2H6HA

Y365f protein farnesyltransferase mutant complexed with a farnesylated ddptasacvls peptide product at 1.8a
Total Genus 133
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
133
sequence length
315
structure length
315
Chain Sequence
b'FVSLDSPSYVLYRDRAEWADIDPVPQNDGPNPVVQIIYSDKFRDVYDYFRAVLQRDERSERAFKLTRDAIELNAANYTVWHFRRVLLKSLQKDLHEEMNYITAIIEEQPKNYQVWHHRRVLVEWLRDPSQELEFIADILNQDAKNYHAWQHRQWVIQEFKLWDNELQYVDQLLKEDVRNNSVWNQRYFVISNTTGYNDRAVLEREVQYTLEMIKLVPHNESAWNYLKGILQDRGLSKYPNLLNQLLDLQPSHSSPYLIAFLVDIYEDMLENQCDNKEDILNKALELCEILAKEKDTIRKEYWRYIGRSLQSKHST'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protein farnesyltransferase/geranylgeranyltransferase type I
publication title Conversion of protein farnesyltransferase to a geranylgeranyltransferase.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 133
structure length 315
sequence length 315
ec nomenclature ec 2.5.1.58: Protein farnesyltransferase.
pdb deposition date 2006-05-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01239 PPTA Protein prenyltransferase alpha subunit repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.120 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Protein prenylyltransferase 2h6hA00
1LD7A 3C72A 3Q73A 1QBQA 3KSQA 1TNOA 2F0YA 1JCSA 3DSXA 4GTTA 1N95A 1KZOA 1S64A 1DCEA 4YDOA 1KZPA 1N4QA 2H6GA 1FT2A 3DRAA 4YDEA 1JCRA 3EU5A 1FPPA 4GTMA 3DSTA 4LNBA 3DSSA 3HXBA 4LNGA 3DSUA 2ZIRA 2ZISA 1N9AA 4L9PA 1LD8A 1FT1A 3E33A 1LTXA 3HXDA 2BEDA 1N4PA 4GTQA 3KSLA 3Q75A 3Q7FA 3Q7AA 1TNYA 4EHMA 3HXEA 3EUVA 2H6IA 1SA4A 2H6HA 3PZ2A 3DPYA 4MBGA 1O1SA 1SA5A 3SFXA 1TN7A 3HXCA 1D8EA 1TN8A 3SFYA 1JCQA 1N4SA 1TN6A 4GTRA 4GTVA 4GTSA 4GTPA 3PZ1A 2R2LA 3DSVA 1TNUA 3HXFA 2IEJA 3Q78A 1N4RA 3E30A 1NI1A 3PZ4A 1MZCA 1TNBA 1X81A 3E34A 3Q79A 1O1RA 1O5MA 1S63A 3DSWA 3PZ3A 1NL4A 1N94A 1O1TA 1D8DA 2H6FA 3E37A 1TNZA 3E32A 4GTOA
chains in the Genus database with same CATH superfamily
5KCMA 1K1BA 3W9FA 3KS2A 1SW6A 2F37A 3UQ3A 3RO2A 2VSYA 4E85A 4DLQA 4UUCA 3C3RA 5FQ6A 3G2TA 3EU5A 3VTYA 4GB9A 3CVPA 5AN8A 2GRRB 4GTMA 4A55A 4G1TA 2V4HC 3CVYA 2XCCA 3EHQA 3CLJA 4D10C 4U8YD 2LNIA 5DBKA 3ZIMA 3EHMA 4G23A 3C3QA 5AAOA 3UPVA 3RIBA 4U04A 4GZDA 3SHFA 2JEKA 2PNNA 3CEQA 4YVQC 4GTRA 3L16A 3TG4A 4KZCA 4N2SA 1HG5A 2VJ8A 3FP3A 5ENSD 3T8KA 1KPSB 3PE4A 5D2MC 4C9BB 3PZ4A 1MZCA 4B8AA 4RLYA 4I9CA 4WNEA 5CBNA 3NAWA 5FJYA 4EZJA 2EIJE 4HB5A 3Q73A 3FTVA 4TUMA 4UWGA 3CK7A 4GYWA 5G2NA 4A63B 4EQFA 3FTZA 1NA3A 3NZUA 5AJDA 3ISMC 5BV1A 3B95A 4Y6CA 4O1PA 3X2QE 2E2EA 4Z68A 5BW8C 2BUGA 4R7LA 2DIWA 1OUVA 4GMLA 4HLLA 4HBDA 3CIAA 1UJKA 3MX3A 3OAWA 4L9PA 3NBNB 2IOSA 2PQRA 2WB2A 3NZSA 5G04J 2FBNA 4K03A 4Q96A 4G11A 3MKQB 4JB8P 4OVUA 3SFXA 3IV0A 1TJFA 3OXGA 3CHPA 4LRZA 3FDHA 4JEHA 2WXPA 3DPDA 4PH4B 2B0OE 1EF1C 1OCOE 3ABKE 3ASNE 4XI0A 4J8DA 4CEMA 3PE3A 4CT4A 2KZTB 5LFAA 2F8XK 1HU3A 3MKRA 1H6KA 4ANUA 1X81A 3FU5A 3U4TA 1S63A 5LOZA 3Q5MA 5FQ4A 3SD5A 2H6FA 5ARGA 3GZ2A 5HRYA 4QFVA 4K5CA 4XE0A 4APFA 3TWQA 5JHBA 3NOCD 2VTBA 3AS4A 4B89A 1PC2A 3SGHA 1N95A 3LDZA 3ULQA 2IY0C 4YDOA 3U66A 2FO1E 3DRAA 2HE0A 2WPVA 4F6RD 1FPPA 3BG0B 2CG3A 2AVPA 1MHQA 2QC9A 1N9AA 2VGYA 2CHXA 3RJVA 1LD8A 5AQ9A 1OWLA 5G05C 2V5QC 3KSLA 4U8HA 1TNYA 3V79K 5FZSA 3R9AB 3LVQE 1BI7B 2L0TB 1JPLA 2PM6A 1TN6A 2L6JA 4F1PA 3PVLA 4EBAA 4K5BA 1H2VC 3SO8A 2R05A 4BFRA 2IU1A 1MX2A 4A1SA 4G26A 2P9IG 3ASGA 2J4BA 4CDRA 1TNBA 3J5PA 1PY1A 3Q79A 2VYIA 2OEVA 4JA9A 3TWTA 3RSEG 1IQUA 5FINA 2XEVA 3Q47B 4I6GA 1D8DA 4OVVA 5BT1A 1FVHA 1K8KG 1N0RA 4ABNA 2DCPA 4NIKA 5KNHD 3APFA 5BV0A 1HXIA 3AAAC 3FEYA 1Z5SC 3VLFA 4L2LA 4AOFA 3AS8A 4KBQA 3IHVA 2R59A 1ZB1A 3BQOA 5AENA 4YDEA 1JCRA 3Q9NC 2DWZA 3PNLB 4U0ZA 1KT0A 4KMOA 3B7TA 3HXBA 3LS8A 4GA2A 5BXOA 3FEXA 3GZSA 2X38A 4GA1A 3CVUA 4P29A 5JJ7A 3APDA 2RD0A 3CHOA 2BEDA 2YHEA 2LSUA 5ANLA 1E8WA 3CVXA 2KCKA 3DPYA 4I1AA 4YDWA 4HRNA 5A6CA 1O1SA 2X6KA 4O6FA 3FY4A 5M72A 2HO1A 2WXRA 4WWOA 4YNDA 3Q49B 1N4SA 2KM4A 2MYOA 3UM3A 4MS6A 3TXMA 3EIQC 1DCQA 2R2LA 2BKKB 3JCKC 2EQXA 3DEPA 2LAHA 2OCCE 4EZLA 1DNPA 1E8XA 1IQRA 1BLXB 1MX4A 5ENNA 4ATZD 3ZNGA 4U0UA 5ENOD 3DEOA 1K3ZD 4DLOA 3HXCA 3L17A 2BKGA 2GRQB 4MRUA 2XHEA 3OTNA 3LY7A 5A7DB 3D9JA 4G25A 1UJJA 4HOTA 2XQ0A 4GMRA 1IXVA 4AY6A 3D9PA 3ZKJA 2WVIA 4JA7A 2XGMA 3ABLE 4QQIA 3DXMG 4F1SA 3ZFWA 3UT7A 4HNAD 1SZ9A 4ME2A 2LXLA 5FIOA 3CK9A 1FT1A 3OXFA 2P2CP 4LUNU 4FADA 4ANVA 3HXEA 3TL5A 5J90A 4YDYA 3RRUA 4J7WA 5B1AE 2WXMA 2WM9A 1HO8A 5FQ8A 2ZGGA 3MZLB 3J5QB 4KVOA 2EIKE 4FJZA 2J08A 3U64A 4HFGA 1WAO1 3TXNA 1ELRA 4X8QA 3V2XA 1E90A 2IEJA 4BEPA 3O48A 3ASHA 4K0RA 2CG2A 3E30A 1DVPA 4E6HA 3PUKA 3ZYLA 2NC9A 2YNQA 1NA0A 4BESA 4ZFHA 4KVMA 4OAVB 4N3BA 4XX5A 3JUEA 3ULYA 4PUCA 4BX9A 2HR2A 2F8YA 3KSQA 5ARFA 3Q4AB 3UKRG 4GZ3A 3LJ3A 3D9KA 3FH7A 5CBOA 4F7AA 2VSNA 2BF0X 1FT2A 3TJPA 2XENA 5CEDB 4AVXA 4FLBA 2QY7A 3BEEA 3MV3B 2LUHA 3AG1E 5HQ8A 1MYOA 1UN8A 1OXJA 2PZIA 5AQBA 2L0IA 1WDYA 3LXUX 3B13A 3RKVA 3PZ2A 1QNFA 4Y6WA 3QC1A 5JA4D 1TN7A 4BTAA 3P2BA 1HZ4A 3ZXPA 2C0MA 1MQSA 2J07A 3L13A 4JD2G 5ENQD 3U9WA 1N11A 1ELKA 4UQXA 5C2YA 5KJLA 4XKBA 3R9MA 1ELWA 3TAXA 3HYMB 3MCXA 4IN3B 4GCOA 4JHRA 3T8MA 5AJLA 3CV0A 2MRIA 3LEWA 3DSWA 1U2VG 1OWPA 1N94A 3CHRA 3UINC 4H7YA 1H19A 3MYVA 4DX6D 2DVWA 1IYGA 3LKUA 1H2TC 4JHJA 2I6HA 3FUKA 2OOEA 5EDSA 4DRXE 2F0YA 3DSXA 2L6BA 3L08A 4J0UA 1KZPA 3L9TA 4ILGA 3FTYA 3PS6A 1N54A 2VGXB 4BX8A 3EJNA 2CFZA 4WNFA 4ILIA 3AG2E 3CKBA 2WXGA 2VGEA 3ENEA 1AP7A 2ETAA 4N5CA 2C2LA 4NURA 1LTXA 3ABME 5CMWA 2LO6A 3AG4E 2R5SA 3EUVA 3ONKA 5CECB 2H6HA 3KAEA 2J49A 4DX1A 1OT8A 1SA5A 1H6PA 4ACKA 2X6IA 2WMNA 3FUNA 4RSYA 3SFYA 5CCLA 2B6CA 2HM8A 5E76A 3DBSA 4LCTA 3DSVA 5G05J 4HRLA 4TRQA 1TNUA 4BT9A 5EYPF 3R7QA 3WXXA 4WUYA 1Y8MA 5H7PA 4LNUD 4BSZB 1O1TA 3HHMA 1OWMA 4TUUA 5LCWJ 3CK8A 4F53A 2V8SE 2DZOA 1LD7A 4I6JA 3FU6A 1S70B 4HLEA 4AV7A 1UW4B 2GGFA 5KJKA 5C1DA 2J8SD 1N4QA 4GPKA 4OYSA 1MJ0A 3O4ZA 3PREA 4AY5A 2XS8A 2CHWA 5ANRA 4Q69A 2WXJA 4BSXA 2I1JA 3QOUA 1ZU2A 4TXQA 5D0QD 3BG1B 3ZUVB 3RK6A 4CGVA 3QNKA 3FU3A 2R03A 4DX2A 5JJ6A 3FU0A 1HS6A 1L5JA 1E8ZA 2JLBA 3PDNA 4J8EA 3IXEA 3KEAA 4UWKA 4CGWA 1HH8A 4V3IA 4XZ4A 2GROB 4MBGA 1UG3A 2OVFA 1S0PA 3LPZA 2XEHA 3ZYKA 1D8EA 3SI5A 1IHBA 3MEKA 4L2YA 4UWHA 4EPZA 4TV3A 1Z3XA 1E7VA 1MX6A 1TEZA 3JQ1A 4CRWA 4PDXA 1IKND 3PEUB 3CVVA 4HOUA 2ZXWE 1SQMA 3E34A 2WQHA 4LEUA 3TWRA 3T9KA 2FI7A 1HX8A 5AYWD 3D9MA 1WM5A 3FUHA 3ML9A 3RU0A 3QWVA 3FTWA 4Q94A 3Q9UC 3UIOC 4FA6A 3D9HA 1EYHA 4UI9K 1V55E 5AARA 3IEGA 2QYJA 2A5UA 2KC7A 5BNWA 2Y1LE 4MLPA 3D3MA 1KT1A 2J9QA 4HI9A 1P5QA 5EILA 1TYQG 3S7DA 2X6FA 4JC8A 1QQEA 3CSTA 2DYRE 2Y0BG 2XRZA 3SQVA 4CZ2D 3HXDA 1H2UA 5EIDA 2FF4A 5FZRA 4C0EA 4EHMA 4B94A 2IO2C 4CDNA 1UN9A 2KCVA 3EDTB 4UWLA 3URZA 2XZTG 2AXVA 4YVOA 4WAFA 3ZYMA 2PL2A 4GA0A 3C98A 2ETCA 4KXKB 5EN5D 1TN8A 2NYJA 2YHCA 1V54E 3FTXA 4U95D 2UWJG 1YCSB 1Y6IA 3ASFA 4XIFA 3RAUA 4JVSA 4DI3A 3UMVA 2YINA 4I17A 3V31A 2XRYA 4C0MA 3Q78A 1N4RA 4AIFA 3ML8A 5CEAA 3I5PA 2ILRA 4LERA 1AWCB 3CKCA 3CSFA 4N3CA 2AWIA 3E37A 3HIZA 5JHAA 2J4DA 4AP2A 1W3BA 1HG2A 4O60A 4B0ZA 4BT8A 3SZ7A 2WMOA 4HRMB 2DZNA 4DX7D 1E96B 1HE8A 4GMJA 3FUEA 4UQZA 3ONLA 5LX8A 4ZHBA 3E4BA 2X6HA 2AXZA 3TG5A 4AM9A 4F3VA 1FVFA 2WXKA 3E33A 2Y4TA 4GZ6A 2LSVA 5B3SE 3DXKG 1OWOA 4I2WA 4B93B 2H6IA 2Y3AA 3ASDA 5HKPA 4BERA 2WXQA 5BUZA 5E75A 2XGSA 3LVRE 3RRNB 4FHKA 3APCA 1QZ2A 3EU9A 4I1MA 3AU4A 2NSZA 1D9SA 2IFUA 5HI7A 3CQGB 5DIZA 3R7RA 3G2UA 3S7JA 4UQYA 3VLEA 3UUXA 5T3RA 3EHRA 2QZAA 4JL0A 2P9LG 5KBAA 1PAQA 2GRMA 1U3DA 3UM2A 4FC8A 1HF8A 4L23A 2AXUA 3E32A 3VTXA 2GRPB 4M3OA 1N0QA 3C72A 1QBQA 2FO7A 2IONA 3SNXA 1S64A 2H6GA 2RKKA 2XPIA 3MA5A 1OWNA 3QK0A 5CMYA 1Z6TA 4K5AB 4GZ5A 1EPUA 2XPYA 3B7RL 5EIBE 4I9EA 1G3NB 5FQ7A 3QJZA 3SY2A 4I2ZA 4U63A 3Q7AA 2IQCA 3C5RA 3ZHEB 2X3MA 4WWNA 2AJAA 3PH0C 4U8VD 2VGXA 4HI8A 3GZ1A 3HVEB 3ZVVA 2ZGDA 3N71A 1X5BA 3IKOB 1E7UA 3NOGD 3S7BA 3CR3A 3FWVA 2V5FA 3HXFA 3D9IA 4ANWA 3FUJA 1NI1A 2CHZA 4C48B 1N52A 4W9RA 3FTSA 3AG3E 3F6QA 3PZ3A 5FT9A 3CHSA 1B89A 2UY1B 2XZDG 1TNZA 3BU8A 2I2OA 1JWGA 4APOA 1RZ4A 2WQ6A 1OCCE 3ULEG 4IYPA 4G24A 4J8YA 3UKUG 3SBTB 3BUAA 3JXIA 3MGBA 5HS0A 5CHEE 4IULA 5IY5E 3MKQA 3DWLG 3PZDA 3B7SA 2RFMA 2NXPA 4ILHB 4UI9C 5T8IA 4DK5A 3DSTA 4U07A 4HXIA 3ESLA 4TXRA 2ZIRA 2ZISA 4H7XA 3S2AA 2WXFA 2XCBA 2KZTA 2ZU6B 4LSZE 4GTQA 5JMND 5A23A 4J8FA 4RVBA 4HVBA 4AXHA 3ZRHA 3MV2B 4CDMA 3CGHA 2C0LA 2L9BA 3FFLA 4O1OA 3HRAA 4A1GA 4WWPA 1YA0A 4XKCA 1JCQA 4G2VA 2Y4UA 3P1UA 3ZU7B 4GTVA 2WXHA 2ETBA 1LF8A 2A4ZA 1Q2ZA 2P9SG 3UIPC 3KD7A 3NQPA 3TWSA 4DJAA 2Q7FA 2ONDA 4A3TA 3UM1A 3TWUA 4HS2A 4G8LA 4PS3A 4AEZC 3W9GA 5FZQA 2RFAA 3OXLA 4GYOA 4U7EB 2XGOA 2FEZA 4ATGA 4HOQA 2MOWA 3ZEFA 2HYZA 3TGOA 2R17C 1NZNA 5LP0A 3FHEA 3QAQA 1H0AA 2P9KG 3CVNA 3WG7E 2Y69E 1UOHA 2IOLA 3ZPJA 4DPRA 3AJIA 4EZKA 4KT6B 3LYAA 2WXLA 4LNBA 3EIJA 1A17A 2VSXE 3DSSA 4L7TA 3ZW3A 2I1KA 2YQ8A 3D9NA 5JJTA 3LJNA 4A3VA 4J8SA 3FTUA 5CCMA 5B1BE 3ZN3A 5D66A 2XEEA 1E8YA 3I4GA 3G2SA 4JEUA 5AIJA 3FUMA 4U96D 2XPZA 2FULA 1K1AA 4CYMD 2EILE 2WXOA 1SVXA 2P9UG 4XEIG 1OCZE 2AW6A 3QARA 4JW1A 1NFIE 5D0OD 3QB2A 1SZAA 5AQ7A 2GRLA 2OV8A 3B7BA 3KEZA 1JWFA 5AQAA 3TWVA 1ZBPA 4EBAG 1RW2A 3LY8A 3Q15A 4EECA 1NL4A 3RRMB 2KCLA 1INZA 4B8CB 4XI9A 1BD8A 4N2QA 3C3OA 4GAAA 3UXGA 1HFAA 1WY6A 4I6EA 3NB2A 1JCSA 4DX5D 3PNTB 4GTTA 5G04C 3GW4A 1JUQA 5ENRD 5ENTD 4FU3A 5CRUA 2KXPC 3V30A 4N39A 2IJGX 3SF4A 3UTMA 3D9LA 3DSUA 3NF1A 3PUJA 5LCWC 3IHYA 1YMPA 4WNGA 2KATA 4MKTA 2PQNA 1N4PA 5EKQD 5T4YA 2I9CA 3SFZA 4N5QA 5ITZF 4GZCA 3MJWA 1EDUA 1BU9A 3G2VA 4FULA 3ZXSA 4J6IA 5KJNA 4CCAA 1XNFA 2M63A 2KBXA 1VDYA 4BETA 3L6AA 4BY6A 2EIME 3FUDA 1XGWA 2DYSE 3FH5A 3PRZA 4URKA 2VTBB 3K9IA 4GTSA 1BI8B 4JPSA 3HDXA 2EINE 5EX3A 3V2OA 4DI4A 2PM7A 4BTBA 5J08A 3ASOE 3ZYQA 5ENPD 1O1RA 3HG0D 2DBAA 4NRHB 4HORA 3CHMA 2P9PG 1KLXA 3TWWA 4IRUA 2MHKA 1FCHA 3JXJA 4GTOA 5FWQA 1IHGA 1TNOA 3UM0A 2E0IA 3LY9A 1KZOA 1DCEA 2WQ7A 4NACA 3QWPA 1NP7A 4L1BA 4GU5A 3UI2A 4CT0A 4AJWA 1U3CA 2GRNB 2V4LA 3CQCB 3CVQA 4LNGA 1H6OA 3FUFA 5EX0A 5KJMA 3FH8A 3FUIA 1Z3YA 1YYHA 3CVWA 4FHJA 3D9OA 2OVBA 3AS5A 3Q7FA 2R02A 1WG0A 3ESKA 1SA4A 3T5VA 3CVLA 3B7UX 5KNGA 3ZGQA 4DUIA 5EYLA 4M7CA 2A5EA 3S7FA 2BTDA 1QYMA 4FLHA 3JUIA 3LCAA 2QFCA 3SBSA 2RG8A 1OY3D 3PZ1A 3CHQA 2OEWA 3QWWA 4UWFA 3PEVB 4RG9A 2XS1A 3EHNA 2P9NG 4JHKA 3JQ0A 4TXPA 3T5XA 3ZHEA 1A5EA 4PS7A 4ACLA 3HVEA 3RO3A 4WNDA 2IO3C 3I3NA 4I43A 3G2WA 2WXIA 1TR4A 4GPMA 3UX4A 4GCNA 2J09A 3L54A 4GYYA 3I4RB 2VSOE 2QYUA 2IF4A 4PS8A 2V0PA 1TJCA 1BPOA 2UY1A 2GW1A 2LXMA 4HOSA 1GW6A 4LG6A 5FTPA 2JABA 1DC2A 3JYSA 3VLDA 3UT8A 2WXNA 3Q75A 3AU5A 3TWXA 3L22A 4JXTA 4FJYA 4G8KA 3U3WA 4RQIA 2CFUA 2P58C 4UI9J 5BPPA 2VQ2A 4U0SA 4KZ0A 3QKYA 3FULA 2LAIA 4ANXA 4FP7A 3L82A 4GTPA 1OCRE 3QDNA 5CRVA 5BXUA 4OAUC 5CERB 4JZYA 4N3AA 1O5MA 3UT4A 4NQ0A 5G55A 3GYZA 5KWDA 4HQDA 4KYOB 3IBEA 4RG6A 2X6JA 4I1OB 4BWRA
chains in the Genus database with same CATH topology
1LD7A 3C72A 3Q73A 1QBQA 3KSQA 1TNOA 2F0YA 1JCSA 3DSXA 4GTTA 1N95A 1KZOA 1S64A 1DCEA 4YDOA 1KZPA 1N4QA 2H6GA 1FT2A 3DRAA 4YDEA 1JCRA 3EU5A 1FPPA 4GTMA 3DSTA 4LNBA 3DSSA 3HXBA 4LNGA 3DSUA 2ZIRA 2ZISA 1N9AA 4L9PA 1LD8A 1FT1A 3E33A 1LTXA 3HXDA 2BEDA 1N4PA 4GTQA 3KSLA 3Q75A 3Q7FA 3Q7AA 1TNYA 4EHMA 3HXEA 3EUVA 2H6IA 1SA4A 2H6HA 3PZ2A 3DPYA 4MBGA 1O1SA 1SA5A 3SFXA 1TN7A 3HXCA 1D8EA 1TN8A 3SFYA 1JCQA 1N4SA 1TN6A 4GTRA 4GTVA 4GTSA 4GTPA 3PZ1A 2R2LA 3DSVA 1TNUA 3HXFA 2IEJA 3Q78A 1N4RA 3E30A 1NI1A 3PZ4A 1MZCA 1TNBA 1X81A 3E34A 3Q79A 1O1RA 1O5MA 1S63A 3DSWA 3PZ3A 1NL4A 1N94A 1O1TA 1D8DA 2H6FA 3E37A 1TNZA 3E32A 4GTOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1LD7 A;  3C72 A;  3Q73 A;  1QBQ A;  3KSQ A;  1TNO A;  2F0Y A;  1JCS A;  3DSX A;  4GTT A;  1N95 A;  1KZO A;  1S64 A;  1DCE A;  4YDO A;  1KZP A;  1N4Q A;  2H6G A;  1FT2 A;  3DRA A;  4YDE A;  1JCR A;  3EU5 A;  1FPP A;  4GTM A;  3DST A;  4LNB A;  3DSS A;  3HXB A;  4LNG A;  3DSU A;  2ZIR A;  2ZIS A;  1N9A A;  4L9P A;  1LD8 A;  1FT1 A;  3E33 A;  1LTX A;  3HXD A;  2BED A;  1N4P A;  4GTQ A;  3KSL A;  3Q75 A;  3Q7F A;  3Q7A A;  1TNY A;  4EHM A;  3HXE A;  3EUV A;  2H6I A;  1SA4 A;  2H6H A;  3PZ2 A;  3DPY A;  4MBG A;  1O1S A;  1SA5 A;  3SFX A;  1TN7 A;  3HXC A;  1D8E A;  1TN8 A;  3SFY A;  1JCQ A;  1N4S A;  1TN6 A;  4GTR A;  4GTV A;  4GTS A;  4GTP A;  3PZ1 A;  2R2L A;  3DSV A;  1TNU A;  3HXF A;  2IEJ A;  3Q78 A;  1N4R A;  3E30 A;  1NI1 A;  3PZ4 A;  1MZC A;  1TNB A;  1X81 A;  3E34 A;  3Q79 A;  1O1R A;  1O5M A;  1S63 A;  3DSW A;  3PZ3 A;  1NL4 A;  1N94 A;  1O1T A;  1D8D A;  2H6F A;  3E37 A;  1TNZ A;  3E32 A;  4GTO A; 
#chains in the Genus database with same CATH topology
 5KCM A;  1K1B A;  3W9F A;  3KS2 A;  1SW6 A;  2F37 A;  3UQ3 A;  3RO2 A;  2VSY A;  4E85 A;  4DLQ A;  4UUC A;  3C3R A;  5FQ6 A;  3G2T A;  3EU5 A;  3VTY A;  4GB9 A;  3CVP A;  5AN8 A;  2GRR B;  4GTM A;  4A55 A;  4G1T A;  2V4H C;  3CVY A;  2XCC A;  3EHQ A;  3CLJ A;  4D10 C;  4U8Y D;  2LNI A;  5DBK A;  3ZIM A;  3EHM A;  4G23 A;  3C3Q A;  5AAO A;  3UPV A;  3RIB A;  4U04 A;  4GZD A;  3SHF A;  2JEK A;  2PNN A;  3CEQ A;  4YVQ C;  4GTR A;  3L16 A;  3TG4 A;  4KZC A;  4N2S A;  1HG5 A;  2VJ8 A;  3FP3 A;  5ENS D;  3T8K A;  1KPS B;  3PE4 A;  5D2M C;  4C9B B;  3PZ4 A;  1MZC A;  4B8A A;  4RLY A;  4I9C A;  4WNE A;  5CBN A;  3NAW A;  5FJY A;  4EZJ A;  2EIJ E;  4HB5 A;  3Q73 A;  3FTV A;  4TUM A;  4UWG A;  3CK7 A;  4GYW A;  5G2N A;  4A63 B;  4EQF A;  3FTZ A;  1NA3 A;  3NZU A;  5AJD A;  3ISM C;  5BV1 A;  3B95 A;  4Y6C A;  4O1P A;  3X2Q E;  2E2E A;  4Z68 A;  5BW8 C;  2BUG A;  4R7L A;  2DIW A;  1OUV A;  4GML A;  4HLL A;  4HBD A;  3CIA A;  1UJK A;  3MX3 A;  3OAW A;  4L9P A;  3NBN B;  2IOS A;  2PQR A;  2WB2 A;  3NZS A;  5G04 J;  2FBN A;  4K03 A;  4Q96 A;  4G11 A;  3MKQ B;  4JB8 P;  4OVU A;  3SFX A;  3IV0 A;  1TJF A;  3OXG A;  3CHP A;  4LRZ A;  3FDH A;  4JEH A;  2WXP A;  3DPD A;  4PH4 B;  2B0O E;  1EF1 C;  1OCO E;  3ABK E;  3ASN E;  4XI0 A;  4J8D A;  4CEM A;  3PE3 A;  4CT4 A;  2KZT B;  5LFA A;  2F8X K;  1HU3 A;  3MKR A;  1H6K A;  4ANU A;  1X81 A;  3FU5 A;  3U4T A;  1S63 A;  5LOZ A;  3Q5M A;  5FQ4 A;  3SD5 A;  2H6F A;  5ARG A;  3GZ2 A;  5HRY A;  4QFV A;  4K5C A;  4XE0 A;  4APF A;  3TWQ A;  5JHB A;  3NOC D;  2VTB A;  3AS4 A;  4B89 A;  1PC2 A;  3SGH A;  1N95 A;  3LDZ A;  3ULQ A;  2IY0 C;  4YDO A;  3U66 A;  2FO1 E;  3DRA A;  2HE0 A;  2WPV A;  4F6R D;  1FPP A;  3BG0 B;  2CG3 A;  2AVP A;  1MHQ A;  2QC9 A;  1N9A A;  2VGY A;  2CHX A;  3RJV A;  1LD8 A;  5AQ9 A;  1OWL A;  5G05 C;  2V5Q C;  3KSL A;  4U8H A;  1TNY A;  3V79 K;  5FZS A;  3R9A B;  3LVQ E;  1BI7 B;  2L0T B;  1JPL A;  2PM6 A;  1TN6 A;  2L6J A;  4F1P A;  3PVL A;  4EBA A;  4K5B A;  1H2V C;  3SO8 A;  2R05 A;  4BFR A;  2IU1 A;  1MX2 A;  4A1S A;  4G26 A;  2P9I G;  3ASG A;  2J4B A;  4CDR A;  1TNB A;  3J5P A;  1PY1 A;  3Q79 A;  2VYI A;  2OEV A;  4JA9 A;  3TWT A;  3RSE G;  1IQU A;  5FIN A;  2XEV A;  3Q47 B;  4I6G A;  1D8D A;  4OVV A;  5BT1 A;  1FVH A;  1K8K G;  1N0R A;  4ABN A;  2DCP A;  4NIK A;  5KNH D;  3APF A;  5BV0 A;  1HXI A;  3AAA C;  3FEY A;  1Z5S C;  3VLF A;  4L2L A;  4AOF A;  3AS8 A;  4KBQ A;  3IHV A;  2R59 A;  1ZB1 A;  3BQO A;  5AEN A;  4YDE A;  1JCR A;  3Q9N C;  2DWZ A;  3PNL B;  4U0Z A;  1KT0 A;  4KMO A;  3B7T A;  3HXB A;  3LS8 A;  4GA2 A;  5BXO A;  3FEX A;  3GZS A;  2X38 A;  4GA1 A;  3CVU A;  4P29 A;  5JJ7 A;  3APD A;  2RD0 A;  3CHO A;  2BED A;  2YHE A;  2LSU A;  5ANL A;  1E8W A;  3CVX A;  2KCK A;  3DPY A;  4I1A A;  4YDW A;  4HRN A;  5A6C A;  1O1S A;  2X6K A;  4O6F A;  3FY4 A;  5M72 A;  2HO1 A;  2WXR A;  4WWO A;  4YND A;  3Q49 B;  1N4S A;  2KM4 A;  2MYO A;  3UM3 A;  4MS6 A;  3TXM A;  3EIQ C;  1DCQ A;  2R2L A;  2BKK B;  3JCK C;  2EQX A;  3DEP A;  2LAH A;  2OCC E;  4EZL A;  1DNP A;  1E8X A;  1IQR A;  1BLX B;  1MX4 A;  5ENN A;  4ATZ D;  3ZNG A;  4U0U A;  5ENO D;  3DEO A;  1K3Z D;  4DLO A;  3HXC A;  3L17 A;  2BKG A;  2GRQ B;  4MRU A;  2XHE A;  3OTN A;  3LY7 A;  5A7D B;  3D9J A;  4G25 A;  1UJJ A;  4HOT A;  2XQ0 A;  4GMR A;  1IXV A;  4AY6 A;  3D9P A;  3ZKJ A;  2WVI A;  4JA7 A;  2XGM A;  3ABL E;  4QQI A;  3DXM G;  4F1S A;  3ZFW A;  3UT7 A;  4HNA D;  1SZ9 A;  4ME2 A;  2LXL A;  5FIO A;  3CK9 A;  1FT1 A;  3OXF A;  2P2C P;  4LUN U;  4FAD A;  4ANV A;  3HXE A;  3TL5 A;  5J90 A;  4YDY A;  3RRU A;  4J7W A;  5B1A E;  2WXM A;  2WM9 A;  1HO8 A;  5FQ8 A;  2ZGG A;  3MZL B;  3J5Q B;  4KVO A;  2EIK E;  4FJZ A;  2J08 A;  3U64 A;  4HFG A;  1WAO 1;  3TXN A;  1ELR A;  4X8Q A;  3V2X A;  1E90 A;  2IEJ A;  4BEP A;  3O48 A;  3ASH A;  4K0R A;  2CG2 A;  3E30 A;  1DVP A;  4E6H A;  3PUK A;  3ZYL A;  2NC9 A;  2YNQ A;  1NA0 A;  4BES A;  4ZFH A;  4KVM A;  4OAV B;  4N3B A;  4XX5 A;  3JUE A;  3ULY A;  4PUC A;  4BX9 A;  2HR2 A;  2F8Y A;  3KSQ A;  5ARF A;  3Q4A B;  3UKR G;  4GZ3 A;  3LJ3 A;  3D9K A;  3FH7 A;  5CBO A;  4F7A A;  2VSN A;  2BF0 X;  1FT2 A;  3TJP A;  2XEN A;  5CED B;  4AVX A;  4FLB A;  2QY7 A;  3BEE A;  3MV3 B;  2LUH A;  3AG1 E;  5HQ8 A;  1MYO A;  1UN8 A;  1OXJ A;  2PZI A;  5AQB A;  2L0I A;  1WDY A;  3LXU X;  3B13 A;  3RKV A;  3PZ2 A;  1QNF A;  4Y6W A;  3QC1 A;  5JA4 D;  1TN7 A;  4BTA A;  3P2B A;  1HZ4 A;  3ZXP A;  2C0M A;  1MQS A;  2J07 A;  3L13 A;  4JD2 G;  5ENQ D;  3U9W A;  1N11 A;  1ELK A;  4UQX A;  5C2Y A;  5KJL A;  4XKB A;  3R9M A;  1ELW A;  3TAX A;  3HYM B;  3MCX A;  4IN3 B;  4GCO A;  4JHR A;  3T8M A;  5AJL A;  3CV0 A;  2MRI A;  3LEW A;  3DSW A;  1U2V G;  1OWP A;  1N94 A;  3CHR A;  3UIN C;  4H7Y A;  1H19 A;  3MYV A;  4DX6 D;  2DVW A;  1IYG A;  3LKU A;  1H2T C;  4JHJ A;  2I6H A;  3FUK A;  2OOE A;  5EDS A;  4DRX E;  2F0Y A;  3DSX A;  2L6B A;  3L08 A;  4J0U A;  1KZP A;  3L9T A;  4ILG A;  3FTY A;  3PS6 A;  1N54 A;  2VGX B;  4BX8 A;  3EJN A;  2CFZ A;  4WNF A;  4ILI A;  3AG2 E;  3CKB A;  2WXG A;  2VGE A;  3ENE A;  1AP7 A;  2ETA A;  4N5C A;  2C2L A;  4NUR A;  1LTX A;  3ABM E;  5CMW A;  2LO6 A;  3AG4 E;  2R5S A;  3EUV A;  3ONK A;  5CEC B;  2H6H A;  3KAE A;  2J49 A;  4DX1 A;  1OT8 A;  1SA5 A;  1H6P A;  4ACK A;  2X6I A;  2WMN A;  3FUN A;  4RSY A;  3SFY A;  5CCL A;  2B6C A;  2HM8 A;  5E76 A;  3DBS A;  4LCT A;  3DSV A;  5G05 J;  4HRL A;  4TRQ A;  1TNU A;  4BT9 A;  5EYP F;  3R7Q A;  3WXX A;  4WUY A;  1Y8M A;  5H7P A;  4LNU D;  4BSZ B;  1O1T A;  3HHM A;  1OWM A;  4TUU A;  5LCW J;  3CK8 A;  4F53 A;  2V8S E;  2DZO A;  1LD7 A;  4I6J A;  3FU6 A;  1S70 B;  4HLE A;  4AV7 A;  1UW4 B;  2GGF A;  5KJK A;  5C1D A;  2J8S D;  1N4Q A;  4GPK A;  4OYS A;  1MJ0 A;  3O4Z A;  3PRE A;  4AY5 A;  2XS8 A;  2CHW A;  5ANR A;  4Q69 A;  2WXJ A;  4BSX A;  2I1J A;  3QOU A;  1ZU2 A;  4TXQ A;  5D0Q D;  3BG1 B;  3ZUV B;  3RK6 A;  4CGV A;  3QNK A;  3FU3 A;  2R03 A;  4DX2 A;  5JJ6 A;  3FU0 A;  1HS6 A;  1L5J A;  1E8Z A;  2JLB A;  3PDN A;  4J8E A;  3IXE A;  3KEA A;  4UWK A;  4CGW A;  1HH8 A;  4V3I A;  4XZ4 A;  2GRO B;  4MBG A;  1UG3 A;  2OVF A;  1S0P A;  3LPZ A;  2XEH A;  3ZYK A;  1D8E A;  3SI5 A;  1IHB A;  3MEK A;  4L2Y A;  4UWH A;  4EPZ A;  4TV3 A;  1Z3X A;  1E7V A;  1MX6 A;  1TEZ A;  3JQ1 A;  4CRW A;  4PDX A;  1IKN D;  3PEU B;  3CVV A;  4HOU A;  2ZXW E;  1SQM A;  3E34 A;  2WQH A;  4LEU A;  3TWR A;  3T9K A;  2FI7 A;  1HX8 A;  5AYW D;  3D9M A;  1WM5 A;  3FUH A;  3ML9 A;  3RU0 A;  3QWV A;  3FTW A;  4Q94 A;  3Q9U C;  3UIO C;  4FA6 A;  3D9H A;  1EYH A;  4UI9 K;  1V55 E;  5AAR A;  3IEG A;  2QYJ A;  2A5U A;  2KC7 A;  5BNW A;  2Y1L E;  4MLP A;  3D3M A;  1KT1 A;  2J9Q A;  4HI9 A;  1P5Q A;  5EIL A;  1TYQ G;  3S7D A;  2X6F A;  4JC8 A;  1QQE A;  3CST A;  2DYR E;  2Y0B G;  2XRZ A;  3SQV A;  4CZ2 D;  3HXD A;  1H2U A;  5EID A;  2FF4 A;  5FZR A;  4C0E A;  4EHM A;  4B94 A;  2IO2 C;  4CDN A;  1UN9 A;  2KCV A;  3EDT B;  4UWL A;  3URZ A;  2XZT G;  2AXV A;  4YVO A;  4WAF A;  3ZYM A;  2PL2 A;  4GA0 A;  3C98 A;  2ETC A;  4KXK B;  5EN5 D;  1TN8 A;  2NYJ A;  2YHC A;  1V54 E;  3FTX A;  4U95 D;  2UWJ G;  1YCS B;  1Y6I A;  3ASF A;  4XIF A;  3RAU A;  4JVS A;  4DI3 A;  3UMV A;  2YIN A;  4I17 A;  3V31 A;  2XRY A;  4C0M A;  3Q78 A;  1N4R A;  4AIF A;  3ML8 A;  5CEA A;  3I5P A;  2ILR A;  4LER A;  1AWC B;  3CKC A;  3CSF A;  4N3C A;  2AWI A;  3E37 A;  3HIZ A;  5JHA A;  2J4D A;  4AP2 A;  1W3B A;  1HG2 A;  4O60 A;  4B0Z A;  4BT8 A;  3SZ7 A;  2WMO A;  4HRM B;  2DZN A;  4DX7 D;  1E96 B;  1HE8 A;  4GMJ A;  3FUE A;  4UQZ A;  3ONL A;  5LX8 A;  4ZHB A;  3E4B A;  2X6H A;  2AXZ A;  3TG5 A;  4AM9 A;  4F3V A;  1FVF A;  2WXK A;  3E33 A;  2Y4T A;  4GZ6 A;  2LSV A;  5B3S E;  3DXK G;  1OWO A;  4I2W A;  4B93 B;  2H6I A;  2Y3A A;  3ASD A;  5HKP A;  4BER A;  2WXQ A;  5BUZ A;  5E75 A;  2XGS A;  3LVR E;  3RRN B;  4FHK A;  3APC A;  1QZ2 A;  3EU9 A;  4I1M A;  3AU4 A;  2NSZ A;  1D9S A;  2IFU A;  5HI7 A;  3CQG B;  5DIZ A;  3R7R A;  3G2U A;  3S7J A;  4UQY A;  3VLE A;  3UUX A;  5T3R A;  3EHR A;  2QZA A;  4JL0 A;  2P9L G;  5KBA A;  1PAQ A;  2GRM A;  1U3D A;  3UM2 A;  4FC8 A;  1HF8 A;  4L23 A;  2AXU A;  3E32 A;  3VTX A;  2GRP B;  4M3O A;  1N0Q A;  3C72 A;  1QBQ A;  2FO7 A;  2ION A;  3SNX A;  1S64 A;  2H6G A;  2RKK A;  2XPI A;  3MA5 A;  1OWN A;  3QK0 A;  5CMY A;  1Z6T A;  4K5A B;  4GZ5 A;  1EPU A;  2XPY A;  3B7R L;  5EIB E;  4I9E A;  1G3N B;  5FQ7 A;  3QJZ A;  3SY2 A;  4I2Z A;  4U63 A;  3Q7A A;  2IQC A;  3C5R A;  3ZHE B;  2X3M A;  4WWN A;  2AJA A;  3PH0 C;  4U8V D;  2VGX A;  4HI8 A;  3GZ1 A;  3HVE B;  3ZVV A;  2ZGD A;  3N71 A;  1X5B A;  3IKO B;  1E7U A;  3NOG D;  3S7B A;  3CR3 A;  3FWV A;  2V5F A;  3HXF A;  3D9I A;  4ANW A;  3FUJ A;  1NI1 A;  2CHZ A;  4C48 B;  1N52 A;  4W9R A;  3FTS A;  3AG3 E;  3F6Q A;  3PZ3 A;  5FT9 A;  3CHS A;  1B89 A;  2UY1 B;  2XZD G;  1TNZ A;  3BU8 A;  2I2O A;  1JWG A;  4APO A;  1RZ4 A;  2WQ6 A;  1OCC E;  3ULE G;  4IYP A;  4G24 A;  4J8Y A;  3UKU G;  3SBT B;  3BUA A;  3JXI A;  3MGB A;  5HS0 A;  5CHE E;  4IUL A;  5IY5 E;  3MKQ A;  3DWL G;  3PZD A;  3B7S A;  2RFM A;  2NXP A;  4ILH B;  4UI9 C;  5T8I A;  4DK5 A;  3DST A;  4U07 A;  4HXI A;  3ESL A;  4TXR A;  2ZIR A;  2ZIS A;  4H7X A;  3S2A A;  2WXF A;  2XCB A;  2KZT A;  2ZU6 B;  4LSZ E;  4GTQ A;  5JMN D;  5A23 A;  4J8F A;  4RVB A;  4HVB A;  4AXH A;  3ZRH A;  3MV2 B;  4CDM A;  3CGH A;  2C0L A;  2L9B A;  3FFL A;  4O1O A;  3HRA A;  4A1G A;  4WWP A;  1YA0 A;  4XKC A;  1JCQ A;  4G2V A;  2Y4U A;  3P1U A;  3ZU7 B;  4GTV A;  2WXH A;  2ETB A;  1LF8 A;  2A4Z A;  1Q2Z A;  2P9S G;  3UIP C;  3KD7 A;  3NQP A;  3TWS A;  4DJA A;  2Q7F A;  2OND A;  4A3T A;  3UM1 A;  3TWU A;  4HS2 A;  4G8L A;  4PS3 A;  4AEZ C;  3W9G A;  5FZQ A;  2RFA A;  3OXL A;  4GYO A;  4U7E B;  2XGO A;  2FEZ A;  4ATG A;  4HOQ A;  2MOW A;  3ZEF A;  2HYZ A;  3TGO A;  2R17 C;  1NZN A;  5LP0 A;  3FHE A;  3QAQ A;  1H0A A;  2P9K G;  3CVN A;  3WG7 E;  2Y69 E;  1UOH A;  2IOL A;  3ZPJ A;  4DPR A;  3AJI A;  4EZK A;  4KT6 B;  3LYA A;  2WXL A;  4LNB A;  3EIJ A;  1A17 A;  2VSX E;  3DSS A;  4L7T A;  3ZW3 A;  2I1K A;  2YQ8 A;  3D9N A;  5JJT A;  3LJN A;  4A3V A;  4J8S A;  3FTU A;  5CCM A;  5B1B E;  3ZN3 A;  5D66 A;  2XEE A;  1E8Y A;  3I4G A;  3G2S A;  4JEU A;  5AIJ A;  3FUM A;  4U96 D;  2XPZ A;  2FUL A;  1K1A A;  4CYM D;  2EIL E;  2WXO A;  1SVX A;  2P9U G;  4XEI G;  1OCZ E;  2AW6 A;  3QAR A;  4JW1 A;  1NFI E;  5D0O D;  3QB2 A;  1SZA A;  5AQ7 A;  2GRL A;  2OV8 A;  3B7B A;  3KEZ A;  1JWF A;  5AQA A;  3TWV A;  1ZBP A;  4EBA G;  1RW2 A;  3LY8 A;  3Q15 A;  4EEC A;  1NL4 A;  3RRM B;  2KCL A;  1INZ A;  4B8C B;  4XI9 A;  1BD8 A;  4N2Q A;  3C3O A;  4GAA A;  3UXG A;  1HFA A;  1WY6 A;  4I6E A;  3NB2 A;  1JCS A;  4DX5 D;  3PNT B;  4GTT A;  5G04 C;  3GW4 A;  1JUQ A;  5ENR D;  5ENT D;  4FU3 A;  5CRU A;  2KXP C;  3V30 A;  4N39 A;  2IJG X;  3SF4 A;  3UTM A;  3D9L A;  3DSU A;  3NF1 A;  3PUJ A;  5LCW C;  3IHY A;  1YMP A;  4WNG A;  2KAT A;  4MKT A;  2PQN A;  1N4P A;  5EKQ D;  5T4Y A;  2I9C A;  3SFZ A;  4N5Q A;  5ITZ F;  4GZC A;  3MJW A;  1EDU A;  1BU9 A;  3G2V A;  4FUL A;  3ZXS A;  4J6I A;  5KJN A;  4CCA A;  1XNF A;  2M63 A;  2KBX A;  1VDY A;  4BET A;  3L6A A;  4BY6 A;  2EIM E;  3FUD A;  1XGW A;  2DYS E;  3FH5 A;  3PRZ A;  4URK A;  2VTB B;  3K9I A;  4GTS A;  1BI8 B;  4JPS A;  3HDX A;  2EIN E;  5EX3 A;  3V2O A;  4DI4 A;  2PM7 A;  4BTB A;  5J08 A;  3ASO E;  3ZYQ A;  5ENP D;  1O1R A;  3HG0 D;  2DBA A;  4NRH B;  4HOR A;  3CHM A;  2P9P G;  1KLX A;  3TWW A;  4IRU A;  2MHK A;  1FCH A;  3JXJ A;  4GTO A;  5FWQ A;  1IHG A;  1TNO A;  3UM0 A;  2E0I A;  3LY9 A;  1KZO A;  1DCE A;  2WQ7 A;  4NAC A;  3QWP A;  1NP7 A;  4L1B A;  4GU5 A;  3UI2 A;  4CT0 A;  4AJW A;  1U3C A;  2GRN B;  2V4L A;  3CQC B;  3CVQ A;  4LNG A;  1H6O A;  3FUF A;  5EX0 A;  5KJM A;  3FH8 A;  3FUI A;  1Z3Y A;  1YYH A;  3CVW A;  4FHJ A;  3D9O A;  2OVB A;  3AS5 A;  3Q7F A;  2R02 A;  1WG0 A;  3ESK A;  1SA4 A;  3T5V A;  3CVL A;  3B7U X;  5KNG A;  3ZGQ A;  4DUI A;  5EYL A;  4M7C A;  2A5E A;  3S7F A;  2BTD A;  1QYM A;  4FLH A;  3JUI A;  3LCA A;  2QFC A;  3SBS A;  2RG8 A;  1OY3 D;  3PZ1 A;  3CHQ A;  2OEW A;  3QWW A;  4UWF A;  3PEV B;  4RG9 A;  2XS1 A;  3EHN A;  2P9N G;  4JHK A;  3JQ0 A;  4TXP A;  3T5X A;  3ZHE A;  1A5E A;  4PS7 A;  4ACL A;  3HVE A;  3RO3 A;  4WND A;  2IO3 C;  3I3N A;  4I43 A;  3G2W A;  2WXI A;  1TR4 A;  4GPM A;  3UX4 A;  4GCN A;  2J09 A;  3L54 A;  4GYY A;  3I4R B;  2VSO E;  2QYU A;  2IF4 A;  4PS8 A;  2V0P A;  1TJC A;  1BPO A;  2UY1 A;  2GW1 A;  2LXM A;  4HOS A;  1GW6 A;  4LG6 A;  5FTP A;  2JAB A;  1DC2 A;  3JYS A;  3VLD A;  3UT8 A;  2WXN A;  3Q75 A;  3AU5 A;  3TWX A;  3L22 A;  4JXT A;  4FJY A;  4G8K A;  3U3W A;  4RQI A;  2CFU A;  2P58 C;  4UI9 J;  5BPP A;  2VQ2 A;  4U0S A;  4KZ0 A;  3QKY A;  3FUL A;  2LAI A;  4ANX A;  4FP7 A;  3L82 A;  4GTP A;  1OCR E;  3QDN A;  5CRV A;  5BXU A;  4OAU C;  5CER B;  4JZY A;  4N3A A;  1O5M A;  3UT4 A;  4NQ0 A;  5G55 A;  3GYZ A;  5KWD A;  4HQD A;  4KYO B;  3IBE A;  4RG6 A;  2X6J A;  4I1O B;  4BWR A; 
#chains in the Genus database with same CATH homology
 1LD7 A;  3C72 A;  3Q73 A;  1QBQ A;  3KSQ A;  1TNO A;  2F0Y A;  1JCS A;  3DSX A;  4GTT A;  1N95 A;  1KZO A;  1S64 A;  1DCE A;  4YDO A;  1KZP A;  1N4Q A;  2H6G A;  1FT2 A;  3DRA A;  4YDE A;  1JCR A;  3EU5 A;  1FPP A;  4GTM A;  3DST A;  4LNB A;  3DSS A;  3HXB A;  4LNG A;  3DSU A;  2ZIR A;  2ZIS A;  1N9A A;  4L9P A;  1LD8 A;  1FT1 A;  3E33 A;  1LTX A;  3HXD A;  2BED A;  1N4P A;  4GTQ A;  3KSL A;  3Q75 A;  3Q7F A;  3Q7A A;  1TNY A;  4EHM A;  3HXE A;  3EUV A;  2H6I A;  1SA4 A;  2H6H A;  3PZ2 A;  3DPY A;  4MBG A;  1O1S A;  1SA5 A;  3SFX A;  1TN7 A;  3HXC A;  1D8E A;  1TN8 A;  3SFY A;  1JCQ A;  1N4S A;  1TN6 A;  4GTR A;  4GTV A;  4GTS A;  4GTP A;  3PZ1 A;  2R2L A;  3DSV A;  1TNU A;  3HXF A;  2IEJ A;  3Q78 A;  1N4R A;  3E30 A;  1NI1 A;  3PZ4 A;  1MZC A;  1TNB A;  1X81 A;  3E34 A;  3Q79 A;  1O1R A;  1O5M A;  1S63 A;  3DSW A;  3PZ3 A;  1NL4 A;  1N94 A;  1O1T A;  1D8D A;  2H6F A;  3E37 A;  1TNZ A;  3E32 A;  4GTO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...