2H6HA

Y365f protein farnesyltransferase mutant complexed with a farnesylated ddptasacvls peptide product at 1.8a
Total Genus 133
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
133
sequence length
315
structure length
315
Chain Sequence
FVSLDSPSYVLYRDRAEWADIDPVPQNDGPNPVVQIIYSDKFRDVYDYFRAVLQRDERSERAFKLTRDAIELNAANYTVWHFRRVLLKSLQKDLHEEMNYITAIIEEQPKNYQVWHHRRVLVEWLRDPSQELEFIADILNQDAKNYHAWQHRQWVIQEFKLWDNELQYVDQLLKEDVRNNSVWNQRYFVISNTTGYNDRAVLEREVQYTLEMIKLVPHNESAWNYLKGILQDRGLSKYPNLLNQLLDLQPSHSSPYLIAFLVDIYEDMLENQCDNKEDILNKALELCEILAKEKDTIRKEYWRYIGRSLQSKHST
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protein farnesyltransferase/geranylgeranyltransferase type I
publication title Conversion of protein farnesyltransferase to a geranylgeranyltransferase.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 133
structure length 315
sequence length 315
ec nomenclature ec 2.5.1.58: Protein farnesyltransferase.
pdb deposition date 2006-05-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01239 PPTA Protein prenyltransferase alpha subunit repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.120 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Protein prenylyltransferase 2h6hA00
2F0YA 3Q73A 4GTPA 1QBQA 4GTMA 3HXDA 2H6FA 1O1TA 1N4QA 1N95A 1TNUA 2IEJA 1NL4A 4GTQA 3DSUA 3E33A 3Q7AA 4LNGA 2BEDA 3E30A 3DPYA 3EU5A 4GTOA 1SA5A 3Q79A 2ZISA 2ZIRA 3DSXA 1S63A 1LTXA 1SA4A 1X81A 2H6HA 3PZ1A 3DRAA 3HXFA 3EUVA 3HXBA 4EHMA 2H6GA 3Q7FA 3SFYA 4L9PA 4GTTA 4GTVA 1O1RA 3DSWA 1O1SA 1TNBA 3DSSA 3DSTA 4YDOA 1D8EA 1NI1A 1O5MA 1TNOA 1FT2A 3SFXA 3KSLA 2H6IA 2R2LA 1D8DA 1S64A 1KZPA 1N4RA 1LD7A 1JCQA 1N4SA 3PZ4A 3E34A 3Q78A 1JCRA 1N94A 3E37A 3Q75A 3C72A 3KSQA 4GTSA 1TN7A 1TN6A 1FPPA 1TN8A 3E32A 1KZOA 1DCEA 3HXEA 1N9AA 3PZ3A 1LD8A 1N4PA 3DSVA 3PZ2A 4MBGA 4GTRA 4LNBA 1MZCA 1JCSA 3HXCA 1FT1A 1TNYA 1TNZA 4YDEA
chains in the Genus database with same CATH superfamily
4GTPA 3V30A 3PDNA 1N0RA 4XIFA 5BW8C 1DC2A 2XCCA 4BT8A 4B0ZA 4DLOA 2XPZA 3AG3E 4EQFA 1Z6TA 5D66A 3EU9A 1SW6A 2PM7A 4IYPA 4BTBA 3Q79A 3SQVA 1NA3A 4FA6A 1E8WA 1SA4A 3CVUA 4YNDA 4DUIA 5HQ8A 1RZ4A 1TEZA 4CEMA 3EDTB 2VTBB 4X8QA 2XQ0A 1D8EA 3G2WA 4WNGA 2CHWA 4J8DA 3L82A 1PY1A 3PRZA 5AJDA 3L16A 3MYVA 3QK0A 1E8YA 3HDXA 4JA9A 2R2LA 3S7BA 1NA0A 2FULA 1NFIE 3FH5A 4HOSA 2WXOA 1OUVA 3CVYA 4BERA 4NIKA 3V2OA 4W9RA 1SQMA 1JWGA 4BY6A 4CYMD 5G2NA 3E37A 2BF0X 2GW1A 3DWLG 4BX9A 1TN7A 3UINC 5LOZA 2J07A 2AVPA 4B8AA 4PS8A 4B93B 3FH8A 2I2OA 5AN8A 4D10C 4WNFA 3AG2E 2DIWA 5AYWD 2IY0C 4HRMB 3UM0A 5J90A 4GTMA 3OAWA 4OVVA 3ZYKA 4K03A 2P9UG 3VLDA 3APCA 3P1UA 5ANRA 4U8YD 3ZW3A 4C0MA 3WXXA 3Q15A 3PNLB 2ILRA 1BPOA 4CDRA 4XKCA 2QY7A 3S7JA 2QFCA 3JUIA 3D9MA 5FZSA 1W3BA 2E2EA 2UWJG 2NYJA 4F7AA 3APDA 4GZDA 4E6HA 5FQ8A 2Y4TA 3HXFA 4F53A 3IXEA 4QFVA 3HXBA 1UJKA 4UWLA 3ABKE 4GTTA 4GTVA 2J08A 3MZLB 4DRXE 3DSWA 1ELRA 4FLBA 3ZYQA 1TNBA 3DSSA 1P5QA 1YYHA 3ASDA 4Y6WA 4N2QA 1HF8A 2C0LA 4CRWA 4A63B 1E8ZA 4ZHBA 5E76A 2PQNA 2OEWA 4K5BA 1LF8A 2HE0A 3ASFA 3HVEB 4LG6A 4FJZA 1E90A 3FEXA 2P9KG 1WG0A 5B1AE 2HR2A 3VLEA 4DX7D 3Q47B 3FUJA 3L9TA 3FP3A 5AQ9A 4A1SA 3UIPC 5C2YA 4BTAA 2VJ8A 3RKVA 4F6RD 3UQ3A 1SZ9A 1TNZA 4JB8P 4G8LA 2R05A 3UTMA 4YVQC 1U3CA 2XS1A 2WXPA 2XRZA 5ITZF 3UIOC 3S7DA 4HLLA 2BTDA 1VDYA 4Q96A 2FF4A 3CHPA 3ASGA 3E30A 4XI0A 3AS5A 3ZUVB 4G23A 3TWSA 3W9FA 3ZGQA 3CHOA 5HRYA 2OOEA 4I6EA 3C5RA 2EIME 3I5PA 3EUVA 4O60A 3ASNE 4DJAA 4HNAD 1BU9A 4I9CA 2RFMA 3GZSA 1N54A 1MX4A 1UN9A 3G2VA 5FQ4A 3CKCA 3T5VA 1UJJA 1O5MA 3ZVVA 3LCAA 2V5FA 2I1JA 4HFGA 4GMLA 4CDNA 4HVBA 4WAFA 4I1AA 4UI9C 2XCBA 5G05J 2AXVA 4U63A 4TUUA 5CHEE 2ETBA 3AG1E 4LNUD 2DWZA 3JYSA 4MBGA 1KLXA 4GTRA 1JCSA 4MS6A 2RG8A 4NURA 4ANXA 3FY4A 2KCLA 2X6KA 3HYMB 2X6IA 2WQ6A 5A23A 4PS3A 3TWVA 4I1MA 3JQ1A 2DCPA 4G8KA 2V0PA 3QNKA 3B7BA 3ONKA 2IEJA 3U66A 2EINE 4GTQA 3Q7AA 5AQ7A 3TWRA 4LNGA 2IQCA 3N71A 3U4TA 2I6HA 4EZJA 2J9QA 3V2XA 4F1SA 3CQGB 4G24A 4HOUA 5KJLA 5G55A 3B7RL 2XEVA 4JA7A 2DBAA 1KPSB 2WXIA 2WMNA 4HLEA 1E96B 3ABME 2GRMA 3G2UA 5BT1A 4DX6D 3MJWA 3KD7A 2PM6A 4HBDA 4AVXA 4K0RA 2EIJE 4HI9A 3ZXSA 1MQSA 2WQ7A 3D9KA 1XGWA 3ESLA 2WXJA 2V8SE 1U3DA 4FC8A 1JCRA 3HG0D 3SY2A 4RVBA 4WWPA 5JMND 3C72A 4CDMA 5BNWA 3FWVA 3FTVA 4GCNA 2XEEA 5KNHD 4OAUC 3PZ2A 4JC8A 1FCHA 2QZAA 4UUCA 2NSZA 1HG5A 2LSUA 3FU3A 3ULEG 2VSYA 2YHCA 2JEKA 5AAOA 3SHFA 3FUEA 3SGHA 2WXQA 5CRUA 4UWHA 1INZA 3FU0A 3ZN3A 3E4BA 3JQ0A 4GTOA 3ZU7B 4HQDA 1BI8B 2BKKB 1EF1C 5JHAA 4JHRA 3FTWA 3SZ7A 4N5QA 2C0MA 1IYGA 2IO2C 2UY1A 3Q7FA 5E75A 2X6FA 3RRMB 3BU8A 2HM8A 1O1SA 4GCOA 3CSTA 4YDOA 5CEDB 4KMOA 1MYOA 3KEZA 3L17A 4EPZA 4DX2A 4AEZC 3NZSA 3LJ3A 1JCQA 4V3IA 5ENTD 1L5JA 3CKBA 3EHNA 2KXPC 3ZPJA 4JXTA 5ENSD 3D9PA 5A7DB 4N3AA 3BG0B 4GTSA 2OCCE 2I9CA 3KEAA 1TN6A 3E32A 4I1OB 3FTUA 3ZEFA 4FULA 2CG3A 1MJ0A 4G1TA 3ZFWA 4O1PA 3FTSA 2WXMA 4BFRA 3QC1A 4ABNA 4GZ3A 4YDEA 4KZ0A 3UUXA 3GYZA 3SFZA 4BWRA 3O48A 4LSZE 5ENOD 1HX8A 3J5PA 1NL4A 2J4BA 4B8CB 2FBNA 3B7UX 1DCQA 1UN8A 3VTXA 3LY7A 2WXKA 3IKOB 3I4GA 3ASHA 5AQBA 1S63A 4APFA 5ARFA 4G11A 1X81A 5FZRA 4CT0A 2C2LA 4NACA 4JZYA 3FTXA 2WB2A 4TV3A 2FEZA 4J8FA 5CCMA 4AIFA 2VSOE 3RAUA 5CBNA 4MRUA 3APFA 2H6IA 2YHEA 3O4ZA 5D0OD 1HXIA 1MX6A 2WXGA 3NF1A 3DPDA 4HRLA 1X5BA 3CK8A 2P58C 3CHMA 3NOGD 3FTYA 4TRQA 5FZQA 4UI9J 5BV0A 4GMRA 2XGOA 2P9PG 2A5EA 3PUJA 4B94A 4KT6B 4U0ZA 5KBAA 2B0OE 2KATA 5T4YA 1DVPA 1MZCA 1HFAA 3UT8A 1YA0A 4NQ0A 4MKTA 2F37A 4RG6A 4L2LA 5HS0A 3CQCB 4KVOA 4EBAA 1GW6A 2IOLA 1N4QA 5LFAA 4L7TA 2AXUA 3FULA 3I4RB 4FLHA 3CHSA 4LUNU 4L2YA 2P9IG 4U7EB 3FU6A 4JVSA 3HVEA 2ETAA 3CV0A 4DX5D 1WM5A 5EN5D 3FUNA 2DZOA 4XKBA 4Y6CA 2AW6A 5EYPF 1H6KA 5BPPA 4L9PA 3CR3A 1O1RA 2KZTB 2WM9A 3LVRE 3SNXA 1WY6A 2LSVA 1G3NB 2IONA 1ELKA 3LPZA 1DNPA 2V4HC 3D9JA 4EECA 3DBSA 5ENNA 3FU5A 1OCCE 3KAEA 1S64A 1NP7A 4BSXA 3RSEG 2F8XK 2IF4A 3MV3B 4N3CA 4IRUA 1TJCA 3D9OA 1FPPA 2VGXA 5KCMA 3JXJA 1HO8A 3TJPA 3CVXA 3PZ3A 3SD5A 4H7XA 1SZAA 4BEPA 2IO3C 2Y1LE 4GA0A 3R7RA 3LVQE 4LRZA 2P2CP 4RLYA 4YDWA 3LJNA 3ML9A 2WPVA 2V4LA 1SA5A 3S2AA 2PQRA 2ZISA 4HRNA 5ANLA 4HS2A 3PZ1A 3DRAA 4AM9A 5EX3A 5CBOA 4I43A 2B6CA 3AG4E 5ENPD 3RRNB 1OT8A 2LO6A 4J8EA 2MRIA 3DSTA 1IHBA 1TNOA 3QDNA 5FQ6A 5G04J 2YQ8A 2GROB 3EHQA 2A4ZA 4Q94A 5EDSA 3Q4AB 3UX4A 1QZ2A 3QB2A 5HI7A 4FHJA 3Q78A 4ILGA 4AP2A 1IQRA 3FUMA 4GU5A 3D9NA 4LCTA 3BQOA 1H0AA 3CSFA 1LD8A 1H2TC 1E7UA 3P2BA 4P29A 4N2SA 3ISMC 5CRVA 3L22A 5LP0A 1B89A 2F0YA 4IULA 1HE8A 3HXDA 3TWXA 4URKA 3NZUA 3LEWA 4QQIA 3KS2A 3U64A 3MGBA 3TL5A 1EPUA 2BEDA 4U8HA 4HOTA 2DYRE 4GPKA 2XENA 4N3BA 3W9GA 2ZIRA 1IKND 2WXHA 5D0QD 5CMYA 1E7VA 3IHVA 4EZKA 2CHZA 3SFYA 3B7SA 4ACKA 2MHKA 3C3RA 4F1PA 4BX8A 4AY6A 3TXMA 2R59A 1FT2A 3PS6A 3SFXA 2XHEA 1FVFA 2V5QC 1K3ZD 2DZNA 3V79K 2OV8A 5FWQA 1K1BA 4J8YA 1QQEA 5IY5E 3LXUX 4ME2A 2DYSE 3TGOA 3MA5A 4I9EA 3VTYA 3MV2B 3IBEA 4FP7A 4G2VA 5KJNA 1YCSB 1ZB1A 5CECB 1QYMA 1O1TA 2CFUA 2VGEA 3ONLA 1OWPA 3WG7E 5ARGA 1KT1A 5AARA 4DLQA 5J08A 3FFLA 3ZIMA 3ZHEA 3EHMA 2GRNB 4U96D 4YDYA 1Y8MA 3CIAA 4E85A 2VSNA 2WQHA 2L0IA 5BV1A 3SBTB 3L13A 4N5CA 3SO8A 3FUIA 3DSXA 3UMVA 2A5UA 4JPSA 4K5AB 4ANWA 2X6JA 3Q49B 1E8XA 3EIJA 3LDZA 3IEGA 4GA2A 4OYSA 2EQXA 3CVWA 4YVOA 1N0QA 1OXJA 5LX8A 4APOA 4GZ5A 4O6FA 3BUAA 2X6HA 2QC9A 1N4SA 2X38A 3OTNA 3E34A 2BUGA 3R7QA 3ML8A 3NOCD 5AENA 4DI3A 3TG4A 5LCWC 2PZIA 4JD2G 4WNEA 2RKKA 3LY9A 4J0UA 1TJFA 5AQAA 4O1OA 1FT1A 3AS8A 5DBKA 5EYLA 4RG9A 3JXIA 3FHEA 2XS8A 4HOQA 3GZ2A 2GRRB 2WXFA 2H6FA 4J8SA 1JUQA 4G25A 1OCOE 1HH8A 2XRYA 2IOSA 1BD8A 3URZA 5FIOA 3S7FA 3T8MA 4PDXA 3CLJA 4LERA 4PUCA 4WNDA 4HXIA 3B13A 4M7CA 4ILHB 3D9LA 3T5XA 3ESKA 5EX0A 5CERB 2VTBA 3QJZA 5EIBE 4HORA 2ETCA 2KCVA 1D9SA 2XZDG 2XPYA 3G2SA 2QYJA 4R7LA 4XI9A 3JUEA 3EIQC 5JA4D 1JWFA 3K9IA 5A6CA 2WVIA 5EKQD 3MKQB 4AY5A 4BT9A 2L9BA 1JPLA 2R17C 1BLXB 5G05C 4CGVA 4ZFHA 4RSYA 4C0EA 5JJ6A 2KM4A 2PL2A 1N4RA 3ABLE 2WXRA 2Y0BG 3C3OA 2Y3AA 2IJGX 1NZNA 4C48B 2OVBA 3ULYA 1TYQG 2HYZA 3AU4A 3C98A 3HXEA 5FTPA 2XEHA 1OCZE 3OXFA 5M72A 4XZ4A 4J7WA 3QOUA 5KNGA 1EDUA 4GAAA 3NBNB 1XNFA 2L6BA 4UWFA 3CGHA 2KZTA 4ILIA 3Q73A 5EILA 3Q9UC 4L1BA 2L0TB 5ENRD 4TUMA 3BG1B 1A5EA 4L23A 3JCKC 1N95A 2GRQB 4K5CA 3U3WA 3D9IA 4Q69A 3DEOA 3DSUA 2J49A 2CG2A 4KVMA 4M3OA 1LTXA 1SVXA 3NQPA 3TAXA 1H2UA 1FVHA 3ZNGA 5BUZA 2J4DA 2WXLA 1V54E 5B3SE 4GZ6A 3ZXPA 3UT7A 2HO1A 5BXUA 2E0IA 1KT0A 1NI1A 3RO2A 1RW2A 1OWOA 2FO7A 2R02A 4JEUA 3B7TA 3D9HA 4EBAG 3CHRA 1LD7A 4I2WA 5FINA 4KXKB 1H19A 3PE3A 2GRPB 1Z3YA 4UWGA 1S70B 4RQIA 2LXLA 5CMWA 1V55E 4HB5A 1N9AA 3QWWA 5JJ7A 2EILE 2RD0A 4ANVA 3EJNA 3T9KA 3FUKA 4NRHB 4U8VD 4HI8A 4BESA 2LAHA 4A3VA 3R9AB 1AP7A 3PNTB 1PAQA 4TXQA 4GA1A 3QARA 3VLFA 4CT4A 5AIJA 2LUHA 4DK5A 2JLBA 3MKRA 3TWWA 1YMPA 2P9SG 4U95D 3RO3A 4MLPA 4I6GA 4JW1A 3DPYA 4DX1A 2WXNA 4CCAA 2CHXA 4WUYA 2FO1E 4ANUA 2ONDA 4UI9K 1H2VC 4I6JA 4A3TA 1WAO1 4JHJA 1K8KG 1ELWA 3LYAA 1UW4B 2VYIA 2MYOA 3EHRA 3IV0A 5CCLA 5JJTA 4H7YA 5JHBA 2QYUA 4ACLA 2NXPA 1A17A 2RFAA 4Z68A 3CEQA 3TWTA 1D8DA 2XPIA 2PNNA 5H7PA 4CGWA 2LNIA 3IHYA 2AXZA 5FQ7A 4WWOA 4GYOA 1N94A 1MHQA 3HIZA 4U0UA 4B89A 5FJYA 3SF4A 1TN8A 5B1BE 1KZOA 3T8KA 5LCWJ 3FTZA 3UM1A 2OEVA 4JL0A 3MCXA 2AJAA 2IU1A 3F6QA 3HXCA 4GMJA 4G26A 5FT9A 2I1KA 4PH4B 4GZCA 3J5QB 2FI7A 1QBQA 2VGXB 2GRLA 2LAIA 1HS6A 3RK6A 3FH7A 2EIKE 3D3MA 3E33A 3BEEA 4A1GA 1BI7B 3PUKA 3ZKJA 4IN3B 5C1DA 3QWVA 3EU5A 5T3RA 4AOFA 3MX3A 3OXGA 2LXMA 1UG3A 4U04A 4F3VA 2AWIA 3AJIA 5KJKA 3L54A 3DEPA 4N39A 1UOHA 4J6IA 3GW4A 4UQXA 4LEUA 2VGYA 4GYWA 4JEHA 3TG5A 1Y6IA 3UXGA 3NAWA 3KSLA 3ZYLA 5ENQD 3CK7A 1Q2ZA 2XZTG 1ZU2A 4KBQA 3R9MA 2YINA 3DXKG 4KZCA 3PZ4A 2YNQA 2Y69E 2NC9A 1N52A 3HHMA 3Q75A 3KSQA 2CFZA 3FUDA 4KYOB 1OY3D 2P9LG 4GPMA 3LKUA 3FUHA 1TR4A 2R03A 2ZGDA 4TXRA 3TWQA 2Q7FA 2ZU6B 1TNUA 2XGSA 5D2MC 3UI2A 3Q9NC 2J8SD 2JABA 4U07A 1H6OA 2KCKA 3TWUA 3QKYA 1MX2A 1OCRE 4C9BB 2WMOA 3CVNA 3GZ1A 1N11A 1OWLA 4U0SA 1H6PA 2H6HA 3MEKA 3UPVA 2XGMA 4CZ2D 5KJMA 3CHQA 1K1AA 4OAVB 3AS4A 3SBSA 3CVQA 1IXVA 3OXLA 5T8IA 1OWNA 1WDYA 4UQZA 3RU0A 1QNFA 3AAAC 2VSXE 1Z3XA 4I2ZA 4XE0A 3RIBA 3QAQA 3UKUG 3UT4A 2KC7A 5BXOA 2GGFA 2IFUA 4EZLA 2J09A 3PVLA 4FU3A 4AV7A 1PC2A 3PE4A 2DVWA 1N4PA 2M63A 4GYYA 5DIZA 3ZRHA 2R5SA 4LNBA 5KWDA 1TNYA 3AU5A 2VQ2A 3FDHA 4BSZB 1Z5SC 3RRUA 3V31A 4AJWA 1U2VG 3MKQA 2ZGGA 4GB9A 2OVFA 1OWMA 3PZDA 4AXHA 4UWKA 3RJVA 3QWPA 2Y4UA 3LY8A 3PREA 2ZXWE 4FHKA 3ULQA 3PEVB 3CVPA 1HU3A 2KBXA 2MOWA 3B95A 4TXPA 4PS7A 4FADA 3TXNA 2X3MA 1IQUA 3FUFA 5G04C 4UQYA 1IHGA 3ZHEB 1AWCB 3CVLA 3FEYA 3ENEA 4EHMA 2H6GA 4ATZD 4XEIG 3L08A 3X2QE 4I17A 2L6JA 3UM2A 3HRAA 3DXMG 1ZBPA 3UM3A 2BKGA 1KZPA 3C3QA 3CK9A 4FJYA 1HG2A 3I3NA 3PEUB 4ATGA 4A55A 5HKPA 3Q5MA 3ASOE 4DI4A 4DPRA 1EYHA 4JHKA 3ZYMA 1S0PA 3NB2A 3SI5A 2F8YA 3UKRG 3G2TA 2UY1B 1DCEA 5AJLA 2P9NG 3CVVA 3DSVA 4BETA 1HZ4A 4WWNA 3LS8A 5CEAA 3L6AA 5EIDA 3PH0C 4OVUA 3U9WA 4XX5A
chains in the Genus database with same CATH topology
2F0YA 3Q73A 4GTPA 1QBQA 4GTMA 3HXDA 2H6FA 1O1TA 1N4QA 1N95A 1TNUA 2IEJA 1NL4A 4GTQA 3DSUA 3E33A 3Q7AA 4LNGA 2BEDA 3E30A 3DPYA 3EU5A 4GTOA 1SA5A 3Q79A 2ZISA 2ZIRA 3DSXA 1S63A 1LTXA 1SA4A 1X81A 2H6HA 3PZ1A 3DRAA 3HXFA 3EUVA 3HXBA 4EHMA 2H6GA 3Q7FA 3SFYA 4L9PA 4GTTA 4GTVA 1O1RA 3DSWA 1O1SA 1TNBA 3DSSA 3DSTA 4YDOA 1D8EA 1NI1A 1O5MA 1TNOA 1FT2A 3SFXA 3KSLA 2H6IA 2R2LA 1D8DA 1S64A 1KZPA 1N4RA 1LD7A 1JCQA 1N4SA 3PZ4A 3E34A 3Q78A 1JCRA 1N94A 3E37A 3Q75A 3C72A 3KSQA 4GTSA 1TN7A 1TN6A 1FPPA 1TN8A 3E32A 1KZOA 1DCEA 3HXEA 1N9AA 3PZ3A 1LD8A 1N4PA 3DSVA 3PZ2A 4MBGA 4GTRA 4LNBA 1MZCA 1JCSA 3HXCA 1FT1A 1TNYA 1TNZA 4YDEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2F0Y A;  3Q73 A;  4GTP A;  1QBQ A;  4GTM A;  3HXD A;  2H6F A;  1O1T A;  1N4Q A;  1N95 A;  1TNU A;  2IEJ A;  1NL4 A;  4GTQ A;  3DSU A;  3E33 A;  3Q7A A;  4LNG A;  2BED A;  3E30 A;  3DPY A;  3EU5 A;  4GTO A;  1SA5 A;  3Q79 A;  2ZIS A;  2ZIR A;  3DSX A;  1S63 A;  1LTX A;  1SA4 A;  1X81 A;  2H6H A;  3PZ1 A;  3DRA A;  3HXF A;  3EUV A;  3HXB A;  4EHM A;  2H6G A;  3Q7F A;  3SFY A;  4L9P A;  4GTT A;  4GTV A;  1O1R A;  3DSW A;  1O1S A;  1TNB A;  3DSS A;  3DST A;  4YDO A;  1D8E A;  1NI1 A;  1O5M A;  1TNO A;  1FT2 A;  3SFX A;  3KSL A;  2H6I A;  2R2L A;  1D8D A;  1S64 A;  1KZP A;  1N4R A;  1LD7 A;  1JCQ A;  1N4S A;  3PZ4 A;  3E34 A;  3Q78 A;  1JCR A;  1N94 A;  3E37 A;  3Q75 A;  3C72 A;  3KSQ A;  4GTS A;  1TN7 A;  1TN6 A;  1FPP A;  1TN8 A;  3E32 A;  1KZO A;  1DCE A;  3HXE A;  1N9A A;  3PZ3 A;  1LD8 A;  1N4P A;  3DSV A;  3PZ2 A;  4MBG A;  4GTR A;  4LNB A;  1MZC A;  1JCS A;  3HXC A;  1FT1 A;  1TNY A;  1TNZ A;  4YDE A; 
#chains in the Genus database with same CATH topology
 4GTP A;  3V30 A;  3PDN A;  1N0R A;  4XIF A;  5BW8 C;  1DC2 A;  2XCC A;  4BT8 A;  4B0Z A;  4DLO A;  2XPZ A;  3AG3 E;  4EQF A;  1Z6T A;  5D66 A;  3EU9 A;  1SW6 A;  2PM7 A;  4IYP A;  4BTB A;  3Q79 A;  3SQV A;  1NA3 A;  4FA6 A;  1E8W A;  1SA4 A;  3CVU A;  4YND A;  4DUI A;  5HQ8 A;  1RZ4 A;  1TEZ A;  4CEM A;  3EDT B;  2VTB B;  4X8Q A;  2XQ0 A;  1D8E A;  3G2W A;  4WNG A;  2CHW A;  4J8D A;  3L82 A;  1PY1 A;  3PRZ A;  5AJD A;  3L16 A;  3MYV A;  3QK0 A;  1E8Y A;  3HDX A;  4JA9 A;  2R2L A;  3S7B A;  1NA0 A;  2FUL A;  1NFI E;  3FH5 A;  4HOS A;  2WXO A;  1OUV A;  3CVY A;  4BER A;  4NIK A;  3V2O A;  4W9R A;  1SQM A;  1JWG A;  4BY6 A;  4CYM D;  5G2N A;  3E37 A;  2BF0 X;  2GW1 A;  3DWL G;  4BX9 A;  1TN7 A;  3UIN C;  5LOZ A;  2J07 A;  2AVP A;  4B8A A;  4PS8 A;  4B93 B;  3FH8 A;  2I2O A;  5AN8 A;  4D10 C;  4WNF A;  3AG2 E;  2DIW A;  5AYW D;  2IY0 C;  4HRM B;  3UM0 A;  5J90 A;  4GTM A;  3OAW A;  4OVV A;  3ZYK A;  4K03 A;  2P9U G;  3VLD A;  3APC A;  3P1U A;  5ANR A;  4U8Y D;  3ZW3 A;  4C0M A;  3WXX A;  3Q15 A;  3PNL B;  2ILR A;  1BPO A;  4CDR A;  4XKC A;  2QY7 A;  3S7J A;  2QFC A;  3JUI A;  3D9M A;  5FZS A;  1W3B A;  2E2E A;  2UWJ G;  2NYJ A;  4F7A A;  3APD A;  4GZD A;  4E6H A;  5FQ8 A;  2Y4T A;  3HXF A;  4F53 A;  3IXE A;  4QFV A;  3HXB A;  1UJK A;  4UWL A;  3ABK E;  4GTT A;  4GTV A;  2J08 A;  3MZL B;  4DRX E;  3DSW A;  1ELR A;  4FLB A;  3ZYQ A;  1TNB A;  3DSS A;  1P5Q A;  1YYH A;  3ASD A;  4Y6W A;  4N2Q A;  1HF8 A;  2C0L A;  4CRW A;  4A63 B;  1E8Z A;  4ZHB A;  5E76 A;  2PQN A;  2OEW A;  4K5B A;  1LF8 A;  2HE0 A;  3ASF A;  3HVE B;  4LG6 A;  4FJZ A;  1E90 A;  3FEX A;  2P9K G;  1WG0 A;  5B1A E;  2HR2 A;  3VLE A;  4DX7 D;  3Q47 B;  3FUJ A;  3L9T A;  3FP3 A;  5AQ9 A;  4A1S A;  3UIP C;  5C2Y A;  4BTA A;  2VJ8 A;  3RKV A;  4F6R D;  3UQ3 A;  1SZ9 A;  1TNZ A;  4JB8 P;  4G8L A;  2R05 A;  3UTM A;  4YVQ C;  1U3C A;  2XS1 A;  2WXP A;  2XRZ A;  5ITZ F;  3UIO C;  3S7D A;  4HLL A;  2BTD A;  1VDY A;  4Q96 A;  2FF4 A;  3CHP A;  3ASG A;  3E30 A;  4XI0 A;  3AS5 A;  3ZUV B;  4G23 A;  3TWS A;  3W9F A;  3ZGQ A;  3CHO A;  5HRY A;  2OOE A;  4I6E A;  3C5R A;  2EIM E;  3I5P A;  3EUV A;  4O60 A;  3ASN E;  4DJA A;  4HNA D;  1BU9 A;  4I9C A;  2RFM A;  3GZS A;  1N54 A;  1MX4 A;  1UN9 A;  3G2V A;  5FQ4 A;  3CKC A;  3T5V A;  1UJJ A;  1O5M A;  3ZVV A;  3LCA A;  2V5F A;  2I1J A;  4HFG A;  4GML A;  4CDN A;  4HVB A;  4WAF A;  4I1A A;  4UI9 C;  2XCB A;  5G05 J;  2AXV A;  4U63 A;  4TUU A;  5CHE E;  2ETB A;  3AG1 E;  4LNU D;  2DWZ A;  3JYS A;  4MBG A;  1KLX A;  4GTR A;  1JCS A;  4MS6 A;  2RG8 A;  4NUR A;  4ANX A;  3FY4 A;  2KCL A;  2X6K A;  3HYM B;  2X6I A;  2WQ6 A;  5A23 A;  4PS3 A;  3TWV A;  4I1M A;  3JQ1 A;  2DCP A;  4G8K A;  2V0P A;  3QNK A;  3B7B A;  3ONK A;  2IEJ A;  3U66 A;  2EIN E;  4GTQ A;  3Q7A A;  5AQ7 A;  3TWR A;  4LNG A;  2IQC A;  3N71 A;  3U4T A;  2I6H A;  4EZJ A;  2J9Q A;  3V2X A;  4F1S A;  3CQG B;  4G24 A;  4HOU A;  5KJL A;  5G55 A;  3B7R L;  2XEV A;  4JA7 A;  2DBA A;  1KPS B;  2WXI A;  2WMN A;  4HLE A;  1E96 B;  3ABM E;  2GRM A;  3G2U A;  5BT1 A;  4DX6 D;  3MJW A;  3KD7 A;  2PM6 A;  4HBD A;  4AVX A;  4K0R A;  2EIJ E;  4HI9 A;  3ZXS A;  1MQS A;  2WQ7 A;  3D9K A;  1XGW A;  3ESL A;  2WXJ A;  2V8S E;  1U3D A;  4FC8 A;  1JCR A;  3HG0 D;  3SY2 A;  4RVB A;  4WWP A;  5JMN D;  3C72 A;  4CDM A;  5BNW A;  3FWV A;  3FTV A;  4GCN A;  2XEE A;  5KNH D;  4OAU C;  3PZ2 A;  4JC8 A;  1FCH A;  2QZA A;  4UUC A;  2NSZ A;  1HG5 A;  2LSU A;  3FU3 A;  3ULE G;  2VSY A;  2YHC A;  2JEK A;  5AAO A;  3SHF A;  3FUE A;  3SGH A;  2WXQ A;  5CRU A;  4UWH A;  1INZ A;  3FU0 A;  3ZN3 A;  3E4B A;  3JQ0 A;  4GTO A;  3ZU7 B;  4HQD A;  1BI8 B;  2BKK B;  1EF1 C;  5JHA A;  4JHR A;  3FTW A;  3SZ7 A;  4N5Q A;  2C0M A;  1IYG A;  2IO2 C;  2UY1 A;  3Q7F A;  5E75 A;  2X6F A;  3RRM B;  3BU8 A;  2HM8 A;  1O1S A;  4GCO A;  3CST A;  4YDO A;  5CED B;  4KMO A;  1MYO A;  3KEZ A;  3L17 A;  4EPZ A;  4DX2 A;  4AEZ C;  3NZS A;  3LJ3 A;  1JCQ A;  4V3I A;  5ENT D;  1L5J A;  3CKB A;  3EHN A;  2KXP C;  3ZPJ A;  4JXT A;  5ENS D;  3D9P A;  5A7D B;  4N3A A;  3BG0 B;  4GTS A;  2OCC E;  2I9C A;  3KEA A;  1TN6 A;  3E32 A;  4I1O B;  3FTU A;  3ZEF A;  4FUL A;  2CG3 A;  1MJ0 A;  4G1T A;  3ZFW A;  4O1P A;  3FTS A;  2WXM A;  4BFR A;  3QC1 A;  4ABN A;  4GZ3 A;  4YDE A;  4KZ0 A;  3UUX A;  3GYZ A;  3SFZ A;  4BWR A;  3O48 A;  4LSZ E;  5ENO D;  1HX8 A;  3J5P A;  1NL4 A;  2J4B A;  4B8C B;  2FBN A;  3B7U X;  1DCQ A;  1UN8 A;  3VTX A;  3LY7 A;  2WXK A;  3IKO B;  3I4G A;  3ASH A;  5AQB A;  1S63 A;  4APF A;  5ARF A;  4G11 A;  1X81 A;  5FZR A;  4CT0 A;  2C2L A;  4NAC A;  4JZY A;  3FTX A;  2WB2 A;  4TV3 A;  2FEZ A;  4J8F A;  5CCM A;  4AIF A;  2VSO E;  3RAU A;  5CBN A;  4MRU A;  3APF A;  2H6I A;  2YHE A;  3O4Z A;  5D0O D;  1HXI A;  1MX6 A;  2WXG A;  3NF1 A;  3DPD A;  4HRL A;  1X5B A;  3CK8 A;  2P58 C;  3CHM A;  3NOG D;  3FTY A;  4TRQ A;  5FZQ A;  4UI9 J;  5BV0 A;  4GMR A;  2XGO A;  2P9P G;  2A5E A;  3PUJ A;  4B94 A;  4KT6 B;  4U0Z A;  5KBA A;  2B0O E;  2KAT A;  5T4Y A;  1DVP A;  1MZC A;  1HFA A;  3UT8 A;  1YA0 A;  4NQ0 A;  4MKT A;  2F37 A;  4RG6 A;  4L2L A;  5HS0 A;  3CQC B;  4KVO A;  4EBA A;  1GW6 A;  2IOL A;  1N4Q A;  5LFA A;  4L7T A;  2AXU A;  3FUL A;  3I4R B;  4FLH A;  3CHS A;  4LUN U;  4L2Y A;  2P9I G;  4U7E B;  3FU6 A;  4JVS A;  3HVE A;  2ETA A;  3CV0 A;  4DX5 D;  1WM5 A;  5EN5 D;  3FUN A;  2DZO A;  4XKB A;  4Y6C A;  2AW6 A;  5EYP F;  1H6K A;  5BPP A;  4L9P A;  3CR3 A;  1O1R A;  2KZT B;  2WM9 A;  3LVR E;  3SNX A;  1WY6 A;  2LSV A;  1G3N B;  2ION A;  1ELK A;  3LPZ A;  1DNP A;  2V4H C;  3D9J A;  4EEC A;  3DBS A;  5ENN A;  3FU5 A;  1OCC E;  3KAE A;  1S64 A;  1NP7 A;  4BSX A;  3RSE G;  2F8X K;  2IF4 A;  3MV3 B;  4N3C A;  4IRU A;  1TJC A;  3D9O A;  1FPP A;  2VGX A;  5KCM A;  3JXJ A;  1HO8 A;  3TJP A;  3CVX A;  3PZ3 A;  3SD5 A;  4H7X A;  1SZA A;  4BEP A;  2IO3 C;  2Y1L E;  4GA0 A;  3R7R A;  3LVQ E;  4LRZ A;  2P2C P;  4RLY A;  4YDW A;  3LJN A;  3ML9 A;  2WPV A;  2V4L A;  1SA5 A;  3S2A A;  2PQR A;  2ZIS A;  4HRN A;  5ANL A;  4HS2 A;  3PZ1 A;  3DRA A;  4AM9 A;  5EX3 A;  5CBO A;  4I43 A;  2B6C A;  3AG4 E;  5ENP D;  3RRN B;  1OT8 A;  2LO6 A;  4J8E A;  2MRI A;  3DST A;  1IHB A;  1TNO A;  3QDN A;  5FQ6 A;  5G04 J;  2YQ8 A;  2GRO B;  3EHQ A;  2A4Z A;  4Q94 A;  5EDS A;  3Q4A B;  3UX4 A;  1QZ2 A;  3QB2 A;  5HI7 A;  4FHJ A;  3Q78 A;  4ILG A;  4AP2 A;  1IQR A;  3FUM A;  4GU5 A;  3D9N A;  4LCT A;  3BQO A;  1H0A A;  3CSF A;  1LD8 A;  1H2T C;  1E7U A;  3P2B A;  4P29 A;  4N2S A;  3ISM C;  5CRV A;  3L22 A;  5LP0 A;  1B89 A;  2F0Y A;  4IUL A;  1HE8 A;  3HXD A;  3TWX A;  4URK A;  3NZU A;  3LEW A;  4QQI A;  3KS2 A;  3U64 A;  3MGB A;  3TL5 A;  1EPU A;  2BED A;  4U8H A;  4HOT A;  2DYR E;  4GPK A;  2XEN A;  4N3B A;  3W9G A;  2ZIR A;  1IKN D;  2WXH A;  5D0Q D;  5CMY A;  1E7V A;  3IHV A;  4EZK A;  2CHZ A;  3SFY A;  3B7S A;  4ACK A;  2MHK A;  3C3R A;  4F1P A;  4BX8 A;  4AY6 A;  3TXM A;  2R59 A;  1FT2 A;  3PS6 A;  3SFX A;  2XHE A;  1FVF A;  2V5Q C;  1K3Z D;  2DZN A;  3V79 K;  2OV8 A;  5FWQ A;  1K1B A;  4J8Y A;  1QQE A;  5IY5 E;  3LXU X;  4ME2 A;  2DYS E;  3TGO A;  3MA5 A;  4I9E A;  3VTY A;  3MV2 B;  3IBE A;  4FP7 A;  4G2V A;  5KJN A;  1YCS B;  1ZB1 A;  5CEC B;  1QYM A;  1O1T A;  2CFU A;  2VGE A;  3ONL A;  1OWP A;  3WG7 E;  5ARG A;  1KT1 A;  5AAR A;  4DLQ A;  5J08 A;  3FFL A;  3ZIM A;  3ZHE A;  3EHM A;  2GRN B;  4U96 D;  4YDY A;  1Y8M A;  3CIA A;  4E85 A;  2VSN A;  2WQH A;  2L0I A;  5BV1 A;  3SBT B;  3L13 A;  4N5C A;  3SO8 A;  3FUI A;  3DSX A;  3UMV A;  2A5U A;  4JPS A;  4K5A B;  4ANW A;  2X6J A;  3Q49 B;  1E8X A;  3EIJ A;  3LDZ A;  3IEG A;  4GA2 A;  4OYS A;  2EQX A;  3CVW A;  4YVO A;  1N0Q A;  1OXJ A;  5LX8 A;  4APO A;  4GZ5 A;  4O6F A;  3BUA A;  2X6H A;  2QC9 A;  1N4S A;  2X38 A;  3OTN A;  3E34 A;  2BUG A;  3R7Q A;  3ML8 A;  3NOC D;  5AEN A;  4DI3 A;  3TG4 A;  5LCW C;  2PZI A;  4JD2 G;  4WNE A;  2RKK A;  3LY9 A;  4J0U A;  1TJF A;  5AQA A;  4O1O A;  1FT1 A;  3AS8 A;  5DBK A;  5EYL A;  4RG9 A;  3JXI A;  3FHE A;  2XS8 A;  4HOQ A;  3GZ2 A;  2GRR B;  2WXF A;  2H6F A;  4J8S A;  1JUQ A;  4G25 A;  1OCO E;  1HH8 A;  2XRY A;  2IOS A;  1BD8 A;  3URZ A;  5FIO A;  3S7F A;  3T8M A;  4PDX A;  3CLJ A;  4LER A;  4PUC A;  4WND A;  4HXI A;  3B13 A;  4M7C A;  4ILH B;  3D9L A;  3T5X A;  3ESK A;  5EX0 A;  5CER B;  2VTB A;  3QJZ A;  5EIB E;  4HOR A;  2ETC A;  2KCV A;  1D9S A;  2XZD G;  2XPY A;  3G2S A;  2QYJ A;  4R7L A;  4XI9 A;  3JUE A;  3EIQ C;  5JA4 D;  1JWF A;  3K9I A;  5A6C A;  2WVI A;  5EKQ D;  3MKQ B;  4AY5 A;  4BT9 A;  2L9B A;  1JPL A;  2R17 C;  1BLX B;  5G05 C;  4CGV A;  4ZFH A;  4RSY A;  4C0E A;  5JJ6 A;  2KM4 A;  2PL2 A;  1N4R A;  3ABL E;  2WXR A;  2Y0B G;  3C3O A;  2Y3A A;  2IJG X;  1NZN A;  4C48 B;  2OVB A;  3ULY A;  1TYQ G;  2HYZ A;  3AU4 A;  3C98 A;  3HXE A;  5FTP A;  2XEH A;  1OCZ E;  3OXF A;  5M72 A;  4XZ4 A;  4J7W A;  3QOU A;  5KNG A;  1EDU A;  4GAA A;  3NBN B;  1XNF A;  2L6B A;  4UWF A;  3CGH A;  2KZT A;  4ILI A;  3Q73 A;  5EIL A;  3Q9U C;  4L1B A;  2L0T B;  5ENR D;  4TUM A;  3BG1 B;  1A5E A;  4L23 A;  3JCK C;  1N95 A;  2GRQ B;  4K5C A;  3U3W A;  3D9I A;  4Q69 A;  3DEO A;  3DSU A;  2J49 A;  2CG2 A;  4KVM A;  4M3O A;  1LTX A;  1SVX A;  3NQP A;  3TAX A;  1H2U A;  1FVH A;  3ZNG A;  5BUZ A;  2J4D A;  2WXL A;  1V54 E;  5B3S E;  4GZ6 A;  3ZXP A;  3UT7 A;  2HO1 A;  5BXU A;  2E0I A;  1KT0 A;  1NI1 A;  3RO2 A;  1RW2 A;  1OWO A;  2FO7 A;  2R02 A;  4JEU A;  3B7T A;  3D9H A;  4EBA G;  3CHR A;  1LD7 A;  4I2W A;  5FIN A;  4KXK B;  1H19 A;  3PE3 A;  2GRP B;  1Z3Y A;  4UWG A;  1S70 B;  4RQI A;  2LXL A;  5CMW A;  1V55 E;  4HB5 A;  1N9A A;  3QWW A;  5JJ7 A;  2EIL E;  2RD0 A;  4ANV A;  3EJN A;  3T9K A;  3FUK A;  4NRH B;  4U8V D;  4HI8 A;  4BES A;  2LAH A;  4A3V A;  3R9A B;  1AP7 A;  3PNT B;  1PAQ A;  4TXQ A;  4GA1 A;  3QAR A;  3VLF A;  4CT4 A;  5AIJ A;  2LUH A;  4DK5 A;  2JLB A;  3MKR A;  3TWW A;  1YMP A;  2P9S G;  4U95 D;  3RO3 A;  4MLP A;  4I6G A;  4JW1 A;  3DPY A;  4DX1 A;  2WXN A;  4CCA A;  2CHX A;  4WUY A;  2FO1 E;  4ANU A;  2OND A;  4UI9 K;  1H2V C;  4I6J A;  4A3T A;  1WAO 1;  4JHJ A;  1K8K G;  1ELW A;  3LYA A;  1UW4 B;  2VYI A;  2MYO A;  3EHR A;  3IV0 A;  5CCL A;  5JJT A;  4H7Y A;  5JHB A;  2QYU A;  4ACL A;  2NXP A;  1A17 A;  2RFA A;  4Z68 A;  3CEQ A;  3TWT A;  1D8D A;  2XPI A;  2PNN A;  5H7P A;  4CGW A;  2LNI A;  3IHY A;  2AXZ A;  5FQ7 A;  4WWO A;  4GYO A;  1N94 A;  1MHQ A;  3HIZ A;  4U0U A;  4B89 A;  5FJY A;  3SF4 A;  1TN8 A;  5B1B E;  1KZO A;  3T8K A;  5LCW J;  3FTZ A;  3UM1 A;  2OEV A;  4JL0 A;  3MCX A;  2AJA A;  2IU1 A;  3F6Q A;  3HXC A;  4GMJ A;  4G26 A;  5FT9 A;  2I1K A;  4PH4 B;  4GZC A;  3J5Q B;  2FI7 A;  1QBQ A;  2VGX B;  2GRL A;  2LAI A;  1HS6 A;  3RK6 A;  3FH7 A;  2EIK E;  3D3M A;  3E33 A;  3BEE A;  4A1G A;  1BI7 B;  3PUK A;  3ZKJ A;  4IN3 B;  5C1D A;  3QWV A;  3EU5 A;  5T3R A;  4AOF A;  3MX3 A;  3OXG A;  2LXM A;  1UG3 A;  4U04 A;  4F3V A;  2AWI A;  3AJI A;  5KJK A;  3L54 A;  3DEP A;  4N39 A;  1UOH A;  4J6I A;  3GW4 A;  4UQX A;  4LEU A;  2VGY A;  4GYW A;  4JEH A;  3TG5 A;  1Y6I A;  3UXG A;  3NAW A;  3KSL A;  3ZYL A;  5ENQ D;  3CK7 A;  1Q2Z A;  2XZT G;  1ZU2 A;  4KBQ A;  3R9M A;  2YIN A;  3DXK G;  4KZC A;  3PZ4 A;  2YNQ A;  2Y69 E;  2NC9 A;  1N52 A;  3HHM A;  3Q75 A;  3KSQ A;  2CFZ A;  3FUD A;  4KYO B;  1OY3 D;  2P9L G;  4GPM A;  3LKU A;  3FUH A;  1TR4 A;  2R03 A;  2ZGD A;  4TXR A;  3TWQ A;  2Q7F A;  2ZU6 B;  1TNU A;  2XGS A;  5D2M C;  3UI2 A;  3Q9N C;  2J8S D;  2JAB A;  4U07 A;  1H6O A;  2KCK A;  3TWU A;  3QKY A;  1MX2 A;  1OCR E;  4C9B B;  2WMO A;  3CVN A;  3GZ1 A;  1N11 A;  1OWL A;  4U0S A;  1H6P A;  2H6H A;  3MEK A;  3UPV A;  2XGM A;  4CZ2 D;  5KJM A;  3CHQ A;  1K1A A;  4OAV B;  3AS4 A;  3SBS A;  3CVQ A;  1IXV A;  3OXL A;  5T8I A;  1OWN A;  1WDY A;  4UQZ A;  3RU0 A;  1QNF A;  3AAA C;  2VSX E;  1Z3X A;  4I2Z A;  4XE0 A;  3RIB A;  3QAQ A;  3UKU G;  3UT4 A;  2KC7 A;  5BXO A;  2GGF A;  2IFU A;  4EZL A;  2J09 A;  3PVL A;  4FU3 A;  4AV7 A;  1PC2 A;  3PE4 A;  2DVW A;  1N4P A;  2M63 A;  4GYY A;  5DIZ A;  3ZRH A;  2R5S A;  4LNB A;  5KWD A;  1TNY A;  3AU5 A;  2VQ2 A;  3FDH A;  4BSZ B;  1Z5S C;  3RRU A;  3V31 A;  4AJW A;  1U2V G;  3MKQ A;  2ZGG A;  4GB9 A;  2OVF A;  1OWM A;  3PZD A;  4AXH A;  4UWK A;  3RJV A;  3QWP A;  2Y4U A;  3LY8 A;  3PRE A;  2ZXW E;  4FHK A;  3ULQ A;  3PEV B;  3CVP A;  1HU3 A;  2KBX A;  2MOW A;  3B95 A;  4TXP A;  4PS7 A;  4FAD A;  3TXN A;  2X3M A;  1IQU A;  3FUF A;  5G04 C;  4UQY A;  1IHG A;  3ZHE B;  1AWC B;  3CVL A;  3FEY A;  3ENE A;  4EHM A;  2H6G A;  4ATZ D;  4XEI G;  3L08 A;  3X2Q E;  4I17 A;  2L6J A;  3UM2 A;  3HRA A;  3DXM G;  1ZBP A;  3UM3 A;  2BKG A;  1KZP A;  3C3Q A;  3CK9 A;  4FJY A;  1HG2 A;  3I3N A;  3PEU B;  4ATG A;  4A55 A;  5HKP A;  3Q5M A;  3ASO E;  4DI4 A;  4DPR A;  1EYH A;  4JHK A;  3ZYM A;  1S0P A;  3NB2 A;  3SI5 A;  2F8Y A;  3UKR G;  3G2T A;  2UY1 B;  1DCE A;  5AJL A;  2P9N G;  3CVV A;  3DSV A;  4BET A;  1HZ4 A;  4WWN A;  3LS8 A;  5CEA A;  3L6A A;  5EID A;  3PH0 C;  4OVU A;  3U9W A;  4XX5 A; 
#chains in the Genus database with same CATH homology
 2F0Y A;  3Q73 A;  4GTP A;  1QBQ A;  4GTM A;  3HXD A;  2H6F A;  1O1T A;  1N4Q A;  1N95 A;  1TNU A;  2IEJ A;  1NL4 A;  4GTQ A;  3DSU A;  3E33 A;  3Q7A A;  4LNG A;  2BED A;  3E30 A;  3DPY A;  3EU5 A;  4GTO A;  1SA5 A;  3Q79 A;  2ZIS A;  2ZIR A;  3DSX A;  1S63 A;  1LTX A;  1SA4 A;  1X81 A;  2H6H A;  3PZ1 A;  3DRA A;  3HXF A;  3EUV A;  3HXB A;  4EHM A;  2H6G A;  3Q7F A;  3SFY A;  4L9P A;  4GTT A;  4GTV A;  1O1R A;  3DSW A;  1O1S A;  1TNB A;  3DSS A;  3DST A;  4YDO A;  1D8E A;  1NI1 A;  1O5M A;  1TNO A;  1FT2 A;  3SFX A;  3KSL A;  2H6I A;  2R2L A;  1D8D A;  1S64 A;  1KZP A;  1N4R A;  1LD7 A;  1JCQ A;  1N4S A;  3PZ4 A;  3E34 A;  3Q78 A;  1JCR A;  1N94 A;  3E37 A;  3Q75 A;  3C72 A;  3KSQ A;  4GTS A;  1TN7 A;  1TN6 A;  1FPP A;  1TN8 A;  3E32 A;  1KZO A;  1DCE A;  3HXE A;  1N9A A;  3PZ3 A;  1LD8 A;  1N4P A;  3DSV A;  3PZ2 A;  4MBG A;  4GTR A;  4LNB A;  1MZC A;  1JCS A;  3HXC A;  1FT1 A;  1TNY A;  1TNZ A;  4YDE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...