4JW1A 3FTYA 5EYPF 2V5FA 2LAIA 3IBEA 3CK9A 2FO1E 1B89A 1O1RA 2XZTG 5JJTA 1UJJA 2AJAA 4FC8A 4DX2A 1OT8A 4ATGA 3ASHA 3AU4A 3PZDA 1SQMA 4KT6B 5FIOA 4G2VA 2CHXA 3SZ7A 2VGXB 4HI8A 4ACKA 2GRPB 4TV3A 5AYWD 4DK5A 2QYJA 4GMJA 3SO8A 3NZSA 1MJ0A 1QZ2A 3PNLB 2I6HA 3I5PA 1IHGA 5ENTD 1XNFA 3S7DA 3L17A 5J90A 3Q15A 1H2UA 5EDSA 2CFUA 4IRUA 4RQIA 2H6IA 3J5QB 4G26A 5B1AE 5ENRD 2XEEA 4BERA 3LPZA 1INZA 4XIFA 4DI3A 3UMVA 4LSZE 3UKRG 2BKGA 3ZYQA 4WNGA 4HRNA 4XI9A 3KS2A 2EILE 1S64A 1UG3A 3BU8A 2YQ8A 2IY0C 3T8MA 4XI0A 3FH7A 1ELRA 2XPIA 4GTSA 3AS5A 4LERA 1JCSA 3CEQA 2J4BA 4FULA 4A3TA 3KEZA 4AY5A 4J8DA 4LRZA 3QWWA 2J08A 4J8FA 1Q2ZA 4B94A 4TXQA 2EINE 3P2BA 1HS6A 1P5QA 4AIFA 3LVRE 1KPSB 1NP7A 3DSVA 3PE3A 1JWFA 1NA3A 2M63A 3UXGA 2IO3C 2HYZA 4PS8A 3RIBA 1Y8MA 2DIWA 3J5PA 4HXIA 3TJPA 3FEYA 4F7AA 2ZXWE 1D8EA 4MLPA 3FHEA 2LXLA 3VTXA 1E7UA 3S7BA 3CQGB 4B0ZA 1TNUA 3APFA 4NRHB 4GB9A 2IU1A 3PS6A 2AVPA 2B0OE 4BY6A 5LX8A 1UN8A 3Q9NC 2V8SE 1DCEA 3AG2E 4O1OA 2V5QC 3QDNA 1H2TC 2WMOA 2GRMA 4EPZA 2XHEA 2I1JA 2AXUA 4APFA 4B89A 1MHQA 1LTXA 1N0RA 1Z3YA 4JD2G 5FJYA 3JCKC 3R7QA 2J8SD 3ZHEB 4GTVA 4JXTA 1HZ4A 4Z68A 3V31A 2L9BA 3FTSA 2OV8A 2LSVA 3RSEG 2QY7A 3QARA 4GPMA 3EHRA 2Y4UA 3FY4A 5KNGA 3DXMG 4B8AA 4CRWA 2NXPA 1FPPA 5E76A 3TGOA 3L22A 1VDYA 5KJLA 4XE0A 2RFMA 3Q75A 2CHWA 3HXCA 5EYLA 3L54A 3PEVB 5CCLA 3CV0A 3DEPA 1YA0A 3FUNA 1AWCB 1EYHA 2WXQA 4GTQA 3JUIA 3DXKG 4GTTA 2WXPA 1WY6A 3SQVA 1N9AA 1Y6IA 1LF8A 1NFIE 2XS1A 3CVLA 2IOLA 3DRAA 2Y69E 3LYAA 4AOFA 2P58C 3MCXA 4GYWA 5LCWJ 5JMND 2J4DA
chains in the Genus database with same CATH topology
3E30A 1LD7A 3EUVA 1JCRA 1TNZA 3HXBA 3E37A 1S64A 1N95A 1TN7A 1QBQA 3DSUA 1D8DA 2H6HA 1LTXA 3Q78A 3HXDA 4GTSA 1SA4A 1FT1A 1TNBA 1X81A 1JCSA 4EHMA 4GTVA 1SA5A 1MZCA 1NL4A 1KZOA 3C72A 1O1RA 3SFYA 3SFXA 3Q79A 1LD8A 4YDEA 1N94A 1TN8A 1N4SA 2IEJA 3HXFA 3DPYA 4GTMA 4LNGA 2H6FA 1FPPA 3DSVA 1TN6A 4MBGA 2BEDA 3DSSA 1N4QA 1TNOA 2ZIRA 2F0YA 3Q75A 4YDOA 3PZ4A 2H6GA 3DSTA 3HXCA 1FT2A 3DSWA 1S63A 3HXEA 1D8EA 4GTQA 1JCQA 2R2LA 4GTTA 3E32A 3PZ1A 1N4RA 3DSXA 1O5MA 4L9PA 1O1SA 1N9AA 1O1TA 1N4PA 3PZ2A 1TNUA 3EU5A 3DRAA 4GTRA 2H6IA 1NI1A 4GTOA 3E33A 3Q7FA 3PZ3A 3E34A 1TNYA 3KSLA 2ZISA 4LNBA 3Q7AA 1DCEA 1KZPA 4GTPA 3KSQA 3Q73A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3E30 A;  1LD7 A;  3EUV A;  1JCR A;  1TNZ A;  3HXB A;  3E37 A;  1S64 A;  1N95 A;  1TN7 A;  1QBQ A;  3DSU A;  1D8D A;  2H6H A;  1LTX A;  3Q78 A;  3HXD A;  4GTS A;  1SA4 A;  1FT1 A;  1TNB A;  1X81 A;  1JCS A;  4EHM A;  4GTV A;  1SA5 A;  1MZC A;  1NL4 A;  1KZO A;  3C72 A;  1O1R A;  3SFY A;  3SFX A;  3Q79 A;  1LD8 A;  4YDE A;  1N94 A;  1TN8 A;  1N4S A;  2IEJ A;  3HXF A;  3DPY A;  4GTM A;  4LNG A;  2H6F A;  1FPP A;  3DSV A;  1TN6 A;  4MBG A;  2BED A;  3DSS A;  1N4Q A;  1TNO A;  2ZIR A;  2F0Y A;  3Q75 A;  4YDO A;  3PZ4 A;  2H6G A;  3DST A;  3HXC A;  1FT2 A;  3DSW A;  1S63 A;  3HXE A;  1D8E A;  4GTQ A;  1JCQ A;  2R2L A;  4GTT A;  3E32 A;  3PZ1 A;  1N4R A;  3DSX A;  1O5M A;  4L9P A;  1O1S A;  1N9A A;  1O1T A;  1N4P A;  3PZ2 A;  1TNU A;  3EU5 A;  3DRA A;  4GTR A;  2H6I A;  1NI1 A;  4GTO A;  3E33 A;  3Q7F A;  3PZ3 A;  3E34 A;  1TNY A;  3KSL A;  2ZIS A;  4LNB A;  3Q7A A;  1DCE A;  1KZP A;  4GTP A;  3KSQ A;  3Q73 A; 
#chains in the Genus database with same CATH topology
 4DX6 D;  5FT9 A;  3CHP A;  5CED B;  4FJY A;  1X5B A;  3RRU A;  2XGS A;  2BUG A;  2AW6 A;  2QZA A;  2WXG A;  5BXO A;  3SF4 A;  4DJA A;  1KT1 A;  4HLL A;  4EHM A;  5T8I A;  2YNQ A;  3PH0 C;  2ILR A;  2WQH A;  1WAO 1;  3TG5 A;  4NQ0 A;  3MGB A;  3SFY A;  2P2C P;  3EDT B;  4KXK B;  2KC7 A;  3HG0 D;  1YCS B;  3ML8 A;  4HOS A;  4TUM A;  1A17 A;  4L23 A;  3CVP A;  3LJ3 A;  3UT7 A;  3CVU A;  1E8Y A;  2X6F A;  3UIN C;  4I1M A;  3L16 A;  4ANV A;  2F8X K;  4X8Q A;  3L08 A;  3Q4A B;  5KCM A;  4GZ3 A;  2XCC A;  5G04 C;  1IHB A;  2R2L A;  2GRN B;  5KWD A;  2WXR A;  2CG3 A;  1JUQ A;  2IO2 C;  3ONL A;  1S0P A;  3DEO A;  1U3C A;  3ABM E;  3LEW A;  3EU5 A;  4LCT A;  3MKR A;  4WWN A;  4P29 A;  1IQR A;  1ZBP A;  4HI9 A;  4FP7 A;  1MYO A;  4WNE A;  3VTY A;  2RG8 A;  3D9O A;  3ZFW A;  4N3C A;  4N2S A;  1UOH A;  4UWG A;  5CEA A;  4Q69 A;  1Z3X A;  4N3B A;  1Z6T A;  4NIK A;  2RD0 A;  3VLF A;  3HYM B;  1H6K A;  1TN7 A;  3TWR A;  2XQ0 A;  4G1T A;  4FLH A;  3FUK A;  2GRR B;  4I1O B;  3X2Q E;  2JLB A;  1TNB A;  3UT8 A;  2KCK A;  1PC2 A;  5ENQ D;  3FUL A;  3Q47 B;  3P1U A;  4I43 A;  3I4R B;  2EQX A;  1IYG A;  4FAD A;  4E85 A;  3FTV A;  1SZ9 A;  3TWU A;  4HRM B;  2L6B A;  4N5Q A;  3CR3 A;  3CST A;  2ZGG A;  2WMN A;  3RRM B;  4KBQ A;  4ILI A;  4YDY A;  3SD5 A;  3SBS A;  3CVV A;  1OWP A;  4J8S A;  4F53 A;  3HXF A;  4F3V A;  2YHC A;  4APO A;  2VTB A;  1JWG A;  3OXG A;  1FVH A;  4O60 A;  3B7T A;  2UY1 A;  3MEK A;  4B93 B;  1HG5 A;  3HVE A;  3B7S A;  4AY6 A;  3U3W A;  1HFA A;  3AG4 E;  2WXN A;  2MYO A;  2XEN A;  2E2E A;  4HOT A;  4YDW A;  1V54 E;  2CFZ A;  2VSY A;  3AG3 E;  2L0T B;  2VYI A;  1G3N B;  1O1T A;  1N0Q A;  3CHQ A;  1OCC E;  1MQS A;  4JL0 A;  1K3Z D;  3SGH A;  2CHZ A;  3Q7A A;  4J7W A;  3IV0 A;  5EKQ D;  4K5A B;  3NAW A;  2VJ8 A;  4HS2 A;  5E75 A;  4TXR A;  1GW6 A;  4OAV B;  3UM1 A;  3RJV A;  3R7R A;  5LCW C;  2DBA A;  5AJL A;  3ULY A;  3D3M A;  3MKQ B;  4BX9 A;  2KZT B;  2FF4 A;  5KNH D;  1DCQ A;  4FHK A;  3QWV A;  2X3M A;  4GZD A;  4BTB A;  3ZXS A;  1UJK A;  1MX4 A;  1TN8 A;  5CMY A;  1IKN D;  4CCA A;  1TN6 A;  4UWK A;  3W9F A;  5FWQ A;  2LNI A;  4RG9 A;  4O1P A;  2ZIR A;  4DLO A;  3RO3 A;  1FT2 A;  3CHS A;  3HXE A;  2X6H A;  3DWL G;  5CEC B;  4BET A;  2VGX A;  2I1K A;  1E90 A;  3D9M A;  1N4R A;  3ZVV A;  3ESL A;  2WXO A;  2Y1L E;  3PZ2 A;  4GYO A;  2P9S G;  3ASD A;  3Q7F A;  4J6I A;  3E34 A;  2IF4 A;  2X6K A;  3ABL E;  4ABN A;  4XX5 A;  4QFV A;  4BX8 A;  4CDN A;  4HNA D;  5AQA A;  2P9N G;  3ML9 A;  3ULE G;  2PM7 A;  2IJG X;  3UX4 A;  4OYS A;  3JYS A;  4I17 A;  4JA7 A;  2GRL A;  4U04 A;  3CHO A;  3TWW A;  3DSU A;  1N52 A;  1D8D A;  2X6I A;  3T5X A;  1BI8 B;  3ZW3 A;  3IXE A;  4URK A;  2XRZ A;  3T9K A;  4C0M A;  1KT0 A;  4I6G A;  3ZN3 A;  1PY1 A;  4L7T A;  4KVO A;  3AS4 A;  4MRU A;  4EEC A;  3C3O A;  2DCP A;  3QK0 A;  4U7E B;  4AEZ C;  4AM9 A;  4V3I A;  1BI7 B;  4U0Z A;  1N94 A;  1DNP A;  3UIP C;  2VGE A;  4UWL A;  5AQ9 A;  4GTM A;  3D9H A;  3PVL A;  4GMR A;  3PDN A;  1DVP A;  4CGW A;  1YYH A;  4XEI G;  2J9Q A;  1IXV A;  1TEZ A;  1E8X A;  3GZ2 A;  4DX7 D;  2HE0 A;  3K9I A;  2WXL A;  4JZY A;  2DVW A;  3CVN A;  3IKO B;  2FO7 A;  1HU3 A;  3ZIM A;  4HRL A;  2PL2 A;  4U63 A;  3FUM A;  3E33 A;  4LUN U;  4BEP A;  1N54 A;  3UM2 A;  1BPO A;  4YND A;  4LNB A;  3NOG D;  4JEU A;  3VLE A;  2GGF A;  3D9N A;  1OXJ A;  1SZA A;  1RZ4 A;  4TRQ A;  5AAO A;  1N95 A;  3ASG A;  5ARF A;  4BES A;  4GCO A;  3EIJ A;  1X81 A;  4MS6 A;  1KZO A;  1QQE A;  4MKT A;  4BTA A;  3ASN E;  3WXX A;  2MHK A;  2WQ7 A;  5HS0 A;  1E96 B;  2LO6 A;  1H0A A;  5HRY A;  2FUL A;  5D0O D;  3HRA A;  3ZHE A;  4ACL A;  4CEM A;  2IEJ A;  3UM0 A;  4D10 C;  4C9B B;  4AVX A;  5A23 A;  3ZYL A;  3LS8 A;  4K0R A;  4U95 D;  4MBG A;  3FH8 A;  3Q49 B;  2F0Y A;  3CLJ A;  4PH4 B;  4E6H A;  4G25 A;  5CHE E;  3APC A;  1OWL A;  3FTX A;  4RSY A;  4JHJ A;  2FI7 A;  3TXM A;  1K8K G;  4U0S A;  4ANW A;  3PE4 A;  3CHM A;  3UT4 A;  3L6A A;  4PS3 A;  3ZKJ A;  5H7P A;  4L9P A;  4GCN A;  3G2S A;  3GW4 A;  2BTD A;  1A5E A;  2HR2 A;  4GZ5 A;  2DYR E;  3ZPJ A;  2KXP C;  4CGV A;  2WB2 A;  3C98 A;  3B7R L;  3Q73 A;  4ATZ D;  3CVX A;  1JCR A;  2Y4T A;  3T5V A;  1MX2 A;  3O4Z A;  3RRN B;  1XGW A;  3LKU A;  3NBN B;  1QBQ A;  3AU5 A;  4GA2 A;  4K5C A;  3CIA A;  4G24 A;  3AAA C;  3I3N A;  4U8V D;  1FT1 A;  3UPV A;  5KJN A;  4JHK A;  3V2X A;  5BUZ A;  4I9E A;  2WXJ A;  1UN9 A;  3L13 A;  2I9C A;  4ANU A;  2R02 A;  1OCR E;  5AEN A;  4C0E A;  4DX1 A;  5HQ8 A;  1TJC A;  3SBT B;  1N11 A;  3UM3 A;  3CVY A;  4AV7 A;  2R5S A;  4PS7 A;  4BSZ B;  3L9T A;  4CT0 A;  1K1B A;  2H6F A;  3DSS A;  5IY5 E;  3MJW A;  3BEE A;  4I6J A;  4KVM A;  4H7X A;  1TNO A;  3DBS A;  2KCL A;  4O6F A;  1HG2 A;  2X6J A;  4NUR A;  1BD8 A;  3DPD A;  1H2V C;  3ASO E;  3I4G A;  4AXH A;  1NA0 A;  3FUE A;  2J49 A;  1O5M A;  1O1S A;  2YIN A;  3SNX A;  3ZXP A;  4GZC A;  3JXI A;  3JQ0 A;  4GTR A;  3OXF A;  4N3A A;  3LY8 A;  1KLX A;  2KAT A;  4N5C A;  3U9W A;  4RLY A;  3RAU A;  4DLQ A;  4I2Z A;  4JC8 A;  3FWV A;  2PQN A;  4IN3 B;  3QKY A;  4KZ0 A;  3E30 A;  1SVX A;  3EUV A;  2V4H C;  5M72 A;  3ZEF A;  5D66 A;  2V0P A;  5FIN A;  3TWX A;  4ILH B;  2ZU6 B;  4L1B A;  3V79 K;  3TL5 A;  4CDR A;  1SA5 A;  4CZ2 D;  2GRO B;  1HXI A;  4UWF A;  2AXV A;  4Y6W A;  3FU3 A;  4GA0 A;  5G05 J;  4AP2 A;  5G55 A;  3SFX A;  1S70 B;  5FQ8 A;  5BV1 A;  4BSX A;  3PUJ A;  2C0L A;  1YMP A;  1PAQ A;  5C1D A;  4M3O A;  4GU5 A;  4RG6 A;  4HVB A;  4EBA A;  3C5R A;  3AJI A;  2RKK A;  3ZUV B;  1HO8 A;  3U64 A;  4N39 A;  1D9S A;  4WND A;  3SHF A;  5ENP D;  5AIJ A;  2EIJ E;  3PRZ A;  3LY7 A;  4KZC A;  3NQP A;  2Q7F A;  4UI9 J;  5AN8 A;  3SFZ A;  1EPU A;  5BXU A;  3DSW A;  2R59 A;  2B6C A;  5FQ6 A;  1S63 A;  5FQ4 A;  4U0U A;  2HO1 A;  2Y0B G;  3D9K A;  5CRV A;  5AQ7 A;  4F6R D;  2NC9 A;  4UUC A;  4K03 A;  4EZJ A;  1FCH A;  4UI9 K;  2ETB A;  3MA5 A;  3O48 A;  3JQ1 A;  3QC1 A;  4NAC A;  5EIL A;  3ISM C;  1MX6 A;  3MYV A;  4WUY A;  2LXM A;  1E7V A;  1EF1 C;  1TJF A;  4I2W A;  4TUU A;  3ABK E;  3VLD A;  1OY3 D;  2C2L A;  2LAH A;  3LXU X;  2AXZ A;  2KBX A;  2ETA A;  5J08 A;  3PNT B;  4I9C A;  3D9P A;  5ANR A;  2JEK A;  5JHA A;  3FU0 A;  1E8W A;  4GYY A;  5B1B E;  2P9I G;  3Q79 A;  3TWV A;  3UKU G;  4GPK A;  1LD8 A;  3Q5M A;  5FZQ A;  3BG1 B;  2XZD G;  4JB8 P;  3MKQ A;  3PEU B;  4JHR A;  1N4S A;  2KZT A;  4JA9 A;  4UQZ A;  3KAE A;  4LNG A;  4WWO A;  4A3V A;  2MOW A;  2OEW A;  4UWH A;  3LY9 A;  1OCO E;  3D9L A;  3NOC D;  4EQF A;  1HF8 A;  4KMO A;  3B7B A;  2KM4 A;  2L0I A;  4EZK A;  5BNW A;  2GW1 A;  4HLE A;  3ONK A;  4IYP A;  5CMW A;  4LG6 A;  4A1S A;  4JVS A;  3EIQ C;  3BG0 B;  3CHR A;  5AJD A;  3LJN A;  3EHQ A;  2DZO A;  4J8E A;  3UI2 A;  3RO2 A;  2NYJ A;  2VSO E;  3KSL A;  2ZIS A;  5C2Y A;  4BT9 A;  1ZB1 A;  4RVB A;  3ENE A;  3B13 A;  5ENS D;  1LD7 A;  4G8L A;  2V4L A;  3SY2 A;  1Z5S C;  3C3Q A;  3E37 A;  1NZN A;  4DI4 A;  3CVQ A;  5ARG A;  1ZU2 A;  5T3R A;  2LUH A;  1AP7 A;  4UQX A;  2QC9 A;  3CK7 A;  1MZC A;  5EIB E;  3B95 A;  3MZL B;  2FBN A;  2P9U G;  3MX3 A;  2WVI A;  3ESK A;  3T8K A;  2EIM E;  2XPY A;  5LP0 A;  5CBN A;  2R17 C;  2XCB A;  3BQO A;  3IEG A;  1FVF A;  4FU3 A;  3FUH A;  5KBA A;  3DPY A;  5CER B;  2X38 A;  2VGY A;  2BED A;  1WDY A;  5G05 C;  2I2O A;  2L6J A;  4YDO A;  4I1A A;  4GA1 A;  4YVO A;  3OXL A;  4W9R A;  2YHE A;  3D9J A;  3CSF A;  4K5B A;  2UWJ G;  4CYM D;  3FU5 A;  2WXM A;  2CG2 A;  3PZ1 A;  2A5E A;  4HQD A;  1EDU A;  1N4P A;  2RFA A;  4F1P A;  4UI9 C;  5EX0 A;  5LOZ A;  5FZS A;  5KJK A;  3QWP A;  3QB2 A;  1OWM A;  3FDH A;  4G11 A;  3Q9U C;  2XEH A;  4Y6C A;  3JUE A;  4ME2 A;  2FEZ A;  3KEA A;  2R03 A;  3UQ3 A;  2WPV A;  4DX5 D;  4Q94 A;  5DBK A;  1OWO A;  3HDX A;  5FZR A;  5G04 J;  2KCV A;  3CKB A;  4L2Y A;  3FEX A;  3LVQ E;  1K1A A;  3S2A A;  4HOQ A;  3IHY A;  4HFG A;  4L2L A;  3FTZ A;  2XPZ A;  3V2O A;  3TWS A;  2ZGD A;  3QAQ A;  4HBD A;  4J0U A;  5A6C A;  2WXH A;  2J09 A;  3G2V A;  3W9G A;  1WM5 A;  3PZ4 A;  1ELW A;  3G2W A;  2LSU A;  1IQU A;  2J07 A;  3D9I A;  5FQ7 A;  5HI7 A;  1U2V G;  2JAB A;  1JCQ A;  2DZN A;  3RK6 A;  3UUX A;  5A7D B;  2QFC A;  3OTN A;  3APD A;  3NF1 A;  2WXK A;  4OAU C;  3ZYM A;  4UQY A;  3KSQ A;  4PDX A;  1TR4 A;  2NSZ A;  4FHJ A;  1QYM A;  3TWT A;  2QYU A;  2IQC A;  4WNF A;  5ENO D;  2WXF A;  2PNN A;  2F37 A;  3GYZ A;  3FFL A;  4FJZ A;  2AWI A;  2VSN A;  1QNF A;  3TG4 A;  3S7J A;  3ASF A;  5LFA A;  3G2U A;  4M7C A;  3V30 A;  5G2N A;  2PZI A;  4ANX A;  4PUC A;  2WXI A;  1U3D A;  5JA4 D;  5T4Y A;  3NZU A;  3R9A B;  2A4Z A;  1SW6 A;  3EHN A;  5AAR A;  4BWR A;  2MRI A;  4A63 B;  4G23 A;  3ZRH A;  2H6G A;  3LDZ A;  1TYQ G;  3DST A;  3RKV A;  4WAF A;  3PRE A;  4JEH A;  3AG1 E;  3EJN A;  3FUI A;  2WM9 A;  3DSX A;  2P9K G;  3BUA A;  3ZYK A;  2XEV A;  2DWZ A;  3AS8 A;  5BV0 A;  4XKC A;  3UTM A;  5HKP A;  4DUI A;  1RW2 A;  2WQ6 A;  3FUF A;  2P9L G;  2VQ2 A;  4G8K A;  1E8Z A;  4N2Q A;  1KZP A;  2OVB A;  4GTP A;  3U4T A;  2ETC A;  1BLX B;  5BPP A;  3G2T A;  3FUD A;  2DYS E;  2XS8 A;  3FUJ A;  1TNZ A;  2VSX E;  5FTP A;  3JXJ A;  2IOS A;  4ZFH A;  2XRY A;  1SA4 A;  4DPR A;  3HIZ A;  4EZL A;  1NL4 A;  3C72 A;  4I6E A;  3ZNG A;  3C3R A;  2E0I A;  1H19 A;  2Y3A A;  3U66 A;  4H7Y A;  5JJ7 A;  4OVU A;  3CK8 A;  1V55 E;  3F6Q A;  4U07 A;  2R05 A;  3CGH A;  4AJW A;  2P9P G;  3NB2 A;  3WG7 E;  2HM8 A;  5ENN A;  4HOR A;  3GZS A;  4BT8 A;  3FTW A;  3IHV A;  2XGO A;  5ANL A;  1W3B A;  3ZGQ A;  4U8H A;  2OVF A;  4GZ6 A;  4U96 D;  2OEV A;  5B3S E;  3FTU A;  1JPL A;  5JHB A;  3ULQ A;  5EID A;  4XZ4 A;  1OWN A;  3EHM A;  4FLB A;  1DC2 A;  5AQB A;  3QNK A;  4ZHB A;  4EBA G;  4LEU A;  2OND A;  2BKK B;  1NI1 A;  4A1G A;  4LNU D;  3N71 A;  4U8Y D;  3PZ3 A;  1TNY A;  3FH5 A;  3L82 A;  5CBO A;  4YVQ C;  4ILG A;  3HXB A;  5BT1 A;  2A5U A;  4HB5 A;  4IUL A;  3GZ1 A;  4CDM A;  4FA6 A;  3EU9 A;  2C0M A;  3OAW A;  3HXD A;  1L5J A;  1OUV A;  3HHM A;  2VTB B;  3E4B A;  4QQI A;  3MV2 B;  4J8Y A;  4GML A;  4TXP A;  4KYO B;  4XKB A;  5D0Q D;  4DRX E;  3FP3 A;  2IFU A;  3R9M A;  2UY1 B;  1BU9 A;  4YDE A;  5CCM A;  4OVV A;  3CVW A;  4JPS A;  3FU6 A;  3HVE B;  4Q96 A;  4CT4 A;  5BW8 C;  5CRU A;  2EIK E;  5DIZ A;  2OOE A;  4GAA A;  2ION A;  5D2M C;  4A55 A;  4R7L A;  3QOU A;  1N4Q A;  1ELK A;  3TAX A;  3KD7 A;  3MV3 B;  3B7U X;  2F8Y A;  4B8C B;  3RU0 A;  5EX3 A;  4C48 B;  3SI5 A;  3UIO C;  5ITZ F;  3URZ A;  3LCA A;  1HH8 A;  3QJZ A;  3E32 A;  3PUK A;  4BFR A;  1H6P A;  2GRQ B;  1WG0 A;  1OCZ E;  2OCC E;  3CQC B;  3ZU7 B;  4GTO A;  2XGM A;  4HOU A;  5JJ6 A;  3TXN A;  3S7F A;  3CKC A;  4WWP A;  2BF0 X;  5EN5 D;  4F1S A;  2PQR A;  5KJM A;  2PM6 A;  1UW4 B;  1H6O A;  3TWQ A;  1HE8 A;  2H6H A;  3Q78 A;  1HX8 A;  4JW1 A;  3FTY A;  5EYP F;  2V5F A;  2LAI A;  3IBE A;  3CK9 A;  2FO1 E;  1B89 A;  1O1R A;  2XZT G;  5JJT A;  1UJJ A;  2AJA A;  4FC8 A;  4DX2 A;  1OT8 A;  4ATG A;  3ASH A;  3AU4 A;  3PZD A;  1SQM A;  4KT6 B;  5FIO A;  4G2V A;  2CHX A;  3SZ7 A;  2VGX B;  4HI8 A;  4ACK A;  2GRP B;  4TV3 A;  5AYW D;  4DK5 A;  2QYJ A;  4GMJ A;  3SO8 A;  3NZS A;  1MJ0 A;  1QZ2 A;  3PNL B;  2I6H A;  3I5P A;  1IHG A;  5ENT D;  1XNF A;  3S7D A;  3L17 A;  5J90 A;  3Q15 A;  1H2U A;  5EDS A;  2CFU A;  4IRU A;  4RQI A;  2H6I A;  3J5Q B;  4G26 A;  5B1A E;  5ENR D;  2XEE A;  4BER A;  3LPZ A;  1INZ A;  4XIF A;  4DI3 A;  3UMV A;  4LSZ E;  3UKR G;  2BKG A;  3ZYQ A;  4WNG A;  4HRN A;  4XI9 A;  3KS2 A;  2EIL E;  1S64 A;  1UG3 A;  3BU8 A;  2YQ8 A;  2IY0 C;  3T8M A;  4XI0 A;  3FH7 A;  1ELR A;  2XPI A;  4GTS A;  3AS5 A;  4LER A;  1JCS A;  3CEQ A;  2J4B A;  4FUL A;  4A3T A;  3KEZ A;  4AY5 A;  4J8D A;  4LRZ A;  3QWW A;  2J08 A;  4J8F A;  1Q2Z A;  4B94 A;  4TXQ A;  2EIN E;  3P2B A;  1HS6 A;  1P5Q A;  4AIF A;  3LVR E;  1KPS B;  1NP7 A;  3DSV A;  3PE3 A;  1JWF A;  1NA3 A;  2M63 A;  3UXG A;  2IO3 C;  2HYZ A;  4PS8 A;  3RIB A;  1Y8M A;  2DIW A;  3J5P A;  4HXI A;  3TJP A;  3FEY A;  4F7A A;  2ZXW E;  1D8E A;  4MLP A;  3FHE A;  2LXL A;  3VTX A;  1E7U A;  3S7B A;  3CQG B;  4B0Z A;  1TNU A;  3APF A;  4NRH B;  4GB9 A;  2IU1 A;  3PS6 A;  2AVP A;  2B0O E;  4BY6 A;  5LX8 A;  1UN8 A;  3Q9N C;  2V8S E;  1DCE A;  3AG2 E;  4O1O A;  2V5Q C;  3QDN A;  1H2T C;  2WMO A;  2GRM A;  4EPZ A;  2XHE A;  2I1J A;  2AXU A;  4APF A;  4B89 A;  1MHQ A;  1LTX A;  1N0R A;  1Z3Y A;  4JD2 G;  5FJY A;  3JCK C;  3R7Q A;  2J8S D;  3ZHE B;  4GTV A;  4JXT A;  1HZ4 A;  4Z68 A;  3V31 A;  2L9B A;  3FTS A;  2OV8 A;  2LSV A;  3RSE G;  2QY7 A;  3QAR A;  4GPM A;  3EHR A;  2Y4U A;  3FY4 A;  5KNG A;  3DXM G;  4B8A A;  4CRW A;  2NXP A;  1FPP A;  5E76 A;  3TGO A;  3L22 A;  1VDY A;  5KJL A;  4XE0 A;  2RFM A;  3Q75 A;  2CHW A;  3HXC A;  5EYL A;  3L54 A;  3PEV B;  5CCL A;  3CV0 A;  3DEP A;  1YA0 A;  3FUN A;  1AWC B;  1EYH A;  2WXQ A;  4GTQ A;  3JUI A;  3DXK G;  4GTT A;  2WXP A;  1WY6 A;  3SQV A;  1N9A A;  1Y6I A;  1LF8 A;  1NFI E;  2XS1 A;  3CVL A;  2IOL A;  3DRA A;  2Y69 E;  3LYA A;  4AOF A;  2P58 C;  3MCX A;  4GYW A;  5LCW J;  5JMN D;  2J4D A; 
#chains in the Genus database with same CATH homology
 3E30 A;  1LD7 A;  3EUV A;  1JCR A;  1TNZ A;  3HXB A;  3E37 A;  1S64 A;  1N95 A;  1TN7 A;  1QBQ A;  3DSU A;  1D8D A;  2H6H A;  1LTX A;  3Q78 A;  3HXD A;  4GTS A;  1SA4 A;  1FT1 A;  1TNB A;  1X81 A;  1JCS A;  4EHM A;  4GTV A;  1SA5 A;  1MZC A;  1NL4 A;  1KZO A;  3C72 A;  1O1R A;  3SFY A;  3SFX A;  3Q79 A;  1LD8 A;  4YDE A;  1N94 A;  1TN8 A;  1N4S A;  2IEJ A;  3HXF A;  3DPY A;  4GTM A;  4LNG A;  2H6F A;  1FPP A;  3DSV A;  1TN6 A;  4MBG A;  2BED A;  3DSS A;  1N4Q A;  1TNO A;  2ZIR A;  2F0Y A;  3Q75 A;  4YDO A;  3PZ4 A;  2H6G A;  3DST A;  3HXC A;  1FT2 A;  3DSW A;  1S63 A;  3HXE A;  1D8E A;  4GTQ A;  1JCQ A;  2R2L A;  4GTT A;  3E32 A;  3PZ1 A;  1N4R A;  3DSX A;  1O5M A;  4L9P A;  1O1S A;  1N9A A;  1O1T A;  1N4P A;  3PZ2 A;  1TNU A;  3EU5 A;  3DRA A;  4GTR A;  2H6I A;  1NI1 A;  4GTO A;  3E33 A;  3Q7F A;  3PZ3 A;  3E34 A;  1TNY A;  3KSL A;  2ZIS A;  4LNB A;  3Q7A A;  1DCE A;  1KZP A;  4GTP A;  3KSQ A;  3Q73 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...