2H6HA

Y365f protein farnesyltransferase mutant complexed with a farnesylated ddptasacvls peptide product at 1.8a
Total Genus 133
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
133
sequence length
315
structure length
315
Chain Sequence
b'FVSLDSPSYVLYRDRAEWADIDPVPQNDGPNPVVQIIYSDKFRDVYDYFRAVLQRDERSERAFKLTRDAIELNAANYTVWHFRRVLLKSLQKDLHEEMNYITAIIEEQPKNYQVWHHRRVLVEWLRDPSQELEFIADILNQDAKNYHAWQHRQWVIQEFKLWDNELQYVDQLLKEDVRNNSVWNQRYFVISNTTGYNDRAVLEREVQYTLEMIKLVPHNESAWNYLKGILQDRGLSKYPNLLNQLLDLQPSHSSPYLIAFLVDIYEDMLENQCDNKEDILNKALELCEILAKEKDTIRKEYWRYIGRSLQSKHST'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Conversion of protein farnesyltransferase to a geranylgeranyltransferase.
pubmed doi rcsb
molecule keywords Protein farnesyltransferase/geranylgeranyltransferase type I
source organism Homo sapiens
molecule tags Transferase
total genus 133
structure length 315
sequence length 315
ec nomenclature ec 2.5.1.58: Protein farnesyltransferase.
pdb deposition date 2006-05-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01239 PPTA Protein prenyltransferase alpha subunit repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.120 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Protein prenylyltransferase 2h6hA00
2ZIRA 1N4SA 1N4PA 1TNZA 2BEDA 3PZ1A 3DSXA 1LD8A 3E34A 1TN6A 1JCSA 1JCQA 1MZCA 3DSVA 4MBGA 1NI1A 3Q73A 1LD7A 2H6IA 4GTPA 1TNUA 3E32A 4GTRA 4GTTA 4LNGA 1N4RA 1N95A 1O1RA 3E37A 3SFXA 3E30A 1N9AA 3DSTA 1N94A 1D8DA 4GTQA 3DSUA 2H6HA 1LTXA 1S63A 1SA4A 1N4QA 1TN7A 1DCEA 4GTMA 3DRAA 3PZ3A 1D8EA 3KSLA 2R2LA 1NL4A 1FPPA 3HXFA 3PZ4A 2F0YA 4YDOA 1FT2A 4GTSA 2IEJA 3HXDA 1S64A 1KZOA 3Q79A 1FT1A 3Q75A 4GTOA 3KSQA 1TNBA 3SFYA 2H6FA 1JCRA 4YDEA 3HXEA 3DPYA 3C72A 1SA5A 3EU5A 3HXCA 3EUVA 3E33A 3Q78A 2H6GA 1QBQA 1KZPA 1O5MA 3PZ2A 1TNYA 4LNBA 1TNOA 1O1SA 3Q7AA 4L9PA 3HXBA 1X81A 3DSWA 3DSSA 1TN8A 3Q7FA 1O1TA 4EHMA 2ZISA 4GTVA
chains in the Genus database with same CATH superfamily
1UJJA 2XEEA 3PVLA 5T8IA 3RRMB 5BPPA 4XEIG 1H6KA 4F1PA 4I6EA 4GAAA 3FDHA 3FUHA 3SHFA 4HORA 2WXNA 2LSUA 1U3DA 4HB5A 1OCRE 1SZAA 4ILGA 5LFAA 1TNUA 3ZKJA 4XE0A 1ZU2A 2WXMA 4G25A 3TAXA 3L22A 3DSTA 3NZSA 2NSZA 4AOFA 4J7WA 1HH8A 3IXEA 3T8MA 4N39A 4GZCA 4GTQA 4I1MA 4FC8A 4O1OA 1KLXA 4BY6A 5BT1A 4NURA 1AWCB 3MGBA 3QJZA 2IJGX 2X6JA 2KBXA 4WNGA 2RFAA 5H7PA 1H6OA 4BTBA 1S64A 5LCWJ 4K5CA 4FJZA 4CDNA 3FUKA 2OOEA 4GMLA 5BNWA 2V4HC 3URZA 3EU9A 4EPZA 4RSYA 3C3QA 3Q5MA 3ZHEA 1TNOA 4DLOA 2C0LA 3TXNA 4APOA 1PC2A 4OYSA 1OT8A 1XGWA 3JXJA 1IHGA 3UM1A 4EHMA 3SFZA 4Z68A 2DWZA 3RRUA 3EIJA 4FHKA 5ITZF 2V5QC 2R17C 4CEMA 1JCSA 1JCQA 3FTWA 5ANLA 1L5JA 2XS8A 1MZCA 2MRIA 4MBGA 4PDXA 2RFMA 4B8AA 5A6CA 2OV8A 3FFLA 2P9UG 3RSEG 3MCXA 2ZGGA 1UG3A 3HRAA 4U95D 3AS4A 3ULYA 4L2YA 2VJ8A 4FLBA 1HZ4A 3AG2E 2CG3A 1JWFA 1D8DA 3D9PA 5FQ7A 3PEUB 5C2YA 4O6FA 5AENA 3RKVA 2OEVA 4DX1A 2V0PA 3CQCB 3JYSA 5G04J 4HXIA 4WWPA 4BX9A 5CEDB 3ZYKA 3L13A 3T5VA 2KCKA 4J0UA 2WB2A 1KT0A 1RZ4A 2YHCA 4GZ6A 3AAAC 3CVVA 2H6GA 2CFZA 4HVBA 3FU6A 3PUJA 3ZXPA 3ZN3A 3CKBA 2VYIA 4MS6A 4AP2A 2P9PG 1G3NB 5FJYA 4KT6B 1E8ZA 1Z3XA 3UM0A 4YVOA 1A17A 2BKGA 1N4SA 2BEDA 3ABME 1Z5SC 3PUKA 4ANWA 5HKPA 2RD0A 4N3AA 3Q73A 3FUIA 4YVQC 4B89A 4N5CA 3DBSA 2PL2A 3CHOA 4N3CA 1ELWA 2EQXA 3BUAA 3LXUX 4BSZB 5CRUA 3OXFA 3VLDA 3ASOE 1DCEA 2I6HA 2IQCA 2QFCA 3V30A 3AG3E 3ZYLA 4CT4A 2I1JA 1MQSA 4GTOA 5CMYA 3KSQA 1OCOE 4GU5A 4IYPA 5ANRA 1S0PA 3HDXA 1SA5A 2EILE 3HXCA 3QWVA 3TGOA 2KCVA 4EQFA 3UXGA 5JJ7A 4J8EA 3B95A 2WXOA 4L2LA 4CGVA 1D9SA 2J4BA 4LG6A 4TRQA 2XRZA 4ACLA 2ZXWE 1SZ9A 4F6RD 4XIFA 4DX6D 1DNPA 3SY2A 1MX2A 2LXLA 4LSZE 4HOQA 4FJYA 3AG1E 5FQ8A 2WXQA 3L9TA 4UWLA 3UQ3A 3CVXA 1E8YA 2XGOA 2Y1LE 3ASHA 4MRUA 5KBAA 4JC8A 4EZLA 5FZSA 2AXUA 3DXKG 2ETCA 4HNAD 2XEHA 2H6IA 3CVYA 4W9RA 3TWSA 4JPSA 1IQUA 5C1DA 3BQOA 4ATZD 1YMPA 3AS8A 4GB9A 2RKKA 2WXHA 2I9CA 2X6FA 5KJKA 3R9MA 2C0MA 1BPOA 3ONLA 2MOWA 2ETBA 2WMNA 4LRZA 5FWQA 5LP0A 3FTUA 4GZ5A 3CVNA 5G05J 4EECA 1TN7A 2EIME 3S7DA 3F6QA 3PZ4A 3RK6A 4BWRA 3B7SA 2WMOA 2J9QA 3ONKA 4ZFHA 4GYOA 2KXPC 4LEUA 4MKTA 4FLHA 2LO6A 4GA0A 4B94A 1UN9A 3UTMA 5AARA 3QK0A 4WWNA 4N3BA 2ZGDA 3QNKA 1Z6TA 1VDYA 3MX3A 3NOGD 3ML9A 2Y3AA 2XGSA 4B8CB 2QY7A 4OAVB 3L54A 4HBDA 5FZQA 4EZKA 1N0RA 1YCSB 2LUHA 2HM8A 3Q15A 5D2MC 3W9FA 1MHQA 1N11A 2ZU6B 1JUQA 5CMWA 5J08A 1DCQA 5EIDA 5EYLA 3EHQA 4KMOA 4ABNA 2C2LA 2V4LA 3E4BA 5AIJA 1TJFA 3APFA 3B7BA 5CCLA 3D9LA 4DI4A 1IKND 1SA4A 4JEHA 4GYWA 5ENNA 2F8XK 5CEAA 2WXJA 5DBKA 4LERA 4RG9A 1NL4A 4I17A 3JXIA 3MKRA 4JZYA 4GTSA 2WPVA 2XZTG 1E8WA 2AWIA 3SFYA 4QQIA 1ZB1A 2DYRE 1MJ0A 2WM9A 1Y6IA 1K3ZD 5B1BE 4WNEA 4B93B 5B3SE 5EX3A 5FIOA 4L23A 2UY1A 3MYVA 1YA0A 2FF4A 4LNBA 1O1SA 3FP3A 4N2SA 3X2QE 5ENRD 4EBAG 1HF8A 5AQ9A 4GTVA 4U63A 3CVUA 4RVBA 4KXKB 3LJNA 3V79K 4AY6A 2PQRA 5ARFA 3FUNA 5ARGA 4YDYA 4I9EA 4K5BA 3SBTB 2ONDA 3GW4A 5BV0A 1N0QA 3DSVA 3I4GA 3PS6A 2B6CA 3CHQA 4GTPA 2DVWA 1UW4B 2VQ2A 4BESA 4BSXA 3S7JA 1N95A 4AXHA 2FULA 4A63B 3KD7A 4BFRA 5AQ7A 2Y4TA 1JPLA 3LY8A 5KJNA 4U8VD 4DLQA 3CIAA 1QQEA 4I2WA 3DSUA 3FUMA 4TUUA 3CSTA 1LTXA 3FU5A 2AVPA 2KZTB 4J8SA 4FA6A 2UWJG 3MV3B 4QFVA 1V55E 5E75A 4GCNA 2PM6A 2XENA 1GW6A 2VGXB 5JHBA 3AJIA 1ELKA 2R03A 3HXDA 3Q79A 4PUCA 1JCRA 3NB2A 3HXEA 4GMRA 4U8YD 2R02A 2AJAA 4UI9C 3ESKA 3G2SA 3FTYA 5KNHD 2XCBA 3EHNA 2GROB 3JQ0A 3CVWA 3QOUA 1OXJA 4DUIA 1W3BA 3VTXA 4KYOB 3EHRA 5FINA 3U3WA 3ZYMA 3PDNA 3U4TA 2JABA 4GA1A 2IF4A 3G2VA 2WQ6A 3ABKE 3QARA 3ISMC 3TWUA 2UY1B 2P9SG 3L17A 5FZRA 2J09A 4AVXA 1YYHA 5FTPA 3E37A 1P5QA 1BLXB 1N9AA 2KATA 5AAOA 2P9KG 2PQNA 4CDRA 1OCCE 3NZUA 4IRUA 4Q96A 3P2BA 2WQHA 3D9NA 4BX8A 4G2VA 4ANXA 2IOSA 3KEZA 1FT2A 5ENSD 4CGWA 1H0AA 5AYWD 3D9IA 1KZOA 5KWDA 1FT1A 4MLPA 4JW1A 4G23A 2WXKA 3CKCA 3RO3A 1UN8A 4J6IA 4HS2A 3SD5A 3E33A 3MA5A 3HHMA 2GRMA 2AXVA 4FU3A 5ENOD 2XPYA 2FI7A 3UIOC 2X6HA 3ULQA 3LCAA 3ZXSA 5BXOA 3ZFWA 1NP7A 1U3CA 2L0TB 2YHEA 5EIBE 3IV0A 3CK9A 3ZU7B 4UWFA 3CLJA 1SW6A 4TUMA 4BTAA 3ZIMA 3ZGQA 3QAQA 2XGMA 4CDMA 5LOZA 1N4RA 2MYOA 3RJVA 1E90A 4XI9A 3R9AB 4JA9A 3IHYA 5FT9A 3GZ1A 1H2VC 3LVQE 3LKUA 2JEKA 2DIWA 3UX4A 1E7VA 3JCKC 3ULEG 2B0OE 4U0ZA 4F3VA 3PZ3A 1NFIE 4UWGA 3T9KA 2L9BA 5CBNA 2F8YA 1K1BA 4KBQA 3I3NA 5CHEE 3ZEFA 4D10C 1QNFA 3BG1B 4CYMD 2H6FA 1EF1C 4V3IA 4HRNA 3UM2A 1EYHA 4DRXE 3UPVA 3LS8A 1WM5A 2VTBA 2Y4UA 3FH5A 1TNYA 3HYMB 3UI2A 5BUZA 5EDSA 1B89A 3DSWA 4I2ZA 5LCWC 3LEWA 3D9OA 3WG7E 3KAEA 4JHJA 4CRWA 4H7XA 3NOCD 2J08A 2R05A 5BW8C 4KZ0A 4ME2A 3DXMG 3MZLB 4Q94A 3NF1A 1RW2A 5FQ6A 4WWOA 3ZNGA 2OVBA 4OVUA 3E32A 4IN3B 4GTRA 3V31A 3PZDA 1HXIA 2AW6A 1N94A 2I1KA 2XPIA 1NA3A 2J49A 4HRLA 2BF0X 1Z3YA 2J4DA 2HR2A 3SO8A 1FVFA 4UQYA 1N4QA 1IHBA 4WNDA 1OUVA 2JLBA 2L6BA 3KSLA 2AXZA 4A3TA 1SVXA 4F1SA 5JHAA 3GYZA 5HQ8A 3JQ1A 4A55A 3Q49B 1HX8A 2OVFA 3G2TA 4U0UA 3EUVA 3J5QB 2IOLA 1E8XA 2EINE 3D3MA 3UIPC 2VGYA 2VSNA 3IHVA 2ZISA 3SBSA 2R5SA 3LY7A 1UOHA 2E2EA 3RIBA 3OAWA 4H7YA 4XX5A 1KT1A 3ZW3A 3MEKA 4N2QA 5M72A 2X38A 1TEZA 4PS3A 1LD7A 1INZA 2VTBB 1WAO1 3N71A 2XCCA 4J8YA 3T5XA 3FH8A 4GTTA 3FTSA 4DI3A 2X6IA 2VGEA 3L08A 4BT9A 5HS0A 3C5RA 1LF8A 3PE3A 5EKQD 2KZTA 1K1AA 3CR3A 3JUIA 4I6GA 3UT7A 4G8KA 4Q69A 3S7FA 4JA7A 3FY4A 2H6HA 2VGXA 2XQ0A 3ASFA 3EJNA 2BKKB 4GTMA 2GW1A 3DRAA 3U9WA 5G2NA 2F0YA 4NACA 3HIZA 4A1GA 3P1UA 5HI7A 2WXFA 1N54A 5EN5D 4GPMA 2WXPA 5KNGA 3EU5A 4P29A 4OVVA 3CK8A 3QDNA 4G8LA 4AM9A 5CERB 4A3VA 4NIKA 1HG2A 4FP7A 5A7DB 4HOUA 1PY1A 3Q7AA 4L9PA 2NXPA 4DX5D 4LCTA 2X6KA 4NQ0A 4FULA 2CG2A 4I43A 3BU8A 1MYOA 4U0SA 3DSXA 3FTXA 2XEVA 2CHZA 3D9MA 2LAIA 4UI9K 4K5AB 4UQZA 2DZOA 3C3RA 4O60A 3TWRA 1HO8A 3L6AA 1H2UA 2GRPB 3QB2A 3Q9UC 4U04A 3TWVA 3R7QA 4Y6WA 2XHEA 3K9IA 4XI0A 2VSOE 3RU0A 4E85A 4OAUC 3TXMA 4C9BB 3W9GA 2NC9A 3D9HA 3FHEA 1IYGA 1MX4A 5ENTD 4BETA 4O1PA 4TV3A 3AS5A 3TG4A 5IY5E 1IQRA 2X3MA 2J8SD 4C0EA 1EDUA 5BV1A 5G05C 4NRHB 3ZVVA 3PEVB 2VSYA 4RQIA 3EHMA 1A5EA 1N52A 3PZ2A 4GZ3A 3WXXA 3LYAA 3G2WA 4GMJA 3RO2A 2ZIRA 4F53A 2XRYA 5A23A 2CFUA 4XZ4A 1IXVA 5EILA 3CHPA 1TNZA 5B1AE 3UT4A 3V2XA 3OXGA 4GCOA 4UQXA 2QYUA 1LD8A 3DEPA 4TXQA 3R7RA 5KJLA 3IEGA 4RG6A 3C98A 2XPZA 2CHWA 1E7UA 5AJLA 4E6HA 3UUXA 3QKYA 4A1SA 2P9LG 3FU0A 2LSVA 3TWXA 2GRNB 4JEUA 4URKA 1TR4A 1EPUA 3IKOB 2ILRA 1UJKA 4UWKA 3GZ2A 3SFXA 2V5FA 4HLLA 2DBAA 4M3OA 4C48B 4DJAA 4PS7A 3ENEA 4EBAA 3NQPA 1JWGA 2I2OA 3B7UX 1ELRA 2XZDG 5CBOA 4YDOA 1WG0A 1SQMA 5KJMA 4AJWA 3UT8A 1TNBA 1WY6A 3APDA 3CQGB 4L1BA 1TJCA 3CVPA 3VLFA 4B0ZA 2MHKA 2QYJA 3Q78A 4GZDA 2A5UA 4YDWA 1KZPA 2XS1A 1OCZE 4G26A 3NAWA 2IFUA 3B7RL 1NZNA 3DSSA 5JJ6A 5J90A 5D66A 2A5EA 1O1TA 2WQ7A 2YNQA 3HG0D 1N4PA 5JMND 5DIZA 3PZ1A 3B7TA 4AV7A 1AP7A 3CK7A 5CECB 4BT8A 3E34A 2DCPA 1ZBPA 2L6JA 2HYZA 3LJ3A 1FCHA 3FWVA 1S70B 3ABLE 5JJTA 3DWLG 4LNUD 1HE8A 2M63A 3CHRA 4TXPA 1KPSB 4U8HA 4I1AA 2F37A 1O1RA 3FTVA 3SI5A 3I5PA 3FH7A 1OY3D 3ASGA 3MJWA 2LNIA 4JHRA 4HFGA 3Q9NC 3ASDA 2KM4A 5E76A 3TL5A 4ANUA 4HLEA 3QWPA 3UKRG 4ANVA 4PS8A 2R2LA 1FPPA 4YNDA 5D0QD 4AEZC 4APFA 1HG5A 2E0IA 2P58C 5BXUA 4HI8A 3SNXA 3OTNA 4JD2G 3FUDA 2QC9A 3DPYA 3QWWA 5LX8A 3RAUA 3UINC 3LDZA 3I4RB 2YINA 4JVSA 5AN8A 4CT0A 3HVEA 5FQ4A 1X81A 2HE0A 1TN8A 2VSXE 4K03A 3JUEA 3D9JA 4G24A 4WNFA 2WVIA 4C0MA 1K8KG 5AJDA 1BI7B 3ZHEB 2WXRA 1OWPA 2FEZA 4GPKA 4AY5A 2Q7FA 3UM3A 4N5QA 5EYPF 3FUEA 3Q47B 4ZHBA 4KVOA 5EX0A 3PREA 4KZCA 2V8SE 1TYQG 3BEEA 4G1TA 3ML8A 2WXGA 3DEOA 2CHXA 3EDTB 5AQAA 2FO7A 3KEAA 3DPDA 3ZYQA 4JXTA 1OWMA 1OWNA 2PM7A 2L0IA 4I9CA 2BUGA 1E96B 4JB8P 2P9IG 4IULA 3HXFA 2GRLA 3VTYA 2DYSE 2EIKE 4KVMA 3FULA 3PRZA 4DK5A 4JHKA 3SF4A 3APCA 5AQBA 3UKUG 3ZRHA 5T4YA 3TWWA 1H19A 3BG0B 3J5PA 4UUCA 3PE4A 4ATGA 1O5MA 4M7CA 2IY0C 3AG4E 4BERA 1MX6A 3RRNB 2DZNA 3HXBA 3C3OA 4GA2A 4AIFA 2QZAA 5CCMA 2PZIA 3QC1A 2ETAA 3ZPJA 3CSFA 4Y6CA 2FO1E 4I1OB 4HQDA 4RLYA 3CEQA 1H6PA 4PH4B 4XKCA 2GRQB 3MKQA 5G04C 1TN6A 3ESLA 4GYYA 3TJPA 3U64A 2PNNA 2LAHA 2KC7A 4JL0A 4HI9A 3CHMA 1FVHA 4CZ2D 3AU5A 3HVEB 2IONA 3PNTB 4LNGA 3SQVA 4HOTA 4LUNU 3E30A 1HU3A 3MV2B 1XNFA 3OXLA 2IU1A 3CV0A 2Y69E 4J8DA 2P2CP 3TWTA 4J8FA 4UWHA 2FBNA 5T3RA 2OEWA 1S63A 4U7EB 4UI9J 3VLEA 4K0RA 4ACKA 3FEXA 1HFAA 3EIQC 3T8KA 1Y8MA 3Q75A 4FHJA 4WAFA 3S7BA 4HOSA 1PAQA 2NYJA 5HRYA 1HS6A 1DVPA 3V2OA 1QBQA 1QZ2A 5JA4D 4U96D 3CVLA 2KCLA 2OCCE 3UMVA 3FUFA 4XKBA 3D9KA 3TWQA 4TXRA 3CVQA 3FU3A 3GZSA 2RG8A 3CHSA 1Q2ZA 2EIJE 2J07A 2GGFA 1NA0A 4DPRA 4FADA 4ILIA 2YQ8A 1WDYA 4BEPA 5G55A 3PH0C 4DX7D 3TG5A 3LVRE 5ENQD 4ILHB 2WXLA 4F7AA 1NI1A 1U2VG 3S2AA 1BI8B 2IO3C 3KS2A 3L82A 4U07A 3FUJA 2BTDA 3PNLB 4WUYA 3L16A 3NBNB 2P9NG 5CRVA 3O48A 2LXMA 4G11A 5D0OD 2GRRB 2WXIA 1OWLA 3B13A 4HRMB 4I6JA 3G2UA 5KCMA 3MKQB 4R7LA 1V54E 3FEYA 1D8EA 3LPZA 1BD8A 2IO2C 2A4ZA 3AU4A 2HO1A 2R59A 3CGHA 2IEJA 1DC2A 5ENPD 4L7TA 1X5BA 1OWOA 4X8QA 4YDEA 3SGHA 4DX2A 3C72A 2Y0BG 3ASNE 3U66A 3O4ZA 4CCAA 3Q4AB 3FTZA 1BU9A 1QYMA 3ZUVB 3SZ7A 3IBEA 4EZJA 3Q7FA 3LY9A 1H2TC
chains in the Genus database with same CATH topology
2ZIRA 1N4SA 1N4PA 1TNZA 2BEDA 3PZ1A 3DSXA 1LD8A 3E34A 1TN6A 1JCSA 1JCQA 1MZCA 3DSVA 4MBGA 1NI1A 3Q73A 1LD7A 2H6IA 4GTPA 1TNUA 3E32A 4GTRA 4GTTA 4LNGA 1N4RA 1N95A 1O1RA 3E37A 3SFXA 3E30A 1N9AA 3DSTA 1N94A 1D8DA 4GTQA 3DSUA 2H6HA 1LTXA 1S63A 1SA4A 1N4QA 1TN7A 1DCEA 4GTMA 3DRAA 3PZ3A 1D8EA 3KSLA 2R2LA 1NL4A 1FPPA 3HXFA 3PZ4A 2F0YA 4YDOA 1FT2A 4GTSA 2IEJA 3HXDA 1S64A 1KZOA 3Q79A 1FT1A 3Q75A 4GTOA 3KSQA 1TNBA 3SFYA 2H6FA 1JCRA 4YDEA 3HXEA 3DPYA 3C72A 1SA5A 3EU5A 3HXCA 3EUVA 3E33A 3Q78A 2H6GA 1QBQA 1KZPA 1O5MA 3PZ2A 1TNYA 4LNBA 1TNOA 1O1SA 3Q7AA 4L9PA 3HXBA 1X81A 3DSWA 3DSSA 1TN8A 3Q7FA 1O1TA 4EHMA 2ZISA 4GTVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ZIR A;  1N4S A;  1N4P A;  1TNZ A;  2BED A;  3PZ1 A;  3DSX A;  1LD8 A;  3E34 A;  1TN6 A;  1JCS A;  1JCQ A;  1MZC A;  3DSV A;  4MBG A;  1NI1 A;  3Q73 A;  1LD7 A;  2H6I A;  4GTP A;  1TNU A;  3E32 A;  4GTR A;  4GTT A;  4LNG A;  1N4R A;  1N95 A;  1O1R A;  3E37 A;  3SFX A;  3E30 A;  1N9A A;  3DST A;  1N94 A;  1D8D A;  4GTQ A;  3DSU A;  2H6H A;  1LTX A;  1S63 A;  1SA4 A;  1N4Q A;  1TN7 A;  1DCE A;  4GTM A;  3DRA A;  3PZ3 A;  1D8E A;  3KSL A;  2R2L A;  1NL4 A;  1FPP A;  3HXF A;  3PZ4 A;  2F0Y A;  4YDO A;  1FT2 A;  4GTS A;  2IEJ A;  3HXD A;  1S64 A;  1KZO A;  3Q79 A;  1FT1 A;  3Q75 A;  4GTO A;  3KSQ A;  1TNB A;  3SFY A;  2H6F A;  1JCR A;  4YDE A;  3HXE A;  3DPY A;  3C72 A;  1SA5 A;  3EU5 A;  3HXC A;  3EUV A;  3E33 A;  3Q78 A;  2H6G A;  1QBQ A;  1KZP A;  1O5M A;  3PZ2 A;  1TNY A;  4LNB A;  1TNO A;  1O1S A;  3Q7A A;  4L9P A;  3HXB A;  1X81 A;  3DSW A;  3DSS A;  1TN8 A;  3Q7F A;  1O1T A;  4EHM A;  2ZIS A;  4GTV A; 
#chains in the Genus database with same CATH topology
 1UJJ A;  2XEE A;  3PVL A;  5T8I A;  3RRM B;  5BPP A;  4XEI G;  1H6K A;  4F1P A;  4I6E A;  4GAA A;  3FDH A;  3FUH A;  3SHF A;  4HOR A;  2WXN A;  2LSU A;  1U3D A;  4HB5 A;  1OCR E;  1SZA A;  4ILG A;  5LFA A;  1TNU A;  3ZKJ A;  4XE0 A;  1ZU2 A;  2WXM A;  4G25 A;  3TAX A;  3L22 A;  3DST A;  3NZS A;  2NSZ A;  4AOF A;  4J7W A;  1HH8 A;  3IXE A;  3T8M A;  4N39 A;  4GZC A;  4GTQ A;  4I1M A;  4FC8 A;  4O1O A;  1KLX A;  4BY6 A;  5BT1 A;  4NUR A;  1AWC B;  3MGB A;  3QJZ A;  2IJG X;  2X6J A;  2KBX A;  4WNG A;  2RFA A;  5H7P A;  1H6O A;  4BTB A;  1S64 A;  5LCW J;  4K5C A;  4FJZ A;  4CDN A;  3FUK A;  2OOE A;  4GML A;  5BNW A;  2V4H C;  3URZ A;  3EU9 A;  4EPZ A;  4RSY A;  3C3Q A;  3Q5M A;  3ZHE A;  1TNO A;  4DLO A;  2C0L A;  3TXN A;  4APO A;  1PC2 A;  4OYS A;  1OT8 A;  1XGW A;  3JXJ A;  1IHG A;  3UM1 A;  4EHM A;  3SFZ A;  4Z68 A;  2DWZ A;  3RRU A;  3EIJ A;  4FHK A;  5ITZ F;  2V5Q C;  2R17 C;  4CEM A;  1JCS A;  1JCQ A;  3FTW A;  5ANL A;  1L5J A;  2XS8 A;  1MZC A;  2MRI A;  4MBG A;  4PDX A;  2RFM A;  4B8A A;  5A6C A;  2OV8 A;  3FFL A;  2P9U G;  3RSE G;  3MCX A;  2ZGG A;  1UG3 A;  3HRA A;  4U95 D;  3AS4 A;  3ULY A;  4L2Y A;  2VJ8 A;  4FLB A;  1HZ4 A;  3AG2 E;  2CG3 A;  1JWF A;  1D8D A;  3D9P A;  5FQ7 A;  3PEU B;  5C2Y A;  4O6F A;  5AEN A;  3RKV A;  2OEV A;  4DX1 A;  2V0P A;  3CQC B;  3JYS A;  5G04 J;  4HXI A;  4WWP A;  4BX9 A;  5CED B;  3ZYK A;  3L13 A;  3T5V A;  2KCK A;  4J0U A;  2WB2 A;  1KT0 A;  1RZ4 A;  2YHC A;  4GZ6 A;  3AAA C;  3CVV A;  2H6G A;  2CFZ A;  4HVB A;  3FU6 A;  3PUJ A;  3ZXP A;  3ZN3 A;  3CKB A;  2VYI A;  4MS6 A;  4AP2 A;  2P9P G;  1G3N B;  5FJY A;  4KT6 B;  1E8Z A;  1Z3X A;  3UM0 A;  4YVO A;  1A17 A;  2BKG A;  1N4S A;  2BED A;  3ABM E;  1Z5S C;  3PUK A;  4ANW A;  5HKP A;  2RD0 A;  4N3A A;  3Q73 A;  3FUI A;  4YVQ C;  4B89 A;  4N5C A;  3DBS A;  2PL2 A;  3CHO A;  4N3C A;  1ELW A;  2EQX A;  3BUA A;  3LXU X;  4BSZ B;  5CRU A;  3OXF A;  3VLD A;  3ASO E;  1DCE A;  2I6H A;  2IQC A;  2QFC A;  3V30 A;  3AG3 E;  3ZYL A;  4CT4 A;  2I1J A;  1MQS A;  4GTO A;  5CMY A;  3KSQ A;  1OCO E;  4GU5 A;  4IYP A;  5ANR A;  1S0P A;  3HDX A;  1SA5 A;  2EIL E;  3HXC A;  3QWV A;  3TGO A;  2KCV A;  4EQF A;  3UXG A;  5JJ7 A;  4J8E A;  3B95 A;  2WXO A;  4L2L A;  4CGV A;  1D9S A;  2J4B A;  4LG6 A;  4TRQ A;  2XRZ A;  4ACL A;  2ZXW E;  1SZ9 A;  4F6R D;  4XIF A;  4DX6 D;  1DNP A;  3SY2 A;  1MX2 A;  2LXL A;  4LSZ E;  4HOQ A;  4FJY A;  3AG1 E;  5FQ8 A;  2WXQ A;  3L9T A;  4UWL A;  3UQ3 A;  3CVX A;  1E8Y A;  2XGO A;  2Y1L E;  3ASH A;  4MRU A;  5KBA A;  4JC8 A;  4EZL A;  5FZS A;  2AXU A;  3DXK G;  2ETC A;  4HNA D;  2XEH A;  2H6I A;  3CVY A;  4W9R A;  3TWS A;  4JPS A;  1IQU A;  5C1D A;  3BQO A;  4ATZ D;  1YMP A;  3AS8 A;  4GB9 A;  2RKK A;  2WXH A;  2I9C A;  2X6F A;  5KJK A;  3R9M A;  2C0M A;  1BPO A;  3ONL A;  2MOW A;  2ETB A;  2WMN A;  4LRZ A;  5FWQ A;  5LP0 A;  3FTU A;  4GZ5 A;  3CVN A;  5G05 J;  4EEC A;  1TN7 A;  2EIM E;  3S7D A;  3F6Q A;  3PZ4 A;  3RK6 A;  4BWR A;  3B7S A;  2WMO A;  2J9Q A;  3ONK A;  4ZFH A;  4GYO A;  2KXP C;  4LEU A;  4MKT A;  4FLH A;  2LO6 A;  4GA0 A;  4B94 A;  1UN9 A;  3UTM A;  5AAR A;  3QK0 A;  4WWN A;  4N3B A;  2ZGD A;  3QNK A;  1Z6T A;  1VDY A;  3MX3 A;  3NOG D;  3ML9 A;  2Y3A A;  2XGS A;  4B8C B;  2QY7 A;  4OAV B;  3L54 A;  4HBD A;  5FZQ A;  4EZK A;  1N0R A;  1YCS B;  2LUH A;  2HM8 A;  3Q15 A;  5D2M C;  3W9F A;  1MHQ A;  1N11 A;  2ZU6 B;  1JUQ A;  5CMW A;  5J08 A;  1DCQ A;  5EID A;  5EYL A;  3EHQ A;  4KMO A;  4ABN A;  2C2L A;  2V4L A;  3E4B A;  5AIJ A;  1TJF A;  3APF A;  3B7B A;  5CCL A;  3D9L A;  4DI4 A;  1IKN D;  1SA4 A;  4JEH A;  4GYW A;  5ENN A;  2F8X K;  5CEA A;  2WXJ A;  5DBK A;  4LER A;  4RG9 A;  1NL4 A;  4I17 A;  3JXI A;  3MKR A;  4JZY A;  4GTS A;  2WPV A;  2XZT G;  1E8W A;  2AWI A;  3SFY A;  4QQI A;  1ZB1 A;  2DYR E;  1MJ0 A;  2WM9 A;  1Y6I A;  1K3Z D;  5B1B E;  4WNE A;  4B93 B;  5B3S E;  5EX3 A;  5FIO A;  4L23 A;  2UY1 A;  3MYV A;  1YA0 A;  2FF4 A;  4LNB A;  1O1S A;  3FP3 A;  4N2S A;  3X2Q E;  5ENR D;  4EBA G;  1HF8 A;  5AQ9 A;  4GTV A;  4U63 A;  3CVU A;  4RVB A;  4KXK B;  3LJN A;  3V79 K;  4AY6 A;  2PQR A;  5ARF A;  3FUN A;  5ARG A;  4YDY A;  4I9E A;  4K5B A;  3SBT B;  2OND A;  3GW4 A;  5BV0 A;  1N0Q A;  3DSV A;  3I4G A;  3PS6 A;  2B6C A;  3CHQ A;  4GTP A;  2DVW A;  1UW4 B;  2VQ2 A;  4BES A;  4BSX A;  3S7J A;  1N95 A;  4AXH A;  2FUL A;  4A63 B;  3KD7 A;  4BFR A;  5AQ7 A;  2Y4T A;  1JPL A;  3LY8 A;  5KJN A;  4U8V D;  4DLQ A;  3CIA A;  1QQE A;  4I2W A;  3DSU A;  3FUM A;  4TUU A;  3CST A;  1LTX A;  3FU5 A;  2AVP A;  2KZT B;  4J8S A;  4FA6 A;  2UWJ G;  3MV3 B;  4QFV A;  1V55 E;  5E75 A;  4GCN A;  2PM6 A;  2XEN A;  1GW6 A;  2VGX B;  5JHB A;  3AJI A;  1ELK A;  2R03 A;  3HXD A;  3Q79 A;  4PUC A;  1JCR A;  3NB2 A;  3HXE A;  4GMR A;  4U8Y D;  2R02 A;  2AJA A;  4UI9 C;  3ESK A;  3G2S A;  3FTY A;  5KNH D;  2XCB A;  3EHN A;  2GRO B;  3JQ0 A;  3CVW A;  3QOU A;  1OXJ A;  4DUI A;  1W3B A;  3VTX A;  4KYO B;  3EHR A;  5FIN A;  3U3W A;  3ZYM A;  3PDN A;  3U4T A;  2JAB A;  4GA1 A;  2IF4 A;  3G2V A;  2WQ6 A;  3ABK E;  3QAR A;  3ISM C;  3TWU A;  2UY1 B;  2P9S G;  3L17 A;  5FZR A;  2J09 A;  4AVX A;  1YYH A;  5FTP A;  3E37 A;  1P5Q A;  1BLX B;  1N9A A;  2KAT A;  5AAO A;  2P9K G;  2PQN A;  4CDR A;  1OCC E;  3NZU A;  4IRU A;  4Q96 A;  3P2B A;  2WQH A;  3D9N A;  4BX8 A;  4G2V A;  4ANX A;  2IOS A;  3KEZ A;  1FT2 A;  5ENS D;  4CGW A;  1H0A A;  5AYW D;  3D9I A;  1KZO A;  5KWD A;  1FT1 A;  4MLP A;  4JW1 A;  4G23 A;  2WXK A;  3CKC A;  3RO3 A;  1UN8 A;  4J6I A;  4HS2 A;  3SD5 A;  3E33 A;  3MA5 A;  3HHM A;  2GRM A;  2AXV A;  4FU3 A;  5ENO D;  2XPY A;  2FI7 A;  3UIO C;  2X6H A;  3ULQ A;  3LCA A;  3ZXS A;  5BXO A;  3ZFW A;  1NP7 A;  1U3C A;  2L0T B;  2YHE A;  5EIB E;  3IV0 A;  3CK9 A;  3ZU7 B;  4UWF A;  3CLJ A;  1SW6 A;  4TUM A;  4BTA A;  3ZIM A;  3ZGQ A;  3QAQ A;  2XGM A;  4CDM A;  5LOZ A;  1N4R A;  2MYO A;  3RJV A;  1E90 A;  4XI9 A;  3R9A B;  4JA9 A;  3IHY A;  5FT9 A;  3GZ1 A;  1H2V C;  3LVQ E;  3LKU A;  2JEK A;  2DIW A;  3UX4 A;  1E7V A;  3JCK C;  3ULE G;  2B0O E;  4U0Z A;  4F3V A;  3PZ3 A;  1NFI E;  4UWG A;  3T9K A;  2L9B A;  5CBN A;  2F8Y A;  1K1B A;  4KBQ A;  3I3N A;  5CHE E;  3ZEF A;  4D10 C;  1QNF A;  3BG1 B;  4CYM D;  2H6F A;  1EF1 C;  4V3I A;  4HRN A;  3UM2 A;  1EYH A;  4DRX E;  3UPV A;  3LS8 A;  1WM5 A;  2VTB A;  2Y4U A;  3FH5 A;  1TNY A;  3HYM B;  3UI2 A;  5BUZ A;  5EDS A;  1B89 A;  3DSW A;  4I2Z A;  5LCW C;  3LEW A;  3D9O A;  3WG7 E;  3KAE A;  4JHJ A;  4CRW A;  4H7X A;  3NOC D;  2J08 A;  2R05 A;  5BW8 C;  4KZ0 A;  4ME2 A;  3DXM G;  3MZL B;  4Q94 A;  3NF1 A;  1RW2 A;  5FQ6 A;  4WWO A;  3ZNG A;  2OVB A;  4OVU A;  3E32 A;  4IN3 B;  4GTR A;  3V31 A;  3PZD A;  1HXI A;  2AW6 A;  1N94 A;  2I1K A;  2XPI A;  1NA3 A;  2J49 A;  4HRL A;  2BF0 X;  1Z3Y A;  2J4D A;  2HR2 A;  3SO8 A;  1FVF A;  4UQY A;  1N4Q A;  1IHB A;  4WND A;  1OUV A;  2JLB A;  2L6B A;  3KSL A;  2AXZ A;  4A3T A;  1SVX A;  4F1S A;  5JHA A;  3GYZ A;  5HQ8 A;  3JQ1 A;  4A55 A;  3Q49 B;  1HX8 A;  2OVF A;  3G2T A;  4U0U A;  3EUV A;  3J5Q B;  2IOL A;  1E8X A;  2EIN E;  3D3M A;  3UIP C;  2VGY A;  2VSN A;  3IHV A;  2ZIS A;  3SBS A;  2R5S A;  3LY7 A;  1UOH A;  2E2E A;  3RIB A;  3OAW A;  4H7Y A;  4XX5 A;  1KT1 A;  3ZW3 A;  3MEK A;  4N2Q A;  5M72 A;  2X38 A;  1TEZ A;  4PS3 A;  1LD7 A;  1INZ A;  2VTB B;  1WAO 1;  3N71 A;  2XCC A;  4J8Y A;  3T5X A;  3FH8 A;  4GTT A;  3FTS A;  4DI3 A;  2X6I A;  2VGE A;  3L08 A;  4BT9 A;  5HS0 A;  3C5R A;  1LF8 A;  3PE3 A;  5EKQ D;  2KZT A;  1K1A A;  3CR3 A;  3JUI A;  4I6G A;  3UT7 A;  4G8K A;  4Q69 A;  3S7F A;  4JA7 A;  3FY4 A;  2H6H A;  2VGX A;  2XQ0 A;  3ASF A;  3EJN A;  2BKK B;  4GTM A;  2GW1 A;  3DRA A;  3U9W A;  5G2N A;  2F0Y A;  4NAC A;  3HIZ A;  4A1G A;  3P1U A;  5HI7 A;  2WXF A;  1N54 A;  5EN5 D;  4GPM A;  2WXP A;  5KNG A;  3EU5 A;  4P29 A;  4OVV A;  3CK8 A;  3QDN A;  4G8L A;  4AM9 A;  5CER B;  4A3V A;  4NIK A;  1HG2 A;  4FP7 A;  5A7D B;  4HOU A;  1PY1 A;  3Q7A A;  4L9P A;  2NXP A;  4DX5 D;  4LCT A;  2X6K A;  4NQ0 A;  4FUL A;  2CG2 A;  4I43 A;  3BU8 A;  1MYO A;  4U0S A;  3DSX A;  3FTX A;  2XEV A;  2CHZ A;  3D9M A;  2LAI A;  4UI9 K;  4K5A B;  4UQZ A;  2DZO A;  3C3R A;  4O60 A;  3TWR A;  1HO8 A;  3L6A A;  1H2U A;  2GRP B;  3QB2 A;  3Q9U C;  4U04 A;  3TWV A;  3R7Q A;  4Y6W A;  2XHE A;  3K9I A;  4XI0 A;  2VSO E;  3RU0 A;  4E85 A;  4OAU C;  3TXM A;  4C9B B;  3W9G A;  2NC9 A;  3D9H A;  3FHE A;  1IYG A;  1MX4 A;  5ENT D;  4BET A;  4O1P A;  4TV3 A;  3AS5 A;  3TG4 A;  5IY5 E;  1IQR A;  2X3M A;  2J8S D;  4C0E A;  1EDU A;  5BV1 A;  5G05 C;  4NRH B;  3ZVV A;  3PEV B;  2VSY A;  4RQI A;  3EHM A;  1A5E A;  1N52 A;  3PZ2 A;  4GZ3 A;  3WXX A;  3LYA A;  3G2W A;  4GMJ A;  3RO2 A;  2ZIR A;  4F53 A;  2XRY A;  5A23 A;  2CFU A;  4XZ4 A;  1IXV A;  5EIL A;  3CHP A;  1TNZ A;  5B1A E;  3UT4 A;  3V2X A;  3OXG A;  4GCO A;  4UQX A;  2QYU A;  1LD8 A;  3DEP A;  4TXQ A;  3R7R A;  5KJL A;  3IEG A;  4RG6 A;  3C98 A;  2XPZ A;  2CHW A;  1E7U A;  5AJL A;  4E6H A;  3UUX A;  3QKY A;  4A1S A;  2P9L G;  3FU0 A;  2LSV A;  3TWX A;  2GRN B;  4JEU A;  4URK A;  1TR4 A;  1EPU A;  3IKO B;  2ILR A;  1UJK A;  4UWK A;  3GZ2 A;  3SFX A;  2V5F A;  4HLL A;  2DBA A;  4M3O A;  4C48 B;  4DJA A;  4PS7 A;  3ENE A;  4EBA A;  3NQP A;  1JWG A;  2I2O A;  3B7U X;  1ELR A;  2XZD G;  5CBO A;  4YDO A;  1WG0 A;  1SQM A;  5KJM A;  4AJW A;  3UT8 A;  1TNB A;  1WY6 A;  3APD A;  3CQG B;  4L1B A;  1TJC A;  3CVP A;  3VLF A;  4B0Z A;  2MHK A;  2QYJ A;  3Q78 A;  4GZD A;  2A5U A;  4YDW A;  1KZP A;  2XS1 A;  1OCZ E;  4G26 A;  3NAW A;  2IFU A;  3B7R L;  1NZN A;  3DSS A;  5JJ6 A;  5J90 A;  5D66 A;  2A5E A;  1O1T A;  2WQ7 A;  2YNQ A;  3HG0 D;  1N4P A;  5JMN D;  5DIZ A;  3PZ1 A;  3B7T A;  4AV7 A;  1AP7 A;  3CK7 A;  5CEC B;  4BT8 A;  3E34 A;  2DCP A;  1ZBP A;  2L6J A;  2HYZ A;  3LJ3 A;  1FCH A;  3FWV A;  1S70 B;  3ABL E;  5JJT A;  3DWL G;  4LNU D;  1HE8 A;  2M63 A;  3CHR A;  4TXP A;  1KPS B;  4U8H A;  4I1A A;  2F37 A;  1O1R A;  3FTV A;  3SI5 A;  3I5P A;  3FH7 A;  1OY3 D;  3ASG A;  3MJW A;  2LNI A;  4JHR A;  4HFG A;  3Q9N C;  3ASD A;  2KM4 A;  5E76 A;  3TL5 A;  4ANU A;  4HLE A;  3QWP A;  3UKR G;  4ANV A;  4PS8 A;  2R2L A;  1FPP A;  4YND A;  5D0Q D;  4AEZ C;  4APF A;  1HG5 A;  2E0I A;  2P58 C;  5BXU A;  4HI8 A;  3SNX A;  3OTN A;  4JD2 G;  3FUD A;  2QC9 A;  3DPY A;  3QWW A;  5LX8 A;  3RAU A;  3UIN C;  3LDZ A;  3I4R B;  2YIN A;  4JVS A;  5AN8 A;  4CT0 A;  3HVE A;  5FQ4 A;  1X81 A;  2HE0 A;  1TN8 A;  2VSX E;  4K03 A;  3JUE A;  3D9J A;  4G24 A;  4WNF A;  2WVI A;  4C0M A;  1K8K G;  5AJD A;  1BI7 B;  3ZHE B;  2WXR A;  1OWP A;  2FEZ A;  4GPK A;  4AY5 A;  2Q7F A;  3UM3 A;  4N5Q A;  5EYP F;  3FUE A;  3Q47 B;  4ZHB A;  4KVO A;  5EX0 A;  3PRE A;  4KZC A;  2V8S E;  1TYQ G;  3BEE A;  4G1T A;  3ML8 A;  2WXG A;  3DEO A;  2CHX A;  3EDT B;  5AQA A;  2FO7 A;  3KEA A;  3DPD A;  3ZYQ A;  4JXT A;  1OWM A;  1OWN A;  2PM7 A;  2L0I A;  4I9C A;  2BUG A;  1E96 B;  4JB8 P;  2P9I G;  4IUL A;  3HXF A;  2GRL A;  3VTY A;  2DYS E;  2EIK E;  4KVM A;  3FUL A;  3PRZ A;  4DK5 A;  4JHK A;  3SF4 A;  3APC A;  5AQB A;  3UKU G;  3ZRH A;  5T4Y A;  3TWW A;  1H19 A;  3BG0 B;  3J5P A;  4UUC A;  3PE4 A;  4ATG A;  1O5M A;  4M7C A;  2IY0 C;  3AG4 E;  4BER A;  1MX6 A;  3RRN B;  2DZN A;  3HXB A;  3C3O A;  4GA2 A;  4AIF A;  2QZA A;  5CCM A;  2PZI A;  3QC1 A;  2ETA A;  3ZPJ A;  3CSF A;  4Y6C A;  2FO1 E;  4I1O B;  4HQD A;  4RLY A;  3CEQ A;  1H6P A;  4PH4 B;  4XKC A;  2GRQ B;  3MKQ A;  5G04 C;  1TN6 A;  3ESL A;  4GYY A;  3TJP A;  3U64 A;  2PNN A;  2LAH A;  2KC7 A;  4JL0 A;  4HI9 A;  3CHM A;  1FVH A;  4CZ2 D;  3AU5 A;  3HVE B;  2ION A;  3PNT B;  4LNG A;  3SQV A;  4HOT A;  4LUN U;  3E30 A;  1HU3 A;  3MV2 B;  1XNF A;  3OXL A;  2IU1 A;  3CV0 A;  2Y69 E;  4J8D A;  2P2C P;  3TWT A;  4J8F A;  4UWH A;  2FBN A;  5T3R A;  2OEW A;  1S63 A;  4U7E B;  4UI9 J;  3VLE A;  4K0R A;  4ACK A;  3FEX A;  1HFA A;  3EIQ C;  3T8K A;  1Y8M A;  3Q75 A;  4FHJ A;  4WAF A;  3S7B A;  4HOS A;  1PAQ A;  2NYJ A;  5HRY A;  1HS6 A;  1DVP A;  3V2O A;  1QBQ A;  1QZ2 A;  5JA4 D;  4U96 D;  3CVL A;  2KCL A;  2OCC E;  3UMV A;  3FUF A;  4XKB A;  3D9K A;  3TWQ A;  4TXR A;  3CVQ A;  3FU3 A;  3GZS A;  2RG8 A;  3CHS A;  1Q2Z A;  2EIJ E;  2J07 A;  2GGF A;  1NA0 A;  4DPR A;  4FAD A;  4ILI A;  2YQ8 A;  1WDY A;  4BEP A;  5G55 A;  3PH0 C;  4DX7 D;  3TG5 A;  3LVR E;  5ENQ D;  4ILH B;  2WXL A;  4F7A A;  1NI1 A;  1U2V G;  3S2A A;  1BI8 B;  2IO3 C;  3KS2 A;  3L82 A;  4U07 A;  3FUJ A;  2BTD A;  3PNL B;  4WUY A;  3L16 A;  3NBN B;  2P9N G;  5CRV A;  3O48 A;  2LXM A;  4G11 A;  5D0O D;  2GRR B;  2WXI A;  1OWL A;  3B13 A;  4HRM B;  4I6J A;  3G2U A;  5KCM A;  3MKQ B;  4R7L A;  1V54 E;  3FEY A;  1D8E A;  3LPZ A;  1BD8 A;  2IO2 C;  2A4Z A;  3AU4 A;  2HO1 A;  2R59 A;  3CGH A;  2IEJ A;  1DC2 A;  5ENP D;  4L7T A;  1X5B A;  1OWO A;  4X8Q A;  4YDE A;  3SGH A;  4DX2 A;  3C72 A;  2Y0B G;  3ASN E;  3U66 A;  3O4Z A;  4CCA A;  3Q4A B;  3FTZ A;  1BU9 A;  1QYM A;  3ZUV B;  3SZ7 A;  3IBE A;  4EZJ A;  3Q7F A;  3LY9 A;  1H2T C; 
#chains in the Genus database with same CATH homology
 2ZIR A;  1N4S A;  1N4P A;  1TNZ A;  2BED A;  3PZ1 A;  3DSX A;  1LD8 A;  3E34 A;  1TN6 A;  1JCS A;  1JCQ A;  1MZC A;  3DSV A;  4MBG A;  1NI1 A;  3Q73 A;  1LD7 A;  2H6I A;  4GTP A;  1TNU A;  3E32 A;  4GTR A;  4GTT A;  4LNG A;  1N4R A;  1N95 A;  1O1R A;  3E37 A;  3SFX A;  3E30 A;  1N9A A;  3DST A;  1N94 A;  1D8D A;  4GTQ A;  3DSU A;  2H6H A;  1LTX A;  1S63 A;  1SA4 A;  1N4Q A;  1TN7 A;  1DCE A;  4GTM A;  3DRA A;  3PZ3 A;  1D8E A;  3KSL A;  2R2L A;  1NL4 A;  1FPP A;  3HXF A;  3PZ4 A;  2F0Y A;  4YDO A;  1FT2 A;  4GTS A;  2IEJ A;  3HXD A;  1S64 A;  1KZO A;  3Q79 A;  1FT1 A;  3Q75 A;  4GTO A;  3KSQ A;  1TNB A;  3SFY A;  2H6F A;  1JCR A;  4YDE A;  3HXE A;  3DPY A;  3C72 A;  1SA5 A;  3EU5 A;  3HXC A;  3EUV A;  3E33 A;  3Q78 A;  2H6G A;  1QBQ A;  1KZP A;  1O5M A;  3PZ2 A;  1TNY A;  4LNB A;  1TNO A;  1O1S A;  3Q7A A;  4L9P A;  3HXB A;  1X81 A;  3DSW A;  3DSS A;  1TN8 A;  3Q7F A;  1O1T A;  4EHM A;  2ZIS A;  4GTV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...