2H6FA

Protein farnesyltransferase complexed with a farnesylated ddptasacvls peptide product at 1.5a resolution
Total Genus 134
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
134
sequence length
315
structure length
315
Chain Sequence
FVSLDSPSYVLYRDRAEWADIDPVPQNDGPNPVVQIIYSDKFRDVYDYFRAVLQRDERSERAFKLTRDAIELNAANYTVWHFRRVLLKSLQKDLHEEMNYITAIIEEQPKNYQVWHHRRVLVEWLRDPSQELEFIADILNQDAKNYHAWQHRQWVIQEFKLWDNELQYVDQLLKEDVRNNSVWNQRYFVISNTTGYNDRAVLEREVQYTLEMIKLVPHNESAWNYLKGILQDRGLSKYPNLLNQLLDLQPSHSSPYLIAFLVDIYEDMLENQCDNKEDILNKALELCEILAKEKDTIRKEYWRYIGRSLQSKHST
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protein farnesyltransferase/geranylgeranyltransferase type I
publication title Conversion of protein farnesyltransferase to a geranylgeranyltransferase.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 134
structure length 315
sequence length 315
ec nomenclature ec 2.5.1.58: Protein farnesyltransferase.
pdb deposition date 2006-05-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01239 PPTA Protein prenyltransferase alpha subunit repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.120 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Protein prenylyltransferase 2h6fA00
3C72A 2R2LA 3E30A 4GTQA 3SFYA 1JCRA 1FT2A 1X81A 3HXDA 3PZ2A 1QBQA 4L9PA 3Q7AA 1TN8A 3PZ3A 1TN7A 3Q78A 3PZ4A 4GTMA 3KSLA 1N9AA 3HXCA 3HXFA 3E34A 1S64A 1KZOA 3DSWA 2F0YA 1FPPA 1N95A 1JCSA 2BEDA 4EHMA 2H6FA 3HXEA 3Q73A 1N4RA 1TNYA 3Q7FA 3DSUA 1TNZA 1KZPA 3E33A 1D8EA 4LNGA 1NL4A 4MBGA 3E32A 1O1RA 4GTPA 1JCQA 3DRAA 2ZISA 1MZCA 1LD8A 3Q79A 4LNBA 2ZIRA 1N4SA 3E37A 1LTXA 1SA5A 2H6HA 1TNBA 1D8DA 1FT1A 3DSTA 3EU5A 2H6IA 1N4QA 3DSXA 4GTSA 4GTOA 2H6GA 4YDEA 3PZ1A 3DSVA 1DCEA 1TNOA 1O1TA 3SFXA 3KSQA 4GTRA 2IEJA 1O1SA 3HXBA 1TNUA 1TN6A 1NI1A 3DSSA 1N4PA 1S63A 3Q75A 4GTVA 1O5MA 1N94A 4YDOA 3DPYA 4GTTA 3EUVA 1LD7A 1SA4A
chains in the Genus database with same CATH superfamily
4ILHB 3LDZA 3DPDA 3UIOC 5EN5D 5DIZA 3PZ2A 4L9PA 2CG2A 2WXQA 4H7YA 2JLBA 3L08A 2Q7FA 3CSTA 3HG0D 3UKUG 1N9AA 1S64A 4UI9C 2GROB 2P9IG 4KBQA 1N4RA 4J8DA 3NOCD 3SGHA 4CT4A 3TWUA 4U7EB 4G23A 1BI7B 2J49A 3IHYA 4L2LA 2IQCA 2EILE 2PM7A 2J9QA 3LXUX 4EPZA 3QKYA 5D66A 1OCOE 2WXJA 4HNAD 4GPMA 2P9SG 1H2VC 4F1SA 2OV8A 4U0SA 1HG2A 3CIAA 5KNGA 4AY5A 1K8KG 1NA3A 3ML9A 5ARFA 2IO3C 1V55E 2GRPB 5AIJA 2H6GA 3FH7A 2CFUA 2IY0C 5KNHD 2YQ8A 4ACKA 4LCTA 3KSQA 4PDXA 5ENOD 1S70B 4F1PA 4HOQA 3DSSA 3RIBA 2X6JA 3Q4AB 4Y6CA 3Q75A 2WXGA 1O5MA 1H6KA 2GRRB 2BF0X 4HBDA 3DXMG 1MJ0A 2XRYA 4A63B 3Q49B 4HXIA 5A23A 3ABLE 4I1MA 3AS5A 4E6HA 1ZB1A 3EIQC 3UX4A 2Y3AA 4TXRA 4LEUA 3RO2A 2JEKA 5HS0A 1IYGA 1TN7A 5JJ6A 3TL5A 2KZTA 3PDNA 1SQMA 3DSWA 2LXMA 2MOWA 3I5PA 3ZGQA 2DVWA 4WUYA 4KZ0A 1E8XA 2WXOA 3BQOA 3L16A 4GYOA 2XRZA 5CERB 1UW4B 2FEZA 4RG6A 3UM3A 3HDXA 5CMYA 2XGOA 3CVXA 3WXXA 3ZU7B 2DYRE 3PUKA 1ELKA 1HZ4A 1O1RA 3ZXPA 3RJVA 4APOA 2BKGA 5ANLA 3Q79A 3PNLB 4IYPA 3I4RB 3RU0A 4OYSA 5AJLA 4J8YA 3RAUA 3C98A 1YYHA 3IV0A 4DRXE 1OXJA 4UQXA 1JWGA 2XEVA 1TNOA 5G2NA 3ZYKA 4CYMD 3CQGB 2HM8A 2Y0BG 1TNUA 3CHRA 3R9AB 5JHAA 5E76A 3ZYMA 3L9TA 4BSXA 4ANWA 5EDSA 3DEOA 3KD7A 1PC2A 3ZYQA 4B0ZA 4IRUA 3B7UX 4BX9A 5BPPA 1E8ZA 5LCWC 5A7DB 1DCQA 2OVBA 3LEWA 3FU5A 2ZXWE 2WXPA 1EF1C 2E0IA 3D9NA 3B13A 3JYSA 5EX3A 1OUVA 5HRYA 3C3QA 3MGBA 3FUNA 4TXPA 3LY8A 5FQ6A 1X5BA 3X2QE 2BEDA 4CZ2D 2H6FA 5JMND 2FULA 1H6OA 3AG4E 3EIJA 2VTBA 2A5UA 1WM5A 4G8LA 1IHGA 4TUMA 4N39A 5EX0A 1K3ZD 3CVLA 3HVEA 4JVSA 4GTPA 1E8WA 5ENNA 3CEQA 4GZ3A 4DLOA 3C3RA 2XPZA 3P1UA 4U8HA 1KT0A 5ARGA 4GA1A 3FUIA 3ABME 5FINA 2XGSA 1N0RA 1TYQG 3SBTB 1H2UA 1TJCA 2OVFA 4WNEA 1NP7A 3AAAC 5T8IA 4YDOA 2IONA 4CEMA 3GZSA 1QZ2A 4HORA 5KJMA 4J8SA 3TG4A 1V54E 2UWJG 2VQ2A 1Y8MA 3B7TA 4A3VA 2IFUA 3ESKA 1NFIE 4FADA 3PZ4A 5BUZA 1ELRA 2ZU6B 3FUJA 4U0ZA 3HXCA 1TR4A 1P5QA 4AY6A 2NXPA 3JUIA 3QC1A 3Q73A 2J08A 2VSXE 1TNZA 3ZKJA 4F53A 4XIFA 2XEHA 4F6RD 4DK5A 3MX3A 4GB9A 3SD5A 1A5EA 3FFLA 3HRAA 4U63A 2FO1E 2YHCA 3NOGD 2E2EA 2GRQB 4WNDA 5ENTD 1SVXA 3PZ1A 4G24A 3PE4A 3CHPA 2QY7A 1IXVA 4K5CA 3MEKA 2YHEA 2X6IA 5T4YA 4ANUA 4C48B 2LNIA 4I6GA 5FIOA 2YNQA 3SZ7A 2LSVA 1W3BA 4BTBA 1Z6TA 4WWPA 3SF4A 2XENA 4YVQC 2R2LA 2VSYA 3KS2A 2WXIA 4GA2A 1OWOA 4QFVA 4AP2A 1MX6A 4G8KA 5CEAA 3MKQA 4GMLA 1EYHA 4BETA 5BXUA 3HHMA 2J4DA 3JQ0A 2RD0A 2V4LA 3S7JA 5ENSD 5KWDA 3G2UA 4U0UA 2WMOA 3HIZA 4U8VD 1OCRE 1HF8A 3AG1E 2L0TB 4XKBA 3URZA 1NL4A 3QDNA 4Q69A 3Q5MA 2C0MA 1IHBA 2X6KA 4WWNA 1HG5A 1A17A 2HO1A 2OEVA 3QNKA 4LNBA 4DX5D 3D9OA 4DI3A 1TNBA 3PS6A 3EU5A 2H6IA 3UM2A 2WXRA 3VLDA 4L23A 4GCOA 3NBNB 1H19A 1O1TA 4QQIA 3J5PA 5AYWD 4ABNA 3ASHA 1DC2A 4LUNU 4G2VA 3U4TA 3IXEA 4B8AA 1WDYA 4N3AA 3QOUA 1ELWA 2IF4A 4YVOA 2P9PG 3CR3A 3DBSA 3PEVB 1KT1A 4AOFA 1JCRA 1FT2A 1VDYA 3MA5A 3EHMA 1QBQA 3V2OA 3ZNGA 3S7DA 1NZNA 5J90A 4PH4B 4HRNA 4ANXA 2F8YA 2P9LG 2VSOE 4RSYA 1YCSB 4HRLA 4DX7D 1N95A 3MV3B 4FHKA 3RO3A 2PM6A 1TNYA 2YINA 4ZFHA 3FUFA 3Q7FA 5CBOA 4KT6B 2P9UG 3V31A 3ZN3A 3RKVA 4CRWA 2ETAA 2VSNA 2XHEA 4PS3A 4GCNA 2MYOA 2XS8A 2F37A 4OVUA 4KMOA 3D9PA 1LD8A 3UXGA 3GZ2A 1UG3A 2WXLA 5C2YA 3VLEA 3DXKG 2WQ6A 3TWRA 3FTWA 4G11A 2EIKE 4LERA 3KEAA 1BD8A 4JC8A 4CGWA 5G55A 4X8QA 4I2ZA 4HLLA 2Y4TA 5CHEE 2GRMA 3SNXA 2V0PA 3SFXA 3NQPA 3EJNA 3UKRG 5LX8A 1EDUA 3CK8A 4EBAG 1S63A 3CHSA 4U95D 2WQ7A 5E75A 3G2SA 2R05A 3LS8A 3JUEA 3UT4A 1OCZE 3S2AA 5FWQA 3ZFWA 1Q2ZA 3CKCA 1X81A 5H7PA 3SY2A 1BPOA 3BU8A 4O1PA 4J0UA 4M7CA 4LRZA 4FJYA 1G3NB 3MV2B 3QWVA 4BT8A 2KBXA 2WB2A 4YDWA 3FULA 3B95A 2FI7A 3ASFA 4G1TA 2I1KA 2LSUA 4NURA 4JHKA 2ETCA 3CLJA 2RG8A 2R03A 3DSUA 3ASDA 4MBGA 4BY6A 4U8YD 2DIWA 3GW4A 2AXUA 2Y69E 3ABKE 4DPRA 3I3NA 2B0OE 4JHRA 3NAWA 3TWSA 2I6HA 4J7WA 1ZBPA 3L54A 4UWLA 3OAWA 5D0OD 3UIPC 2UY1B 3W9GA 3T8MA 5CRUA 2WQHA 1RW2A 2IEJA 1O1SA 4JL0A 5FJYA 4DLQA 1UJKA 5FT9A 3QWPA 2B6CA 4HI8A 3U66A 1H0AA 2V5QC 2Y4UA 4HS2A 2MRIA 1SA4A 5KJLA 4ATZD 3ONKA 2P9NG 4NRHB 3SFYA 3B7SA 4XZ4A 4EQFA 2PQNA 3PZ3A 5ENRD 3D9HA 3AU4A 3RRMB 4UWHA 2KATA 2KCLA 5C1DA 3SFZA 2GW1A 2HE0A 5AENA 4ILIA 1UOHA 4I1OB 3V30A 1SZ9A 3PE3A 1JCSA 3HXEA 3PZDA 3FUEA 3G2WA 4BTAA 2PZIA 3OXLA 4HQDA 1D8EA 4XX5A 4LNGA 1BLXB 4KVMA 4C9BB 4OAUC 4TXQA 2V5FA 4FA6A 3Q15A 1JPLA 3JCKC 3E37A 1QYMA 2A4ZA 3CQCB 4LNUD 2RFMA 3QB2A 3LVQE 3K9IA 4OVVA 2VGXB 4GTOA 3FHEA 4YDEA 3ASGA 2V8SE 2WXKA 3BEEA 2MHKA 3FUHA 4MS6A 4RVBA 3D9IA 4GTVA 4N3CA 3DPYA 3RRNB 3SHFA 1LD7A 3PRZA 2CG3A 3E30A 3LY9A 3OXGA 1EPUA 1N11A 3AG2E 2IJGX 5B3SE 4CCAA 5IY5E 4BEPA 5CCLA 1N54A 3AS8A 2M63A 4BSZB 3CKBA 4ILGA 4ACLA 2F0YA 3ZHEB 5JJTA 1WAO1 5G04J 3ZRHA 1SW6A 4EZKA 3LCAA 5G05J 4TV3A 2LXLA 1IQRA 4JEHA 1FCHA 3LJ3A 1N52A 2KM4A 5CEDB 4GYWA 3I4GA 3DRAA 2I1JA 2XQ0A 2EINE 4J8EA 1Y6IA 4A3TA 4C0MA 2VGYA 3CVVA 2J4BA 3LVRE 2DZOA 4DX1A 3APCA 4A55A 4L1BA 3ASOE 1FT1A 4AV7A 2P58C 5HI7A 1OWMA 2VGXA 4GTSA 5AJDA 1HH8A 3LPZA 3CVQA 4I9CA 5EILA 1UJJA 4GU5A 5EIBE 2NYJA 2KC7A 1TN6A 1LF8A 2EIJE 1N4PA 3CVUA 4UQZA 5B1BE 3ZPJA 3U64A 3UM0A 2CHXA 4JZYA 2OCCE 5AARA 2F8XK 3FTVA 2XPIA 4IULA 3CVNA 3JXJA 3SI5A 1SZAA 3N71A 4RQIA 3QWWA 5T3RA 4J8FA 2WXHA 3IKOB 1WG0A 4CT0A 4WNGA 4M3OA 4I6JA 3ZYLA 4MRUA 3FWVA 4ZHBA 3ZHEA 4R7LA 4K0RA 4DJAA 3FEXA 4WAFA 4EHMA 4TUUA 4HLEA 3EHNA 3WG7E 2XPYA 4WNFA 2RKKA 1KLXA 5BNWA 3APFA 3D3MA 1RZ4A 3E32A 1TEZA 1E96B 4W9RA 3OTNA 2WMNA 4I17A 4B8CB 3PH0C 3GZ1A 3RK6A 2XZDG 3FTXA 4HVBA 5KJNA 4XKCA 1SA5A 3VTYA 5KJKA 4Q94A 1E7UA 1S0PA 2DBAA 3DSVA 5M72A 5D0QD 1DCEA 2R5SA 2AW6A 5BT1A 3L13A 2L6JA 4CGVA 3TWVA 3TWTA 1N0QA 3FEYA 1HXIA 4JHJA 1TJFA 4FU3A 4UI9J 4HOTA 2C2LA 3TWXA 2PNNA 3C72A 3APDA 3UINC 3V2XA 3HYMB 5EKQD 1PY1A 4B89A 1OT8A 3L82A 5CCMA 4I6EA 5LP0A 4BESA 1Z5SC 3R9MA 3FY4A 2AWIA 4GZCA 1U2VG 1FPPA 1HU3A 4GZDA 4DI4A 3L22A 1UN9A 1U3DA 3JXIA 3FUKA 3G2VA 4F3VA 1QQEA 2XGMA 4JPSA 1JCQA 4LG6A 4N2QA 2RFAA 4FP7A 3LJNA 4EECA 1N4SA 3CV0A 5ANRA 4JXTA 5FZSA 3CGHA 1PAQA 4JB8P 5JHBA 1IQUA 2CHWA 1AWCB 4FJZA 4U07A 1MQSA 2IO2C 4FC8A 4HOUA 2BKKB 3BG1B 4KVOA 3L6AA 1DVPA 3HXBA 4I1AA 4TRQA 3CHMA 3UMVA 4XI0A 1N94A 5ENQD 2KZTB 3UI2A 4XI9A 4HI9A 2DCPA 3ZVVA 4EBAA 1BI8B 3RRUA 4DX2A 2X3MA 4RLYA 3FTZA 4APFA 5JJ7A 2WXMA 4GTMA 3FU3A 5AAOA 2R59A 3KAEA 3PNTB 3UUXA 5FQ8A 1K1AA 1YA0A 2C0LA 4BWRA 4BX8A 4H7XA 4HFGA 3E33A 1ZU2A 2XCBA 2EQXA 1MX4A 1OWNA 4ATGA 3VLFA 2R17C 4GMRA 4BERA 1MX2A 5JA4D 3MKRA 4MKTA 1LTXA 5LFAA 4B94A 3V79K 3FU0A 4AIFA 2LUHA 3FDHA 4JW1A 5EYLA 1N4QA 1INZA 5B1AE 3G2TA 3AG3E 3SQVA 2PL2A 5LCWJ 2J09A 2XCCA 5AQAA 3LKUA 3OXFA 2VGEA 2V4HC 4UI9K 4EZJA 4OAVB 4RG9A 1NI1A 3UT8A 2GRNB 2P9KG 4PS8A 3T8KA 3TJPA 2AXVA 4GTTA 3EUVA 1L5JA 2X6FA 4GAAA 2Y1LE 4GPKA 1UN8A 2NC9A 4N2SA 4ANVA 2OEWA 4NQ0A 3B7RL 3ULQA 4URKA 2ZGDA 3D9LA 3C3OA 2VTBB 3AU5A 3T9KA 3L17A 2ZGGA 3HVEB 4I2WA 2EIME 2KXPC 4KYOB 4A1SA 4GYYA 1D9SA 1GW6A 3UT7A 2PQRA 3DWLG 5FQ7A 3FTUA 3QAQA 4GZ6A 2ONDA 4GMJA 1BU9A 3S7BA 2CHZA 4FHJA 2L6BA 2DYSE 3PUJA 3DEPA 3RSEG 3TXNA 3T5XA 3EHRA 2QYJA 4K5BA 3EU9A 3CHQA 4NIKA 2H6HA 2WVIA 5AN8A 1K1BA 1HFAA 4AEZC 5CBNA 4KZCA 4GTRA 3J5QB 3CHOA 4O1OA 3ZW3A 3MJWA 5BV1A 1H6PA 4B93B 2DWZA 3IHVA 3S7FA 1AP7A 3AJIA 2ILRA 2XEEA 3PVLA 2LO6A 3B7BA 2UY1A 4F7AA 5DBKA 2AJAA 4EZLA 4KXKB 3QJZA 4XEIG 3EHQA 3CK7A 3HXDA 1FVHA 3EDTB 3JQ1A 1OCCE 3ESLA 3Q9UC 3FUDA 4ME2A 2P2CP 3HXFA 2VJ8A 2AVPA 2DZNA 2J8SD 4JD2G 3IBEA 2IU1A 2IOSA 3UTMA 2I9CA 4HRMB 2KCVA 3U9WA 3FU6A 1MZCA 3UQ3A 2ZIRA 4C0EA 3FTYA 4UWGA 5BV0A 4CDMA 4GZ5A 2HR2A 3ZEFA 3MCXA 2GRLA 3O48A 4GA0A 2NSZA 4Q96A 3DSXA 3CVWA 4PUCA 1JUQA 5KCMA 3UM1A 4BT9A 2WXNA 3MZLB 4CDNA 4DX6D 5AQ9A 3LY7A 4UQYA 3NZSA 4PS7A 4I9EA 2BUGA 4G25A 4G26A 1Z3YA 3MKQB 2LAIA 1HE8A 3U3WA 4YNDA 4DUIA 3SBSA 5KBAA 4K5AB 4V3IA 3ULYA 3R7QA 1E90A 3IEGA 3SO8A 3QK0A 3FTSA 3Q7AA 1TN8A 2QZAA 3ML8A 3ONLA 3ZXSA 2JABA 1XNFA 5CECB 3F6QA 3Q9NC 1E8YA 4LSZE 3Q78A 5EIDA 3NF1A 4NACA 5HQ8A 3E34A 4J6IA 2L9BA 1KZOA 1Z3XA 1DNPA 4N5QA 5EYPF 3FUMA 1WY6A 5FTPA 2GGFA 4HB5A 5ENPD 3AS4A 3FH5A 5CMWA 3GYZA 1OY3D 4MLPA 3CVPA 1QNFA 2CFZA 3TGOA 2FBNA 2KCKA 1MYOA 2ZISA 4BFRA 4JA7A 2BTDA 3PEUB 4P29A 1HX8A 4FLHA 3FH8A 5G04C 2OOEA 3ISMC 5G05C 4FLBA 2XS1A 1B89A 2QC9A 3KEZA 2VYIA 3NZUA 3TWWA 4CDRA 4E85A 3ENEA 3ASNE 3BG0B 1NA0A 3ZIMA 5D2MC 1HS6A 1OWLA 2J07A 2IOLA 1XGWA 2X6HA 5FQ4A 5J08A 1H2TC 2WPVA 2ETBA 3TXMA 3CK9A 3P2BA 2FO7A 4GTQA 2QYUA 2XZTG 5FZRA 1MHQA 3E4BA 1OWPA 3O4ZA 2FF4A 3KSLA 4N3BA 3R7RA 3TWQA 4UWKA 5ITZF 2A5EA 4HOSA 2HYZA 4AVXA 4L2YA 3CSFA 4U04A 1HO8A 4WWOA 4YDYA 2QFCA 5BW8C 1KZPA 1YMPA 3ZUVB 1U3CA 5AQBA 5BXOA 5CRVA 4L7TA 3NB2A 1E7VA 4FULA 5AQ7A 3D9KA 5HKPA 3C5RA 3TAXA 2X38A 4UWFA 3T5VA 2R02A 5LOZA 3BUAA 3ULEG 4AJWA 4U96D 3CVYA 3TG5A 1KPSB 4JEUA 4UUCA 2WXFA 1D8DA 3DSTA 4O60A 3Q47B 4N5CA 4AM9A 3QARA 2AXZA 1FVFA 4AXHA 1JWFA 4A1GA 5FZQA 1IKND 3FP3A 5A6CA 3W9FA 4JA9A 3UPVA 3VTXA 2L0IA 3MYVA 4IN3B 2WM9A 4Y6WA 4D10C 3D9MA 4Z68A 2LAHA 2I2OA 4XE0A 4O6FA 4K03A 3D9JA 3LYAA 4I43A 3PREA
chains in the Genus database with same CATH topology
3C72A 2R2LA 3E30A 4GTQA 3SFYA 1JCRA 1FT2A 1X81A 3HXDA 3PZ2A 1QBQA 4L9PA 3Q7AA 1TN8A 3PZ3A 1TN7A 3Q78A 3PZ4A 4GTMA 3KSLA 1N9AA 3HXCA 3HXFA 3E34A 1S64A 1KZOA 3DSWA 2F0YA 1FPPA 1N95A 1JCSA 2BEDA 4EHMA 2H6FA 3HXEA 3Q73A 1N4RA 1TNYA 3Q7FA 3DSUA 1TNZA 1KZPA 3E33A 1D8EA 4LNGA 1NL4A 4MBGA 3E32A 1O1RA 4GTPA 1JCQA 3DRAA 2ZISA 1MZCA 1LD8A 3Q79A 4LNBA 2ZIRA 1N4SA 3E37A 1LTXA 1SA5A 2H6HA 1TNBA 1D8DA 1FT1A 3DSTA 3EU5A 2H6IA 1N4QA 3DSXA 4GTSA 4GTOA 2H6GA 4YDEA 3PZ1A 3DSVA 1DCEA 1TNOA 1O1TA 3SFXA 3KSQA 4GTRA 2IEJA 1O1SA 3HXBA 1TNUA 1TN6A 1NI1A 3DSSA 1N4PA 1S63A 3Q75A 4GTVA 1O5MA 1N94A 4YDOA 3DPYA 4GTTA 3EUVA 1LD7A 1SA4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3C72 A;  2R2L A;  3E30 A;  4GTQ A;  3SFY A;  1JCR A;  1FT2 A;  1X81 A;  3HXD A;  3PZ2 A;  1QBQ A;  4L9P A;  3Q7A A;  1TN8 A;  3PZ3 A;  1TN7 A;  3Q78 A;  3PZ4 A;  4GTM A;  3KSL A;  1N9A A;  3HXC A;  3HXF A;  3E34 A;  1S64 A;  1KZO A;  3DSW A;  2F0Y A;  1FPP A;  1N95 A;  1JCS A;  2BED A;  4EHM A;  2H6F A;  3HXE A;  3Q73 A;  1N4R A;  1TNY A;  3Q7F A;  3DSU A;  1TNZ A;  1KZP A;  3E33 A;  1D8E A;  4LNG A;  1NL4 A;  4MBG A;  3E32 A;  1O1R A;  4GTP A;  1JCQ A;  3DRA A;  2ZIS A;  1MZC A;  1LD8 A;  3Q79 A;  4LNB A;  2ZIR A;  1N4S A;  3E37 A;  1LTX A;  1SA5 A;  2H6H A;  1TNB A;  1D8D A;  1FT1 A;  3DST A;  3EU5 A;  2H6I A;  1N4Q A;  3DSX A;  4GTS A;  4GTO A;  2H6G A;  4YDE A;  3PZ1 A;  3DSV A;  1DCE A;  1TNO A;  1O1T A;  3SFX A;  3KSQ A;  4GTR A;  2IEJ A;  1O1S A;  3HXB A;  1TNU A;  1TN6 A;  1NI1 A;  3DSS A;  1N4P A;  1S63 A;  3Q75 A;  4GTV A;  1O5M A;  1N94 A;  4YDO A;  3DPY A;  4GTT A;  3EUV A;  1LD7 A;  1SA4 A; 
#chains in the Genus database with same CATH topology
 4ILH B;  3LDZ A;  3DPD A;  3UIO C;  5EN5 D;  5DIZ A;  3PZ2 A;  4L9P A;  2CG2 A;  2WXQ A;  4H7Y A;  2JLB A;  3L08 A;  2Q7F A;  3CST A;  3HG0 D;  3UKU G;  1N9A A;  1S64 A;  4UI9 C;  2GRO B;  2P9I G;  4KBQ A;  1N4R A;  4J8D A;  3NOC D;  3SGH A;  4CT4 A;  3TWU A;  4U7E B;  4G23 A;  1BI7 B;  2J49 A;  3IHY A;  4L2L A;  2IQC A;  2EIL E;  2PM7 A;  2J9Q A;  3LXU X;  4EPZ A;  3QKY A;  5D66 A;  1OCO E;  2WXJ A;  4HNA D;  4GPM A;  2P9S G;  1H2V C;  4F1S A;  2OV8 A;  4U0S A;  1HG2 A;  3CIA A;  5KNG A;  4AY5 A;  1K8K G;  1NA3 A;  3ML9 A;  5ARF A;  2IO3 C;  1V55 E;  2GRP B;  5AIJ A;  2H6G A;  3FH7 A;  2CFU A;  2IY0 C;  5KNH D;  2YQ8 A;  4ACK A;  4LCT A;  3KSQ A;  4PDX A;  5ENO D;  1S70 B;  4F1P A;  4HOQ A;  3DSS A;  3RIB A;  2X6J A;  3Q4A B;  4Y6C A;  3Q75 A;  2WXG A;  1O5M A;  1H6K A;  2GRR B;  2BF0 X;  4HBD A;  3DXM G;  1MJ0 A;  2XRY A;  4A63 B;  3Q49 B;  4HXI A;  5A23 A;  3ABL E;  4I1M A;  3AS5 A;  4E6H A;  1ZB1 A;  3EIQ C;  3UX4 A;  2Y3A A;  4TXR A;  4LEU A;  3RO2 A;  2JEK A;  5HS0 A;  1IYG A;  1TN7 A;  5JJ6 A;  3TL5 A;  2KZT A;  3PDN A;  1SQM A;  3DSW A;  2LXM A;  2MOW A;  3I5P A;  3ZGQ A;  2DVW A;  4WUY A;  4KZ0 A;  1E8X A;  2WXO A;  3BQO A;  3L16 A;  4GYO A;  2XRZ A;  5CER B;  1UW4 B;  2FEZ A;  4RG6 A;  3UM3 A;  3HDX A;  5CMY A;  2XGO A;  3CVX A;  3WXX A;  3ZU7 B;  2DYR E;  3PUK A;  1ELK A;  1HZ4 A;  1O1R A;  3ZXP A;  3RJV A;  4APO A;  2BKG A;  5ANL A;  3Q79 A;  3PNL B;  4IYP A;  3I4R B;  3RU0 A;  4OYS A;  5AJL A;  4J8Y A;  3RAU A;  3C98 A;  1YYH A;  3IV0 A;  4DRX E;  1OXJ A;  4UQX A;  1JWG A;  2XEV A;  1TNO A;  5G2N A;  3ZYK A;  4CYM D;  3CQG B;  2HM8 A;  2Y0B G;  1TNU A;  3CHR A;  3R9A B;  5JHA A;  5E76 A;  3ZYM A;  3L9T A;  4BSX A;  4ANW A;  5EDS A;  3DEO A;  3KD7 A;  1PC2 A;  3ZYQ A;  4B0Z A;  4IRU A;  3B7U X;  4BX9 A;  5BPP A;  1E8Z A;  5LCW C;  5A7D B;  1DCQ A;  2OVB A;  3LEW A;  3FU5 A;  2ZXW E;  2WXP A;  1EF1 C;  2E0I A;  3D9N A;  3B13 A;  3JYS A;  5EX3 A;  1OUV A;  5HRY A;  3C3Q A;  3MGB A;  3FUN A;  4TXP A;  3LY8 A;  5FQ6 A;  1X5B A;  3X2Q E;  2BED A;  4CZ2 D;  2H6F A;  5JMN D;  2FUL A;  1H6O A;  3AG4 E;  3EIJ A;  2VTB A;  2A5U A;  1WM5 A;  4G8L A;  1IHG A;  4TUM A;  4N39 A;  5EX0 A;  1K3Z D;  3CVL A;  3HVE A;  4JVS A;  4GTP A;  1E8W A;  5ENN A;  3CEQ A;  4GZ3 A;  4DLO A;  3C3R A;  2XPZ A;  3P1U A;  4U8H A;  1KT0 A;  5ARG A;  4GA1 A;  3FUI A;  3ABM E;  5FIN A;  2XGS A;  1N0R A;  1TYQ G;  3SBT B;  1H2U A;  1TJC A;  2OVF A;  4WNE A;  1NP7 A;  3AAA C;  5T8I A;  4YDO A;  2ION A;  4CEM A;  3GZS A;  1QZ2 A;  4HOR A;  5KJM A;  4J8S A;  3TG4 A;  1V54 E;  2UWJ G;  2VQ2 A;  1Y8M A;  3B7T A;  4A3V A;  2IFU A;  3ESK A;  1NFI E;  4FAD A;  3PZ4 A;  5BUZ A;  1ELR A;  2ZU6 B;  3FUJ A;  4U0Z A;  3HXC A;  1TR4 A;  1P5Q A;  4AY6 A;  2NXP A;  3JUI A;  3QC1 A;  3Q73 A;  2J08 A;  2VSX E;  1TNZ A;  3ZKJ A;  4F53 A;  4XIF A;  2XEH A;  4F6R D;  4DK5 A;  3MX3 A;  4GB9 A;  3SD5 A;  1A5E A;  3FFL A;  3HRA A;  4U63 A;  2FO1 E;  2YHC A;  3NOG D;  2E2E A;  2GRQ B;  4WND A;  5ENT D;  1SVX A;  3PZ1 A;  4G24 A;  3PE4 A;  3CHP A;  2QY7 A;  1IXV A;  4K5C A;  3MEK A;  2YHE A;  2X6I A;  5T4Y A;  4ANU A;  4C48 B;  2LNI A;  4I6G A;  5FIO A;  2YNQ A;  3SZ7 A;  2LSV A;  1W3B A;  4BTB A;  1Z6T A;  4WWP A;  3SF4 A;  2XEN A;  4YVQ C;  2R2L A;  2VSY A;  3KS2 A;  2WXI A;  4GA2 A;  1OWO A;  4QFV A;  4AP2 A;  1MX6 A;  4G8K A;  5CEA A;  3MKQ A;  4GML A;  1EYH A;  4BET A;  5BXU A;  3HHM A;  2J4D A;  3JQ0 A;  2RD0 A;  2V4L A;  3S7J A;  5ENS D;  5KWD A;  3G2U A;  4U0U A;  2WMO A;  3HIZ A;  4U8V D;  1OCR E;  1HF8 A;  3AG1 E;  2L0T B;  4XKB A;  3URZ A;  1NL4 A;  3QDN A;  4Q69 A;  3Q5M A;  2C0M A;  1IHB A;  2X6K A;  4WWN A;  1HG5 A;  1A17 A;  2HO1 A;  2OEV A;  3QNK A;  4LNB A;  4DX5 D;  3D9O A;  4DI3 A;  1TNB A;  3PS6 A;  3EU5 A;  2H6I A;  3UM2 A;  2WXR A;  3VLD A;  4L23 A;  4GCO A;  3NBN B;  1H19 A;  1O1T A;  4QQI A;  3J5P A;  5AYW D;  4ABN A;  3ASH A;  1DC2 A;  4LUN U;  4G2V A;  3U4T A;  3IXE A;  4B8A A;  1WDY A;  4N3A A;  3QOU A;  1ELW A;  2IF4 A;  4YVO A;  2P9P G;  3CR3 A;  3DBS A;  3PEV B;  1KT1 A;  4AOF A;  1JCR A;  1FT2 A;  1VDY A;  3MA5 A;  3EHM A;  1QBQ A;  3V2O A;  3ZNG A;  3S7D A;  1NZN A;  5J90 A;  4PH4 B;  4HRN A;  4ANX A;  2F8Y A;  2P9L G;  2VSO E;  4RSY A;  1YCS B;  4HRL A;  4DX7 D;  1N95 A;  3MV3 B;  4FHK A;  3RO3 A;  2PM6 A;  1TNY A;  2YIN A;  4ZFH A;  3FUF A;  3Q7F A;  5CBO A;  4KT6 B;  2P9U G;  3V31 A;  3ZN3 A;  3RKV A;  4CRW A;  2ETA A;  2VSN A;  2XHE A;  4PS3 A;  4GCN A;  2MYO A;  2XS8 A;  2F37 A;  4OVU A;  4KMO A;  3D9P A;  1LD8 A;  3UXG A;  3GZ2 A;  1UG3 A;  2WXL A;  5C2Y A;  3VLE A;  3DXK G;  2WQ6 A;  3TWR A;  3FTW A;  4G11 A;  2EIK E;  4LER A;  3KEA A;  1BD8 A;  4JC8 A;  4CGW A;  5G55 A;  4X8Q A;  4I2Z A;  4HLL A;  2Y4T A;  5CHE E;  2GRM A;  3SNX A;  2V0P A;  3SFX A;  3NQP A;  3EJN A;  3UKR G;  5LX8 A;  1EDU A;  3CK8 A;  4EBA G;  1S63 A;  3CHS A;  4U95 D;  2WQ7 A;  5E75 A;  3G2S A;  2R05 A;  3LS8 A;  3JUE A;  3UT4 A;  1OCZ E;  3S2A A;  5FWQ A;  3ZFW A;  1Q2Z A;  3CKC A;  1X81 A;  5H7P A;  3SY2 A;  1BPO A;  3BU8 A;  4O1P A;  4J0U A;  4M7C A;  4LRZ A;  4FJY A;  1G3N B;  3MV2 B;  3QWV A;  4BT8 A;  2KBX A;  2WB2 A;  4YDW A;  3FUL A;  3B95 A;  2FI7 A;  3ASF A;  4G1T A;  2I1K A;  2LSU A;  4NUR A;  4JHK A;  2ETC A;  3CLJ A;  2RG8 A;  2R03 A;  3DSU A;  3ASD A;  4MBG A;  4BY6 A;  4U8Y D;  2DIW A;  3GW4 A;  2AXU A;  2Y69 E;  3ABK E;  4DPR A;  3I3N A;  2B0O E;  4JHR A;  3NAW A;  3TWS A;  2I6H A;  4J7W A;  1ZBP A;  3L54 A;  4UWL A;  3OAW A;  5D0O D;  3UIP C;  2UY1 B;  3W9G A;  3T8M A;  5CRU A;  2WQH A;  1RW2 A;  2IEJ A;  1O1S A;  4JL0 A;  5FJY A;  4DLQ A;  1UJK A;  5FT9 A;  3QWP A;  2B6C A;  4HI8 A;  3U66 A;  1H0A A;  2V5Q C;  2Y4U A;  4HS2 A;  2MRI A;  1SA4 A;  5KJL A;  4ATZ D;  3ONK A;  2P9N G;  4NRH B;  3SFY A;  3B7S A;  4XZ4 A;  4EQF A;  2PQN A;  3PZ3 A;  5ENR D;  3D9H A;  3AU4 A;  3RRM B;  4UWH A;  2KAT A;  2KCL A;  5C1D A;  3SFZ A;  2GW1 A;  2HE0 A;  5AEN A;  4ILI A;  1UOH A;  4I1O B;  3V30 A;  1SZ9 A;  3PE3 A;  1JCS A;  3HXE A;  3PZD A;  3FUE A;  3G2W A;  4BTA A;  2PZI A;  3OXL A;  4HQD A;  1D8E A;  4XX5 A;  4LNG A;  1BLX B;  4KVM A;  4C9B B;  4OAU C;  4TXQ A;  2V5F A;  4FA6 A;  3Q15 A;  1JPL A;  3JCK C;  3E37 A;  1QYM A;  2A4Z A;  3CQC B;  4LNU D;  2RFM A;  3QB2 A;  3LVQ E;  3K9I A;  4OVV A;  2VGX B;  4GTO A;  3FHE A;  4YDE A;  3ASG A;  2V8S E;  2WXK A;  3BEE A;  2MHK A;  3FUH A;  4MS6 A;  4RVB A;  3D9I A;  4GTV A;  4N3C A;  3DPY A;  3RRN B;  3SHF A;  1LD7 A;  3PRZ A;  2CG3 A;  3E30 A;  3LY9 A;  3OXG A;  1EPU A;  1N11 A;  3AG2 E;  2IJG X;  5B3S E;  4CCA A;  5IY5 E;  4BEP A;  5CCL A;  1N54 A;  3AS8 A;  2M63 A;  4BSZ B;  3CKB A;  4ILG A;  4ACL A;  2F0Y A;  3ZHE B;  5JJT A;  1WAO 1;  5G04 J;  3ZRH A;  1SW6 A;  4EZK A;  3LCA A;  5G05 J;  4TV3 A;  2LXL A;  1IQR A;  4JEH A;  1FCH A;  3LJ3 A;  1N52 A;  2KM4 A;  5CED B;  4GYW A;  3I4G A;  3DRA A;  2I1J A;  2XQ0 A;  2EIN E;  4J8E A;  1Y6I A;  4A3T A;  4C0M A;  2VGY A;  3CVV A;  2J4B A;  3LVR E;  2DZO A;  4DX1 A;  3APC A;  4A55 A;  4L1B A;  3ASO E;  1FT1 A;  4AV7 A;  2P58 C;  5HI7 A;  1OWM A;  2VGX A;  4GTS A;  5AJD A;  1HH8 A;  3LPZ A;  3CVQ A;  4I9C A;  5EIL A;  1UJJ A;  4GU5 A;  5EIB E;  2NYJ A;  2KC7 A;  1TN6 A;  1LF8 A;  2EIJ E;  1N4P A;  3CVU A;  4UQZ A;  5B1B E;  3ZPJ A;  3U64 A;  3UM0 A;  2CHX A;  4JZY A;  2OCC E;  5AAR A;  2F8X K;  3FTV A;  2XPI A;  4IUL A;  3CVN A;  3JXJ A;  3SI5 A;  1SZA A;  3N71 A;  4RQI A;  3QWW A;  5T3R A;  4J8F A;  2WXH A;  3IKO B;  1WG0 A;  4CT0 A;  4WNG A;  4M3O A;  4I6J A;  3ZYL A;  4MRU A;  3FWV A;  4ZHB A;  3ZHE A;  4R7L A;  4K0R A;  4DJA A;  3FEX A;  4WAF A;  4EHM A;  4TUU A;  4HLE A;  3EHN A;  3WG7 E;  2XPY A;  4WNF A;  2RKK A;  1KLX A;  5BNW A;  3APF A;  3D3M A;  1RZ4 A;  3E32 A;  1TEZ A;  1E96 B;  4W9R A;  3OTN A;  2WMN A;  4I17 A;  4B8C B;  3PH0 C;  3GZ1 A;  3RK6 A;  2XZD G;  3FTX A;  4HVB A;  5KJN A;  4XKC A;  1SA5 A;  3VTY A;  5KJK A;  4Q94 A;  1E7U A;  1S0P A;  2DBA A;  3DSV A;  5M72 A;  5D0Q D;  1DCE A;  2R5S A;  2AW6 A;  5BT1 A;  3L13 A;  2L6J A;  4CGV A;  3TWV A;  3TWT A;  1N0Q A;  3FEY A;  1HXI A;  4JHJ A;  1TJF A;  4FU3 A;  4UI9 J;  4HOT A;  2C2L A;  3TWX A;  2PNN A;  3C72 A;  3APD A;  3UIN C;  3V2X A;  3HYM B;  5EKQ D;  1PY1 A;  4B89 A;  1OT8 A;  3L82 A;  5CCM A;  4I6E A;  5LP0 A;  4BES A;  1Z5S C;  3R9M A;  3FY4 A;  2AWI A;  4GZC A;  1U2V G;  1FPP A;  1HU3 A;  4GZD A;  4DI4 A;  3L22 A;  1UN9 A;  1U3D A;  3JXI A;  3FUK A;  3G2V A;  4F3V A;  1QQE A;  2XGM A;  4JPS A;  1JCQ A;  4LG6 A;  4N2Q A;  2RFA A;  4FP7 A;  3LJN A;  4EEC A;  1N4S A;  3CV0 A;  5ANR A;  4JXT A;  5FZS A;  3CGH A;  1PAQ A;  4JB8 P;  5JHB A;  1IQU A;  2CHW A;  1AWC B;  4FJZ A;  4U07 A;  1MQS A;  2IO2 C;  4FC8 A;  4HOU A;  2BKK B;  3BG1 B;  4KVO A;  3L6A A;  1DVP A;  3HXB A;  4I1A A;  4TRQ A;  3CHM A;  3UMV A;  4XI0 A;  1N94 A;  5ENQ D;  2KZT B;  3UI2 A;  4XI9 A;  4HI9 A;  2DCP A;  3ZVV A;  4EBA A;  1BI8 B;  3RRU A;  4DX2 A;  2X3M A;  4RLY A;  3FTZ A;  4APF A;  5JJ7 A;  2WXM A;  4GTM A;  3FU3 A;  5AAO A;  2R59 A;  3KAE A;  3PNT B;  3UUX A;  5FQ8 A;  1K1A A;  1YA0 A;  2C0L A;  4BWR A;  4BX8 A;  4H7X A;  4HFG A;  3E33 A;  1ZU2 A;  2XCB A;  2EQX A;  1MX4 A;  1OWN A;  4ATG A;  3VLF A;  2R17 C;  4GMR A;  4BER A;  1MX2 A;  5JA4 D;  3MKR A;  4MKT A;  1LTX A;  5LFA A;  4B94 A;  3V79 K;  3FU0 A;  4AIF A;  2LUH A;  3FDH A;  4JW1 A;  5EYL A;  1N4Q A;  1INZ A;  5B1A E;  3G2T A;  3AG3 E;  3SQV A;  2PL2 A;  5LCW J;  2J09 A;  2XCC A;  5AQA A;  3LKU A;  3OXF A;  2VGE A;  2V4H C;  4UI9 K;  4EZJ A;  4OAV B;  4RG9 A;  1NI1 A;  3UT8 A;  2GRN B;  2P9K G;  4PS8 A;  3T8K A;  3TJP A;  2AXV A;  4GTT A;  3EUV A;  1L5J A;  2X6F A;  4GAA A;  2Y1L E;  4GPK A;  1UN8 A;  2NC9 A;  4N2S A;  4ANV A;  2OEW A;  4NQ0 A;  3B7R L;  3ULQ A;  4URK A;  2ZGD A;  3D9L A;  3C3O A;  2VTB B;  3AU5 A;  3T9K A;  3L17 A;  2ZGG A;  3HVE B;  4I2W A;  2EIM E;  2KXP C;  4KYO B;  4A1S A;  4GYY A;  1D9S A;  1GW6 A;  3UT7 A;  2PQR A;  3DWL G;  5FQ7 A;  3FTU A;  3QAQ A;  4GZ6 A;  2OND A;  4GMJ A;  1BU9 A;  3S7B A;  2CHZ A;  4FHJ A;  2L6B A;  2DYS E;  3PUJ A;  3DEP A;  3RSE G;  3TXN A;  3T5X A;  3EHR A;  2QYJ A;  4K5B A;  3EU9 A;  3CHQ A;  4NIK A;  2H6H A;  2WVI A;  5AN8 A;  1K1B A;  1HFA A;  4AEZ C;  5CBN A;  4KZC A;  4GTR A;  3J5Q B;  3CHO A;  4O1O A;  3ZW3 A;  3MJW A;  5BV1 A;  1H6P A;  4B93 B;  2DWZ A;  3IHV A;  3S7F A;  1AP7 A;  3AJI A;  2ILR A;  2XEE A;  3PVL A;  2LO6 A;  3B7B A;  2UY1 A;  4F7A A;  5DBK A;  2AJA A;  4EZL A;  4KXK B;  3QJZ A;  4XEI G;  3EHQ A;  3CK7 A;  3HXD A;  1FVH A;  3EDT B;  3JQ1 A;  1OCC E;  3ESL A;  3Q9U C;  3FUD A;  4ME2 A;  2P2C P;  3HXF A;  2VJ8 A;  2AVP A;  2DZN A;  2J8S D;  4JD2 G;  3IBE A;  2IU1 A;  2IOS A;  3UTM A;  2I9C A;  4HRM B;  2KCV A;  3U9W A;  3FU6 A;  1MZC A;  3UQ3 A;  2ZIR A;  4C0E A;  3FTY A;  4UWG A;  5BV0 A;  4CDM A;  4GZ5 A;  2HR2 A;  3ZEF A;  3MCX A;  2GRL A;  3O48 A;  4GA0 A;  2NSZ A;  4Q96 A;  3DSX A;  3CVW A;  4PUC A;  1JUQ A;  5KCM A;  3UM1 A;  4BT9 A;  2WXN A;  3MZL B;  4CDN A;  4DX6 D;  5AQ9 A;  3LY7 A;  4UQY A;  3NZS A;  4PS7 A;  4I9E A;  2BUG A;  4G25 A;  4G26 A;  1Z3Y A;  3MKQ B;  2LAI A;  1HE8 A;  3U3W A;  4YND A;  4DUI A;  3SBS A;  5KBA A;  4K5A B;  4V3I A;  3ULY A;  3R7Q A;  1E90 A;  3IEG A;  3SO8 A;  3QK0 A;  3FTS A;  3Q7A A;  1TN8 A;  2QZA A;  3ML8 A;  3ONL A;  3ZXS A;  2JAB A;  1XNF A;  5CEC B;  3F6Q A;  3Q9N C;  1E8Y A;  4LSZ E;  3Q78 A;  5EID A;  3NF1 A;  4NAC A;  5HQ8 A;  3E34 A;  4J6I A;  2L9B A;  1KZO A;  1Z3X A;  1DNP A;  4N5Q A;  5EYP F;  3FUM A;  1WY6 A;  5FTP A;  2GGF A;  4HB5 A;  5ENP D;  3AS4 A;  3FH5 A;  5CMW A;  3GYZ A;  1OY3 D;  4MLP A;  3CVP A;  1QNF A;  2CFZ A;  3TGO A;  2FBN A;  2KCK A;  1MYO A;  2ZIS A;  4BFR A;  4JA7 A;  2BTD A;  3PEU B;  4P29 A;  1HX8 A;  4FLH A;  3FH8 A;  5G04 C;  2OOE A;  3ISM C;  5G05 C;  4FLB A;  2XS1 A;  1B89 A;  2QC9 A;  3KEZ A;  2VYI A;  3NZU A;  3TWW A;  4CDR A;  4E85 A;  3ENE A;  3ASN E;  3BG0 B;  1NA0 A;  3ZIM A;  5D2M C;  1HS6 A;  1OWL A;  2J07 A;  2IOL A;  1XGW A;  2X6H A;  5FQ4 A;  5J08 A;  1H2T C;  2WPV A;  2ETB A;  3TXM A;  3CK9 A;  3P2B A;  2FO7 A;  4GTQ A;  2QYU A;  2XZT G;  5FZR A;  1MHQ A;  3E4B A;  1OWP A;  3O4Z A;  2FF4 A;  3KSL A;  4N3B A;  3R7R A;  3TWQ A;  4UWK A;  5ITZ F;  2A5E A;  4HOS A;  2HYZ A;  4AVX A;  4L2Y A;  3CSF A;  4U04 A;  1HO8 A;  4WWO A;  4YDY A;  2QFC A;  5BW8 C;  1KZP A;  1YMP A;  3ZUV B;  1U3C A;  5AQB A;  5BXO A;  5CRV A;  4L7T A;  3NB2 A;  1E7V A;  4FUL A;  5AQ7 A;  3D9K A;  5HKP A;  3C5R A;  3TAX A;  2X38 A;  4UWF A;  3T5V A;  2R02 A;  5LOZ A;  3BUA A;  3ULE G;  4AJW A;  4U96 D;  3CVY A;  3TG5 A;  1KPS B;  4JEU A;  4UUC A;  2WXF A;  1D8D A;  3DST A;  4O60 A;  3Q47 B;  4N5C A;  4AM9 A;  3QAR A;  2AXZ A;  1FVF A;  4AXH A;  1JWF A;  4A1G A;  5FZQ A;  1IKN D;  3FP3 A;  5A6C A;  3W9F A;  4JA9 A;  3UPV A;  3VTX A;  2L0I A;  3MYV A;  4IN3 B;  2WM9 A;  4Y6W A;  4D10 C;  3D9M A;  4Z68 A;  2LAH A;  2I2O A;  4XE0 A;  4O6F A;  4K03 A;  3D9J A;  3LYA A;  4I43 A;  3PRE A; 
#chains in the Genus database with same CATH homology
 3C72 A;  2R2L A;  3E30 A;  4GTQ A;  3SFY A;  1JCR A;  1FT2 A;  1X81 A;  3HXD A;  3PZ2 A;  1QBQ A;  4L9P A;  3Q7A A;  1TN8 A;  3PZ3 A;  1TN7 A;  3Q78 A;  3PZ4 A;  4GTM A;  3KSL A;  1N9A A;  3HXC A;  3HXF A;  3E34 A;  1S64 A;  1KZO A;  3DSW A;  2F0Y A;  1FPP A;  1N95 A;  1JCS A;  2BED A;  4EHM A;  2H6F A;  3HXE A;  3Q73 A;  1N4R A;  1TNY A;  3Q7F A;  3DSU A;  1TNZ A;  1KZP A;  3E33 A;  1D8E A;  4LNG A;  1NL4 A;  4MBG A;  3E32 A;  1O1R A;  4GTP A;  1JCQ A;  3DRA A;  2ZIS A;  1MZC A;  1LD8 A;  3Q79 A;  4LNB A;  2ZIR A;  1N4S A;  3E37 A;  1LTX A;  1SA5 A;  2H6H A;  1TNB A;  1D8D A;  1FT1 A;  3DST A;  3EU5 A;  2H6I A;  1N4Q A;  3DSX A;  4GTS A;  4GTO A;  2H6G A;  4YDE A;  3PZ1 A;  3DSV A;  1DCE A;  1TNO A;  1O1T A;  3SFX A;  3KSQ A;  4GTR A;  2IEJ A;  1O1S A;  3HXB A;  1TNU A;  1TN6 A;  1NI1 A;  3DSS A;  1N4P A;  1S63 A;  3Q75 A;  4GTV A;  1O5M A;  1N94 A;  4YDO A;  3DPY A;  4GTT A;  3EUV A;  1LD7 A;  1SA4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...