2H6HA

Y365f protein farnesyltransferase mutant complexed with a farnesylated ddptasacvls peptide product at 1.8a
Total Genus 133
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
133
sequence length
315
structure length
315
Chain Sequence
FVSLDSPSYVLYRDRAEWADIDPVPQNDGPNPVVQIIYSDKFRDVYDYFRAVLQRDERSERAFKLTRDAIELNAANYTVWHFRRVLLKSLQKDLHEEMNYITAIIEEQPKNYQVWHHRRVLVEWLRDPSQELEFIADILNQDAKNYHAWQHRQWVIQEFKLWDNELQYVDQLLKEDVRNNSVWNQRYFVISNTTGYNDRAVLEREVQYTLEMIKLVPHNESAWNYLKGILQDRGLSKYPNLLNQLLDLQPSHSSPYLIAFLVDIYEDMLENQCDNKEDILNKALELCEILAKEKDTIRKEYWRYIGRSLQSKHST
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Conversion of protein farnesyltransferase to a geranylgeranyltransferase.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords Protein farnesyltransferase/geranylgeranyltransferase type I
total genus 133
structure length 315
sequence length 315
ec nomenclature ec 2.5.1.58: Protein farnesyltransferase.
pdb deposition date 2006-05-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01239 PPTA Protein prenyltransferase alpha subunit repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.120 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Protein prenylyltransferase 2h6hA00
1SA5A 1LTXA 1TNUA 3DSWA 3PZ3A 4GTTA 3DSUA 3Q79A 1JCRA 4GTSA 3HXDA 4GTMA 4EHMA 1N4SA 1TN8A 1TNBA 3EU5A 4L9PA 2R2LA 1JCQA 4YDOA 1O1RA 1S63A 1NL4A 2H6GA 4GTVA 3EUVA 1N9AA 4GTRA 3PZ4A 4GTQA 1TN7A 1TN6A 3E34A 1KZPA 3HXBA 1QBQA 1MZCA 1LD7A 1O1SA 1SA4A 3PZ2A 3HXFA 4LNGA 3Q73A 3Q7AA 3HXCA 1NI1A 1JCSA 2F0YA 3Q78A 4YDEA 3DSSA 3DSVA 2H6IA 1X81A 3DSXA 1TNYA 3DRAA 1DCEA 1FT2A 2BEDA 3KSQA 4GTOA 2H6FA 3DPYA 3Q75A 3Q7FA 3HXEA 3E32A 4GTPA 1D8DA 3C72A 3SFYA 2ZIRA 3DSTA 3KSLA 1LD8A 2IEJA 1TNOA 3SFXA 1N4PA 1N4RA 1D8EA 3E33A 4LNBA 3E30A 1N94A 4MBGA 1FT1A 1N4QA 1N95A 1KZOA 1O5MA 2ZISA 1O1TA 1TNZA 1FPPA 1S64A 3PZ1A 2H6HA 3E37A
chains in the Genus database with same CATH superfamily
1TNUA 3L6AA 4EBAA 2YNQA 5KJNA 5CECB 2XCCA 3P2BA 2MHKA 3TWSA 4B8CB 3GZSA 3C3QA 5FIOA 2H6GA 2XRYA 3Q47B 3UM1A 4ANVA 1E7UA 4NACA 4BT9A 4CGWA 3RAUA 2AWIA 3ASGA 5ENTD 2R5SA 4XI9A 3FWVA 4DK5A 2E2EA 5ANRA 3ML8A 1WY6A 3CQCB 2HYZA 5G05J 3ZHEA 2Y69E 2XQ0A 4DPRA 1OWLA 5CMYA 3G2WA 2P9PG 5HI7A 2OVBA 4G25A 4L23A 3DSSA 2IY0C 3MYVA 3LCAA 3BUAA 4C0EA 4PDXA 2AXUA 1FVFA 1HX8A 1BI8B 5KCMA 2J07A 2XPIA 1TNOA 1N4PA 5LFAA 3MKRA 3E30A 3CHOA 3T8MA 5CHEE 4MBGA 2WQ6A 2GRRB 2P58C 3ZUVB 3FH8A 5C1DA 1MHQA 2IFUA 4N5CA 5EKQD 4Q96A 1H2VC 3L17A 1IKND 1B89A 1EF1C 4CGVA 3LJNA 4OYSA 4NIKA 3AU4A 4I9EA 2P9KG 4AJWA 4RVBA 4N5QA 1HZ4A 2IU1A 1HE8A 4L9PA 3OAWA 3IHVA 4XE0A 3FU5A 3MV2B 3S7FA 5G04C 5LCWC 4AY5A 3LY7A 3AAAC 3L9TA 3VLDA 4GCNA 4B94A 3LKUA 1TEZA 2GRQB 3FH7A 4CT0A 3ZNGA 4GA0A 5ENRD 5FQ4A 3PUJA 1PC2A 5KWDA 4BX8A 2EIJE 3LY9A 4XKBA 4X8QA 1FT2A 3ULYA 1H0AA 4KVMA 3FU6A 1IHGA 3FTSA 3SFYA 3P1UA 3DSTA 1WAO1 1H19A 2ETCA 2GRLA 5LCWJ 5AQAA 4A55A 2XRZA 2KXPC 2BKKB 3FUIA 4APFA 4HRNA 3T9KA 1N95A 3AG3E 5FQ7A 2WXNA 3PH0C 1TNZA 2R17C 4L2YA 3SO8A 3CHMA 3EHRA 4YDYA 3QOUA 4ILHB 5D2MC 3D9OA 2KM4A 1UG3A 5FZRA 4UUCA 3UT7A 3ASNE 4AIFA 5EX3A 4L2LA 1KT1A 1UJJA 1MJ0A 4DI4A 3NZUA 3SHFA 1HO8A 4K5AB 2IO3C 3LJ3A 3G2SA 3TXMA 5IY5E 3TWWA 4CZ2D 3R9MA 5CEDB 2R59A 2BKGA 3ZYQA 4G8LA 4ANUA 1U3CA 3B7SA 3J5PA 4CDNA 3G2VA 4J8SA 3SBTB 1N52A 4EZKA 5AENA 5M72A 4D10C 5D0QD 4XEIG 3U66A 2AXZA 4UI9C 2BTDA 5C2YA 4XX5A 2RD0A 4G8KA 1OXJA 1SZAA 1MQSA 3UX4A 1SW6A 3AS8A 1HFAA 3MGBA 3CR3A 4UI9K 4C9BB 2PZIA 4WNGA 3L13A 2WXJA 2ONDA 4YDWA 2HM8A 4EPZA 5ENQD 4K5BA 4EECA 3S7BA 4PS7A 4U63A 2QFCA 3HXDA 4GTMA 3UKRG 3CVWA 4JD2G 2IJGX 4A3VA 3GW4A 4UQXA 2MRIA 4WAFA 5LP0A 1IQUA 1E96B 2Y3AA 3BG1B 2Y4UA 5ARFA 4XI0A 2ZGGA 3OXLA 5J90A 4ANXA 3HG0D 1JPLA 2JEKA 3J5QB 5CBOA 4TUUA 2OOEA 1HS6A 4FU3A 3JQ0A 3FU0A 3NOGD 3CQGB 4G11A 4FADA 2X6IA 4U0UA 4JHRA 2KCKA 3MV3B 3CVUA 4K03A 4PS3A 4DX2A 1P5QA 3MKQB 3ESKA 2VSXE 3RRNB 2J08A 4HOQA 3ASDA 5CCLA 5AJDA 3ABLE 3LPZA 3TWTA 5JJTA 2DCPA 4B8AA 5ITZF 2M63A 4HOSA 3JUEA 3EU9A 1VDYA 3DXMG 5JA4D 5CEAA 3C3OA 2H6HA 4BTBA 4ABNA 4U7EB 4FJZA 3ZU7B 3MA5A 5HKPA 3OXFA 4ILGA 3VLFA 3IKOB 4GTSA 3EJNA 4FJYA 4I1AA 4HI8A 1TN8A 1TNBA 3UT8A 1BU9A 4JZYA 3NOCD 1S63A 4KMOA 3ZGQA 3JXJA 1HU3A 3QDNA 4IRUA 3KEZA 1MX6A 4ZHBA 4O60A 4OVVA 2R02A 3TGOA 3CK7A 2JABA 3KAEA 2KZTA 3IBEA 3L16A 1MZCA 1E8XA 1BPOA 2A5UA 3U9WA 3Q4AB 4AY6A 3W9GA 2P9NG 4HFGA 3UTMA 3E4BA 4KZ0A 2GW1A 5FQ6A 1JCSA 4RG9A 4JEHA 2X6HA 3B7TA 4JHKA 4J0UA 3ZYMA 2BF0X 3ISMC 1DNPA 3LY8A 2ZIRA 3FTXA 3I4GA 3T5VA 3SFXA 5ANLA 4DLOA 4FLHA 2I2OA 5BXOA 2X6JA 1K1BA 4JVSA 4BY6A 2WXQA 4HI9A 2EIME 1IQRA 1SQMA 4BSZB 5T3RA 1E90A 5G55A 1YMPA 2XGSA 1EDUA 4KXKB 3TG5A 3UIPC 3UMVA 1Z5SC 2OVFA 2QYUA 2L0IA 1OWOA 1LF8A 4HQDA 4WUYA 3APCA 5BW8C 3EUVA 3NB2A 3CKCA 4FC8A 2PM6A 4HOTA 5FTPA 3QJZA 3DEOA 5HQ8A 3TJPA 1RZ4A 1DC2A 1O1SA 4U95D 1FVHA 3RRUA 3SBSA 2IF4A 2F0YA 3D9JA 4PUCA 3PEUB 4J7WA 3TAXA 3RRMB 4L1BA 4GTOA 4FA6A 4AP2A 2DYRE 2EINE 3C3RA 1DCQA 2IEJA 2ZGDA 2LSUA 5G2NA 1N4RA 3G2UA 3CEQA 4RLYA 4YVOA 2B6CA 1O5MA 3HYMB 2XS1A 3I5PA 3RO2A 4F7AA 1Q2ZA 1TYQG 3V30A 4WNFA 3MZLB 2P9LG 3FH5A 2V5QC 3DSWA 4TXQA 3Q79A 2KCLA 4GCOA 3B7BA 3LVQE 2WXRA 1JWFA 4JEUA 2KATA 2FI7A 4O6FA 3Q9NC 3AG1E 3HIZA 4FHJA 2Y0BG 5A23A 3V2XA 1QQEA 3KEAA 1SVXA 1KZPA 3D9MA 4B93B 3PEVB 3CHQA 2LSVA 2OCCE 5A7DB 5DBKA 2CFZA 4OAVB 2LNIA 3HXFA 3MJWA 2LXLA 4ILIA 4Y6WA 2F8YA 4AM9A 2AJAA 1IXVA 4GA1A 4XKCA 3DSVA 5DIZA 2H6IA 4PS8A 4N39A 4U8YD 2WVIA 2KZTB 1UOHA 4GZ6A 3CHRA 3PE3A 2CHXA 3UIOC 3HHMA 3Q9UC 1LD8A 1AWCB 4GMLA 1OCRE 4GYWA 3L08A 4LNBA 3CVPA 4KBQA 5BPPA 4F3VA 3ZPJA 4BTAA 2L6BA 3HVEA 5CRVA 2XEVA 3CKBA 4I9CA 4BFRA 2EIKE 1SA5A 1LTXA 4TUMA 5LOZA 3UKUG 3KS2A 1V55E 2WXFA 2X38A 4EQFA 2V0PA 1BD8A 2NSZA 4I2ZA 4F6RD 4HRLA 1Y6IA 1N9AA 4N3CA 3D9NA 2WQHA 3CHSA 3NZSA 3ZFWA 3EHMA 1TN7A 2F8XK 3D9LA 2V4HC 2GRNB 2WXOA 4FP7A 1N0RA 3EDTB 2XPYA 1RW2A 3PS6A 3UT4A 2KC7A 4HOUA 5B1AE 2RKKA 4WWPA 4HBDA 3SFZA 4G24A 1G3NB 3HXCA 3T5XA 4CCAA 3QARA 2IO2C 3ZYLA 4EBAG 1TNYA 1MX4A 4CDMA 2BEDA 3KSQA 3FUNA 3ZN3A 1IYGA 3UPVA 3FUFA 1UW4B 4B0ZA 3TWVA 5BNWA 3JXIA 4N3AA 4JPSA 3E33A 5BV0A 2IOLA 1FT1A 4JB8P 1MX2A 2YHCA 1UN9A 3EIQC 2VSNA 3DEPA 1S64A 4V3IA 3MCXA 2WMNA 3HDXA 1A17A 2XZDG 3D9PA 2WXLA 4JW1A 3I4RB 3CVLA 1WM5A 2ILRA 3FEXA 3LYAA 2PQNA 3BQOA 5EYPF 3C5RA 3ZXPA 3CLJA 1ZBPA 4EZLA 5CCMA 1BLXB 4KT6B 3D9HA 4BSXA 2FO1E 3TXNA 2NC9A 1U3DA 1QYMA 2QYJA 1JWGA 2GRMA 1H6PA 3CVNA 1QBQA 1INZA 4DX7D 5T8IA 3Q7AA 4ACKA 3AS4A 3O4ZA 3QWVA 4GZDA 4YDEA 4IN3B 4H7XA 4GMJA 2HR2A 4WNDA 3LDZA 3LXUX 2WXGA 3ONKA 3K9IA 3ZHEB 1EPUA 2DVWA 5BUZA 5KNHD 1BI7B 3CVVA 2UY1B 1ELKA 3FHEA 4AEZC 4G2VA 4MS6A 4GYOA 4LG6A 3GZ2A 4XIFA 3DXKG 2V4LA 5EIDA 1KPSB 3OTNA 3QWPA 3ONLA 3WXXA 3PZ1A 2DWZA 4E85A 4AV7A 1YCSB 5KJMA 3E37A 4ATZD 4DX5D 3CGHA 2L6JA 4YNDA 4U07A 1HG5A 2QC9A 4W9RA 4LERA 4UWLA 3PNLB 3VTXA 2XGMA 2C0LA 4AOFA 2CG3A 4DUIA 3FTVA 1OCOE 4TXRA 3WG7E 2VYIA 4I43A 1A5EA 5AARA 2IONA 5FQ8A 1UN8A 2WXHA 2DBAA 4UWGA 3CVQA 4FULA 2X3MA 3T8KA 4GU5A 5JHBA 4K5CA 3IHYA 1LD7A 2PQRA 3CIAA 1SA4A 3TWRA 1ELWA 2LAHA 1XGWA 2I1KA 4OVUA 4GYYA 4A63B 2GROB 3U3WA 1OUVA 4DX6D 4I1OB 3CVYA 3X2QE 3PNTB 4G23A 3DRAA 4BEPA 2YQ8A 2VGEA 2FULA 2VGYA 1OWMA 2CG2A 2P2CP 3U64A 3CK8A 4ACLA 4K0RA 5EYLA 3ABME 5HRYA 1N94A 3SGHA 1OY3D 3GZ1A 2CHWA 3RIBA 2BUGA 4M7CA 1PY1A 1N4QA 4RG6A 2ZISA 1HXIA 1YYHA 3RO3A 1FPPA 2FBNA 4NURA 2R03A 3ZXSA 3FUDA 3UXGA 4A1SA 2J8SD 3I3NA 5ENOD 4KZCA 4J6IA 2J4DA 3ZKJA 2GRPB 4N3BA 2FEZA 3PZDA 3SNXA 4YDOA 4MRUA 2RG8A 3D9KA 4CEMA 4APOA 3S7JA 5FT9A 4TV3A 3MKQA 3PZ4A 3LVRE 1EYHA 3V2OA 2J09A 5AQ7A 4U0SA 4IULA 4CRWA 3FTUA 2PNNA 2RFAA 1W3BA 3CSFA 5AQBA 1NP7A 1YA0A 3TL5A 1WDYA 3L82A 4OAUC 3ULQA 4J8DA 5ENNA 4HLEA 3FUJA 2NXPA 4GPMA 4N2QA 4C0MA 4GTPA 2XGOA 1OT8A 3FP3A 3ZRHA 5CBNA 3FTZA 4DX1A 1H2UA 3HRAA 4UQZA 1Z3YA 2KBXA 2WQ7A 4BESA 1TJCA 2F37A 3ENEA 4WNEA 5AJLA 3UINC 1NA3A 2AW6A 4F1PA 1N54A 3DSUA 4E6HA 3JYSA 4Q69A 4TXPA 2R2LA 5ARGA 3OXGA 4HXIA 4JXTA 1H6OA 3EHQA 3PREA 5EILA 4HRMB 5KBAA 2VSOE 3B13A 5CRUA 5BV1A 1TN6A 5JJ6A 3UM3A 3QK0A 1PAQA 2E0IA 2L9BA 4O1OA 3GYZA 4LNUD 3PDNA 4CT4A 1MYOA 4AVXA 2P9IG 4G26A 4HLLA 4J8FA 1D9SA 2XCBA 5A6CA 3Q78A 5J08A 1N11A 5CERB 4Y6CA 3DSXA 2L0TB 1DCEA 2J49A 3RJVA 2DIWA 5KNGA 4NQ0A 4KYOB 3AU5A 3FTWA 3RKVA 3VLEA 2VJ8A 4I6JA 1NA0A 1D8EA 2WPVA 4UQYA 4U8VD 5EN5D 2ETBA 1KT0A 4MKTA 2DZOA 4Z68A 3S2AA 3HVEB 1KLXA 3UM0A 2FO7A 1QZ2A 4P29A 2WXKA 5G04J 2AVPA 5FZQA 3Q5MA 3B95A 1Z3XA 3AG4E 3QKYA 5E75A 3LS8A 3SY2A 5T4YA 1JUQA 3URZA 3EU5A 4M3OA 3RSEG 1O1RA 4TRQA 1K1AA 4GTVA 3ZVVA 2VTBA 3APFA 5BT1A 4KVOA 1WG0A 3W9FA 2WXIA 3QWWA 3UQ3A 1OCZE 4DRXE 3QB2A 3Q49B 3ASHA 4U04A 3HXBA 2P9UG 3FU3A 2XENA 3QAQA 3MX3A 3V79K 3DPDA 2XZTG 2EILE 3PZ2A 1OCCE 4RQIA 4C48B 3Q73A 4DLQA 4UWFA 3JQ1A 2UY1A 2J9QA 3PUKA 2WB2A 1H2TC 1NFIE 4JL0A 3UM2A 1HH8A 3FUKA 2GGFA 3C98A 4L7TA 2H6FA 3HXEA 1ZB1A 1S0PA 1SZ9A 3C72A 3RK6A 4I6EA 5AQ9A 4GZ5A 2QY7A 2PL2A 3FDHA 4GMRA 4JA9A 2DYSE 3EIJA 1HF8A 1K3ZD 2LUHA 3ESLA 3SQVA 2OEWA 3FULA 1AP7A 3QC1A 3F6QA 4CYMD 4HS2A 4HB5A 1OWPA 4GTTA 3V31A 5B3SE 4IYPA 4H7YA 4I2WA 4GAAA 2ZU6B 4EHMA 4LSZE 3SF4A 2A5EA 2VGXA 2Y1LE 5BXUA 4GA2A 4GTQA 3PVLA 4U96D 1DVPA 1GW6A 3FY4A 4R7LA 2KCVA 4QQIA 3JUIA 3L54A 4AXHA 2P9SG 2UWJG 2FF4A 3TG4A 2IOSA 3ASFA 3ULEG 1S70B 3D9IA 1E8WA 2XS8A 2LXMA 3AG2E 5H7PA 5ENPD 4HORA 4UWHA 1HG2A 4F1SA 3PRZA 1TR4A 1E8ZA 3AS5A 4B89A 3ZW3A 5EIBE 2Y4TA 3E32A 5FINA 3CSTA 3ASOE 1ELRA 4BWRA 3CHPA 4YVQC 4ATGA 5AAOA 2I1JA 4GB9A 3TWQA 2HO1A 3ABKE 4GZ3A 5KJLA 2WXPA 2V5FA 1L5JA 1KZOA 5CMWA 2NYJA 2CFUA 4JC8A 1V54E 3G2TA 3SD5A 4DI3A 3FFLA 2A4ZA 2XEHA 5FZSA 3B7UX 2VSYA 1JCQA 1OWNA 2QZAA 2HE0A 2WMOA 4LCTA 4I6GA 4NRHB 5AYWD 3DWLG 4RSYA 4XZ4A 4JHJA 3DBSA 4GTRA 1TJFA 5B1BE 3NBNB 5EDSA 4A3TA 4I1MA 4CDRA 2LO6A 4G1TA 3BG0B 2ETAA 4EZJA 2WXMA 3TWUA 4J8YA 4LUNU 1ZU2A 3PE4A 3SI5A 2PM7A 5KJKA 2C2LA 4LNGA 4ANWA 5JHAA 1Z6TA 3TWXA 3BU8A 3B7RL 3MEKA 2YHEA 3FUMA 2R05A 4BT8A 1QNFA 4MLPA 2MOWA 1Y8MA 4BX9A 2XPZA 4BETA 3IV0A 4GPKA 1X5BA 3EHNA 3VTYA 3KSLA 2I6HA 3UUXA 1IHBA 3UI2A 2V8SE 2AXVA 2B0OE 4LEUA 2VQ2A 3U4TA 5EX0A 4J8EA 3R7QA 2EQXA 3N71A 4PH4B 5JJ7A 3L22A 2Q7FA 3CK9A 2DZNA 1O1TA 2RFMA 3ZEFA 2XEEA 3RU0A 1U2VG 4U8HA 3PZ3A 3R7RA 1FCHA 3SZ7A 4UWKA 1JCRA 5LX8A 3LEWA 4FHKA 2VGXB 5AIJA 2WM9A 2I9CA 4I17A 3KD7A 1N4SA 5JMND 3AJIA 3CVXA 4Q94A 1N0QA 3IEGA 1NL4A 2CHZA 2YINA 4HNAD 4ME2A 1H6KA 4JA7A 2ZXWE 1XNFA 2C0MA 3E34A 4URKA 4DJAA 4A1GA 3FUEA 3Q15A 4O1PA 3FUHA 3JCKC 2MYOA 4GZCA 4ZFHA 5AN8A 3FEYA 4UI9J 2JLBA 5D0OD 3D3MA 1NI1A 3NAWA 4FLBA 2X6KA 3ZIMA 3R9AB 3O48A 1X81A 1NZNA 2IQCA 1K8KG 3ZYKA 3DPYA 3Q75A 2OEVA 3S7DA 3Q7FA 4WWOA 4F53A 2X6FA 1D8DA 3IXEA 4HVBA 4LRZA 1E7VA 3FTYA 3NF1A 5FWQA 2LAIA 4QFVA 3APDA 2J4BA 4N2SA 2XHEA 1UJKA 3NQPA 3CV0A 1E8YA 5HS0A 5E76A 3BEEA 2OV8A 5D66A 3ML9A 4U0ZA 4BERA 4WWNA 5FJYA 3QNKA 2VTBB 5ENSD 5G05C
chains in the Genus database with same CATH topology
1SA5A 1LTXA 1TNUA 3DSWA 3PZ3A 4GTTA 3DSUA 3Q79A 1JCRA 4GTSA 3HXDA 4GTMA 4EHMA 1N4SA 1TN8A 1TNBA 3EU5A 4L9PA 2R2LA 1JCQA 4YDOA 1O1RA 1S63A 1NL4A 2H6GA 4GTVA 3EUVA 1N9AA 4GTRA 3PZ4A 4GTQA 1TN7A 1TN6A 3E34A 1KZPA 3HXBA 1QBQA 1MZCA 1LD7A 1O1SA 1SA4A 3PZ2A 3HXFA 4LNGA 3Q73A 3Q7AA 3HXCA 1NI1A 1JCSA 2F0YA 3Q78A 4YDEA 3DSSA 3DSVA 2H6IA 1X81A 3DSXA 1TNYA 3DRAA 1DCEA 1FT2A 2BEDA 3KSQA 4GTOA 2H6FA 3DPYA 3Q75A 3Q7FA 3HXEA 3E32A 4GTPA 1D8DA 3C72A 3SFYA 2ZIRA 3DSTA 3KSLA 1LD8A 2IEJA 1TNOA 3SFXA 1N4PA 1N4RA 1D8EA 3E33A 4LNBA 3E30A 1N94A 4MBGA 1FT1A 1N4QA 1N95A 1KZOA 1O5MA 2ZISA 1O1TA 1TNZA 1FPPA 1S64A 3PZ1A 2H6HA 3E37A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1SA5 A;  1LTX A;  1TNU A;  3DSW A;  3PZ3 A;  4GTT A;  3DSU A;  3Q79 A;  1JCR A;  4GTS A;  3HXD A;  4GTM A;  4EHM A;  1N4S A;  1TN8 A;  1TNB A;  3EU5 A;  4L9P A;  2R2L A;  1JCQ A;  4YDO A;  1O1R A;  1S63 A;  1NL4 A;  2H6G A;  4GTV A;  3EUV A;  1N9A A;  4GTR A;  3PZ4 A;  4GTQ A;  1TN7 A;  1TN6 A;  3E34 A;  1KZP A;  3HXB A;  1QBQ A;  1MZC A;  1LD7 A;  1O1S A;  1SA4 A;  3PZ2 A;  3HXF A;  4LNG A;  3Q73 A;  3Q7A A;  3HXC A;  1NI1 A;  1JCS A;  2F0Y A;  3Q78 A;  4YDE A;  3DSS A;  3DSV A;  2H6I A;  1X81 A;  3DSX A;  1TNY A;  3DRA A;  1DCE A;  1FT2 A;  2BED A;  3KSQ A;  4GTO A;  2H6F A;  3DPY A;  3Q75 A;  3Q7F A;  3HXE A;  3E32 A;  4GTP A;  1D8D A;  3C72 A;  3SFY A;  2ZIR A;  3DST A;  3KSL A;  1LD8 A;  2IEJ A;  1TNO A;  3SFX A;  1N4P A;  1N4R A;  1D8E A;  3E33 A;  4LNB A;  3E30 A;  1N94 A;  4MBG A;  1FT1 A;  1N4Q A;  1N95 A;  1KZO A;  1O5M A;  2ZIS A;  1O1T A;  1TNZ A;  1FPP A;  1S64 A;  3PZ1 A;  2H6H A;  3E37 A; 
#chains in the Genus database with same CATH topology
 1TNU A;  3L6A A;  4EBA A;  2YNQ A;  5KJN A;  5CEC B;  2XCC A;  3P2B A;  2MHK A;  3TWS A;  4B8C B;  3GZS A;  3C3Q A;  5FIO A;  2H6G A;  2XRY A;  3Q47 B;  3UM1 A;  4ANV A;  1E7U A;  4NAC A;  4BT9 A;  4CGW A;  3RAU A;  2AWI A;  3ASG A;  5ENT D;  2R5S A;  4XI9 A;  3FWV A;  4DK5 A;  2E2E A;  5ANR A;  3ML8 A;  1WY6 A;  3CQC B;  2HYZ A;  5G05 J;  3ZHE A;  2Y69 E;  2XQ0 A;  4DPR A;  1OWL A;  5CMY A;  3G2W A;  2P9P G;  5HI7 A;  2OVB A;  4G25 A;  4L23 A;  3DSS A;  2IY0 C;  3MYV A;  3LCA A;  3BUA A;  4C0E A;  4PDX A;  2AXU A;  1FVF A;  1HX8 A;  1BI8 B;  5KCM A;  2J07 A;  2XPI A;  1TNO A;  1N4P A;  5LFA A;  3MKR A;  3E30 A;  3CHO A;  3T8M A;  5CHE E;  4MBG A;  2WQ6 A;  2GRR B;  2P58 C;  3ZUV B;  3FH8 A;  5C1D A;  1MHQ A;  2IFU A;  4N5C A;  5EKQ D;  4Q96 A;  1H2V C;  3L17 A;  1IKN D;  1B89 A;  1EF1 C;  4CGV A;  3LJN A;  4OYS A;  4NIK A;  3AU4 A;  4I9E A;  2P9K G;  4AJW A;  4RVB A;  4N5Q A;  1HZ4 A;  2IU1 A;  1HE8 A;  4L9P A;  3OAW A;  3IHV A;  4XE0 A;  3FU5 A;  3MV2 B;  3S7F A;  5G04 C;  5LCW C;  4AY5 A;  3LY7 A;  3AAA C;  3L9T A;  3VLD A;  4GCN A;  4B94 A;  3LKU A;  1TEZ A;  2GRQ B;  3FH7 A;  4CT0 A;  3ZNG A;  4GA0 A;  5ENR D;  5FQ4 A;  3PUJ A;  1PC2 A;  5KWD A;  4BX8 A;  2EIJ E;  3LY9 A;  4XKB A;  4X8Q A;  1FT2 A;  3ULY A;  1H0A A;  4KVM A;  3FU6 A;  1IHG A;  3FTS A;  3SFY A;  3P1U A;  3DST A;  1WAO 1;  1H19 A;  2ETC A;  2GRL A;  5LCW J;  5AQA A;  4A55 A;  2XRZ A;  2KXP C;  2BKK B;  3FUI A;  4APF A;  4HRN A;  3T9K A;  1N95 A;  3AG3 E;  5FQ7 A;  2WXN A;  3PH0 C;  1TNZ A;  2R17 C;  4L2Y A;  3SO8 A;  3CHM A;  3EHR A;  4YDY A;  3QOU A;  4ILH B;  5D2M C;  3D9O A;  2KM4 A;  1UG3 A;  5FZR A;  4UUC A;  3UT7 A;  3ASN E;  4AIF A;  5EX3 A;  4L2L A;  1KT1 A;  1UJJ A;  1MJ0 A;  4DI4 A;  3NZU A;  3SHF A;  1HO8 A;  4K5A B;  2IO3 C;  3LJ3 A;  3G2S A;  3TXM A;  5IY5 E;  3TWW A;  4CZ2 D;  3R9M A;  5CED B;  2R59 A;  2BKG A;  3ZYQ A;  4G8L A;  4ANU A;  1U3C A;  3B7S A;  3J5P A;  4CDN A;  3G2V A;  4J8S A;  3SBT B;  1N52 A;  4EZK A;  5AEN A;  5M72 A;  4D10 C;  5D0Q D;  4XEI G;  3U66 A;  2AXZ A;  4UI9 C;  2BTD A;  5C2Y A;  4XX5 A;  2RD0 A;  4G8K A;  1OXJ A;  1SZA A;  1MQS A;  3UX4 A;  1SW6 A;  3AS8 A;  1HFA A;  3MGB A;  3CR3 A;  4UI9 K;  4C9B B;  2PZI A;  4WNG A;  3L13 A;  2WXJ A;  2OND A;  4YDW A;  2HM8 A;  4EPZ A;  5ENQ D;  4K5B A;  4EEC A;  3S7B A;  4PS7 A;  4U63 A;  2QFC A;  3HXD A;  4GTM A;  3UKR G;  3CVW A;  4JD2 G;  2IJG X;  4A3V A;  3GW4 A;  4UQX A;  2MRI A;  4WAF A;  5LP0 A;  1IQU A;  1E96 B;  2Y3A A;  3BG1 B;  2Y4U A;  5ARF A;  4XI0 A;  2ZGG A;  3OXL A;  5J90 A;  4ANX A;  3HG0 D;  1JPL A;  2JEK A;  3J5Q B;  5CBO A;  4TUU A;  2OOE A;  1HS6 A;  4FU3 A;  3JQ0 A;  3FU0 A;  3NOG D;  3CQG B;  4G11 A;  4FAD A;  2X6I A;  4U0U A;  4JHR A;  2KCK A;  3MV3 B;  3CVU A;  4K03 A;  4PS3 A;  4DX2 A;  1P5Q A;  3MKQ B;  3ESK A;  2VSX E;  3RRN B;  2J08 A;  4HOQ A;  3ASD A;  5CCL A;  5AJD A;  3ABL E;  3LPZ A;  3TWT A;  5JJT A;  2DCP A;  4B8A A;  5ITZ F;  2M63 A;  4HOS A;  3JUE A;  3EU9 A;  1VDY A;  3DXM G;  5JA4 D;  5CEA A;  3C3O A;  2H6H A;  4BTB A;  4ABN A;  4U7E B;  4FJZ A;  3ZU7 B;  3MA5 A;  5HKP A;  3OXF A;  4ILG A;  3VLF A;  3IKO B;  4GTS A;  3EJN A;  4FJY A;  4I1A A;  4HI8 A;  1TN8 A;  1TNB A;  3UT8 A;  1BU9 A;  4JZY A;  3NOC D;  1S63 A;  4KMO A;  3ZGQ A;  3JXJ A;  1HU3 A;  3QDN A;  4IRU A;  3KEZ A;  1MX6 A;  4ZHB A;  4O60 A;  4OVV A;  2R02 A;  3TGO A;  3CK7 A;  2JAB A;  3KAE A;  2KZT A;  3IBE A;  3L16 A;  1MZC A;  1E8X A;  1BPO A;  2A5U A;  3U9W A;  3Q4A B;  4AY6 A;  3W9G A;  2P9N G;  4HFG A;  3UTM A;  3E4B A;  4KZ0 A;  2GW1 A;  5FQ6 A;  1JCS A;  4RG9 A;  4JEH A;  2X6H A;  3B7T A;  4JHK A;  4J0U A;  3ZYM A;  2BF0 X;  3ISM C;  1DNP A;  3LY8 A;  2ZIR A;  3FTX A;  3I4G A;  3T5V A;  3SFX A;  5ANL A;  4DLO A;  4FLH A;  2I2O A;  5BXO A;  2X6J A;  1K1B A;  4JVS A;  4BY6 A;  2WXQ A;  4HI9 A;  2EIM E;  1IQR A;  1SQM A;  4BSZ B;  5T3R A;  1E90 A;  5G55 A;  1YMP A;  2XGS A;  1EDU A;  4KXK B;  3TG5 A;  3UIP C;  3UMV A;  1Z5S C;  2OVF A;  2QYU A;  2L0I A;  1OWO A;  1LF8 A;  4HQD A;  4WUY A;  3APC A;  5BW8 C;  3EUV A;  3NB2 A;  3CKC A;  4FC8 A;  2PM6 A;  4HOT A;  5FTP A;  3QJZ A;  3DEO A;  5HQ8 A;  3TJP A;  1RZ4 A;  1DC2 A;  1O1S A;  4U95 D;  1FVH A;  3RRU A;  3SBS A;  2IF4 A;  2F0Y A;  3D9J A;  4PUC A;  3PEU B;  4J7W A;  3TAX A;  3RRM B;  4L1B A;  4GTO A;  4FA6 A;  4AP2 A;  2DYR E;  2EIN E;  3C3R A;  1DCQ A;  2IEJ A;  2ZGD A;  2LSU A;  5G2N A;  1N4R A;  3G2U A;  3CEQ A;  4RLY A;  4YVO A;  2B6C A;  1O5M A;  3HYM B;  2XS1 A;  3I5P A;  3RO2 A;  4F7A A;  1Q2Z A;  1TYQ G;  3V30 A;  4WNF A;  3MZL B;  2P9L G;  3FH5 A;  2V5Q C;  3DSW A;  4TXQ A;  3Q79 A;  2KCL A;  4GCO A;  3B7B A;  3LVQ E;  2WXR A;  1JWF A;  4JEU A;  2KAT A;  2FI7 A;  4O6F A;  3Q9N C;  3AG1 E;  3HIZ A;  4FHJ A;  2Y0B G;  5A23 A;  3V2X A;  1QQE A;  3KEA A;  1SVX A;  1KZP A;  3D9M A;  4B93 B;  3PEV B;  3CHQ A;  2LSV A;  2OCC E;  5A7D B;  5DBK A;  2CFZ A;  4OAV B;  2LNI A;  3HXF A;  3MJW A;  2LXL A;  4ILI A;  4Y6W A;  2F8Y A;  4AM9 A;  2AJA A;  1IXV A;  4GA1 A;  4XKC A;  3DSV A;  5DIZ A;  2H6I A;  4PS8 A;  4N39 A;  4U8Y D;  2WVI A;  2KZT B;  1UOH A;  4GZ6 A;  3CHR A;  3PE3 A;  2CHX A;  3UIO C;  3HHM A;  3Q9U C;  1LD8 A;  1AWC B;  4GML A;  1OCR E;  4GYW A;  3L08 A;  4LNB A;  3CVP A;  4KBQ A;  5BPP A;  4F3V A;  3ZPJ A;  4BTA A;  2L6B A;  3HVE A;  5CRV A;  2XEV A;  3CKB A;  4I9C A;  4BFR A;  2EIK E;  1SA5 A;  1LTX A;  4TUM A;  5LOZ A;  3UKU G;  3KS2 A;  1V55 E;  2WXF A;  2X38 A;  4EQF A;  2V0P A;  1BD8 A;  2NSZ A;  4I2Z A;  4F6R D;  4HRL A;  1Y6I A;  1N9A A;  4N3C A;  3D9N A;  2WQH A;  3CHS A;  3NZS A;  3ZFW A;  3EHM A;  1TN7 A;  2F8X K;  3D9L A;  2V4H C;  2GRN B;  2WXO A;  4FP7 A;  1N0R A;  3EDT B;  2XPY A;  1RW2 A;  3PS6 A;  3UT4 A;  2KC7 A;  4HOU A;  5B1A E;  2RKK A;  4WWP A;  4HBD A;  3SFZ A;  4G24 A;  1G3N B;  3HXC A;  3T5X A;  4CCA A;  3QAR A;  2IO2 C;  3ZYL A;  4EBA G;  1TNY A;  1MX4 A;  4CDM A;  2BED A;  3KSQ A;  3FUN A;  3ZN3 A;  1IYG A;  3UPV A;  3FUF A;  1UW4 B;  4B0Z A;  3TWV A;  5BNW A;  3JXI A;  4N3A A;  4JPS A;  3E33 A;  5BV0 A;  2IOL A;  1FT1 A;  4JB8 P;  1MX2 A;  2YHC A;  1UN9 A;  3EIQ C;  2VSN A;  3DEP A;  1S64 A;  4V3I A;  3MCX A;  2WMN A;  3HDX A;  1A17 A;  2XZD G;  3D9P A;  2WXL A;  4JW1 A;  3I4R B;  3CVL A;  1WM5 A;  2ILR A;  3FEX A;  3LYA A;  2PQN A;  3BQO A;  5EYP F;  3C5R A;  3ZXP A;  3CLJ A;  1ZBP A;  4EZL A;  5CCM A;  1BLX B;  4KT6 B;  3D9H A;  4BSX A;  2FO1 E;  3TXN A;  2NC9 A;  1U3D A;  1QYM A;  2QYJ A;  1JWG A;  2GRM A;  1H6P A;  3CVN A;  1QBQ A;  1INZ A;  4DX7 D;  5T8I A;  3Q7A A;  4ACK A;  3AS4 A;  3O4Z A;  3QWV A;  4GZD A;  4YDE A;  4IN3 B;  4H7X A;  4GMJ A;  2HR2 A;  4WND A;  3LDZ A;  3LXU X;  2WXG A;  3ONK A;  3K9I A;  3ZHE B;  1EPU A;  2DVW A;  5BUZ A;  5KNH D;  1BI7 B;  3CVV A;  2UY1 B;  1ELK A;  3FHE A;  4AEZ C;  4G2V A;  4MS6 A;  4GYO A;  4LG6 A;  3GZ2 A;  4XIF A;  3DXK G;  2V4L A;  5EID A;  1KPS B;  3OTN A;  3QWP A;  3ONL A;  3WXX A;  3PZ1 A;  2DWZ A;  4E85 A;  4AV7 A;  1YCS B;  5KJM A;  3E37 A;  4ATZ D;  4DX5 D;  3CGH A;  2L6J A;  4YND A;  4U07 A;  1HG5 A;  2QC9 A;  4W9R A;  4LER A;  4UWL A;  3PNL B;  3VTX A;  2XGM A;  2C0L A;  4AOF A;  2CG3 A;  4DUI A;  3FTV A;  1OCO E;  4TXR A;  3WG7 E;  2VYI A;  4I43 A;  1A5E A;  5AAR A;  2ION A;  5FQ8 A;  1UN8 A;  2WXH A;  2DBA A;  4UWG A;  3CVQ A;  4FUL A;  2X3M A;  3T8K A;  4GU5 A;  5JHB A;  4K5C A;  3IHY A;  1LD7 A;  2PQR A;  3CIA A;  1SA4 A;  3TWR A;  1ELW A;  2LAH A;  1XGW A;  2I1K A;  4OVU A;  4GYY A;  4A63 B;  2GRO B;  3U3W A;  1OUV A;  4DX6 D;  4I1O B;  3CVY A;  3X2Q E;  3PNT B;  4G23 A;  3DRA A;  4BEP A;  2YQ8 A;  2VGE A;  2FUL A;  2VGY A;  1OWM A;  2CG2 A;  2P2C P;  3U64 A;  3CK8 A;  4ACL A;  4K0R A;  5EYL A;  3ABM E;  5HRY A;  1N94 A;  3SGH A;  1OY3 D;  3GZ1 A;  2CHW A;  3RIB A;  2BUG A;  4M7C A;  1PY1 A;  1N4Q A;  4RG6 A;  2ZIS A;  1HXI A;  1YYH A;  3RO3 A;  1FPP A;  2FBN A;  4NUR A;  2R03 A;  3ZXS A;  3FUD A;  3UXG A;  4A1S A;  2J8S D;  3I3N A;  5ENO D;  4KZC A;  4J6I A;  2J4D A;  3ZKJ A;  2GRP B;  4N3B A;  2FEZ A;  3PZD A;  3SNX A;  4YDO A;  4MRU A;  2RG8 A;  3D9K A;  4CEM A;  4APO A;  3S7J A;  5FT9 A;  4TV3 A;  3MKQ A;  3PZ4 A;  3LVR E;  1EYH A;  3V2O A;  2J09 A;  5AQ7 A;  4U0S A;  4IUL A;  4CRW A;  3FTU A;  2PNN A;  2RFA A;  1W3B A;  3CSF A;  5AQB A;  1NP7 A;  1YA0 A;  3TL5 A;  1WDY A;  3L82 A;  4OAU C;  3ULQ A;  4J8D A;  5ENN A;  4HLE A;  3FUJ A;  2NXP A;  4GPM A;  4N2Q A;  4C0M A;  4GTP A;  2XGO A;  1OT8 A;  3FP3 A;  3ZRH A;  5CBN A;  3FTZ A;  4DX1 A;  1H2U A;  3HRA A;  4UQZ A;  1Z3Y A;  2KBX A;  2WQ7 A;  4BES A;  1TJC A;  2F37 A;  3ENE A;  4WNE A;  5AJL A;  3UIN C;  1NA3 A;  2AW6 A;  4F1P A;  1N54 A;  3DSU A;  4E6H A;  3JYS A;  4Q69 A;  4TXP A;  2R2L A;  5ARG A;  3OXG A;  4HXI A;  4JXT A;  1H6O A;  3EHQ A;  3PRE A;  5EIL A;  4HRM B;  5KBA A;  2VSO E;  3B13 A;  5CRU A;  5BV1 A;  1TN6 A;  5JJ6 A;  3UM3 A;  3QK0 A;  1PAQ A;  2E0I A;  2L9B A;  4O1O A;  3GYZ A;  4LNU D;  3PDN A;  4CT4 A;  1MYO A;  4AVX A;  2P9I G;  4G26 A;  4HLL A;  4J8F A;  1D9S A;  2XCB A;  5A6C A;  3Q78 A;  5J08 A;  1N11 A;  5CER B;  4Y6C A;  3DSX A;  2L0T B;  1DCE A;  2J49 A;  3RJV A;  2DIW A;  5KNG A;  4NQ0 A;  4KYO B;  3AU5 A;  3FTW A;  3RKV A;  3VLE A;  2VJ8 A;  4I6J A;  1NA0 A;  1D8E A;  2WPV A;  4UQY A;  4U8V D;  5EN5 D;  2ETB A;  1KT0 A;  4MKT A;  2DZO A;  4Z68 A;  3S2A A;  3HVE B;  1KLX A;  3UM0 A;  2FO7 A;  1QZ2 A;  4P29 A;  2WXK A;  5G04 J;  2AVP A;  5FZQ A;  3Q5M A;  3B95 A;  1Z3X A;  3AG4 E;  3QKY A;  5E75 A;  3LS8 A;  3SY2 A;  5T4Y A;  1JUQ A;  3URZ A;  3EU5 A;  4M3O A;  3RSE G;  1O1R A;  4TRQ A;  1K1A A;  4GTV A;  3ZVV A;  2VTB A;  3APF A;  5BT1 A;  4KVO A;  1WG0 A;  3W9F A;  2WXI A;  3QWW A;  3UQ3 A;  1OCZ E;  4DRX E;  3QB2 A;  3Q49 B;  3ASH A;  4U04 A;  3HXB A;  2P9U G;  3FU3 A;  2XEN A;  3QAQ A;  3MX3 A;  3V79 K;  3DPD A;  2XZT G;  2EIL E;  3PZ2 A;  1OCC E;  4RQI A;  4C48 B;  3Q73 A;  4DLQ A;  4UWF A;  3JQ1 A;  2UY1 A;  2J9Q A;  3PUK A;  2WB2 A;  1H2T C;  1NFI E;  4JL0 A;  3UM2 A;  1HH8 A;  3FUK A;  2GGF A;  3C98 A;  4L7T A;  2H6F A;  3HXE A;  1ZB1 A;  1S0P A;  1SZ9 A;  3C72 A;  3RK6 A;  4I6E A;  5AQ9 A;  4GZ5 A;  2QY7 A;  2PL2 A;  3FDH A;  4GMR A;  4JA9 A;  2DYS E;  3EIJ A;  1HF8 A;  1K3Z D;  2LUH A;  3ESL A;  3SQV A;  2OEW A;  3FUL A;  1AP7 A;  3QC1 A;  3F6Q A;  4CYM D;  4HS2 A;  4HB5 A;  1OWP A;  4GTT A;  3V31 A;  5B3S E;  4IYP A;  4H7Y A;  4I2W A;  4GAA A;  2ZU6 B;  4EHM A;  4LSZ E;  3SF4 A;  2A5E A;  2VGX A;  2Y1L E;  5BXU A;  4GA2 A;  4GTQ A;  3PVL A;  4U96 D;  1DVP A;  1GW6 A;  3FY4 A;  4R7L A;  2KCV A;  4QQI A;  3JUI A;  3L54 A;  4AXH A;  2P9S G;  2UWJ G;  2FF4 A;  3TG4 A;  2IOS A;  3ASF A;  3ULE G;  1S70 B;  3D9I A;  1E8W A;  2XS8 A;  2LXM A;  3AG2 E;  5H7P A;  5ENP D;  4HOR A;  4UWH A;  1HG2 A;  4F1S A;  3PRZ A;  1TR4 A;  1E8Z A;  3AS5 A;  4B89 A;  3ZW3 A;  5EIB E;  2Y4T A;  3E32 A;  5FIN A;  3CST A;  3ASO E;  1ELR A;  4BWR A;  3CHP A;  4YVQ C;  4ATG A;  5AAO A;  2I1J A;  4GB9 A;  3TWQ A;  2HO1 A;  3ABK E;  4GZ3 A;  5KJL A;  2WXP A;  2V5F A;  1L5J A;  1KZO A;  5CMW A;  2NYJ A;  2CFU A;  4JC8 A;  1V54 E;  3G2T A;  3SD5 A;  4DI3 A;  3FFL A;  2A4Z A;  2XEH A;  5FZS A;  3B7U X;  2VSY A;  1JCQ A;  1OWN A;  2QZA A;  2HE0 A;  2WMO A;  4LCT A;  4I6G A;  4NRH B;  5AYW D;  3DWL G;  4RSY A;  4XZ4 A;  4JHJ A;  3DBS A;  4GTR A;  1TJF A;  5B1B E;  3NBN B;  5EDS A;  4A3T A;  4I1M A;  4CDR A;  2LO6 A;  4G1T A;  3BG0 B;  2ETA A;  4EZJ A;  2WXM A;  3TWU A;  4J8Y A;  4LUN U;  1ZU2 A;  3PE4 A;  3SI5 A;  2PM7 A;  5KJK A;  2C2L A;  4LNG A;  4ANW A;  5JHA A;  1Z6T A;  3TWX A;  3BU8 A;  3B7R L;  3MEK A;  2YHE A;  3FUM A;  2R05 A;  4BT8 A;  1QNF A;  4MLP A;  2MOW A;  1Y8M A;  4BX9 A;  2XPZ A;  4BET A;  3IV0 A;  4GPK A;  1X5B A;  3EHN A;  3VTY A;  3KSL A;  2I6H A;  3UUX A;  1IHB A;  3UI2 A;  2V8S E;  2AXV A;  2B0O E;  4LEU A;  2VQ2 A;  3U4T A;  5EX0 A;  4J8E A;  3R7Q A;  2EQX A;  3N71 A;  4PH4 B;  5JJ7 A;  3L22 A;  2Q7F A;  3CK9 A;  2DZN A;  1O1T A;  2RFM A;  3ZEF A;  2XEE A;  3RU0 A;  1U2V G;  4U8H A;  3PZ3 A;  3R7R A;  1FCH A;  3SZ7 A;  4UWK A;  1JCR A;  5LX8 A;  3LEW A;  4FHK A;  2VGX B;  5AIJ A;  2WM9 A;  2I9C A;  4I17 A;  3KD7 A;  1N4S A;  5JMN D;  3AJI A;  3CVX A;  4Q94 A;  1N0Q A;  3IEG A;  1NL4 A;  2CHZ A;  2YIN A;  4HNA D;  4ME2 A;  1H6K A;  4JA7 A;  2ZXW E;  1XNF A;  2C0M A;  3E34 A;  4URK A;  4DJA A;  4A1G A;  3FUE A;  3Q15 A;  4O1P A;  3FUH A;  3JCK C;  2MYO A;  4GZC A;  4ZFH A;  5AN8 A;  3FEY A;  4UI9 J;  2JLB A;  5D0O D;  3D3M A;  1NI1 A;  3NAW A;  4FLB A;  2X6K A;  3ZIM A;  3R9A B;  3O48 A;  1X81 A;  1NZN A;  2IQC A;  1K8K G;  3ZYK A;  3DPY A;  3Q75 A;  2OEV A;  3S7D A;  3Q7F A;  4WWO A;  4F53 A;  2X6F A;  1D8D A;  3IXE A;  4HVB A;  4LRZ A;  1E7V A;  3FTY A;  3NF1 A;  5FWQ A;  2LAI A;  4QFV A;  3APD A;  2J4B A;  4N2S A;  2XHE A;  1UJK A;  3NQP A;  3CV0 A;  1E8Y A;  5HS0 A;  5E76 A;  3BEE A;  2OV8 A;  5D66 A;  3ML9 A;  4U0Z A;  4BER A;  4WWN A;  5FJY A;  3QNK A;  2VTB B;  5ENS D;  5G05 C; 
#chains in the Genus database with same CATH homology
 1SA5 A;  1LTX A;  1TNU A;  3DSW A;  3PZ3 A;  4GTT A;  3DSU A;  3Q79 A;  1JCR A;  4GTS A;  3HXD A;  4GTM A;  4EHM A;  1N4S A;  1TN8 A;  1TNB A;  3EU5 A;  4L9P A;  2R2L A;  1JCQ A;  4YDO A;  1O1R A;  1S63 A;  1NL4 A;  2H6G A;  4GTV A;  3EUV A;  1N9A A;  4GTR A;  3PZ4 A;  4GTQ A;  1TN7 A;  1TN6 A;  3E34 A;  1KZP A;  3HXB A;  1QBQ A;  1MZC A;  1LD7 A;  1O1S A;  1SA4 A;  3PZ2 A;  3HXF A;  4LNG A;  3Q73 A;  3Q7A A;  3HXC A;  1NI1 A;  1JCS A;  2F0Y A;  3Q78 A;  4YDE A;  3DSS A;  3DSV A;  2H6I A;  1X81 A;  3DSX A;  1TNY A;  3DRA A;  1DCE A;  1FT2 A;  2BED A;  3KSQ A;  4GTO A;  2H6F A;  3DPY A;  3Q75 A;  3Q7F A;  3HXE A;  3E32 A;  4GTP A;  1D8D A;  3C72 A;  3SFY A;  2ZIR A;  3DST A;  3KSL A;  1LD8 A;  2IEJ A;  1TNO A;  3SFX A;  1N4P A;  1N4R A;  1D8E A;  3E33 A;  4LNB A;  3E30 A;  1N94 A;  4MBG A;  1FT1 A;  1N4Q A;  1N95 A;  1KZO A;  1O5M A;  2ZIS A;  1O1T A;  1TNZ A;  1FPP A;  1S64 A;  3PZ1 A;  2H6H A;  3E37 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...