2H6FA

Protein farnesyltransferase complexed with a farnesylated ddptasacvls peptide product at 1.5a resolution
Total Genus 134
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
134
sequence length
315
structure length
315
Chain Sequence
b'FVSLDSPSYVLYRDRAEWADIDPVPQNDGPNPVVQIIYSDKFRDVYDYFRAVLQRDERSERAFKLTRDAIELNAANYTVWHFRRVLLKSLQKDLHEEMNYITAIIEEQPKNYQVWHHRRVLVEWLRDPSQELEFIADILNQDAKNYHAWQHRQWVIQEFKLWDNELQYVDQLLKEDVRNNSVWNQRYFVISNTTGYNDRAVLEREVQYTLEMIKLVPHNESAWNYLKGILQDRGLSKYPNLLNQLLDLQPSHSSPYLIAFLVDIYEDMLENQCDNKEDILNKALELCEILAKEKDTIRKEYWRYIGRSLQSKHST'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protein farnesyltransferase/geranylgeranyltransferase type I
molecule tags Transferase
source organism Homo sapiens
publication title Conversion of protein farnesyltransferase to a geranylgeranyltransferase.
pubmed doi rcsb
total genus 134
structure length 315
sequence length 315
ec nomenclature ec 2.5.1.58: Protein farnesyltransferase.
pdb deposition date 2006-05-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01239 PPTA Protein prenyltransferase alpha subunit repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.120 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Protein prenylyltransferase 2h6fA00
3HXEA 4GTSA 3PZ2A 1LD8A 1N9AA 1NI1A 2H6IA 4MBGA 4YDEA 2F0YA 1JCSA 3DPYA 1TNYA 1FPPA 3HXBA 1KZOA 1MZCA 2H6GA 1O5MA 1N4RA 1TNBA 1TNZA 3HXFA 3HXCA 3EU5A 1LD7A 1JCRA 3PZ3A 2H6HA 1TN6A 1TNUA 4LNGA 3PZ4A 1FT1A 3Q73A 3KSQA 3DSVA 4GTOA 3SFXA 3DSUA 4LNBA 3E34A 3E32A 1O1TA 1S63A 1TN8A 3Q78A 1QBQA 1N95A 3EUVA 1TNOA 3DSSA 1NL4A 4GTPA 3E37A 3E30A 1N4PA 2ZIRA 2ZISA 2IEJA 1N94A 1KZPA 4GTMA 1JCQA 3DRAA 3DSXA 1X81A 3C72A 4YDOA 1O1SA 1TN7A 4GTTA 1S64A 4EHMA 3HXDA 4L9PA 1O1RA 3Q7AA 1D8DA 2BEDA 1N4QA 1FT2A 4GTVA 3KSLA 1SA4A 3Q7FA 3DSTA 2R2LA 3Q75A 1D8EA 1N4SA 3PZ1A 2H6FA 3SFYA 3Q79A 3E33A 1DCEA 1SA5A 4GTQA 1LTXA 4GTRA 3DSWA
chains in the Genus database with same CATH superfamily
1YA0A 5KCMA 5A7DB 2A5UA 4CGWA 1TR4A 5FINA 4GZ6A 4K03A 4GMRA 3UXGA 3PREA 4DPRA 3FULA 4Z68A 4CEMA 2DYRE 2UY1B 2B0OE 3FUFA 2IFUA 5FJYA 3FUMA 4ILHB 4JEHA 3U4TA 1DCQA 1HXIA 4WNDA 1TNUA 2I6HA 2ETAA 2VGYA 3SD5A 4HRNA 2EIJE 4N5QA 5LCWJ 3E32A 3SI5A 3Q78A 4AY5A 1KT1A 2DCPA 1FCHA 2HM8A 5B1AE 3ASNE 4JVSA 2GRPB 3IHVA 1K1AA 2WXIA 4KT6B 2AJAA 4DX2A 4ME2A 1OXJA 2CG2A 3C72A 4URKA 1O1SA 4JPSA 1WDYA 3LVQE 1MQSA 3RRUA 3VTXA 4GYOA 3SHFA 3QKYA 4KVOA 2ZU6B 3D9JA 2RFMA 4MRUA 3Q79A 1ELWA 2JABA 2XQ0A 3APDA 2GGFA 3TXNA 3FTSA 2IJGX 3CVYA 2YINA 2XS1A 3G2SA 3CVQA 1UN9A 4I1OB 3PS6A 3R7RA 3FUHA 2WMNA 1BI7B 3CK8A 3FHEA 4J7WA 3PDNA 4UWHA 1X5BA 1E8ZA 3HXFA 1LD7A 4GA1A 4UI9K 3BEEA 1PAQA 3IXEA 3HYMB 1RW2A 3EIQC 4TV3A 5H7PA 4NACA 2BUGA 3DSUA 1ZB1A 1QQEA 5J90A 2L6JA 3KS2A 4XI0A 2RD0A 2WQHA 5ITZF 2GROB 3E37A 3E30A 3AS5A 1HO8A 1WAO1 4JXTA 3W9FA 3NZSA 4BY6A 3OXFA 4MLPA 5HKPA 4ANWA 1OCOE 3SF4A 3FTUA 3DRAA 1UJJA 3CHPA 1QNFA 2HO1A 3GZ1A 5ANRA 3CK7A 3R9MA 3O48A 4ANUA 3CLJA 3CQGB 3G2VA 1HZ4A 3VLEA 4A1SA 3TWWA 1SA4A 3QJZA 3FH7A 4OAUC 1H6OA 2LAIA 3Q9UC 5AQBA 2IY0C 4GCOA 2H6FA 3P1UA 4MS6A 4CZ2D 1OCZE 3ASGA 5KJNA 5AARA 3B7SA 3TWUA 4FA6A 1K8KG 3MJWA 3SGHA 3DPYA 4AOFA 4B89A 4HNAD 2KCKA 3BG1B 2FBNA 1DC2A 4G26A 2XRYA 4UQZA 2H6HA 1N54A 4HFGA 4LNGA 2NYJA 4MKTA 1N0RA 4RQIA 4U7EB 2WXNA 2FI7A 2C0MA 4GTOA 3SFXA 2AXVA 4C0MA 2XCCA 3URZA 4UWFA 3U3WA 5HI7A 4PUCA 1XNFA 2LAHA 3ESLA 3HG0D 3UQ3A 3TWRA 2X6JA 1WM5A 2UY1A 3RJVA 4XE0A 4L2LA 3PNTB 1MJ0A 1A5EA 4GZDA 3J5PA 4HXIA 3TG4A 3ZYMA 2GRNB 1GW6A 2I1JA 4UI9J 4I6JA 5EX3A 2EILE 3FEXA 4I6GA 3UPVA 4O1PA 1TN7A 4XI9A 3S7FA 4NIKA 5IY5E 1NP7A 3FDHA 5D0QD 3Q5MA 4UWLA 4HI9A 4GTVA 3D9HA 2CFUA 1V54E 4A63B 3PZ1A 3EDTB 1SZ9A 1HF8A 3HVEB 5HS0A 2WXPA 2WXQA 4EZLA 1EDUA 1MX6A 4IRUA 1Y8MA 4J8EA 4FLBA 2F0YA 5JJTA 4I9EA 2WXOA 3FY4A 3PEVB 4BEPA 2V5QC 4M3OA 3UX4A 3WG7E 5G05J 3KEAA 1L5JA 4CDRA 3PH0C 5E76A 3PZ4A 2MOWA 4EZKA 2WMOA 2ZGGA 4DUIA 4HORA 3FU6A 2HR2A 5CEAA 3C3RA 3UIPC 4FULA 4U07A 3CHMA 3QWWA 2OVBA 4CDMA 3TWTA 4UQYA 3T8MA 4JC8A 4IN3B 3ZHEB 1IQRA 3MEKA 2WXKA 2CHXA 2WXFA 3MKQB 1YMPA 1IHBA 1W3BA 3SZ7A 3TXMA 1NZNA 3LVRE 2XEHA 4HOUA 2R03A 4HRMB 1S64A 4EQFA 3B7UX 1D8DA 2EIME 1RZ4A 4UUCA 5ANLA 2ZXWE 2EQXA 3PRZA 5EIBE 4LEUA 3SFYA 4UWGA 1SA5A 4WNEA 3UKUG 2FEZA 2VSYA 4ANXA 4LNUD 4GMJA 2V4LA 2IONA 5C1DA 4XX5A 3S7BA 3D9OA 1N0QA 3CK9A 4HLEA 4J8DA 2OEVA 2VTBB 4PH4B 4WWPA 3HHMA 3EIJA 2NSZA 3SY2A 4I1AA 2P9NG 4U0SA 2BTDA 2QZAA 1H2UA 3MKRA 3GZ2A 2C2LA 5G04J 1MHQA 2J08A 5C2YA 3IHYA 3IKOB 3QAQA 2X38A 3CIAA 2PM7A 5AN8A 3Q15A 5FT9A 1VDYA 4L1BA 1WG0A 3ABKE 2AVPA 3T5XA 2XS8A 2P9SG 2XPIA 3QWPA 4BWRA 1NA3A 4XKBA 4J8FA 4KXKB 4ILGA 3MV3B 1H0AA 4JZYA 1K1BA 3SO8A 4TUMA 2CG3A 5JHBA 3AS4A 1PC2A 4FLHA 3Q75A 4OYSA 1N52A 3MKQA 3B7BA 4IULA 4GTRA 3L17A 3TG5A 4L7TA 4BSXA 3CHSA 3FU5A 4U04A 3JQ1A 1ZBPA 3HXBA 4GZ3A 3D9LA 4CT0A 3UM0A 3TWXA 4HQDA 3SBSA 3AG3E 2GRLA 2WXGA 4GB9A 5DBKA 4GMLA 3RAUA 4O1OA 5D0OD 4AP2A 2IF4A 4I1MA 2UWJG 3RU0A 3AU4A 2FO1E 2WXLA 3UT4A 5AIJA 3CHQA 5CECB 3R7QA 1N95A 3VLFA 4JA7A 4ATZD 4D10C 4JB8P 4ZHBA 1Z3XA 1DNPA 2IO3C 2XCBA 4JHRA 2KCLA 4H7XA 4BESA 4HLLA 4KZ0A 5LFAA 3FH8A 4RVBA 3GYZA 4E85A 1XGWA 4AVXA 4N39A 4DX6D 4U96D 3CKCA 4BTAA 2JLBA 4PDXA 1UW4B 5AQ7A 2X6KA 3ULYA 2Y4TA 5ENRD 3JUEA 1KLXA 4C9BB 1TYQG 5BPPA 3AU5A 4I17A 1YCSB 1D9SA 2PQNA 4GTQA 5FZQA 5J08A 4DX1A 3PUKA 1IXVA 3B7RL 3ZGQA 3FTZA 1OWOA 2PL2A 4DK5A 1E8WA 2EINE 2Y69E 3C3QA 1OT8A 3O4ZA 1IYGA 2R59A 5EILA 4C48B 4HVBA 2IO2C 1EYHA 1O5MA 4DLQA 4NQ0A 3ZN3A 3EHMA 4A1GA 1UOHA 4GPKA 2RFAA 3KAEA 5EX0A 3UUXA 1O1TA 2CFZA 2DWZA 2ZGDA 2DVWA 1BI8B 3UT8A 2XGSA 2YNQA 4EECA 1Z5SC 4LCTA 3S7JA 3ULEG 4FADA 4GPMA 4BFRA 2ZIRA 2F8XK 1HE8A 4B0ZA 3FUJA 3C98A 2J8SD 2J07A 4GTMA 5CMWA 3JXJA 4TRQA 4KBQA 2WM9A 4ZFHA 1SW6A 3ZIMA 1O1RA 3JUIA 5T3RA 1JWFA 4BERA 3J5QB 4EBAG 4M7CA 3KSLA 2ILRA 2OOEA 3K9IA 4EZJA 1EPUA 1Z6TA 3PNLB 1Q2ZA 3G2TA 1TJFA 3PE4A 4R7LA 5LCWC 4BTBA 3QNKA 4LERA 1E90A 3L22A 4DLOA 4IYPA 1NI1A 2AXUA 2J49A 1JCSA 1KZOA 3I5PA 4L23A 5DIZA 3LS8A 2XPYA 2YHEA 5ENSD 3KD7A 2VJ8A 4Y6WA 3TJPA 4DX7D 5EDSA 5FQ8A 2RG8A 3UM2A 3Q4AB 2VGEA 1UJKA 2KCVA 3ASFA 4LNBA 4FHJA 4K5AB 2P9KG 3FTVA 1TNOA 3TL5A 3GZSA 5CRUA 4TXQA 2EIKE 4A3VA 3HRAA 3MCXA 1EF1C 1PY1A 5BW8C 2MRIA 3CQCB 2NC9A 3PEUB 4NURA 5HQ8A 1E96B 5G04C 2J4BA 2XEEA 4XIFA 4HBDA 5KJMA 4LRZA 4Q94A 4WWOA 3LKUA 2OEWA 4ILIA 5AQ9A 2J09A 3LJNA 4A55A 4DI4A 1BPOA 3FU3A 2VQ2A 4CYMD 3TWQA 3L6AA 3SQVA 5AQAA 2KZTB 3E33A 3ZYLA 2VTBA 2VSXE 1SVXA 4AV7A 5FQ7A 5AYWD 2XZTG 4CRWA 4BT9A 3ML9A 3TWSA 3ZYKA 4YNDA 1NA0A 4RG6A 5CERB 3DEOA 3ABLE 2LNIA 4U95D 3QOUA 3UI2A 2BF0X 1JCRA 1TEZA 3X2QE 4GZCA 4JA9A 1BLXB 4LG6A 5CRVA 2L9BA 2ETCA 3LDZA 1E7UA 3UM3A 1S63A 5EYLA 1JPLA 3FFLA 3ULQA 3CKBA 5KBAA 3MGBA 2VGXA 2HE0A 2XGMA 3EHNA 2VSNA 2ZISA 3D9IA 4N5CA 1N94A 3I3NA 3MYVA 3AJIA 3ESKA 2LSUA 4DJAA 1ZU2A 4GCNA 3D9MA 1JCQA 4HB5A 5HRYA 2PNNA 4KZCA 5LX8A 1K3ZD 5FTPA 2IOLA 3RRNB 4FHKA 1INZA 3QC1A 1HU3A 3LYAA 1ELKA 4O6FA 1KT0A 2XEVA 4KMOA 4QQIA 3ZEFA 3I4RB 4ABNA 3FWVA 3LCAA 1H19A 4N2QA 4APFA 3Q49B 5AENA 2AW6A 5CCMA 2Y4UA 2MYOA 5BNWA 3C5RA 3EHQA 4MBGA 4C0EA 4GA2A 1H2TC 3B7TA 4HRLA 2NXPA 3U66A 4G8KA 3SBTB 3PE3A 3HVEA 3MZLB 3IV0A 2IOSA 2X6FA 4DX5D 3OXLA 2Q7FA 1DVPA 2R05A 4FU3A 3MX3A 3BG0B 3CHOA 2LXLA 4X8QA 2VSOE 3BUAA 4I43A 3ISMC 2LXMA 2PQRA 1OWLA 4J8YA 4TXRA 2XENA 3FUNA 4I2ZA 4J8SA 1Y6IA 3DSXA 2YQ8A 4PS7A 1MX2A 1JWGA 2R02A 4U8HA 3CEQA 2IQCA 4B8CB 3L9TA 3Q7AA 3FUIA 4F1PA 4DI3A 1TJCA 4F3VA 3UKRG 4U8YD 1D8EA 4RG9A 3CVXA 1DCEA 2PM6A 3NAWA 4BETA 5FZSA 3LY9A 3HXEA 4G2VA 1OCCE 4K0RA 3SNXA 1IKND 3ENEA 2OCCE 2JEKA 3VTYA 5G05C 3UM1A 2LO6A 2QYUA 3BQOA 3SFZA 5M72A 3FUEA 1TNBA 4CDNA 1TNZA 2XPZA 3HXCA 4YDWA 4I6EA 1OCRE 3CVLA 3U9WA 3V31A 3ZFWA 3Q73A 3KSQA 3D9NA 2I9CA 3QK0A 3L16A 5B1BE 4UQXA 3FU0A 4LUNU 2E2EA 1QBQA 2DZOA 2HYZA 2MHKA 2DZNA 1E8YA 2L6BA 4JD2G 3ZPJA 3C3OA 4AY6A 4H7YA 2C0LA 3Q9NC 4N3CA 3ZU7B 4J0UA 4HOTA 2F8YA 4Q69A 4YVQC 2KC7A 2P9UG 5D2MC 4TUUA 2KM4A 2XZDG 2VYIA 5CEDB 5G55A 2KXPC 1LF8A 4V3IA 3AG1E 3ZXPA 1UG3A 2WXMA 3LXUX 2X6IA 3VLDA 4XEIG 2A4ZA 3GW4A 2GRMA 3WXXA 5ENPD 3CVVA 4ANVA 4J6IA 3HIZA 2KATA 5FWQA 4BX9A 4CCAA 4XZ4A 5A6CA 2BKKB 1LD8A 1N9AA 1N11A 3ZRHA 1AP7A 1TNYA 3ASHA 5KWDA 1OY3D 2H6GA 2L0IA 2WXHA 3D9PA 1NFIE 3EU5A 3DEPA 5G2NA 1OWMA 2WVIA 3DBSA 3V30A 4G8LA 4PS3A 4RSYA 4KVMA 4HS2A 4G25A 2L0TB 4AJWA 3RSEG 3L82A 5E75A 1A17A 5AJDA 1NL4A 3EU9A 1H6KA 4GA0A 3RO2A 4GYWA 1SZAA 4N2SA 4ACLA 4B93B 2P9IG 5CBOA 4G24A 4N3AA 1S70B 3APCA 3B95A 4APOA 1OWPA 3ZXSA 2WQ6A 4F6RD 2AXZA 4EHMA 3RIBA 4A3TA 5ENOD 3JXIA 3DXKG 2ETBA 2OVFA 3FUKA 5JJ6A 2QYJA 4YVOA 3DSTA 4JHJA 2WXRA 1AWCB 5JA4D 5EN5D 1LTXA 3LY7A 3FTWA 1H2VC 2FULA 4HI8A 1U3DA 3MA5A 4PS8A 3ZUVB 1Z3YA 4YDEA 3QWVA 4OVUA 4BSZB 3CSTA 4G23A 3NBNB 5JJ7A 1FVFA 1P5QA 2WB2A 3TAXA 2P58C 2QY7A 2QC9A 2I2OA 2R5SA 2V8SE 3F6QA 1B89A 2Y0BG 5JMND 5CMYA 1HFAA 4KYOB 1U3CA 3ZW3A 2FO7A 4NRHB 2E0IA 4WUYA 5JHAA 3BU8A 2P9LG 3UT7A 1ELRA 3IBEA 1JUQA 4AM9A 4U0UA 5KNHD 4HOSA 1KZPA 4JW1A 5ENTD 1S0PA 3ML8A 2P2CP 4GU5A 4FP7A 4GTTA 3LJ3A 5EKQD 3NQPA 4FJYA 3R9AB 2BEDA 4BX8A 4XKCA 4WNFA 3LY8A 3CVUA 2IU1A 3PZDA 1UN8A 3D3MA 4AEZC 3IEGA 4GTSA 2DBAA 3CR3A 5KJKA 4UI9C 4F1SA 3UTMA 4L2YA 3V2XA 3RRMB 1MZCA 4AXHA 2ONDA 1E7VA 3NB2A 4AIFA 2DIWA 3ZNGA 4ATGA 2X6HA 1TN6A 3CV0A 4CGVA 4GZ5A 5EYPF 3JCKC 5ARFA 4ACKA 2GRRB 3E34A 5D66A 3AS8A 2XGOA 4G1TA 4WAFA 1TN8A 4Q96A 4B8AA 3EUVA 5EIDA 3FTYA 4GTPA 3NZUA 3FUDA 3E4BA 1N4PA 3APFA 4JEUA 2I1KA 5KNGA 2IEJA 1G3NB 3CVNA 1FVHA 4OVVA 4WWNA 1V55E 2M63A 3NOGD 3JYSA 4UWKA 1HG2A 1OUVA 1X81A 1OWNA 2LSVA 3HXDA 4L9PA 3QDNA 3AAAC 1HS6A 4EBAA 5AAOA 1QZ2A 3G2WA 1FT2A 3N71A 2LUHA 4WNGA 1KPSB 2R2LA 1WY6A 5A23A 1N4SA 5T8IA 3RK6A 2CHWA 4FC8A 5CBNA 2FF4A 2V0PA 3ASOE 1YYHA 3LEWA 3CVPA 5FQ4A 2RKKA 5FQ6A 5ENQD 5FIOA 1N4RA 3T9KA 4LSZE 3QARA 3L54A 3PVLA 4JHKA 3PZ3A 3S7DA 3CHRA 4U0ZA 4BT8A 3JQ0A 5CCLA 3AG2E 3DSVA 4CT4A 4Y6CA 4GYYA 1SQMA 3T5VA 5AJLA 3EJNA 3L08A 3DSSA 3G2UA 2OV8A 3RO3A 4TXPA 3QB2A 4K5CA 4P29A 4RLYA 3P2BA 3Q47B 2VGXB 3ONKA 4N3BA 3ABME 3V79K 1H6PA 5BUZA 1HH8A 4JL0A 3TWVA 2X3MA 5T4YA 4QFVA 5B3SE 3V2OA 1BD8A 3DXMG 3UINC 2XRZA 4W9RA 5KJLA 4K5BA 2Y3AA 4G11A 4I9CA 5ENNA 2DYSE 3LPZA 2WQ7A 3TGOA 3OXGA 1N4QA 2B6CA 2V4HC 1IHGA 3UMVA 3Q7FA 3PUJA 5FZRA 3S2AA 5BT1A 4OAVB 3T8KA 3KEZA 1MYOA 4F7AA 1MX4A 2PZIA 4U8VD 3DSWA 2KZTA 3L13A 5LOZA 4EPZA 1HG5A 3PZ2A 2P9PG 2H6IA 3MV2B 3UIOC 4E6HA 3ONLA 1FPPA 2GW1A 5LP0A 4U63A 2CHZA 4F53A 4GAAA 3DPDA 3U64A 3CGHA 3FH5A 4I2WA 3FTXA 2QFCA 5BXOA 3FEYA 3OTNA 1FT1A 5CHEE 2KBXA 2WXJA 3OAWA 1IQUA 3ZKJA 2F37A 3AG4E 3ZHEA 2XHEA 3B13A 2Y1LE 2BKGA 2R17C 3CSFA 2V5FA 3CVWA 4B94A 1HX8A 3D9KA 4HOQA 5BV0A 3ZVVA 3EHRA 2YHCA 3ASDA 4FJZA 2AWIA 1BU9A 1U2VG 2J9QA 1QYMA 4YDOA 2J4DA 5BXUA 3NOCD 3ZYQA 5BV1A 2WPVA 4O60A 3FP3A 4DRXE 3W9GA 1E8XA 3DWLG 3I4GA 3RKVA 3HDXA 5ARGA 3NF1A 4YDYA 2A5EA 2GRQB
chains in the Genus database with same CATH topology
3HXEA 4GTSA 3PZ2A 1LD8A 1N9AA 1NI1A 2H6IA 4MBGA 4YDEA 2F0YA 1JCSA 3DPYA 1TNYA 1FPPA 3HXBA 1KZOA 1MZCA 2H6GA 1O5MA 1N4RA 1TNBA 1TNZA 3HXFA 3HXCA 3EU5A 1LD7A 1JCRA 3PZ3A 2H6HA 1TN6A 1TNUA 4LNGA 3PZ4A 1FT1A 3Q73A 3KSQA 3DSVA 4GTOA 3SFXA 3DSUA 4LNBA 3E34A 3E32A 1O1TA 1S63A 1TN8A 3Q78A 1QBQA 1N95A 3EUVA 1TNOA 3DSSA 1NL4A 4GTPA 3E37A 3E30A 1N4PA 2ZIRA 2ZISA 2IEJA 1N94A 1KZPA 4GTMA 1JCQA 3DRAA 3DSXA 1X81A 3C72A 4YDOA 1O1SA 1TN7A 4GTTA 1S64A 4EHMA 3HXDA 4L9PA 1O1RA 3Q7AA 1D8DA 2BEDA 1N4QA 1FT2A 4GTVA 3KSLA 1SA4A 3Q7FA 3DSTA 2R2LA 3Q75A 1D8EA 1N4SA 3PZ1A 2H6FA 3SFYA 3Q79A 3E33A 1DCEA 1SA5A 4GTQA 1LTXA 4GTRA 3DSWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3HXE A;  4GTS A;  3PZ2 A;  1LD8 A;  1N9A A;  1NI1 A;  2H6I A;  4MBG A;  4YDE A;  2F0Y A;  1JCS A;  3DPY A;  1TNY A;  1FPP A;  3HXB A;  1KZO A;  1MZC A;  2H6G A;  1O5M A;  1N4R A;  1TNB A;  1TNZ A;  3HXF A;  3HXC A;  3EU5 A;  1LD7 A;  1JCR A;  3PZ3 A;  2H6H A;  1TN6 A;  1TNU A;  4LNG A;  3PZ4 A;  1FT1 A;  3Q73 A;  3KSQ A;  3DSV A;  4GTO A;  3SFX A;  3DSU A;  4LNB A;  3E34 A;  3E32 A;  1O1T A;  1S63 A;  1TN8 A;  3Q78 A;  1QBQ A;  1N95 A;  3EUV A;  1TNO A;  3DSS A;  1NL4 A;  4GTP A;  3E37 A;  3E30 A;  1N4P A;  2ZIR A;  2ZIS A;  2IEJ A;  1N94 A;  1KZP A;  4GTM A;  1JCQ A;  3DRA A;  3DSX A;  1X81 A;  3C72 A;  4YDO A;  1O1S A;  1TN7 A;  4GTT A;  1S64 A;  4EHM A;  3HXD A;  4L9P A;  1O1R A;  3Q7A A;  1D8D A;  2BED A;  1N4Q A;  1FT2 A;  4GTV A;  3KSL A;  1SA4 A;  3Q7F A;  3DST A;  2R2L A;  3Q75 A;  1D8E A;  1N4S A;  3PZ1 A;  2H6F A;  3SFY A;  3Q79 A;  3E33 A;  1DCE A;  1SA5 A;  4GTQ A;  1LTX A;  4GTR A;  3DSW A; 
#chains in the Genus database with same CATH topology
 1YA0 A;  5KCM A;  5A7D B;  2A5U A;  4CGW A;  1TR4 A;  5FIN A;  4GZ6 A;  4K03 A;  4GMR A;  3UXG A;  3PRE A;  4DPR A;  3FUL A;  4Z68 A;  4CEM A;  2DYR E;  2UY1 B;  2B0O E;  3FUF A;  2IFU A;  5FJY A;  3FUM A;  4ILH B;  4JEH A;  3U4T A;  1DCQ A;  1HXI A;  4WND A;  1TNU A;  2I6H A;  2ETA A;  2VGY A;  3SD5 A;  4HRN A;  2EIJ E;  4N5Q A;  5LCW J;  3E32 A;  3SI5 A;  3Q78 A;  4AY5 A;  1KT1 A;  2DCP A;  1FCH A;  2HM8 A;  5B1A E;  3ASN E;  4JVS A;  2GRP B;  3IHV A;  1K1A A;  2WXI A;  4KT6 B;  2AJA A;  4DX2 A;  4ME2 A;  1OXJ A;  2CG2 A;  3C72 A;  4URK A;  1O1S A;  4JPS A;  1WDY A;  3LVQ E;  1MQS A;  3RRU A;  3VTX A;  4GYO A;  3SHF A;  3QKY A;  4KVO A;  2ZU6 B;  3D9J A;  2RFM A;  4MRU A;  3Q79 A;  1ELW A;  2JAB A;  2XQ0 A;  3APD A;  2GGF A;  3TXN A;  3FTS A;  2IJG X;  3CVY A;  2YIN A;  2XS1 A;  3G2S A;  3CVQ A;  1UN9 A;  4I1O B;  3PS6 A;  3R7R A;  3FUH A;  2WMN A;  1BI7 B;  3CK8 A;  3FHE A;  4J7W A;  3PDN A;  4UWH A;  1X5B A;  1E8Z A;  3HXF A;  1LD7 A;  4GA1 A;  4UI9 K;  3BEE A;  1PAQ A;  3IXE A;  3HYM B;  1RW2 A;  3EIQ C;  4TV3 A;  5H7P A;  4NAC A;  2BUG A;  3DSU A;  1ZB1 A;  1QQE A;  5J90 A;  2L6J A;  3KS2 A;  4XI0 A;  2RD0 A;  2WQH A;  5ITZ F;  2GRO B;  3E37 A;  3E30 A;  3AS5 A;  1HO8 A;  1WAO 1;  4JXT A;  3W9F A;  3NZS A;  4BY6 A;  3OXF A;  4MLP A;  5HKP A;  4ANW A;  1OCO E;  3SF4 A;  3FTU A;  3DRA A;  1UJJ A;  3CHP A;  1QNF A;  2HO1 A;  3GZ1 A;  5ANR A;  3CK7 A;  3R9M A;  3O48 A;  4ANU A;  3CLJ A;  3CQG B;  3G2V A;  1HZ4 A;  3VLE A;  4A1S A;  3TWW A;  1SA4 A;  3QJZ A;  3FH7 A;  4OAU C;  1H6O A;  2LAI A;  3Q9U C;  5AQB A;  2IY0 C;  4GCO A;  2H6F A;  3P1U A;  4MS6 A;  4CZ2 D;  1OCZ E;  3ASG A;  5KJN A;  5AAR A;  3B7S A;  3TWU A;  4FA6 A;  1K8K G;  3MJW A;  3SGH A;  3DPY A;  4AOF A;  4B89 A;  4HNA D;  2KCK A;  3BG1 B;  2FBN A;  1DC2 A;  4G26 A;  2XRY A;  4UQZ A;  2H6H A;  1N54 A;  4HFG A;  4LNG A;  2NYJ A;  4MKT A;  1N0R A;  4RQI A;  4U7E B;  2WXN A;  2FI7 A;  2C0M A;  4GTO A;  3SFX A;  2AXV A;  4C0M A;  2XCC A;  3URZ A;  4UWF A;  3U3W A;  5HI7 A;  4PUC A;  1XNF A;  2LAH A;  3ESL A;  3HG0 D;  3UQ3 A;  3TWR A;  2X6J A;  1WM5 A;  2UY1 A;  3RJV A;  4XE0 A;  4L2L A;  3PNT B;  1MJ0 A;  1A5E A;  4GZD A;  3J5P A;  4HXI A;  3TG4 A;  3ZYM A;  2GRN B;  1GW6 A;  2I1J A;  4UI9 J;  4I6J A;  5EX3 A;  2EIL E;  3FEX A;  4I6G A;  3UPV A;  4O1P A;  1TN7 A;  4XI9 A;  3S7F A;  4NIK A;  5IY5 E;  1NP7 A;  3FDH A;  5D0Q D;  3Q5M A;  4UWL A;  4HI9 A;  4GTV A;  3D9H A;  2CFU A;  1V54 E;  4A63 B;  3PZ1 A;  3EDT B;  1SZ9 A;  1HF8 A;  3HVE B;  5HS0 A;  2WXP A;  2WXQ A;  4EZL A;  1EDU A;  1MX6 A;  4IRU A;  1Y8M A;  4J8E A;  4FLB A;  2F0Y A;  5JJT A;  4I9E A;  2WXO A;  3FY4 A;  3PEV B;  4BEP A;  2V5Q C;  4M3O A;  3UX4 A;  3WG7 E;  5G05 J;  3KEA A;  1L5J A;  4CDR A;  3PH0 C;  5E76 A;  3PZ4 A;  2MOW A;  4EZK A;  2WMO A;  2ZGG A;  4DUI A;  4HOR A;  3FU6 A;  2HR2 A;  5CEA A;  3C3R A;  3UIP C;  4FUL A;  4U07 A;  3CHM A;  3QWW A;  2OVB A;  4CDM A;  3TWT A;  4UQY A;  3T8M A;  4JC8 A;  4IN3 B;  3ZHE B;  1IQR A;  3MEK A;  2WXK A;  2CHX A;  2WXF A;  3MKQ B;  1YMP A;  1IHB A;  1W3B A;  3SZ7 A;  3TXM A;  1NZN A;  3LVR E;  2XEH A;  4HOU A;  2R03 A;  4HRM B;  1S64 A;  4EQF A;  3B7U X;  1D8D A;  2EIM E;  1RZ4 A;  4UUC A;  5ANL A;  2ZXW E;  2EQX A;  3PRZ A;  5EIB E;  4LEU A;  3SFY A;  4UWG A;  1SA5 A;  4WNE A;  3UKU G;  2FEZ A;  2VSY A;  4ANX A;  4LNU D;  4GMJ A;  2V4L A;  2ION A;  5C1D A;  4XX5 A;  3S7B A;  3D9O A;  1N0Q A;  3CK9 A;  4HLE A;  4J8D A;  2OEV A;  2VTB B;  4PH4 B;  4WWP A;  3HHM A;  3EIJ A;  2NSZ A;  3SY2 A;  4I1A A;  2P9N G;  4U0S A;  2BTD A;  2QZA A;  1H2U A;  3MKR A;  3GZ2 A;  2C2L A;  5G04 J;  1MHQ A;  2J08 A;  5C2Y A;  3IHY A;  3IKO B;  3QAQ A;  2X38 A;  3CIA A;  2PM7 A;  5AN8 A;  3Q15 A;  5FT9 A;  1VDY A;  4L1B A;  1WG0 A;  3ABK E;  2AVP A;  3T5X A;  2XS8 A;  2P9S G;  2XPI A;  3QWP A;  4BWR A;  1NA3 A;  4XKB A;  4J8F A;  4KXK B;  4ILG A;  3MV3 B;  1H0A A;  4JZY A;  1K1B A;  3SO8 A;  4TUM A;  2CG3 A;  5JHB A;  3AS4 A;  1PC2 A;  4FLH A;  3Q75 A;  4OYS A;  1N52 A;  3MKQ A;  3B7B A;  4IUL A;  4GTR A;  3L17 A;  3TG5 A;  4L7T A;  4BSX A;  3CHS A;  3FU5 A;  4U04 A;  3JQ1 A;  1ZBP A;  3HXB A;  4GZ3 A;  3D9L A;  4CT0 A;  3UM0 A;  3TWX A;  4HQD A;  3SBS A;  3AG3 E;  2GRL A;  2WXG A;  4GB9 A;  5DBK A;  4GML A;  3RAU A;  4O1O A;  5D0O D;  4AP2 A;  2IF4 A;  4I1M A;  2UWJ G;  3RU0 A;  3AU4 A;  2FO1 E;  2WXL A;  3UT4 A;  5AIJ A;  3CHQ A;  5CEC B;  3R7Q A;  1N95 A;  3VLF A;  4JA7 A;  4ATZ D;  4D10 C;  4JB8 P;  4ZHB A;  1Z3X A;  1DNP A;  2IO3 C;  2XCB A;  4JHR A;  2KCL A;  4H7X A;  4BES A;  4HLL A;  4KZ0 A;  5LFA A;  3FH8 A;  4RVB A;  3GYZ A;  4E85 A;  1XGW A;  4AVX A;  4N39 A;  4DX6 D;  4U96 D;  3CKC A;  4BTA A;  2JLB A;  4PDX A;  1UW4 B;  5AQ7 A;  2X6K A;  3ULY A;  2Y4T A;  5ENR D;  3JUE A;  1KLX A;  4C9B B;  1TYQ G;  5BPP A;  3AU5 A;  4I17 A;  1YCS B;  1D9S A;  2PQN A;  4GTQ A;  5FZQ A;  5J08 A;  4DX1 A;  3PUK A;  1IXV A;  3B7R L;  3ZGQ A;  3FTZ A;  1OWO A;  2PL2 A;  4DK5 A;  1E8W A;  2EIN E;  2Y69 E;  3C3Q A;  1OT8 A;  3O4Z A;  1IYG A;  2R59 A;  5EIL A;  4C48 B;  4HVB A;  2IO2 C;  1EYH A;  1O5M A;  4DLQ A;  4NQ0 A;  3ZN3 A;  3EHM A;  4A1G A;  1UOH A;  4GPK A;  2RFA A;  3KAE A;  5EX0 A;  3UUX A;  1O1T A;  2CFZ A;  2DWZ A;  2ZGD A;  2DVW A;  1BI8 B;  3UT8 A;  2XGS A;  2YNQ A;  4EEC A;  1Z5S C;  4LCT A;  3S7J A;  3ULE G;  4FAD A;  4GPM A;  4BFR A;  2ZIR A;  2F8X K;  1HE8 A;  4B0Z A;  3FUJ A;  3C98 A;  2J8S D;  2J07 A;  4GTM A;  5CMW A;  3JXJ A;  4TRQ A;  4KBQ A;  2WM9 A;  4ZFH A;  1SW6 A;  3ZIM A;  1O1R A;  3JUI A;  5T3R A;  1JWF A;  4BER A;  3J5Q B;  4EBA G;  4M7C A;  3KSL A;  2ILR A;  2OOE A;  3K9I A;  4EZJ A;  1EPU A;  1Z6T A;  3PNL B;  1Q2Z A;  3G2T A;  1TJF A;  3PE4 A;  4R7L A;  5LCW C;  4BTB A;  3QNK A;  4LER A;  1E90 A;  3L22 A;  4DLO A;  4IYP A;  1NI1 A;  2AXU A;  2J49 A;  1JCS A;  1KZO A;  3I5P A;  4L23 A;  5DIZ A;  3LS8 A;  2XPY A;  2YHE A;  5ENS D;  3KD7 A;  2VJ8 A;  4Y6W A;  3TJP A;  4DX7 D;  5EDS A;  5FQ8 A;  2RG8 A;  3UM2 A;  3Q4A B;  2VGE A;  1UJK A;  2KCV A;  3ASF A;  4LNB A;  4FHJ A;  4K5A B;  2P9K G;  3FTV A;  1TNO A;  3TL5 A;  3GZS A;  5CRU A;  4TXQ A;  2EIK E;  4A3V A;  3HRA A;  3MCX A;  1EF1 C;  1PY1 A;  5BW8 C;  2MRI A;  3CQC B;  2NC9 A;  3PEU B;  4NUR A;  5HQ8 A;  1E96 B;  5G04 C;  2J4B A;  2XEE A;  4XIF A;  4HBD A;  5KJM A;  4LRZ A;  4Q94 A;  4WWO A;  3LKU A;  2OEW A;  4ILI A;  5AQ9 A;  2J09 A;  3LJN A;  4A55 A;  4DI4 A;  1BPO A;  3FU3 A;  2VQ2 A;  4CYM D;  3TWQ A;  3L6A A;  3SQV A;  5AQA A;  2KZT B;  3E33 A;  3ZYL A;  2VTB A;  2VSX E;  1SVX A;  4AV7 A;  5FQ7 A;  5AYW D;  2XZT G;  4CRW A;  4BT9 A;  3ML9 A;  3TWS A;  3ZYK A;  4YND A;  1NA0 A;  4RG6 A;  5CER B;  3DEO A;  3ABL E;  2LNI A;  4U95 D;  3QOU A;  3UI2 A;  2BF0 X;  1JCR A;  1TEZ A;  3X2Q E;  4GZC A;  4JA9 A;  1BLX B;  4LG6 A;  5CRV A;  2L9B A;  2ETC A;  3LDZ A;  1E7U A;  3UM3 A;  1S63 A;  5EYL A;  1JPL A;  3FFL A;  3ULQ A;  3CKB A;  5KBA A;  3MGB A;  2VGX A;  2HE0 A;  2XGM A;  3EHN A;  2VSN A;  2ZIS A;  3D9I A;  4N5C A;  1N94 A;  3I3N A;  3MYV A;  3AJI A;  3ESK A;  2LSU A;  4DJA A;  1ZU2 A;  4GCN A;  3D9M A;  1JCQ A;  4HB5 A;  5HRY A;  2PNN A;  4KZC A;  5LX8 A;  1K3Z D;  5FTP A;  2IOL A;  3RRN B;  4FHK A;  1INZ A;  3QC1 A;  1HU3 A;  3LYA A;  1ELK A;  4O6F A;  1KT0 A;  2XEV A;  4KMO A;  4QQI A;  3ZEF A;  3I4R B;  4ABN A;  3FWV A;  3LCA A;  1H19 A;  4N2Q A;  4APF A;  3Q49 B;  5AEN A;  2AW6 A;  5CCM A;  2Y4U A;  2MYO A;  5BNW A;  3C5R A;  3EHQ A;  4MBG A;  4C0E A;  4GA2 A;  1H2T C;  3B7T A;  4HRL A;  2NXP A;  3U66 A;  4G8K A;  3SBT B;  3PE3 A;  3HVE A;  3MZL B;  3IV0 A;  2IOS A;  2X6F A;  4DX5 D;  3OXL A;  2Q7F A;  1DVP A;  2R05 A;  4FU3 A;  3MX3 A;  3BG0 B;  3CHO A;  2LXL A;  4X8Q A;  2VSO E;  3BUA A;  4I43 A;  3ISM C;  2LXM A;  2PQR A;  1OWL A;  4J8Y A;  4TXR A;  2XEN A;  3FUN A;  4I2Z A;  4J8S A;  1Y6I A;  3DSX A;  2YQ8 A;  4PS7 A;  1MX2 A;  1JWG A;  2R02 A;  4U8H A;  3CEQ A;  2IQC A;  4B8C B;  3L9T A;  3Q7A A;  3FUI A;  4F1P A;  4DI3 A;  1TJC A;  4F3V A;  3UKR G;  4U8Y D;  1D8E A;  4RG9 A;  3CVX A;  1DCE A;  2PM6 A;  3NAW A;  4BET A;  5FZS A;  3LY9 A;  3HXE A;  4G2V A;  1OCC E;  4K0R A;  3SNX A;  1IKN D;  3ENE A;  2OCC E;  2JEK A;  3VTY A;  5G05 C;  3UM1 A;  2LO6 A;  2QYU A;  3BQO A;  3SFZ A;  5M72 A;  3FUE A;  1TNB A;  4CDN A;  1TNZ A;  2XPZ A;  3HXC A;  4YDW A;  4I6E A;  1OCR E;  3CVL A;  3U9W A;  3V31 A;  3ZFW A;  3Q73 A;  3KSQ A;  3D9N A;  2I9C A;  3QK0 A;  3L16 A;  5B1B E;  4UQX A;  3FU0 A;  4LUN U;  2E2E A;  1QBQ A;  2DZO A;  2HYZ A;  2MHK A;  2DZN A;  1E8Y A;  2L6B A;  4JD2 G;  3ZPJ A;  3C3O A;  4AY6 A;  4H7Y A;  2C0L A;  3Q9N C;  4N3C A;  3ZU7 B;  4J0U A;  4HOT A;  2F8Y A;  4Q69 A;  4YVQ C;  2KC7 A;  2P9U G;  5D2M C;  4TUU A;  2KM4 A;  2XZD G;  2VYI A;  5CED B;  5G55 A;  2KXP C;  1LF8 A;  4V3I A;  3AG1 E;  3ZXP A;  1UG3 A;  2WXM A;  3LXU X;  2X6I A;  3VLD A;  4XEI G;  2A4Z A;  3GW4 A;  2GRM A;  3WXX A;  5ENP D;  3CVV A;  4ANV A;  4J6I A;  3HIZ A;  2KAT A;  5FWQ A;  4BX9 A;  4CCA A;  4XZ4 A;  5A6C A;  2BKK B;  1LD8 A;  1N9A A;  1N11 A;  3ZRH A;  1AP7 A;  1TNY A;  3ASH A;  5KWD A;  1OY3 D;  2H6G A;  2L0I A;  2WXH A;  3D9P A;  1NFI E;  3EU5 A;  3DEP A;  5G2N A;  1OWM A;  2WVI A;  3DBS A;  3V30 A;  4G8L A;  4PS3 A;  4RSY A;  4KVM A;  4HS2 A;  4G25 A;  2L0T B;  4AJW A;  3RSE G;  3L82 A;  5E75 A;  1A17 A;  5AJD A;  1NL4 A;  3EU9 A;  1H6K A;  4GA0 A;  3RO2 A;  4GYW A;  1SZA A;  4N2S A;  4ACL A;  4B93 B;  2P9I G;  5CBO A;  4G24 A;  4N3A A;  1S70 B;  3APC A;  3B95 A;  4APO A;  1OWP A;  3ZXS A;  2WQ6 A;  4F6R D;  2AXZ A;  4EHM A;  3RIB A;  4A3T A;  5ENO D;  3JXI A;  3DXK G;  2ETB A;  2OVF A;  3FUK A;  5JJ6 A;  2QYJ A;  4YVO A;  3DST A;  4JHJ A;  2WXR A;  1AWC B;  5JA4 D;  5EN5 D;  1LTX A;  3LY7 A;  3FTW A;  1H2V C;  2FUL A;  4HI8 A;  1U3D A;  3MA5 A;  4PS8 A;  3ZUV B;  1Z3Y A;  4YDE A;  3QWV A;  4OVU A;  4BSZ B;  3CST A;  4G23 A;  3NBN B;  5JJ7 A;  1FVF A;  1P5Q A;  2WB2 A;  3TAX A;  2P58 C;  2QY7 A;  2QC9 A;  2I2O A;  2R5S A;  2V8S E;  3F6Q A;  1B89 A;  2Y0B G;  5JMN D;  5CMY A;  1HFA A;  4KYO B;  1U3C A;  3ZW3 A;  2FO7 A;  4NRH B;  2E0I A;  4WUY A;  5JHA A;  3BU8 A;  2P9L G;  3UT7 A;  1ELR A;  3IBE A;  1JUQ A;  4AM9 A;  4U0U A;  5KNH D;  4HOS A;  1KZP A;  4JW1 A;  5ENT D;  1S0P A;  3ML8 A;  2P2C P;  4GU5 A;  4FP7 A;  4GTT A;  3LJ3 A;  5EKQ D;  3NQP A;  4FJY A;  3R9A B;  2BED A;  4BX8 A;  4XKC A;  4WNF A;  3LY8 A;  3CVU A;  2IU1 A;  3PZD A;  1UN8 A;  3D3M A;  4AEZ C;  3IEG A;  4GTS A;  2DBA A;  3CR3 A;  5KJK A;  4UI9 C;  4F1S A;  3UTM A;  4L2Y A;  3V2X A;  3RRM B;  1MZC A;  4AXH A;  2OND A;  1E7V A;  3NB2 A;  4AIF A;  2DIW A;  3ZNG A;  4ATG A;  2X6H A;  1TN6 A;  3CV0 A;  4CGV A;  4GZ5 A;  5EYP F;  3JCK C;  5ARF A;  4ACK A;  2GRR B;  3E34 A;  5D66 A;  3AS8 A;  2XGO A;  4G1T A;  4WAF A;  1TN8 A;  4Q96 A;  4B8A A;  3EUV A;  5EID A;  3FTY A;  4GTP A;  3NZU A;  3FUD A;  3E4B A;  1N4P A;  3APF A;  4JEU A;  2I1K A;  5KNG A;  2IEJ A;  1G3N B;  3CVN A;  1FVH A;  4OVV A;  4WWN A;  1V55 E;  2M63 A;  3NOG D;  3JYS A;  4UWK A;  1HG2 A;  1OUV A;  1X81 A;  1OWN A;  2LSV A;  3HXD A;  4L9P A;  3QDN A;  3AAA C;  1HS6 A;  4EBA A;  5AAO A;  1QZ2 A;  3G2W A;  1FT2 A;  3N71 A;  2LUH A;  4WNG A;  1KPS B;  2R2L A;  1WY6 A;  5A23 A;  1N4S A;  5T8I A;  3RK6 A;  2CHW A;  4FC8 A;  5CBN A;  2FF4 A;  2V0P A;  3ASO E;  1YYH A;  3LEW A;  3CVP A;  5FQ4 A;  2RKK A;  5FQ6 A;  5ENQ D;  5FIO A;  1N4R A;  3T9K A;  4LSZ E;  3QAR A;  3L54 A;  3PVL A;  4JHK A;  3PZ3 A;  3S7D A;  3CHR A;  4U0Z A;  4BT8 A;  3JQ0 A;  5CCL A;  3AG2 E;  3DSV A;  4CT4 A;  4Y6C A;  4GYY A;  1SQM A;  3T5V A;  5AJL A;  3EJN A;  3L08 A;  3DSS A;  3G2U A;  2OV8 A;  3RO3 A;  4TXP A;  3QB2 A;  4K5C A;  4P29 A;  4RLY A;  3P2B A;  3Q47 B;  2VGX B;  3ONK A;  4N3B A;  3ABM E;  3V79 K;  1H6P A;  5BUZ A;  1HH8 A;  4JL0 A;  3TWV A;  2X3M A;  5T4Y A;  4QFV A;  5B3S E;  3V2O A;  1BD8 A;  3DXM G;  3UIN C;  2XRZ A;  4W9R A;  5KJL A;  4K5B A;  2Y3A A;  4G11 A;  4I9C A;  5ENN A;  2DYS E;  3LPZ A;  2WQ7 A;  3TGO A;  3OXG A;  1N4Q A;  2B6C A;  2V4H C;  1IHG A;  3UMV A;  3Q7F A;  3PUJ A;  5FZR A;  3S2A A;  5BT1 A;  4OAV B;  3T8K A;  3KEZ A;  1MYO A;  4F7A A;  1MX4 A;  2PZI A;  4U8V D;  3DSW A;  2KZT A;  3L13 A;  5LOZ A;  4EPZ A;  1HG5 A;  3PZ2 A;  2P9P G;  2H6I A;  3MV2 B;  3UIO C;  4E6H A;  3ONL A;  1FPP A;  2GW1 A;  5LP0 A;  4U63 A;  2CHZ A;  4F53 A;  4GAA A;  3DPD A;  3U64 A;  3CGH A;  3FH5 A;  4I2W A;  3FTX A;  2QFC A;  5BXO A;  3FEY A;  3OTN A;  1FT1 A;  5CHE E;  2KBX A;  2WXJ A;  3OAW A;  1IQU A;  3ZKJ A;  2F37 A;  3AG4 E;  3ZHE A;  2XHE A;  3B13 A;  2Y1L E;  2BKG A;  2R17 C;  3CSF A;  2V5F A;  3CVW A;  4B94 A;  1HX8 A;  3D9K A;  4HOQ A;  5BV0 A;  3ZVV A;  3EHR A;  2YHC A;  3ASD A;  4FJZ A;  2AWI A;  1BU9 A;  1U2V G;  2J9Q A;  1QYM A;  4YDO A;  2J4D A;  5BXU A;  3NOC D;  3ZYQ A;  5BV1 A;  2WPV A;  4O60 A;  3FP3 A;  4DRX E;  3W9G A;  1E8X A;  3DWL G;  3I4G A;  3RKV A;  3HDX A;  5ARG A;  3NF1 A;  4YDY A;  2A5E A;  2GRQ B; 
#chains in the Genus database with same CATH homology
 3HXE A;  4GTS A;  3PZ2 A;  1LD8 A;  1N9A A;  1NI1 A;  2H6I A;  4MBG A;  4YDE A;  2F0Y A;  1JCS A;  3DPY A;  1TNY A;  1FPP A;  3HXB A;  1KZO A;  1MZC A;  2H6G A;  1O5M A;  1N4R A;  1TNB A;  1TNZ A;  3HXF A;  3HXC A;  3EU5 A;  1LD7 A;  1JCR A;  3PZ3 A;  2H6H A;  1TN6 A;  1TNU A;  4LNG A;  3PZ4 A;  1FT1 A;  3Q73 A;  3KSQ A;  3DSV A;  4GTO A;  3SFX A;  3DSU A;  4LNB A;  3E34 A;  3E32 A;  1O1T A;  1S63 A;  1TN8 A;  3Q78 A;  1QBQ A;  1N95 A;  3EUV A;  1TNO A;  3DSS A;  1NL4 A;  4GTP A;  3E37 A;  3E30 A;  1N4P A;  2ZIR A;  2ZIS A;  2IEJ A;  1N94 A;  1KZP A;  4GTM A;  1JCQ A;  3DRA A;  3DSX A;  1X81 A;  3C72 A;  4YDO A;  1O1S A;  1TN7 A;  4GTT A;  1S64 A;  4EHM A;  3HXD A;  4L9P A;  1O1R A;  3Q7A A;  1D8D A;  2BED A;  1N4Q A;  1FT2 A;  4GTV A;  3KSL A;  1SA4 A;  3Q7F A;  3DST A;  2R2L A;  3Q75 A;  1D8E A;  1N4S A;  3PZ1 A;  2H6F A;  3SFY A;  3Q79 A;  3E33 A;  1DCE A;  1SA5 A;  4GTQ A;  1LTX A;  4GTR A;  3DSW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...