2H6FA

Protein farnesyltransferase complexed with a farnesylated ddptasacvls peptide product at 1.5a resolution
Total Genus 134
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
134
sequence length
315
structure length
315
Chain Sequence
FVSLDSPSYVLYRDRAEWADIDPVPQNDGPNPVVQIIYSDKFRDVYDYFRAVLQRDERSERAFKLTRDAIELNAANYTVWHFRRVLLKSLQKDLHEEMNYITAIIEEQPKNYQVWHHRRVLVEWLRDPSQELEFIADILNQDAKNYHAWQHRQWVIQEFKLWDNELQYVDQLLKEDVRNNSVWNQRYFVISNTTGYNDRAVLEREVQYTLEMIKLVPHNESAWNYLKGILQDRGLSKYPNLLNQLLDLQPSHSSPYLIAFLVDIYEDMLENQCDNKEDILNKALELCEILAKEKDTIRKEYWRYIGRSLQSKHST
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Conversion of protein farnesyltransferase to a geranylgeranyltransferase.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords Protein farnesyltransferase/geranylgeranyltransferase type I
total genus 134
structure length 315
sequence length 315
ec nomenclature ec 2.5.1.58: Protein farnesyltransferase.
pdb deposition date 2006-05-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01239 PPTA Protein prenyltransferase alpha subunit repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.120 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Protein prenylyltransferase 2h6fA00
2BEDA 1KZOA 1N95A 3DSTA 2H6GA 3E34A 3DSVA 4GTQA 1O5MA 2H6IA 1TNUA 1TNBA 1JCQA 3SFXA 3DSXA 1SA5A 1MZCA 3SFYA 1TNYA 2R2LA 3KSQA 3DPYA 1TN8A 1FT2A 1S63A 2IEJA 1N94A 1FPPA 4EHMA 1N9AA 1JCRA 1KZPA 4GTVA 3KSLA 3PZ3A 4LNGA 3Q7FA 3EUVA 3HXFA 3Q78A 1O1TA 1TNZA 1N4PA 4L9PA 4YDEA 4GTOA 1TN7A 3PZ4A 1LD7A 1N4QA 1N4SA 3HXCA 1TN6A 3HXEA 3DSSA 3DSWA 3C72A 3E33A 3Q73A 2F0YA 1D8DA 2H6FA 4GTMA 1FT1A 1S64A 1JCSA 3Q75A 1SA4A 3Q79A 4GTRA 1DCEA 1NI1A 2ZISA 4GTSA 1LD8A 4GTTA 2H6HA 1D8EA 3HXBA 3E32A 3PZ2A 1O1RA 2ZIRA 3E37A 4MBGA 1O1SA 3DRAA 3DSUA 3HXDA 1N4RA 1TNOA 3PZ1A 4GTPA 3Q7AA 1QBQA 3E30A 3EU5A 4LNBA 1NL4A 4YDOA 1X81A 1LTXA
chains in the Genus database with same CATH superfamily
2PQRA 5B3SE 3MX3A 2I9CA 4KMOA 3JUIA 2V5QC 4CT4A 4F6RD 4C0MA 3AU5A 3DSXA 2CG3A 4TXQA 3ZYLA 4N5CA 5ENQD 2KATA 3QDNA 1E7UA 2MYOA 5JMND 5FZSA 4TXRA 4UUCA 4CYMD 5CEDB 4CGVA 4U63A 3IKOB 2A5EA 4GZDA 5FJYA 1TNZA 2WXQA 4GPKA 4EPZA 2FBNA 3EIQC 1TN7A 2P58C 3HXEA 3UPVA 1BU9A 4BT8A 4IN3B 5LP0A 3ABKE 3Q79A 2GRNB 3ZXSA 4QQIA 3B95A 4JPSA 2X6IA 2ZU6B 2P9LG 3V79K 4N39A 1O1SA 1E8WA 3FU3A 3RU0A 2V8SE 1SW6A 1DCQA 2QYUA 3I5PA 2OVBA 2WQHA 3AU4A 3B7TA 1NFIE 3GYZA 3QJZA 3UKRG 1E8XA 2EILE 2IU1A 1TR4A 2EIJE 4JHJA 2WXIA 3KS2A 5G2NA 2WXRA 4GYYA 4N5QA 3U9WA 4N2QA 2H6IA 4NURA 2HR2A 2PL2A 2V4HC 4PUCA 3AS8A 3FTUA 3MZLB 4U8VD 5ENRD 4U0UA 5KJKA 3FEXA 4GYOA 3UM3A 4LNGA 3L16A 1Z3XA 5CECB 3V31A 4JHKA 2LXLA 3VLFA 4OAVB 4AIFA 3FUIA 3JYSA 5D66A 3FH8A 5CCMA 2GRLA 3SI5A 2WXMA 4GPMA 3CGHA 4AM9A 1SA4A 2OCCE 4HFGA 2B0OE 3UIOC 1NA0A 4OYSA 3QARA 1JWFA 4RSYA 1MYOA 2XGSA 4YNDA 1V54E 3CK8A 5FQ8A 1N4RA 2WXKA 4BEPA 1NA3A 3MJWA 1IHBA 5ANRA 5FQ7A 4YDOA 3AG2E 4UWGA 3ASNE 1EF1C 2V4LA 3LVRE 2IO3C 5D2MC 4LRZA 4W9RA 2HYZA 2GW1A 3V2OA 4A63B 4WWOA 5J90A 3CHOA 2PQNA 1IYGA 1TN8A 1S63A 1Y6IA 3AG3E 3UKUG 1JWGA 1KT1A 2HO1A 2WXNA 1H2VC 3CVUA 3CV0A 1H0AA 5C2YA 4J8YA 4PS7A 2RFMA 2R03A 3R7QA 4UI9C 4HI9A 2DYSE 4ME2A 4M7CA 3OXFA 3GZ2A 4GB9A 3HVEB 2AXUA 1TN6A 2I1KA 4XKCA 4J8FA 3QAQA 1E96B 5CCLA 1HS6A 4B94A 2I2OA 5EYPF 3CVXA 4G2VA 2R17C 3RK6A 3DXKG 5BXOA 4I9CA 4G8LA 2FI7A 3IEGA 3QNKA 3UM0A 5B1BE 5G05J 1SVXA 4N2SA 1D8EA 4BETA 4AEZC 3E37A 3PE3A 3C3RA 2M63A 5A23A 4HOUA 3FP3A 3Q9UC 2BKKB 1TNOA 2FULA 1HO8A 1ELWA 2LO6A 3G2TA 4N3CA 3EU5A 4GZ6A 3IHYA 4UQYA 3ENEA 1YA0A 3DSTA 5BXUA 3APDA 3FUKA 3DSVA 3FDHA 2PNNA 2L9BA 2V5FA 4GZ3A 4TRQA 2CHZA 2WB2A 4A1GA 3QK0A 2LXMA 3FUMA 4I1AA 5BV0A 4J6IA 2Y3AA 2DCPA 3FHEA 2ETAA 4XZ4A 4YVOA 4UWKA 2WVIA 5CBNA 4GA2A 4CEMA 5ENTD 2XCBA 4NIKA 1MHQA 3PE4A 3MKQA 3MGBA 4OVVA 2KZTA 3U64A 2P9PG 4Q96A 5FQ4A 3CK9A 4XKBA 2CFUA 3DWLG 2YNQA 1HG5A 3EJNA 2P9SG 2P9NG 3PEVB 3SBTB 1K8KG 4DX5D 5M72A 5FT9A 5B1AE 1EDUA 1OCOE 3UT8A 2VSYA 4G25A 2AXZA 3ISMC 2BKGA 3T9KA 4ATZD 2H6HA 3TWVA 5JHBA 1BI8B 2QFCA 4U8YD 1HG2A 3ABME 2KCKA 2DVWA 4JVSA 4K03A 3CHMA 4FJZA 2YINA 1XGWA 1IXVA 1TJCA 4DRXE 3HYMB 4I1MA 4EQFA 4EZKA 3D9HA 2E2EA 4MKTA 5AJDA 1LTXA 4G23A 4Y6CA 5LOZA 3LCAA 4DJAA 2VSNA 3CVYA 2CG2A 3T5XA 3CVVA 5EIDA 4I6EA 1S0PA 5BNWA 5EDSA 2AW6A 3VLEA 1IHGA 3FTXA 2R5SA 4BESA 3TWWA 4JHRA 1HU3A 4AOFA 3PVLA 3EUVA 4JL0A 4BERA 1BLXB 4U95D 4O60A 3OXGA 3APFA 4EZLA 3Q73A 4DUIA 1MJ0A 3RO2A 4WWNA 2ZISA 2FO7A 1UJKA 4JZYA 3SO8A 2VTBB 3B7SA 3LDZA 3NZSA 4I17A 1HH8A 2JEKA 4CDMA 1N0RA 1OWNA 2F37A 5AARA 1H2TC 3RJVA 4F3VA 2VQ2A 3V30A 5KNHD 2CHWA 1DC2A 3BG0B 3FU6A 4BTAA 3AJIA 4K5BA 4JD2G 4ILGA 2BEDA 1N95A 1UJJA 1TEZA 4WUYA 4GYWA 2WM9A 1KT0A 5AQ7A 3K9IA 2J8SD 3EHQA 5AENA 2WXJA 3UMVA 4ZHBA 3LY9A 4JEHA 4HNAD 4L23A 2XZDG 4KZCA 5KJLA 1V55E 1K1AA 2XEHA 4EBAA 4HBDA 4UWFA 2Y4TA 4PDXA 4K5CA 5ENPD 4GA0A 3CSFA 5G04J 5ITZF 3U4TA 4XI0A 3ASHA 2WXGA 3OAWA 3D9IA 3LJ3A 4L9PA 1OT8A 5EX0A 4FLHA 4A1SA 4GTOA 4FA6A 3T5VA 4CGWA 2VGEA 4E85A 3E4BA 2ZXWE 3E33A 1D8DA 5T4YA 3TWXA 4I6GA 5AIJA 5JJ7A 3FUHA 4EECA 3ONKA 5HQ8A 2ETCA 3ZN3A 4G11A 1RZ4A 3RO3A 2DYRE 2RD0A 4C0EA 2XHEA 4RG9A 3U66A 4GTRA 4V3IA 2XCCA 1H19A 3CKBA 3SQVA 4O1OA 3PS6A 2DZNA 2Y4UA 4DLOA 2Q7FA 5A7DB 3FTVA 1FVHA 3L08A 2GRRB 3Q5MA 4G26A 2IOLA 1KLXA 5DBKA 3HVEA 4DLQA 1NL4A 1K3ZD 4ANWA 3CVLA 5LCWC 3T8MA 1LF8A 3LY8A 3V2XA 1X5BA 1BD8A 3IV0A 2VGXB 3TWQA 3IHVA 4FP7A 3J5PA 3CR3A 4HRMB 3GW4A 3TWSA 2RKKA 1N9AA 1JCRA 3QKYA 4HQDA 4MRUA 1YCSB 3SBSA 3BUAA 2YQ8A 3EHNA 1AP7A 1N4PA 3UQ3A 3ASGA 1ELKA 5ARGA 1OUVA 1LD7A 4HLLA 4I1OB 3ZHEB 5D0QD 5JJTA 1K1BA 4FADA 4CDRA 4CCAA 1S70B 3UT4A 4WNGA 5CMWA 4E6HA 1QQEA 2JLBA 4J7WA 5AQ9A 1SZAA 1E8ZA 2NXPA 2X6HA 4F1PA 1WG0A 5T8IA 2ZIRA 2GRPB 2LAHA 4BWRA 3NQPA 4ACKA 5JA4D 3L22A 3PUKA 2QYJA 4EBAG 2ILRA 3W9GA 2XGMA 3O4ZA 2EIKE 2ONDA 3AG1E 2WQ6A 1Z5SC 5KJNA 3RAUA 3D9JA 5G55A 4F1SA 1JPLA 1TNUA 1VDYA 1JCQA 4HRNA 2ZGGA 5HI7A 4FJYA 1Z6TA 4OVUA 3CVNA 4EZJA 3SFYA 2J08A 2R2LA 2OV8A 1B89A 1FT2A 4JB8P 4B93B 3ABLE 3PZ3A 3AS4A 2IOSA 3Q78A 4O6FA 4H7XA 4BT9A 3CQGB 4WNFA 4GZCA 3ASDA 3AS5A 1IQRA 3APCA 3QOUA 2UY1B 4HLEA 2WMOA 5AAOA 3DEPA 2F0YA 2H6FA 3NAWA 4XE0A 1FT1A 2WXOA 1JCSA 5JJ6A 2R02A 3VTXA 3DXMG 3I4GA 3MV2B 3Q4AB 1U3DA 5ARFA 3BQOA 1OCRE 1E90A 2F8YA 3LVQE 2XPZA 2FF4A 4NQ0A 4U04A 3NB2A 5IY5E 1O1RA 4B8CB 3CVWA 3R9MA 3CLJA 4Q94A 3ESKA 4FHKA 4I9EA 2QZAA 3QWWA 3BEEA 3SF4A 4KT6B 3ZVVA 4G8KA 4JXTA 3ASOE 4X8QA 3FY4A 3JUEA 4LNBA 2LSVA 2BUGA 1NP7A 1SZ9A 1OCZE 3EU9A 3HG0D 4UQZA 3X2QE 2EIME 3G2VA 5ENSD 3LXUX 3KSQA 1OWMA 5HRYA 3FUNA 4BY6A 3GZSA 2R59A 1UN9A 2WXPA 3TXMA 4JC8A 1QYMA 4R7LA 4ZFHA 2J4BA 2WQ7A 1E7VA 5HKPA 3MA5A 3MEKA 4APOA 5ENNA 3EHMA 2JABA 4DPRA 2WXFA 4D10C 3D9NA 4U96D 1N4QA 4CT0A 2PM7A 3HRAA 3DSSA 3HIZA 3CSTA 4U7EB 2FO1E 2EINE 3UX4A 4DI4A 4GTMA 1S64A 4ILHB 2P9UG 3D9OA 3LPZA 2DZOA 3TWUA 2AWIA 1U2VG 2DIWA 2CHXA 3F6QA 4GTSA 3UXGA 4LSZE 4AV7A 4ANXA 4U07A 5KNGA 2GGFA 2OVFA 4A3TA 1W3BA 4YDYA 2MRIA 3BU8A 3I3NA 1L5JA 3ASFA 5EN5D 3ZFWA 3KEAA 3EIJA 1Z3YA 3MKQB 2I6HA 2LSUA 5LCWJ 1BPOA 4DX1A 2DWZA 3IXEA 1IQUA 3C98A 3RSEG 5CRVA 4BSXA 2IJGX 3NF1A 2BTDA 3DPDA 5BPPA 4L2LA 3CKCA 4RLYA 2WXLA 3PRZA 3LEWA 3EDTB 2V0PA 3GZ1A 3KSLA 3CHRA 3HHMA 3AAAC 2QC9A 4G24A 3ESLA 4FC8A 4HI8A 2KZTB 3ZIMA 3FFLA 4N3BA 3RRUA 3PNTB 4YVQC 5FQ6A 3S2AA 1QZ2A 5D0OD 3PNLB 3PDNA 3ZKJA 2GROB 1KPSB 1XNFA 3LY7A 4CDNA 4WWPA 2X6KA 3DSUA 2GRQB 5BW8C 1ELRA 3HXDA 5AQBA 1NZNA 3CVQA 3P1UA 4LEUA 3I4RB 2AVPA 3TXNA 5CMYA 1HE8A 3E34A 3ZW3A 4GAAA 4AY5A 4KZ0A 3TG5A 4TV3A 3AG4E 4MLPA 4ANVA 2XS1A 3LKUA 2IF4A 1ZU2A 4JA9A 2KCLA 2I1JA 4ATGA 1WAO1 1N94A 5G04C 3SNXA 3URZA 4EHMA 3N71A 1U3CA 2VGYA 4GCOA 1UW4B 4HVBA 3CK7A 1P5QA 5CHEE 2F8XK 1N0QA 1O1TA 3O48A 5CRUA 3UI2A 3ZXPA 2VYIA 4APFA 3NBNB 1N4SA 2X3MA 2J49A 1OWPA 3FTWA 3QWPA 4Q69A 3WXXA 5EIBE 5FINA 5LFAA 3FTYA 4KVOA 3UINC 3Q75A 2OEVA 3KAEA 3PEUB 3KEZA 4CZ2D 3G2SA 3ZYQA 4AJWA 1MX4A 5EKQD 3VLDA 2AJAA 1QNFA 5G05C 1UOHA 3E32A 4O1PA 2P2CP 2XGOA 4XEIG 4ABNA 3CHQA 2LAIA 2YHEA 4FULA 5EILA 3S7BA 4AVXA 3R9AB 1A5EA 5KJMA 4AXHA 2VSXE 5EX3A 4LNUD 3ZEFA 3SFZA 4UWHA 4GTQA 1O5MA 1OWLA 3RKVA 3CIAA 4WNEA 3MKRA 1SA5A 5E75A 3MYVA 3CEQA 3FUJA 1MX2A 4L2YA 1SQMA 2LUHA 1INZA 3FULA 4HXIA 4KXKB 3QB2A 1KZPA 4F53A 3CHPA 3FH7A 3D9KA 3ZUVB 1H2UA 2LNIA 2KM4A 3VTYA 3CQCB 1OXJA 4DX6D 1HX8A 3RRMB 1JUQA 4AP2A 1FVFA 3UIPC 1HZ4A 3CHSA 4M3OA 3FUEA 5CBOA 3CVPA 1OWOA 4C48B 1HFAA 5EYLA 3PZDA 2EQXA 4U0SA 2XS8A 2IFUA 1DCEA 3ZPJA 3MCXA 4GU5A 1LD8A 5FIOA 2QY7A 4ANUA 3PZ2A 2BF0X 2Y69E 3D9LA 3W9FA 4A55A 3QC1A 2KXPC 5J08A 1DVPA 3TJPA 2XRZA 4HB5A 4RG6A 3PZ1A 4XIFA 3S7FA 1G3NB 1QBQA 2XEEA 4GMJA 2IY0C 1RW2A 1ZBPA 4BSZB 1X81A 2L6JA 2AXVA 4RQIA 1HF8A 1EPUA 4DX7D 2P9IG 1WDYA 2KC7A 1GW6A 1TNBA 4JEUA 3MV3B 2UY1A 2CFZA 4L1BA 3ZYMA 3FUDA 4IRUA 3UTMA 3ZGQA 3Q47B 5HS0A 3P2BA 5BT1A 4U8HA 1FPPA 4IULA 4P29A 5AQAA 4BFRA 2XPIA 2XENA 3ZU7B 5ANLA 3QWVA 4TXPA 3TAXA 5JHAA 2DBAA 3S7DA 4Y6WA 1YMPA 1FCHA 2L0IA 3DSWA 3DEOA 3PREA 1YYHA 4XX5A 3B13A 3UM1A 2J09A 3JXJA 3ZNGA 4BX9A 4WAFA 5AYWD 1A17A 3FWVA 3BG1B 5BV1A 4GTTA 3TG4A 5FZQA 1D9SA 2P9KG 4FHJA 1Y8MA 3Q15A 5KCMA 4U0ZA 3SZ7A 5C1DA 2E0IA 2FEZA 5FZRA 1ZB1A 4LUNU 1E8YA 3KD7A 4GA1A 2HM8A 3FTSA 3EHRA 2X38A 5AJLA 2C0LA 3TGOA 4UWLA 3S7JA 4NACA 1OCCE 3E30A 4K5AB 3ULEG 2VGXA 3C5RA 2H6GA 1WY6A 1WM5A 1PC2A 5T3RA 3WG7E 2A5UA 3SFXA 2L0TB 3OXLA 4TUMA 3G2WA 3JQ0A 1MX6A 1UN8A 2WXHA 4J0UA 4HOTA 2HE0A 1PY1A 3D9PA 3ZYKA 2B6CA 2IEJA 4HOQA 4B0ZA 3RIBA 2C0MA 3DBSA 4GTVA 4B8AA 2WMNA 4URKA 3Q7FA 4GMLA 2GRMA 3HDXA 4DK5A 3NZUA 2Y1LE 2MOWA 3ONLA 2VJ8A 3D3MA 5CEAA 1H6PA 1PAQA 3PZ4A 5A6CA 2IONA 4A3VA 3HXCA 1Q2ZA 2YHCA 3SY2A 4FU3A 4KYOB 2NSZA 1TYQG 4B89A 4KVMA 4H7YA 2XZTG 4GMRA 2A4ZA 4KBQA 4WNDA 1UG3A 4HORA 4PH4B 3FH5A 3HXBA 3Q49B 4QFVA 2OEWA 1TJFA 2XPYA 4YDWA 4MBGA 1N54A 3T8KA 3UT7A 2X6JA 3JQ1A 2IQCA 2PM6A 4J8SA 2IO2C 3L82A 1KZOA 3L6AA 3J5QB 5FTPA 2XQ0A 2L6BA 3G2UA 4JA7A 3RRNB 4G1TA 3TWTA 5LX8A 5H7PA 4LG6A 2XRYA 4GCNA 3NOGD 1IKND 2RFAA 5FWQA 3ML9A 2NC9A 4CRWA 4F7AA 5BUZA 3TWRA 3ULYA 3L9TA 4YDEA 4AY6A 4FLBA 4N3AA 1BI7B 4J8EA 4RVBA 4J8DA 3ZRHA 3LJNA 2UWJG 3FU0A 5ENOD 2XEVA 3Q9NC 4PS8A 1N52A 1EYHA 3TL5A 3B7UX 4GZ5A 4TUUA 2J4DA 4L7TA 4MS6A 1H6KA 1H6OA 4C9BB 3C3OA 3IBEA 3FU5A 5CERB 4GTPA 2J07A 4PS3A 2C2LA 3OTNA 3L17A 3D9MA 4ILIA 2ZGDA 4LCTA 4K0RA 3PUJA 3LYAA 3ZHEA 4DX2A 3FUFA 2ETBA 5DIZA 2R05A 2KCVA 3ULQA 4Z68A 5AN8A 4LERA 1MQSA 1MZCA 4OAUC 1TNYA 3SGHA 3DPYA 3JCKC 2WPVA 1DNPA 4HOSA 3R7RA 4I2WA 1OY3D 3ML8A 4UI9K 3B7RL 4UI9J 4DI3A 5KWDA 4HRLA 2VTBA 3HXFA 2KBXA 4NRHB 4HS2A 3L54A 4UQXA 1AWCB 4JW1A 4IYPA 3NOCD 2PZIA 3FEYA 3UM2A 3C72A 2X6FA 2RG8A 3B7BA 1HXIA 3U3WA 4I43A 4I2ZA 3JXIA 2OOEA 4ACLA 1NI1A 2MHKA 4BTBA 3DRAA 2NYJA 3FTZA 2J9QA 3PH0C 3UUXA 2VSOE 5E76A 3Q7AA 3L13A 3SHFA 3C3QA 5KBAA 4BX8A 4XI9A 3SD5A 4I6JA 2Y0BG 3LS8A 1N11A
chains in the Genus database with same CATH topology
2BEDA 1KZOA 1N95A 3DSTA 2H6GA 3E34A 3DSVA 4GTQA 1O5MA 2H6IA 1TNUA 1TNBA 1JCQA 3SFXA 3DSXA 1SA5A 1MZCA 3SFYA 1TNYA 2R2LA 3KSQA 3DPYA 1TN8A 1FT2A 1S63A 2IEJA 1N94A 1FPPA 4EHMA 1N9AA 1JCRA 1KZPA 4GTVA 3KSLA 3PZ3A 4LNGA 3Q7FA 3EUVA 3HXFA 3Q78A 1O1TA 1TNZA 1N4PA 4L9PA 4YDEA 4GTOA 1TN7A 3PZ4A 1LD7A 1N4QA 1N4SA 3HXCA 1TN6A 3HXEA 3DSSA 3DSWA 3C72A 3E33A 3Q73A 2F0YA 1D8DA 2H6FA 4GTMA 1FT1A 1S64A 1JCSA 3Q75A 1SA4A 3Q79A 4GTRA 1DCEA 1NI1A 2ZISA 4GTSA 1LD8A 4GTTA 2H6HA 1D8EA 3HXBA 3E32A 3PZ2A 1O1RA 2ZIRA 3E37A 4MBGA 1O1SA 3DRAA 3DSUA 3HXDA 1N4RA 1TNOA 3PZ1A 4GTPA 3Q7AA 1QBQA 3E30A 3EU5A 4LNBA 1NL4A 4YDOA 1X81A 1LTXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2BED A;  1KZO A;  1N95 A;  3DST A;  2H6G A;  3E34 A;  3DSV A;  4GTQ A;  1O5M A;  2H6I A;  1TNU A;  1TNB A;  1JCQ A;  3SFX A;  3DSX A;  1SA5 A;  1MZC A;  3SFY A;  1TNY A;  2R2L A;  3KSQ A;  3DPY A;  1TN8 A;  1FT2 A;  1S63 A;  2IEJ A;  1N94 A;  1FPP A;  4EHM A;  1N9A A;  1JCR A;  1KZP A;  4GTV A;  3KSL A;  3PZ3 A;  4LNG A;  3Q7F A;  3EUV A;  3HXF A;  3Q78 A;  1O1T A;  1TNZ A;  1N4P A;  4L9P A;  4YDE A;  4GTO A;  1TN7 A;  3PZ4 A;  1LD7 A;  1N4Q A;  1N4S A;  3HXC A;  1TN6 A;  3HXE A;  3DSS A;  3DSW A;  3C72 A;  3E33 A;  3Q73 A;  2F0Y A;  1D8D A;  2H6F A;  4GTM A;  1FT1 A;  1S64 A;  1JCS A;  3Q75 A;  1SA4 A;  3Q79 A;  4GTR A;  1DCE A;  1NI1 A;  2ZIS A;  4GTS A;  1LD8 A;  4GTT A;  2H6H A;  1D8E A;  3HXB A;  3E32 A;  3PZ2 A;  1O1R A;  2ZIR A;  3E37 A;  4MBG A;  1O1S A;  3DRA A;  3DSU A;  3HXD A;  1N4R A;  1TNO A;  3PZ1 A;  4GTP A;  3Q7A A;  1QBQ A;  3E30 A;  3EU5 A;  4LNB A;  1NL4 A;  4YDO A;  1X81 A;  1LTX A; 
#chains in the Genus database with same CATH topology
 2PQR A;  5B3S E;  3MX3 A;  2I9C A;  4KMO A;  3JUI A;  2V5Q C;  4CT4 A;  4F6R D;  4C0M A;  3AU5 A;  3DSX A;  2CG3 A;  4TXQ A;  3ZYL A;  4N5C A;  5ENQ D;  2KAT A;  3QDN A;  1E7U A;  2MYO A;  5JMN D;  5FZS A;  4TXR A;  4UUC A;  4CYM D;  5CED B;  4CGV A;  4U63 A;  3IKO B;  2A5E A;  4GZD A;  5FJY A;  1TNZ A;  2WXQ A;  4GPK A;  4EPZ A;  2FBN A;  3EIQ C;  1TN7 A;  2P58 C;  3HXE A;  3UPV A;  1BU9 A;  4BT8 A;  4IN3 B;  5LP0 A;  3ABK E;  3Q79 A;  2GRN B;  3ZXS A;  4QQI A;  3B95 A;  4JPS A;  2X6I A;  2ZU6 B;  2P9L G;  3V79 K;  4N39 A;  1O1S A;  1E8W A;  3FU3 A;  3RU0 A;  2V8S E;  1SW6 A;  1DCQ A;  2QYU A;  3I5P A;  2OVB A;  2WQH A;  3AU4 A;  3B7T A;  1NFI E;  3GYZ A;  3QJZ A;  3UKR G;  1E8X A;  2EIL E;  2IU1 A;  1TR4 A;  2EIJ E;  4JHJ A;  2WXI A;  3KS2 A;  5G2N A;  2WXR A;  4GYY A;  4N5Q A;  3U9W A;  4N2Q A;  2H6I A;  4NUR A;  2HR2 A;  2PL2 A;  2V4H C;  4PUC A;  3AS8 A;  3FTU A;  3MZL B;  4U8V D;  5ENR D;  4U0U A;  5KJK A;  3FEX A;  4GYO A;  3UM3 A;  4LNG A;  3L16 A;  1Z3X A;  5CEC B;  3V31 A;  4JHK A;  2LXL A;  3VLF A;  4OAV B;  4AIF A;  3FUI A;  3JYS A;  5D66 A;  3FH8 A;  5CCM A;  2GRL A;  3SI5 A;  2WXM A;  4GPM A;  3CGH A;  4AM9 A;  1SA4 A;  2OCC E;  4HFG A;  2B0O E;  3UIO C;  1NA0 A;  4OYS A;  3QAR A;  1JWF A;  4RSY A;  1MYO A;  2XGS A;  4YND A;  1V54 E;  3CK8 A;  5FQ8 A;  1N4R A;  2WXK A;  4BEP A;  1NA3 A;  3MJW A;  1IHB A;  5ANR A;  5FQ7 A;  4YDO A;  3AG2 E;  4UWG A;  3ASN E;  1EF1 C;  2V4L A;  3LVR E;  2IO3 C;  5D2M C;  4LRZ A;  4W9R A;  2HYZ A;  2GW1 A;  3V2O A;  4A63 B;  4WWO A;  5J90 A;  3CHO A;  2PQN A;  1IYG A;  1TN8 A;  1S63 A;  1Y6I A;  3AG3 E;  3UKU G;  1JWG A;  1KT1 A;  2HO1 A;  2WXN A;  1H2V C;  3CVU A;  3CV0 A;  1H0A A;  5C2Y A;  4J8Y A;  4PS7 A;  2RFM A;  2R03 A;  3R7Q A;  4UI9 C;  4HI9 A;  2DYS E;  4ME2 A;  4M7C A;  3OXF A;  3GZ2 A;  4GB9 A;  3HVE B;  2AXU A;  1TN6 A;  2I1K A;  4XKC A;  4J8F A;  3QAQ A;  1E96 B;  5CCL A;  1HS6 A;  4B94 A;  2I2O A;  5EYP F;  3CVX A;  4G2V A;  2R17 C;  3RK6 A;  3DXK G;  5BXO A;  4I9C A;  4G8L A;  2FI7 A;  3IEG A;  3QNK A;  3UM0 A;  5B1B E;  5G05 J;  1SVX A;  4N2S A;  1D8E A;  4BET A;  4AEZ C;  3E37 A;  3PE3 A;  3C3R A;  2M63 A;  5A23 A;  4HOU A;  3FP3 A;  3Q9U C;  2BKK B;  1TNO A;  2FUL A;  1HO8 A;  1ELW A;  2LO6 A;  3G2T A;  4N3C A;  3EU5 A;  4GZ6 A;  3IHY A;  4UQY A;  3ENE A;  1YA0 A;  3DST A;  5BXU A;  3APD A;  3FUK A;  3DSV A;  3FDH A;  2PNN A;  2L9B A;  2V5F A;  4GZ3 A;  4TRQ A;  2CHZ A;  2WB2 A;  4A1G A;  3QK0 A;  2LXM A;  3FUM A;  4I1A A;  5BV0 A;  4J6I A;  2Y3A A;  2DCP A;  3FHE A;  2ETA A;  4XZ4 A;  4YVO A;  4UWK A;  2WVI A;  5CBN A;  4GA2 A;  4CEM A;  5ENT D;  2XCB A;  4NIK A;  1MHQ A;  3PE4 A;  3MKQ A;  3MGB A;  4OVV A;  2KZT A;  3U64 A;  2P9P G;  4Q96 A;  5FQ4 A;  3CK9 A;  4XKB A;  2CFU A;  3DWL G;  2YNQ A;  1HG5 A;  3EJN A;  2P9S G;  2P9N G;  3PEV B;  3SBT B;  1K8K G;  4DX5 D;  5M72 A;  5FT9 A;  5B1A E;  1EDU A;  1OCO E;  3UT8 A;  2VSY A;  4G25 A;  2AXZ A;  3ISM C;  2BKG A;  3T9K A;  4ATZ D;  2H6H A;  3TWV A;  5JHB A;  1BI8 B;  2QFC A;  4U8Y D;  1HG2 A;  3ABM E;  2KCK A;  2DVW A;  4JVS A;  4K03 A;  3CHM A;  4FJZ A;  2YIN A;  1XGW A;  1IXV A;  1TJC A;  4DRX E;  3HYM B;  4I1M A;  4EQF A;  4EZK A;  3D9H A;  2E2E A;  4MKT A;  5AJD A;  1LTX A;  4G23 A;  4Y6C A;  5LOZ A;  3LCA A;  4DJA A;  2VSN A;  3CVY A;  2CG2 A;  3T5X A;  3CVV A;  5EID A;  4I6E A;  1S0P A;  5BNW A;  5EDS A;  2AW6 A;  3VLE A;  1IHG A;  3FTX A;  2R5S A;  4BES A;  3TWW A;  4JHR A;  1HU3 A;  4AOF A;  3PVL A;  3EUV A;  4JL0 A;  4BER A;  1BLX B;  4U95 D;  4O60 A;  3OXG A;  3APF A;  4EZL A;  3Q73 A;  4DUI A;  1MJ0 A;  3RO2 A;  4WWN A;  2ZIS A;  2FO7 A;  1UJK A;  4JZY A;  3SO8 A;  2VTB B;  3B7S A;  3LDZ A;  3NZS A;  4I17 A;  1HH8 A;  2JEK A;  4CDM A;  1N0R A;  1OWN A;  2F37 A;  5AAR A;  1H2T C;  3RJV A;  4F3V A;  2VQ2 A;  3V30 A;  5KNH D;  2CHW A;  1DC2 A;  3BG0 B;  3FU6 A;  4BTA A;  3AJI A;  4K5B A;  4JD2 G;  4ILG A;  2BED A;  1N95 A;  1UJJ A;  1TEZ A;  4WUY A;  4GYW A;  2WM9 A;  1KT0 A;  5AQ7 A;  3K9I A;  2J8S D;  3EHQ A;  5AEN A;  2WXJ A;  3UMV A;  4ZHB A;  3LY9 A;  4JEH A;  4HNA D;  4L23 A;  2XZD G;  4KZC A;  5KJL A;  1V55 E;  1K1A A;  2XEH A;  4EBA A;  4HBD A;  4UWF A;  2Y4T A;  4PDX A;  4K5C A;  5ENP D;  4GA0 A;  3CSF A;  5G04 J;  5ITZ F;  3U4T A;  4XI0 A;  3ASH A;  2WXG A;  3OAW A;  3D9I A;  3LJ3 A;  4L9P A;  1OT8 A;  5EX0 A;  4FLH A;  4A1S A;  4GTO A;  4FA6 A;  3T5V A;  4CGW A;  2VGE A;  4E85 A;  3E4B A;  2ZXW E;  3E33 A;  1D8D A;  5T4Y A;  3TWX A;  4I6G A;  5AIJ A;  5JJ7 A;  3FUH A;  4EEC A;  3ONK A;  5HQ8 A;  2ETC A;  3ZN3 A;  4G11 A;  1RZ4 A;  3RO3 A;  2DYR E;  2RD0 A;  4C0E A;  2XHE A;  4RG9 A;  3U66 A;  4GTR A;  4V3I A;  2XCC A;  1H19 A;  3CKB A;  3SQV A;  4O1O A;  3PS6 A;  2DZN A;  2Y4U A;  4DLO A;  2Q7F A;  5A7D B;  3FTV A;  1FVH A;  3L08 A;  2GRR B;  3Q5M A;  4G26 A;  2IOL A;  1KLX A;  5DBK A;  3HVE A;  4DLQ A;  1NL4 A;  1K3Z D;  4ANW A;  3CVL A;  5LCW C;  3T8M A;  1LF8 A;  3LY8 A;  3V2X A;  1X5B A;  1BD8 A;  3IV0 A;  2VGX B;  3TWQ A;  3IHV A;  4FP7 A;  3J5P A;  3CR3 A;  4HRM B;  3GW4 A;  3TWS A;  2RKK A;  1N9A A;  1JCR A;  3QKY A;  4HQD A;  4MRU A;  1YCS B;  3SBS A;  3BUA A;  2YQ8 A;  3EHN A;  1AP7 A;  1N4P A;  3UQ3 A;  3ASG A;  1ELK A;  5ARG A;  1OUV A;  1LD7 A;  4HLL A;  4I1O B;  3ZHE B;  5D0Q D;  5JJT A;  1K1B A;  4FAD A;  4CDR A;  4CCA A;  1S70 B;  3UT4 A;  4WNG A;  5CMW A;  4E6H A;  1QQE A;  2JLB A;  4J7W A;  5AQ9 A;  1SZA A;  1E8Z A;  2NXP A;  2X6H A;  4F1P A;  1WG0 A;  5T8I A;  2ZIR A;  2GRP B;  2LAH A;  4BWR A;  3NQP A;  4ACK A;  5JA4 D;  3L22 A;  3PUK A;  2QYJ A;  4EBA G;  2ILR A;  3W9G A;  2XGM A;  3O4Z A;  2EIK E;  2OND A;  3AG1 E;  2WQ6 A;  1Z5S C;  5KJN A;  3RAU A;  3D9J A;  5G55 A;  4F1S A;  1JPL A;  1TNU A;  1VDY A;  1JCQ A;  4HRN A;  2ZGG A;  5HI7 A;  4FJY A;  1Z6T A;  4OVU A;  3CVN A;  4EZJ A;  3SFY A;  2J08 A;  2R2L A;  2OV8 A;  1B89 A;  1FT2 A;  4JB8 P;  4B93 B;  3ABL E;  3PZ3 A;  3AS4 A;  2IOS A;  3Q78 A;  4O6F A;  4H7X A;  4BT9 A;  3CQG B;  4WNF A;  4GZC A;  3ASD A;  3AS5 A;  1IQR A;  3APC A;  3QOU A;  2UY1 B;  4HLE A;  2WMO A;  5AAO A;  3DEP A;  2F0Y A;  2H6F A;  3NAW A;  4XE0 A;  1FT1 A;  2WXO A;  1JCS A;  5JJ6 A;  2R02 A;  3VTX A;  3DXM G;  3I4G A;  3MV2 B;  3Q4A B;  1U3D A;  5ARF A;  3BQO A;  1OCR E;  1E90 A;  2F8Y A;  3LVQ E;  2XPZ A;  2FF4 A;  4NQ0 A;  4U04 A;  3NB2 A;  5IY5 E;  1O1R A;  4B8C B;  3CVW A;  3R9M A;  3CLJ A;  4Q94 A;  3ESK A;  4FHK A;  4I9E A;  2QZA A;  3QWW A;  3BEE A;  3SF4 A;  4KT6 B;  3ZVV A;  4G8K A;  4JXT A;  3ASO E;  4X8Q A;  3FY4 A;  3JUE A;  4LNB A;  2LSV A;  2BUG A;  1NP7 A;  1SZ9 A;  1OCZ E;  3EU9 A;  3HG0 D;  4UQZ A;  3X2Q E;  2EIM E;  3G2V A;  5ENS D;  3LXU X;  3KSQ A;  1OWM A;  5HRY A;  3FUN A;  4BY6 A;  3GZS A;  2R59 A;  1UN9 A;  2WXP A;  3TXM A;  4JC8 A;  1QYM A;  4R7L A;  4ZFH A;  2J4B A;  2WQ7 A;  1E7V A;  5HKP A;  3MA5 A;  3MEK A;  4APO A;  5ENN A;  3EHM A;  2JAB A;  4DPR A;  2WXF A;  4D10 C;  3D9N A;  4U96 D;  1N4Q A;  4CT0 A;  2PM7 A;  3HRA A;  3DSS A;  3HIZ A;  3CST A;  4U7E B;  2FO1 E;  2EIN E;  3UX4 A;  4DI4 A;  4GTM A;  1S64 A;  4ILH B;  2P9U G;  3D9O A;  3LPZ A;  2DZO A;  3TWU A;  2AWI A;  1U2V G;  2DIW A;  2CHX A;  3F6Q A;  4GTS A;  3UXG A;  4LSZ E;  4AV7 A;  4ANX A;  4U07 A;  5KNG A;  2GGF A;  2OVF A;  4A3T A;  1W3B A;  4YDY A;  2MRI A;  3BU8 A;  3I3N A;  1L5J A;  3ASF A;  5EN5 D;  3ZFW A;  3KEA A;  3EIJ A;  1Z3Y A;  3MKQ B;  2I6H A;  2LSU A;  5LCW J;  1BPO A;  4DX1 A;  2DWZ A;  3IXE A;  1IQU A;  3C98 A;  3RSE G;  5CRV A;  4BSX A;  2IJG X;  3NF1 A;  2BTD A;  3DPD A;  5BPP A;  4L2L A;  3CKC A;  4RLY A;  2WXL A;  3PRZ A;  3LEW A;  3EDT B;  2V0P A;  3GZ1 A;  3KSL A;  3CHR A;  3HHM A;  3AAA C;  2QC9 A;  4G24 A;  3ESL A;  4FC8 A;  4HI8 A;  2KZT B;  3ZIM A;  3FFL A;  4N3B A;  3RRU A;  3PNT B;  4YVQ C;  5FQ6 A;  3S2A A;  1QZ2 A;  5D0O D;  3PNL B;  3PDN A;  3ZKJ A;  2GRO B;  1KPS B;  1XNF A;  3LY7 A;  4CDN A;  4WWP A;  2X6K A;  3DSU A;  2GRQ B;  5BW8 C;  1ELR A;  3HXD A;  5AQB A;  1NZN A;  3CVQ A;  3P1U A;  4LEU A;  3I4R B;  2AVP A;  3TXN A;  5CMY A;  1HE8 A;  3E34 A;  3ZW3 A;  4GAA A;  4AY5 A;  4KZ0 A;  3TG5 A;  4TV3 A;  3AG4 E;  4MLP A;  4ANV A;  2XS1 A;  3LKU A;  2IF4 A;  1ZU2 A;  4JA9 A;  2KCL A;  2I1J A;  4ATG A;  1WAO 1;  1N94 A;  5G04 C;  3SNX A;  3URZ A;  4EHM A;  3N71 A;  1U3C A;  2VGY A;  4GCO A;  1UW4 B;  4HVB A;  3CK7 A;  1P5Q A;  5CHE E;  2F8X K;  1N0Q A;  1O1T A;  3O48 A;  5CRU A;  3UI2 A;  3ZXP A;  2VYI A;  4APF A;  3NBN B;  1N4S A;  2X3M A;  2J49 A;  1OWP A;  3FTW A;  3QWP A;  4Q69 A;  3WXX A;  5EIB E;  5FIN A;  5LFA A;  3FTY A;  4KVO A;  3UIN C;  3Q75 A;  2OEV A;  3KAE A;  3PEU B;  3KEZ A;  4CZ2 D;  3G2S A;  3ZYQ A;  4AJW A;  1MX4 A;  5EKQ D;  3VLD A;  2AJA A;  1QNF A;  5G05 C;  1UOH A;  3E32 A;  4O1P A;  2P2C P;  2XGO A;  4XEI G;  4ABN A;  3CHQ A;  2LAI A;  2YHE A;  4FUL A;  5EIL A;  3S7B A;  4AVX A;  3R9A B;  1A5E A;  5KJM A;  4AXH A;  2VSX E;  5EX3 A;  4LNU D;  3ZEF A;  3SFZ A;  4UWH A;  4GTQ A;  1O5M A;  1OWL A;  3RKV A;  3CIA A;  4WNE A;  3MKR A;  1SA5 A;  5E75 A;  3MYV A;  3CEQ A;  3FUJ A;  1MX2 A;  4L2Y A;  1SQM A;  2LUH A;  1INZ A;  3FUL A;  4HXI A;  4KXK B;  3QB2 A;  1KZP A;  4F53 A;  3CHP A;  3FH7 A;  3D9K A;  3ZUV B;  1H2U A;  2LNI A;  2KM4 A;  3VTY A;  3CQC B;  1OXJ A;  4DX6 D;  1HX8 A;  3RRM B;  1JUQ A;  4AP2 A;  1FVF A;  3UIP C;  1HZ4 A;  3CHS A;  4M3O A;  3FUE A;  5CBO A;  3CVP A;  1OWO A;  4C48 B;  1HFA A;  5EYL A;  3PZD A;  2EQX A;  4U0S A;  2XS8 A;  2IFU A;  1DCE A;  3ZPJ A;  3MCX A;  4GU5 A;  1LD8 A;  5FIO A;  2QY7 A;  4ANU A;  3PZ2 A;  2BF0 X;  2Y69 E;  3D9L A;  3W9F A;  4A55 A;  3QC1 A;  2KXP C;  5J08 A;  1DVP A;  3TJP A;  2XRZ A;  4HB5 A;  4RG6 A;  3PZ1 A;  4XIF A;  3S7F A;  1G3N B;  1QBQ A;  2XEE A;  4GMJ A;  2IY0 C;  1RW2 A;  1ZBP A;  4BSZ B;  1X81 A;  2L6J A;  2AXV A;  4RQI A;  1HF8 A;  1EPU A;  4DX7 D;  2P9I G;  1WDY A;  2KC7 A;  1GW6 A;  1TNB A;  4JEU A;  3MV3 B;  2UY1 A;  2CFZ A;  4L1B A;  3ZYM A;  3FUD A;  4IRU A;  3UTM A;  3ZGQ A;  3Q47 B;  5HS0 A;  3P2B A;  5BT1 A;  4U8H A;  1FPP A;  4IUL A;  4P29 A;  5AQA A;  4BFR A;  2XPI A;  2XEN A;  3ZU7 B;  5ANL A;  3QWV A;  4TXP A;  3TAX A;  5JHA A;  2DBA A;  3S7D A;  4Y6W A;  1YMP A;  1FCH A;  2L0I A;  3DSW A;  3DEO A;  3PRE A;  1YYH A;  4XX5 A;  3B13 A;  3UM1 A;  2J09 A;  3JXJ A;  3ZNG A;  4BX9 A;  4WAF A;  5AYW D;  1A17 A;  3FWV A;  3BG1 B;  5BV1 A;  4GTT A;  3TG4 A;  5FZQ A;  1D9S A;  2P9K G;  4FHJ A;  1Y8M A;  3Q15 A;  5KCM A;  4U0Z A;  3SZ7 A;  5C1D A;  2E0I A;  2FEZ A;  5FZR A;  1ZB1 A;  4LUN U;  1E8Y A;  3KD7 A;  4GA1 A;  2HM8 A;  3FTS A;  3EHR A;  2X38 A;  5AJL A;  2C0L A;  3TGO A;  4UWL A;  3S7J A;  4NAC A;  1OCC E;  3E30 A;  4K5A B;  3ULE G;  2VGX A;  3C5R A;  2H6G A;  1WY6 A;  1WM5 A;  1PC2 A;  5T3R A;  3WG7 E;  2A5U A;  3SFX A;  2L0T B;  3OXL A;  4TUM A;  3G2W A;  3JQ0 A;  1MX6 A;  1UN8 A;  2WXH A;  4J0U A;  4HOT A;  2HE0 A;  1PY1 A;  3D9P A;  3ZYK A;  2B6C A;  2IEJ A;  4HOQ A;  4B0Z A;  3RIB A;  2C0M A;  3DBS A;  4GTV A;  4B8A A;  2WMN A;  4URK A;  3Q7F A;  4GML A;  2GRM A;  3HDX A;  4DK5 A;  3NZU A;  2Y1L E;  2MOW A;  3ONL A;  2VJ8 A;  3D3M A;  5CEA A;  1H6P A;  1PAQ A;  3PZ4 A;  5A6C A;  2ION A;  4A3V A;  3HXC A;  1Q2Z A;  2YHC A;  3SY2 A;  4FU3 A;  4KYO B;  2NSZ A;  1TYQ G;  4B89 A;  4KVM A;  4H7Y A;  2XZT G;  4GMR A;  2A4Z A;  4KBQ A;  4WND A;  1UG3 A;  4HOR A;  4PH4 B;  3FH5 A;  3HXB A;  3Q49 B;  4QFV A;  2OEW A;  1TJF A;  2XPY A;  4YDW A;  4MBG A;  1N54 A;  3T8K A;  3UT7 A;  2X6J A;  3JQ1 A;  2IQC A;  2PM6 A;  4J8S A;  2IO2 C;  3L82 A;  1KZO A;  3L6A A;  3J5Q B;  5FTP A;  2XQ0 A;  2L6B A;  3G2U A;  4JA7 A;  3RRN B;  4G1T A;  3TWT A;  5LX8 A;  5H7P A;  4LG6 A;  2XRY A;  4GCN A;  3NOG D;  1IKN D;  2RFA A;  5FWQ A;  3ML9 A;  2NC9 A;  4CRW A;  4F7A A;  5BUZ A;  3TWR A;  3ULY A;  3L9T A;  4YDE A;  4AY6 A;  4FLB A;  4N3A A;  1BI7 B;  4J8E A;  4RVB A;  4J8D A;  3ZRH A;  3LJN A;  2UWJ G;  3FU0 A;  5ENO D;  2XEV A;  3Q9N C;  4PS8 A;  1N52 A;  1EYH A;  3TL5 A;  3B7U X;  4GZ5 A;  4TUU A;  2J4D A;  4L7T A;  4MS6 A;  1H6K A;  1H6O A;  4C9B B;  3C3O A;  3IBE A;  3FU5 A;  5CER B;  4GTP A;  2J07 A;  4PS3 A;  2C2L A;  3OTN A;  3L17 A;  3D9M A;  4ILI A;  2ZGD A;  4LCT A;  4K0R A;  3PUJ A;  3LYA A;  3ZHE A;  4DX2 A;  3FUF A;  2ETB A;  5DIZ A;  2R05 A;  2KCV A;  3ULQ A;  4Z68 A;  5AN8 A;  4LER A;  1MQS A;  1MZC A;  4OAU C;  1TNY A;  3SGH A;  3DPY A;  3JCK C;  2WPV A;  1DNP A;  4HOS A;  3R7R A;  4I2W A;  1OY3 D;  3ML8 A;  4UI9 K;  3B7R L;  4UI9 J;  4DI3 A;  5KWD A;  4HRL A;  2VTB A;  3HXF A;  2KBX A;  4NRH B;  4HS2 A;  3L54 A;  4UQX A;  1AWC B;  4JW1 A;  4IYP A;  3NOC D;  2PZI A;  3FEY A;  3UM2 A;  3C72 A;  2X6F A;  2RG8 A;  3B7B A;  1HXI A;  3U3W A;  4I43 A;  4I2Z A;  3JXI A;  2OOE A;  4ACL A;  1NI1 A;  2MHK A;  4BTB A;  3DRA A;  2NYJ A;  3FTZ A;  2J9Q A;  3PH0 C;  3UUX A;  2VSO E;  5E76 A;  3Q7A A;  3L13 A;  3SHF A;  3C3Q A;  5KBA A;  4BX8 A;  4XI9 A;  3SD5 A;  4I6J A;  2Y0B G;  3LS8 A;  1N11 A; 
#chains in the Genus database with same CATH homology
 2BED A;  1KZO A;  1N95 A;  3DST A;  2H6G A;  3E34 A;  3DSV A;  4GTQ A;  1O5M A;  2H6I A;  1TNU A;  1TNB A;  1JCQ A;  3SFX A;  3DSX A;  1SA5 A;  1MZC A;  3SFY A;  1TNY A;  2R2L A;  3KSQ A;  3DPY A;  1TN8 A;  1FT2 A;  1S63 A;  2IEJ A;  1N94 A;  1FPP A;  4EHM A;  1N9A A;  1JCR A;  1KZP A;  4GTV A;  3KSL A;  3PZ3 A;  4LNG A;  3Q7F A;  3EUV A;  3HXF A;  3Q78 A;  1O1T A;  1TNZ A;  1N4P A;  4L9P A;  4YDE A;  4GTO A;  1TN7 A;  3PZ4 A;  1LD7 A;  1N4Q A;  1N4S A;  3HXC A;  1TN6 A;  3HXE A;  3DSS A;  3DSW A;  3C72 A;  3E33 A;  3Q73 A;  2F0Y A;  1D8D A;  2H6F A;  4GTM A;  1FT1 A;  1S64 A;  1JCS A;  3Q75 A;  1SA4 A;  3Q79 A;  4GTR A;  1DCE A;  1NI1 A;  2ZIS A;  4GTS A;  1LD8 A;  4GTT A;  2H6H A;  1D8E A;  3HXB A;  3E32 A;  3PZ2 A;  1O1R A;  2ZIR A;  3E37 A;  4MBG A;  1O1S A;  3DRA A;  3DSU A;  3HXD A;  1N4R A;  1TNO A;  3PZ1 A;  4GTP A;  3Q7A A;  1QBQ A;  3E30 A;  3EU5 A;  4LNB A;  1NL4 A;  4YDO A;  1X81 A;  1LTX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...