2H6IA

W102t/y365f protein farnesyltransferase double mutant complexed with a geranylgeranylated ddptasacvls peptide product at 3.0a
Total Genus 131
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
131
sequence length
315
structure length
315
Chain Sequence
FVSLDSPSYVLYRDRAEWADIDPVPQNDGPNPVVQIIYSDKFRDVYDYFRAVLQRDERSERAFKLTRDAIELNAANYTVWHFRRVLLKSLQKDLHEEMNYITAIIEEQPKNYQVWHHRRVLVEWLRDPSQELEFIADILNQDAKNYHAWQHRQWVIQEFKLWDNELQYVDQLLKEDVRNNSVWNQRYFVISNTTGYNDRAVLEREVQYTLEMIKLVPHNESAWNYLKGILQDRGLSKYPNLLNQLLDLQPSHSSPYLIAFLVDIYEDMLENQCDNKEDILNKALELCEILAKEKDTIRKEYWRYIGRSLQSKHST
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Conversion of protein farnesyltransferase to a geranylgeranyltransferase.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords Protein farnesyltransferase/geranylgeranyltransferase type I
total genus 131
structure length 315
sequence length 315
ec nomenclature ec 2.5.1.58: Protein farnesyltransferase.
pdb deposition date 2006-05-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01239 PPTA Protein prenyltransferase alpha subunit repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.120 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Protein prenylyltransferase 2h6iA00
1TN6A 3Q7AA 4GTTA 2H6IA 3KSLA 4YDEA 1N4PA 1TN7A 2H6FA 4GTVA 2R2LA 3PZ1A 1NI1A 1FPPA 1TNZA 3Q79A 2IEJA 1O1SA 1JCQA 3DRAA 4GTPA 2F0YA 1N9AA 4YDOA 3KSQA 3DSTA 3EU5A 3DSWA 3HXEA 3Q7FA 3DSUA 1TNYA 1N4QA 1S63A 2ZIRA 3DSVA 3EUVA 1N95A 4GTOA 1N94A 4GTRA 1SA4A 3DPYA 1QBQA 3HXFA 3PZ3A 4EHMA 1KZPA 1FT2A 3HXDA 3PZ2A 3HXBA 4L9PA 1TN8A 1LD8A 1NL4A 1JCSA 1LTXA 3Q78A 1MZCA 1SA5A 2H6GA 1O1RA 4LNBA 3Q73A 1DCEA 4GTQA 1X81A 3C72A 1S64A 4GTSA 3E30A 3DSXA 2BEDA 3E33A 1TNOA 1LD7A 1JCRA 1D8DA 1N4SA 1TNBA 3Q75A 3E34A 3E37A 4LNGA 1D8EA 3HXCA 3SFYA 1KZOA 1FT1A 3DSSA 2ZISA 1O5MA 2H6HA 4GTMA 1O1TA 3SFXA 1TNUA 1N4RA 4MBGA 3E32A 3PZ4A
chains in the Genus database with same CATH superfamily
5CRVA 4GZ6A 2GRQB 4GTTA 3QJZA 1TN7A 3APCA 4ILHB 3UT7A 4Q96A 2WQ7A 3MKQA 2IEJA 3SGHA 3F6QA 3JQ1A 4KVOA 1DCQA 2L6JA 4MRUA 4TV3A 1JUQA 3CV0A 1PAQA 2AXUA 2B0OE 5B3SE 4HRMB 3OTNA 2ILRA 4WNGA 4BFRA 5HRYA 5T8IA 2XEHA 5G04J 3FUEA 4EZKA 4UWHA 4DI4A 1QBQA 3UUXA 2XGMA 4U8HA 2V5QC 2P2CP 2VSOE 1MJ0A 5BXUA 4C0MA 2VGXA 1LD8A 4AM9A 2R59A 2YQ8A 5FIOA 3FUJA 3L9TA 1X81A 5ITZF 4JZYA 3ML9A 2CFZA 1S64A 1IXVA 4J8SA 2CFUA 3RO3A 1UG3A 3EIJA 2BTDA 3PE4A 4HOQA 3SI5A 2GRRB 4L2YA 3UINC 2EIJE 1FVHA 2KBXA 4YVOA 2KZTA 4I43A 1NI1A 2PM6A 4J8EA 3IHVA 3HIZA 1TJCA 3ASGA 4LRZA 1NA3A 3NF1A 3PH0C 3DSUA 3URZA 2YHEA 3QKYA 3FUKA 2DBAA 4DX5D 3EUVA 4HQDA 4HB5A 5G2NA 4AY6A 3ESKA 3FUFA 2OOEA 1K3ZD 4FC8A 4NACA 5ANLA 4DUIA 4ANXA 3SHFA 4C0EA 2FULA 1ELWA 1HG2A 1BI8B 3L17A 3B95A 5G04C 5FQ6A 3CHOA 1OXJA 3ZPJA 4OYSA 1O1RA 3UIOC 3SQVA 4JHJA 3FY4A 1H6OA 4I9CA 3U64A 3ABKE 2VTBA 3CR3A 5B1BE 4ANUA 4Q94A 4XX5A 2QFCA 3GZ2A 1TJFA 3Q9NC 1QNFA 3NAWA 4ILIA 3TL5A 3C3RA 2IQCA 2OVFA 2C0MA 4K0RA 5FINA 2XEVA 3FUMA 2VTBB 4FU3A 4RQIA 5ENNA 3RRUA 3MX3A 3NOGD 4J0UA 5AAOA 3T9KA 5KNGA 3PZ4A 1WG0A 1E8WA 2HYZA 1A5EA 2X6HA 2IF4A 3I4GA 3CHRA 4U8VD 5JA4D 1N9AA 4O60A 4A55A 5HI7A 2MOWA 1SZ9A 3UT4A 4UWGA 5BT1A 3TXNA 4F3VA 4WNFA 4P29A 1EF1C 3PVLA 2CG3A 3UI2A 3UKRG 4UWLA 4AVXA 3BU8A 2IONA 4UI9J 4EZJA 1BU9A 3UXGA 2EQXA 4J8YA 3HXDA 4X8QA 1SVXA 3UQ3A 4M3OA 3VLFA 2OVBA 5KNHD 3CHSA 1ELKA 4OAVB 3LKUA 2V4LA 3FUHA 1H2TC 4CGVA 3P2BA 5AQ9A 4BERA 3CHMA 2J9QA 3ZYQA 3ZHEB 3JCKC 3JUEA 2A5EA 2LXMA 4XI9A 3FDHA 3E33A 3QAQA 3ASHA 4J7WA 2R03A 3CVLA 1D8EA 4LERA 1S70B 4AXHA 3D9PA 3TWRA 3CGHA 1H6PA 4JA9A 3MKQB 3FWVA 3Q7AA 2H6FA 2R2LA 1AP7A 2XENA 1TNZA 2NSZA 2C2LA 4XE0A 3APDA 3AG1E 3DSTA 4BX8A 4J6IA 5AQ7A 1EYHA 2XRYA 3KAEA 4U8YD 3D9OA 1HH8A 2GRPB 2J09A 4IN3B 4U96D 1N0QA 1OWPA 4KYOB 2X6FA 4FLHA 4JEUA 4C48B 4HOUA 4OVUA 1HE8A 1FT2A 3PNTB 1N0RA 3CSTA 5ENRD 3X2QE 1YCSB 5FZSA 4CDRA 3CVNA 2P9IG 4GMRA 2WQ6A 1SZAA 4KVMA 1DCEA 4Z68A 2FBNA 3PEUB 5LOZA 4GTQA 3UX4A 4HXIA 5A6CA 3V79K 4GZ5A 1EPUA 4U07A 4D10C 5BNWA 2VSNA 2F8XK 3MV2B 3E34A 2DVWA 1D9SA 3DPDA 4JPSA 5D0OD 4A3TA 3PDNA 3LYAA 3MZLB 1MQSA 4PS7A 4WWPA 3G2UA 3Q5MA 4ACLA 4A63B 5BPPA 5G55A 3ZXPA 4A3VA 3DRAA 2BUGA 4CDMA 3KSQA 3TXMA 4H7XA 4B94A 2FO7A 4FJYA 2CHXA 2BKKB 4UQYA 2WXHA 4ATZD 4EZLA 5E75A 3ZIMA 3FFLA 3IHYA 3RU0A 4TXQA 1MX2A 3UM0A 5ENTD 4APFA 4XEIG 2WXGA 1MZCA 2WM9A 1DVPA 3BG0B 3JUIA 4GMLA 1RW2A 1NP7A 1E7UA 3EHQA 3FU5A 1KT0A 3QOUA 1KPSB 1OWMA 3EU9A 5AQAA 4N5CA 1W3BA 2EILE 4HNAD 3B7TA 3L22A 2LAHA 4LSZE 5BV0A 5CEDB 3B7UX 4B8CB 4K5CA 2DZNA 3SFYA 3DSSA 1UW4B 3WG7E 2ZISA 3ISMC 4U0UA 2E2EA 3AU4A 1DNPA 5BV1A 3HYMB 3LS8A 2ETBA 4WAFA 4KZ0A 2VQ2A 5FJYA 3PZ1A 4XKCA 5EIDA 4CGWA 1JWFA 1UN8A 3CK7A 4MLPA 2MHKA 4CDNA 4HOSA 3QARA 3FUDA 4BY6A 3CVQA 3P1UA 4FHKA 4EECA 4I2WA 5EDSA 3LJ3A 1N4QA 3TWWA 4F1PA 3D9KA 3PEVB 2L9BA 2ZIRA 2WXJA 3MYVA 4AEZC 3CK9A 3K9IA 3IXEA 4R7LA 3LVRE 5EX3A 4EHMA 2NYJA 2WVIA 3HXBA 3IEGA 2CHWA 4O1PA 5JHAA 3ZXSA 1SA5A 1ZB1A 2VYIA 4HI9A 4LEUA 1HF8A 3Q73A 4IRUA 5EN5D 3HVEA 3UKUG 1UOHA 3MA5A 3PUKA 3Q4AB 4N3CA 3BUAA 2AXVA 1U2VG 4FADA 4BX9A 4TXRA 1HG5A 2OV8A 5CBOA 3FEXA 4K03A 1TEZA 1MYOA 2VSYA 4BT8A 3FTSA 3D3MA 2IO2C 3TG4A 5B1AE 3I5PA 5FZQA 3B7SA 2WXOA 2IJGX 3BEEA 4MBGA 1IHBA 1Z5SC 3S7DA 2WMOA 4GU5A 1FVFA 3SBSA 2KCKA 4CZ2D 5G05C 2XRZA 5EILA 4YDOA 3EHRA 2PQNA 2IO3C 1Y6IA 1S63A 4BWRA 2OEVA 5CERB 4FP7A 1V54E 3V30A 3ULEG 4N3BA 4GTRA 5AQBA 2XGSA 4JEHA 2KCVA 4IULA 3TWTA 3CVWA 3SZ7A 2PL2A 2FEZA 3TWXA 4I1AA 3W9GA 3S7FA 4HOTA 2I1JA 2ZGGA 3ZW3A 4Y6WA 3C72A 1E8ZA 2LNIA 3CVPA 3EDTB 5KWDA 2DZOA 2BEDA 1GW6A 2KC7A 1DC2A 1HO8A 1LD7A 1D8DA 2AVPA 1TNBA 1NZNA 3GZ1A 4GYOA 3ZYKA 1IHGA 1KZOA 1EDUA 1FT1A 5D0QD 3MEKA 4LCTA 4TUMA 1KLXA 4JB8P 3ZGQA 3RAUA 4IYPA 3O4ZA 4DX6D 3UPVA 4I2ZA 2QC9A 1B89A 5JHBA 2WB2A 4AP2A 5CCLA 3Q79A 2FO1E 3ONKA 3VLEA 2KCLA 2XS1A 4F53A 3EIQC 3HXEA 4HVBA 2AWIA 3RSEG 3CKBA 4UQXA 2XCCA 1Z3XA 3DEPA 3CQCB 3G2SA 1E90A 5BUZA 5JJ7A 1BI7B 2A4ZA 4GCNA 3KEZA 4I9EA 1XGWA 3ZKJA 2HR2A 4GMJA 4GYWA 3ULQA 3TAXA 3HHMA 4UWKA 3G2VA 3C3OA 2ETCA 5CMWA 4GZDA 3LCAA 2AW6A 4JHKA 5CECB 2DYSE 4AOFA 2Y0BG 4ZHBA 3Q47B 3J5QB 4UUCA 5ENSD 3RO2A 4G8KA 2Y4UA 3JQ0A 2P9NG 3C3QA 4AV7A 3SY2A 5HQ8A 4QFVA 3G2WA 4G8LA 3U3WA 2VJ8A 2F37A 3GW4A 3Q9UC 3R9MA 2Y69E 1JCRA 5D2MC 1N4SA 2E0IA 3AG2E 2I9CA 3E37A 3D9NA 4LNGA 3AG3E 4CT4A 5ANRA 1IKND 4JHRA 2PQRA 1BD8A 2FI7A 1H2VC 3CVYA 3ABLE 3LY7A 3SFXA 3UTMA 4GZ3A 3FEYA 5EKQD 1TNUA 4BSXA 3V31A 3AJIA 2P9SG 3QB2A 5BW8C 1OT8A 1H6KA 2H6IA 1K1BA 3SNXA 5J90A 2R02A 2WQHA 3JXJA 1AWCB 3U4TA 2Q7FA 1S0PA 3RJVA 2A5UA 4FJZA 3ASNE 4A1GA 3EHMA 1OCZE 2UY1A 2EIME 1Y8MA 3CK8A 4A1SA 4PUCA 3VLDA 3ZYMA 4DX1A 1N94A 4FHJA 3TJPA 3J5PA 2GW1A 2AXZA 3RK6A 3CSFA 4EBAG 3B13A 2JABA 5DIZA 3L82A 3L08A 3ESLA 3HVEB 3CKCA 1NL4A 3PS6A 2Y4TA 2H6GA 1MX4A 4WUYA 4PDXA 1YA0A 3UM2A 5DBKA 5G05J 2V8SE 4U0ZA 3FULA 3EHNA 1NFIE 5CCMA 1HXIA 4J8DA 3W9FA 3MGBA 2WPVA 2XS8A 3LDZA 4BTAA 3L54A 3R9AB 5CHEE 4DJAA 3FHEA 5BXOA 4U04A 3EJNA 5LCWC 2OCCE 3OXGA 1WY6A 2VGEA 3AS5A 3FP3A 3KEAA 4XZ4A 2VGXB 4NQ0A 4GA0A 5HKPA 4KMOA 2X3MA 3E4BA 5LFAA 4CYMD 1OCRE 1JCQA 2YNQA 4MKTA 4F7AA 2R05A 3DXMG 4HLEA 4W9RA 3FH8A 2P9UG 3FU3A 3PREA 1P5QA 4F1SA 3QC1A 2IOSA 2WXQA 4GZCA 1HX8A 2XGOA 3CIAA 1K8KG 1YMPA 4YNDA 2P58C 3SO8A 5LCWJ 2P9PG 2KXPC 2EINE 1JCSA 3G2TA 3U66A 3CVXA 2KZTB 4JXTA 2ONDA 3CVUA 4JL0A 2IU1A 3ENEA 1OCCE 1VDYA 4ILGA 4M7CA 4J8FA 1N11A 3NB2A 4BSZB 2WXFA 1HS6A 4EBAA 2QZAA 4UWFA 3NQPA 2UWJG 2OEWA 4LNUD 4AIFA 4E85A 3ZRHA 1U3DA 2I2OA 4JC8A 2RFAA 3FUNA 3QWVA 4L23A 1SW6A 3OXFA 4EQFA 2FF4A 3RIBA 2ZU6B 5FQ7A 1OUVA 4U7EB 2PM7A 3LJNA 3ML8A 5FWQA 4FLBA 3ZN3A 1O1SA 4XKBA 5EIBE 3UM3A 3CEQA 3CLJA 4LUNU 3ZHEA 4APOA 1OWLA 4U95D 2I1KA 1MX6A 3UT8A 4ABNA 3IV0A 2J08A 2AJAA 4DLOA 4DRXE 2GRLA 3QWPA 1N52A 4I6GA 4BT9A 2P9KG 4URKA 2CHZA 4GB9A 1OCOE 3B7BA 3T8MA 3HG0D 3Q49B 2DCPA 3APFA 3PZ3A 5IY5E 5JMND 2LO6A 2XCBA 4L9PA 3Q78A 5C1DA 4WWOA 2LSVA 4N2SA 5AYWD 4OAUC 3OAWA 2J49A 2YHCA 3SBTB 3AS8A 4WNEA 3Q75A 4LG6A 1RZ4A 4E6HA 5KJMA 2MRIA 3V2OA 1O5MA 1HU3A 2CG2A 4CCAA 4GPMA 3KSLA 3KS2A 1BPOA 3RKVA 3IKOB 1Z3YA 2WXPA 4I1MA 4B8AA 3QWWA 1OY3D 4AY5A 3DBSA 5ARFA 1INZA 3Q7FA 3ZEFA 3HRAA 1E8XA 4G23A 3RRNB 3KD7A 2KATA 4O6FA 3DSVA 2DYRE 3ASFA 5CBNA 4GA2A 4L7TA 4PS8A 3LY9A 3JYSA 4HRNA 3D9HA 3D9MA 4B0ZA 1BLXB 4G26A 3QDNA 4UI9K 3PZ2A 2VGYA 4ANWA 4CRWA 1QYMA 4H7YA 5FZRA 5M72A 2BF0X 4DX2A 3TWQA 2VSXE 2YINA 3L6AA 2ZXWE 3B7RL 5ENOD 2ZGDA 2DIWA 2GRNB 1V55E 4GTSA 1LF8A 3LEWA 5T4YA 3PNLB 4WWNA 4L2LA 4MS6A 3MCXA 1IQUA 4NURA 5AARA 1N4RA 1U3CA 5FQ4A 4FA6A 5EX0A 5C2YA 4KBQA 4GTVA 2Y3AA 3ZFWA 3QNKA 5AJLA 3SD5A 4N2QA 3N71A 1E7VA 2GROB 2F0YA 4N3AA 3R7QA 3NZUA 5KCMA 3EU5A 3D9IA 3BG1B 2XPIA 1UJJA 3FTUA 4JW1A 2HO1A 3Q15A 2HM8A 3CVVA 5JJTA 2WMNA 3PUJA 3GYZA 5H7PA 1SA4A 3IBEA 3HXFA 3TWSA 2J07A 4GA1A 4XIFA 3LXUX 1PC2A 1PY1A 5KBAA 2B6CA 2X6KA 1WAO1 3LY8A 2F8YA 5KJLA 4KZCA 5T3RA 3GZSA 4GYYA 1UJKA 2L6BA 1KT1A 4RG6A 5LX8A 4ATGA 4G24A 5ARGA 3ASDA 1FCHA 4G2VA 1OWNA 1TNOA 2J4BA 2WXNA 3ZUVB 2XZDG 3LPZA 5HS0A 2X6IA 3U9WA 1IYGA 3TGOA 2WXMA 4K5AB 1G3NB 5D66A 2BKGA 3O48A 4WNDA 3NOCD 4I17A 1QZ2A 2J4DA 1NA0A 2DWZA 3L13A 2ETAA 5AENA 3NZSA 3SF4A 5AN8A 3ULYA 5FT9A 5EYPF 3V2XA 3DSWA 4HLLA 5LP0A 1TNYA 1MHQA 4HS2A 2RD0A 4RSYA 4HORA 3PRZA 3T5VA 4RVBA 5J08A 3S7JA 4I6JA 4JA7A 3T8KA 3FH5A 3CQGB 3NBNB 2L0IA 3DPYA 4XI0A 2J8SD 1E8YA 2PZIA 1LTXA 4DK5A 2WXIA 3FTZA 4ZFHA 4GPKA 2X38A 1HFAA 3D9JA 2XPZA 4N5QA 2QY7A 5EYLA 4BETA 2MYOA 3ZYLA 2I6HA 4B93B 2GRMA 3SFZA 3AU5A 4GCOA 4RG9A 1OWOA 4ME2A 4O1OA 3FUIA 5ENPD 4ACKA 2LAIA 3C5RA 4FULA 1H2UA 2JEKA 3HXCA 1E96B 2RG8A 3FTXA 2H6HA 3QK0A 1O1TA 1HZ4A 5FTPA 3E32A 2JLBA 3S7BA 1TN6A 4DI3A 3HDXA 3AAAC 2NC9A 1FPPA 4ANVA 4TXPA 1WM5A 3C98A 2XHEA 4I6EA 3I3NA 4JVSA 4OVVA 3PZDA 4Y6CA 1TYQG 1X5BA 1N95A 2XPYA 3FU0A 4GTOA 1Z6TA 4PS3A 4PH4B 5E76A 4B89A 3OXLA 4YDYA 4BTBA 5CRUA 5ENQD 4RLYA 3FU6A 4G25A 2IFUA 4N39A 3R7RA 2V0PA 4EPZA 4G11A 4LNBA 4NIKA 2WXKA 3ZU7B 2NXPA 4DPRA 4HRLA 5CEAA 1WDYA 2WXLA 3BQOA 2RKKA 4DLQA 3DSXA 2R5SA 4AJWA 3UM1A 2IY0C 2V4HC 2L0TB 2XZTG 3L16A 1JPLA 2HE0A 1UN9A 4HBDA 2X6JA 1H19A 2P9LG 2RFMA 3VTXA 3ONLA 2R17C 3DXKG 5CMYA 3FTWA 4DX7D 2Y1LE 3RRMB 1ZU2A 4YDEA 1N4PA 1ZBPA 4KXKB 4TUUA 3MKRA 3T5XA 2IOLA 4CT0A 3AG4E 4U0SA 3ABME 4GTPA 3WXXA 3TG5A 2KM4A 3UMVA 5AIJA 3JXIA 4Q69A 2LUHA 3UIPC 3PE3A 5JJ6A 3I4RB 3AS4A 5KJNA 1JWGA 1Q2ZA 4K5BA 3VTYA 4GAAA 4I1OB 2XEEA 1L5JA 2C0LA 4QQIA 3TWVA 4L1BA 3S2AA 4YDWA 3ZNGA 3MV3B 3CHPA 1KZPA 1TR4A 5A23A 4BEPA 2M63A 1A17A 1YYHA 1TN8A 4V3IA 5FQ8A 2XQ0A 4TRQA 2QYUA 3ZVVA 2GGFA 4NRHB 1IQRA 1XNFA 3CHQA 3D9LA 5AJDA 2LXLA 5KJKA 3TWUA 4BESA 4C9BB 5A7DB 3FTYA 2WXRA 3ASOE 1QQEA 3MJWA 2V5FA 2PNNA 3FH7A 4JD2G 3LVQE 4UQZA 2UY1B 4G1TA 1ELRA 4U63A 3E30A 4CEMA 1N54A 1SQMA 2LSUA 3DWLG 3DEOA 2EIKE 4F6RD 4HFGA 4UI9C 4GTMA 2QYJA 1H0AA 4YVQC 4HI8A 3FTVA 4KT6B 1K1AA
chains in the Genus database with same CATH topology
1TN6A 3Q7AA 4GTTA 2H6IA 3KSLA 4YDEA 1N4PA 1TN7A 2H6FA 4GTVA 2R2LA 3PZ1A 1NI1A 1FPPA 1TNZA 3Q79A 2IEJA 1O1SA 1JCQA 3DRAA 4GTPA 2F0YA 1N9AA 4YDOA 3KSQA 3DSTA 3EU5A 3DSWA 3HXEA 3Q7FA 3DSUA 1TNYA 1N4QA 1S63A 2ZIRA 3DSVA 3EUVA 1N95A 4GTOA 1N94A 4GTRA 1SA4A 3DPYA 1QBQA 3HXFA 3PZ3A 4EHMA 1KZPA 1FT2A 3HXDA 3PZ2A 3HXBA 4L9PA 1TN8A 1LD8A 1NL4A 1JCSA 1LTXA 3Q78A 1MZCA 1SA5A 2H6GA 1O1RA 4LNBA 3Q73A 1DCEA 4GTQA 1X81A 3C72A 1S64A 4GTSA 3E30A 3DSXA 2BEDA 3E33A 1TNOA 1LD7A 1JCRA 1D8DA 1N4SA 1TNBA 3Q75A 3E34A 3E37A 4LNGA 1D8EA 3HXCA 3SFYA 1KZOA 1FT1A 3DSSA 2ZISA 1O5MA 2H6HA 4GTMA 1O1TA 3SFXA 1TNUA 1N4RA 4MBGA 3E32A 3PZ4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1TN6 A;  3Q7A A;  4GTT A;  2H6I A;  3KSL A;  4YDE A;  1N4P A;  1TN7 A;  2H6F A;  4GTV A;  2R2L A;  3PZ1 A;  1NI1 A;  1FPP A;  1TNZ A;  3Q79 A;  2IEJ A;  1O1S A;  1JCQ A;  3DRA A;  4GTP A;  2F0Y A;  1N9A A;  4YDO A;  3KSQ A;  3DST A;  3EU5 A;  3DSW A;  3HXE A;  3Q7F A;  3DSU A;  1TNY A;  1N4Q A;  1S63 A;  2ZIR A;  3DSV A;  3EUV A;  1N95 A;  4GTO A;  1N94 A;  4GTR A;  1SA4 A;  3DPY A;  1QBQ A;  3HXF A;  3PZ3 A;  4EHM A;  1KZP A;  1FT2 A;  3HXD A;  3PZ2 A;  3HXB A;  4L9P A;  1TN8 A;  1LD8 A;  1NL4 A;  1JCS A;  1LTX A;  3Q78 A;  1MZC A;  1SA5 A;  2H6G A;  1O1R A;  4LNB A;  3Q73 A;  1DCE A;  4GTQ A;  1X81 A;  3C72 A;  1S64 A;  4GTS A;  3E30 A;  3DSX A;  2BED A;  3E33 A;  1TNO A;  1LD7 A;  1JCR A;  1D8D A;  1N4S A;  1TNB A;  3Q75 A;  3E34 A;  3E37 A;  4LNG A;  1D8E A;  3HXC A;  3SFY A;  1KZO A;  1FT1 A;  3DSS A;  2ZIS A;  1O5M A;  2H6H A;  4GTM A;  1O1T A;  3SFX A;  1TNU A;  1N4R A;  4MBG A;  3E32 A;  3PZ4 A; 
#chains in the Genus database with same CATH topology
 5CRV A;  4GZ6 A;  2GRQ B;  4GTT A;  3QJZ A;  1TN7 A;  3APC A;  4ILH B;  3UT7 A;  4Q96 A;  2WQ7 A;  3MKQ A;  2IEJ A;  3SGH A;  3F6Q A;  3JQ1 A;  4KVO A;  1DCQ A;  2L6J A;  4MRU A;  4TV3 A;  1JUQ A;  3CV0 A;  1PAQ A;  2AXU A;  2B0O E;  5B3S E;  4HRM B;  3OTN A;  2ILR A;  4WNG A;  4BFR A;  5HRY A;  5T8I A;  2XEH A;  5G04 J;  3FUE A;  4EZK A;  4UWH A;  4DI4 A;  1QBQ A;  3UUX A;  2XGM A;  4U8H A;  2V5Q C;  2P2C P;  2VSO E;  1MJ0 A;  5BXU A;  4C0M A;  2VGX A;  1LD8 A;  4AM9 A;  2R59 A;  2YQ8 A;  5FIO A;  3FUJ A;  3L9T A;  1X81 A;  5ITZ F;  4JZY A;  3ML9 A;  2CFZ A;  1S64 A;  1IXV A;  4J8S A;  2CFU A;  3RO3 A;  1UG3 A;  3EIJ A;  2BTD A;  3PE4 A;  4HOQ A;  3SI5 A;  2GRR B;  4L2Y A;  3UIN C;  2EIJ E;  1FVH A;  2KBX A;  4YVO A;  2KZT A;  4I43 A;  1NI1 A;  2PM6 A;  4J8E A;  3IHV A;  3HIZ A;  1TJC A;  3ASG A;  4LRZ A;  1NA3 A;  3NF1 A;  3PH0 C;  3DSU A;  3URZ A;  2YHE A;  3QKY A;  3FUK A;  2DBA A;  4DX5 D;  3EUV A;  4HQD A;  4HB5 A;  5G2N A;  4AY6 A;  3ESK A;  3FUF A;  2OOE A;  1K3Z D;  4FC8 A;  4NAC A;  5ANL A;  4DUI A;  4ANX A;  3SHF A;  4C0E A;  2FUL A;  1ELW A;  1HG2 A;  1BI8 B;  3L17 A;  3B95 A;  5G04 C;  5FQ6 A;  3CHO A;  1OXJ A;  3ZPJ A;  4OYS A;  1O1R A;  3UIO C;  3SQV A;  4JHJ A;  3FY4 A;  1H6O A;  4I9C A;  3U64 A;  3ABK E;  2VTB A;  3CR3 A;  5B1B E;  4ANU A;  4Q94 A;  4XX5 A;  2QFC A;  3GZ2 A;  1TJF A;  3Q9N C;  1QNF A;  3NAW A;  4ILI A;  3TL5 A;  3C3R A;  2IQC A;  2OVF A;  2C0M A;  4K0R A;  5FIN A;  2XEV A;  3FUM A;  2VTB B;  4FU3 A;  4RQI A;  5ENN A;  3RRU A;  3MX3 A;  3NOG D;  4J0U A;  5AAO A;  3T9K A;  5KNG A;  3PZ4 A;  1WG0 A;  1E8W A;  2HYZ A;  1A5E A;  2X6H A;  2IF4 A;  3I4G A;  3CHR A;  4U8V D;  5JA4 D;  1N9A A;  4O60 A;  4A55 A;  5HI7 A;  2MOW A;  1SZ9 A;  3UT4 A;  4UWG A;  5BT1 A;  3TXN A;  4F3V A;  4WNF A;  4P29 A;  1EF1 C;  3PVL A;  2CG3 A;  3UI2 A;  3UKR G;  4UWL A;  4AVX A;  3BU8 A;  2ION A;  4UI9 J;  4EZJ A;  1BU9 A;  3UXG A;  2EQX A;  4J8Y A;  3HXD A;  4X8Q A;  1SVX A;  3UQ3 A;  4M3O A;  3VLF A;  2OVB A;  5KNH D;  3CHS A;  1ELK A;  4OAV B;  3LKU A;  2V4L A;  3FUH A;  1H2T C;  4CGV A;  3P2B A;  5AQ9 A;  4BER A;  3CHM A;  2J9Q A;  3ZYQ A;  3ZHE B;  3JCK C;  3JUE A;  2A5E A;  2LXM A;  4XI9 A;  3FDH A;  3E33 A;  3QAQ A;  3ASH A;  4J7W A;  2R03 A;  3CVL A;  1D8E A;  4LER A;  1S70 B;  4AXH A;  3D9P A;  3TWR A;  3CGH A;  1H6P A;  4JA9 A;  3MKQ B;  3FWV A;  3Q7A A;  2H6F A;  2R2L A;  1AP7 A;  2XEN A;  1TNZ A;  2NSZ A;  2C2L A;  4XE0 A;  3APD A;  3AG1 E;  3DST A;  4BX8 A;  4J6I A;  5AQ7 A;  1EYH A;  2XRY A;  3KAE A;  4U8Y D;  3D9O A;  1HH8 A;  2GRP B;  2J09 A;  4IN3 B;  4U96 D;  1N0Q A;  1OWP A;  4KYO B;  2X6F A;  4FLH A;  4JEU A;  4C48 B;  4HOU A;  4OVU A;  1HE8 A;  1FT2 A;  3PNT B;  1N0R A;  3CST A;  5ENR D;  3X2Q E;  1YCS B;  5FZS A;  4CDR A;  3CVN A;  2P9I G;  4GMR A;  2WQ6 A;  1SZA A;  4KVM A;  1DCE A;  4Z68 A;  2FBN A;  3PEU B;  5LOZ A;  4GTQ A;  3UX4 A;  4HXI A;  5A6C A;  3V79 K;  4GZ5 A;  1EPU A;  4U07 A;  4D10 C;  5BNW A;  2VSN A;  2F8X K;  3MV2 B;  3E34 A;  2DVW A;  1D9S A;  3DPD A;  4JPS A;  5D0O D;  4A3T A;  3PDN A;  3LYA A;  3MZL B;  1MQS A;  4PS7 A;  4WWP A;  3G2U A;  3Q5M A;  4ACL A;  4A63 B;  5BPP A;  5G55 A;  3ZXP A;  4A3V A;  3DRA A;  2BUG A;  4CDM A;  3KSQ A;  3TXM A;  4H7X A;  4B94 A;  2FO7 A;  4FJY A;  2CHX A;  2BKK B;  4UQY A;  2WXH A;  4ATZ D;  4EZL A;  5E75 A;  3ZIM A;  3FFL A;  3IHY A;  3RU0 A;  4TXQ A;  1MX2 A;  3UM0 A;  5ENT D;  4APF A;  4XEI G;  2WXG A;  1MZC A;  2WM9 A;  1DVP A;  3BG0 B;  3JUI A;  4GML A;  1RW2 A;  1NP7 A;  1E7U A;  3EHQ A;  3FU5 A;  1KT0 A;  3QOU A;  1KPS B;  1OWM A;  3EU9 A;  5AQA A;  4N5C A;  1W3B A;  2EIL E;  4HNA D;  3B7T A;  3L22 A;  2LAH A;  4LSZ E;  5BV0 A;  5CED B;  3B7U X;  4B8C B;  4K5C A;  2DZN A;  3SFY A;  3DSS A;  1UW4 B;  3WG7 E;  2ZIS A;  3ISM C;  4U0U A;  2E2E A;  3AU4 A;  1DNP A;  5BV1 A;  3HYM B;  3LS8 A;  2ETB A;  4WAF A;  4KZ0 A;  2VQ2 A;  5FJY A;  3PZ1 A;  4XKC A;  5EID A;  4CGW A;  1JWF A;  1UN8 A;  3CK7 A;  4MLP A;  2MHK A;  4CDN A;  4HOS A;  3QAR A;  3FUD A;  4BY6 A;  3CVQ A;  3P1U A;  4FHK A;  4EEC A;  4I2W A;  5EDS A;  3LJ3 A;  1N4Q A;  3TWW A;  4F1P A;  3D9K A;  3PEV B;  2L9B A;  2ZIR A;  2WXJ A;  3MYV A;  4AEZ C;  3CK9 A;  3K9I A;  3IXE A;  4R7L A;  3LVR E;  5EX3 A;  4EHM A;  2NYJ A;  2WVI A;  3HXB A;  3IEG A;  2CHW A;  4O1P A;  5JHA A;  3ZXS A;  1SA5 A;  1ZB1 A;  2VYI A;  4HI9 A;  4LEU A;  1HF8 A;  3Q73 A;  4IRU A;  5EN5 D;  3HVE A;  3UKU G;  1UOH A;  3MA5 A;  3PUK A;  3Q4A B;  4N3C A;  3BUA A;  2AXV A;  1U2V G;  4FAD A;  4BX9 A;  4TXR A;  1HG5 A;  2OV8 A;  5CBO A;  3FEX A;  4K03 A;  1TEZ A;  1MYO A;  2VSY A;  4BT8 A;  3FTS A;  3D3M A;  2IO2 C;  3TG4 A;  5B1A E;  3I5P A;  5FZQ A;  3B7S A;  2WXO A;  2IJG X;  3BEE A;  4MBG A;  1IHB A;  1Z5S C;  3S7D A;  2WMO A;  4GU5 A;  1FVF A;  3SBS A;  2KCK A;  4CZ2 D;  5G05 C;  2XRZ A;  5EIL A;  4YDO A;  3EHR A;  2PQN A;  2IO3 C;  1Y6I A;  1S63 A;  4BWR A;  2OEV A;  5CER B;  4FP7 A;  1V54 E;  3V30 A;  3ULE G;  4N3B A;  4GTR A;  5AQB A;  2XGS A;  4JEH A;  2KCV A;  4IUL A;  3TWT A;  3CVW A;  3SZ7 A;  2PL2 A;  2FEZ A;  3TWX A;  4I1A A;  3W9G A;  3S7F A;  4HOT A;  2I1J A;  2ZGG A;  3ZW3 A;  4Y6W A;  3C72 A;  1E8Z A;  2LNI A;  3CVP A;  3EDT B;  5KWD A;  2DZO A;  2BED A;  1GW6 A;  2KC7 A;  1DC2 A;  1HO8 A;  1LD7 A;  1D8D A;  2AVP A;  1TNB A;  1NZN A;  3GZ1 A;  4GYO A;  3ZYK A;  1IHG A;  1KZO A;  1EDU A;  1FT1 A;  5D0Q D;  3MEK A;  4LCT A;  4TUM A;  1KLX A;  4JB8 P;  3ZGQ A;  3RAU A;  4IYP A;  3O4Z A;  4DX6 D;  3UPV A;  4I2Z A;  2QC9 A;  1B89 A;  5JHB A;  2WB2 A;  4AP2 A;  5CCL A;  3Q79 A;  2FO1 E;  3ONK A;  3VLE A;  2KCL A;  2XS1 A;  4F53 A;  3EIQ C;  3HXE A;  4HVB A;  2AWI A;  3RSE G;  3CKB A;  4UQX A;  2XCC A;  1Z3X A;  3DEP A;  3CQC B;  3G2S A;  1E90 A;  5BUZ A;  5JJ7 A;  1BI7 B;  2A4Z A;  4GCN A;  3KEZ A;  4I9E A;  1XGW A;  3ZKJ A;  2HR2 A;  4GMJ A;  4GYW A;  3ULQ A;  3TAX A;  3HHM A;  4UWK A;  3G2V A;  3C3O A;  2ETC A;  5CMW A;  4GZD A;  3LCA A;  2AW6 A;  4JHK A;  5CEC B;  2DYS E;  4AOF A;  2Y0B G;  4ZHB A;  3Q47 B;  3J5Q B;  4UUC A;  5ENS D;  3RO2 A;  4G8K A;  2Y4U A;  3JQ0 A;  2P9N G;  3C3Q A;  4AV7 A;  3SY2 A;  5HQ8 A;  4QFV A;  3G2W A;  4G8L A;  3U3W A;  2VJ8 A;  2F37 A;  3GW4 A;  3Q9U C;  3R9M A;  2Y69 E;  1JCR A;  5D2M C;  1N4S A;  2E0I A;  3AG2 E;  2I9C A;  3E37 A;  3D9N A;  4LNG A;  3AG3 E;  4CT4 A;  5ANR A;  1IKN D;  4JHR A;  2PQR A;  1BD8 A;  2FI7 A;  1H2V C;  3CVY A;  3ABL E;  3LY7 A;  3SFX A;  3UTM A;  4GZ3 A;  3FEY A;  5EKQ D;  1TNU A;  4BSX A;  3V31 A;  3AJI A;  2P9S G;  3QB2 A;  5BW8 C;  1OT8 A;  1H6K A;  2H6I A;  1K1B A;  3SNX A;  5J90 A;  2R02 A;  2WQH A;  3JXJ A;  1AWC B;  3U4T A;  2Q7F A;  1S0P A;  3RJV A;  2A5U A;  4FJZ A;  3ASN E;  4A1G A;  3EHM A;  1OCZ E;  2UY1 A;  2EIM E;  1Y8M A;  3CK8 A;  4A1S A;  4PUC A;  3VLD A;  3ZYM A;  4DX1 A;  1N94 A;  4FHJ A;  3TJP A;  3J5P A;  2GW1 A;  2AXZ A;  3RK6 A;  3CSF A;  4EBA G;  3B13 A;  2JAB A;  5DIZ A;  3L82 A;  3L08 A;  3ESL A;  3HVE B;  3CKC A;  1NL4 A;  3PS6 A;  2Y4T A;  2H6G A;  1MX4 A;  4WUY A;  4PDX A;  1YA0 A;  3UM2 A;  5DBK A;  5G05 J;  2V8S E;  4U0Z A;  3FUL A;  3EHN A;  1NFI E;  5CCM A;  1HXI A;  4J8D A;  3W9F A;  3MGB A;  2WPV A;  2XS8 A;  3LDZ A;  4BTA A;  3L54 A;  3R9A B;  5CHE E;  4DJA A;  3FHE A;  5BXO A;  4U04 A;  3EJN A;  5LCW C;  2OCC E;  3OXG A;  1WY6 A;  2VGE A;  3AS5 A;  3FP3 A;  3KEA A;  4XZ4 A;  2VGX B;  4NQ0 A;  4GA0 A;  5HKP A;  4KMO A;  2X3M A;  3E4B A;  5LFA A;  4CYM D;  1OCR E;  1JCQ A;  2YNQ A;  4MKT A;  4F7A A;  2R05 A;  3DXM G;  4HLE A;  4W9R A;  3FH8 A;  2P9U G;  3FU3 A;  3PRE A;  1P5Q A;  4F1S A;  3QC1 A;  2IOS A;  2WXQ A;  4GZC A;  1HX8 A;  2XGO A;  3CIA A;  1K8K G;  1YMP A;  4YND A;  2P58 C;  3SO8 A;  5LCW J;  2P9P G;  2KXP C;  2EIN E;  1JCS A;  3G2T A;  3U66 A;  3CVX A;  2KZT B;  4JXT A;  2OND A;  3CVU A;  4JL0 A;  2IU1 A;  3ENE A;  1OCC E;  1VDY A;  4ILG A;  4M7C A;  4J8F A;  1N11 A;  3NB2 A;  4BSZ B;  2WXF A;  1HS6 A;  4EBA A;  2QZA A;  4UWF A;  3NQP A;  2UWJ G;  2OEW A;  4LNU D;  4AIF A;  4E85 A;  3ZRH A;  1U3D A;  2I2O A;  4JC8 A;  2RFA A;  3FUN A;  3QWV A;  4L23 A;  1SW6 A;  3OXF A;  4EQF A;  2FF4 A;  3RIB A;  2ZU6 B;  5FQ7 A;  1OUV A;  4U7E B;  2PM7 A;  3LJN A;  3ML8 A;  5FWQ A;  4FLB A;  3ZN3 A;  1O1S A;  4XKB A;  5EIB E;  3UM3 A;  3CEQ A;  3CLJ A;  4LUN U;  3ZHE A;  4APO A;  1OWL A;  4U95 D;  2I1K A;  1MX6 A;  3UT8 A;  4ABN A;  3IV0 A;  2J08 A;  2AJA A;  4DLO A;  4DRX E;  2GRL A;  3QWP A;  1N52 A;  4I6G A;  4BT9 A;  2P9K G;  4URK A;  2CHZ A;  4GB9 A;  1OCO E;  3B7B A;  3T8M A;  3HG0 D;  3Q49 B;  2DCP A;  3APF A;  3PZ3 A;  5IY5 E;  5JMN D;  2LO6 A;  2XCB A;  4L9P A;  3Q78 A;  5C1D A;  4WWO A;  2LSV A;  4N2S A;  5AYW D;  4OAU C;  3OAW A;  2J49 A;  2YHC A;  3SBT B;  3AS8 A;  4WNE A;  3Q75 A;  4LG6 A;  1RZ4 A;  4E6H A;  5KJM A;  2MRI A;  3V2O A;  1O5M A;  1HU3 A;  2CG2 A;  4CCA A;  4GPM A;  3KSL A;  3KS2 A;  1BPO A;  3RKV A;  3IKO B;  1Z3Y A;  2WXP A;  4I1M A;  4B8A A;  3QWW A;  1OY3 D;  4AY5 A;  3DBS A;  5ARF A;  1INZ A;  3Q7F A;  3ZEF A;  3HRA A;  1E8X A;  4G23 A;  3RRN B;  3KD7 A;  2KAT A;  4O6F A;  3DSV A;  2DYR E;  3ASF A;  5CBN A;  4GA2 A;  4L7T A;  4PS8 A;  3LY9 A;  3JYS A;  4HRN A;  3D9H A;  3D9M A;  4B0Z A;  1BLX B;  4G26 A;  3QDN A;  4UI9 K;  3PZ2 A;  2VGY A;  4ANW A;  4CRW A;  1QYM A;  4H7Y A;  5FZR A;  5M72 A;  2BF0 X;  4DX2 A;  3TWQ A;  2VSX E;  2YIN A;  3L6A A;  2ZXW E;  3B7R L;  5ENO D;  2ZGD A;  2DIW A;  2GRN B;  1V55 E;  4GTS A;  1LF8 A;  3LEW A;  5T4Y A;  3PNL B;  4WWN A;  4L2L A;  4MS6 A;  3MCX A;  1IQU A;  4NUR A;  5AAR A;  1N4R A;  1U3C A;  5FQ4 A;  4FA6 A;  5EX0 A;  5C2Y A;  4KBQ A;  4GTV A;  2Y3A A;  3ZFW A;  3QNK A;  5AJL A;  3SD5 A;  4N2Q A;  3N71 A;  1E7V A;  2GRO B;  2F0Y A;  4N3A A;  3R7Q A;  3NZU A;  5KCM A;  3EU5 A;  3D9I A;  3BG1 B;  2XPI A;  1UJJ A;  3FTU A;  4JW1 A;  2HO1 A;  3Q15 A;  2HM8 A;  3CVV A;  5JJT A;  2WMN A;  3PUJ A;  3GYZ A;  5H7P A;  1SA4 A;  3IBE A;  3HXF A;  3TWS A;  2J07 A;  4GA1 A;  4XIF A;  3LXU X;  1PC2 A;  1PY1 A;  5KBA A;  2B6C A;  2X6K A;  1WAO 1;  3LY8 A;  2F8Y A;  5KJL A;  4KZC A;  5T3R A;  3GZS A;  4GYY A;  1UJK A;  2L6B A;  1KT1 A;  4RG6 A;  5LX8 A;  4ATG A;  4G24 A;  5ARG A;  3ASD A;  1FCH A;  4G2V A;  1OWN A;  1TNO A;  2J4B A;  2WXN A;  3ZUV B;  2XZD G;  3LPZ A;  5HS0 A;  2X6I A;  3U9W A;  1IYG A;  3TGO A;  2WXM A;  4K5A B;  1G3N B;  5D66 A;  2BKG A;  3O48 A;  4WND A;  3NOC D;  4I17 A;  1QZ2 A;  2J4D A;  1NA0 A;  2DWZ A;  3L13 A;  2ETA A;  5AEN A;  3NZS A;  3SF4 A;  5AN8 A;  3ULY A;  5FT9 A;  5EYP F;  3V2X A;  3DSW A;  4HLL A;  5LP0 A;  1TNY A;  1MHQ A;  4HS2 A;  2RD0 A;  4RSY A;  4HOR A;  3PRZ A;  3T5V A;  4RVB A;  5J08 A;  3S7J A;  4I6J A;  4JA7 A;  3T8K A;  3FH5 A;  3CQG B;  3NBN B;  2L0I A;  3DPY A;  4XI0 A;  2J8S D;  1E8Y A;  2PZI A;  1LTX A;  4DK5 A;  2WXI A;  3FTZ A;  4ZFH A;  4GPK A;  2X38 A;  1HFA A;  3D9J A;  2XPZ A;  4N5Q A;  2QY7 A;  5EYL A;  4BET A;  2MYO A;  3ZYL A;  2I6H A;  4B93 B;  2GRM A;  3SFZ A;  3AU5 A;  4GCO A;  4RG9 A;  1OWO A;  4ME2 A;  4O1O A;  3FUI A;  5ENP D;  4ACK A;  2LAI A;  3C5R A;  4FUL A;  1H2U A;  2JEK A;  3HXC A;  1E96 B;  2RG8 A;  3FTX A;  2H6H A;  3QK0 A;  1O1T A;  1HZ4 A;  5FTP A;  3E32 A;  2JLB A;  3S7B A;  1TN6 A;  4DI3 A;  3HDX A;  3AAA C;  2NC9 A;  1FPP A;  4ANV A;  4TXP A;  1WM5 A;  3C98 A;  2XHE A;  4I6E A;  3I3N A;  4JVS A;  4OVV A;  3PZD A;  4Y6C A;  1TYQ G;  1X5B A;  1N95 A;  2XPY A;  3FU0 A;  4GTO A;  1Z6T A;  4PS3 A;  4PH4 B;  5E76 A;  4B89 A;  3OXL A;  4YDY A;  4BTB A;  5CRU A;  5ENQ D;  4RLY A;  3FU6 A;  4G25 A;  2IFU A;  4N39 A;  3R7R A;  2V0P A;  4EPZ A;  4G11 A;  4LNB A;  4NIK A;  2WXK A;  3ZU7 B;  2NXP A;  4DPR A;  4HRL A;  5CEA A;  1WDY A;  2WXL A;  3BQO A;  2RKK A;  4DLQ A;  3DSX A;  2R5S A;  4AJW A;  3UM1 A;  2IY0 C;  2V4H C;  2L0T B;  2XZT G;  3L16 A;  1JPL A;  2HE0 A;  1UN9 A;  4HBD A;  2X6J A;  1H19 A;  2P9L G;  2RFM A;  3VTX A;  3ONL A;  2R17 C;  3DXK G;  5CMY A;  3FTW A;  4DX7 D;  2Y1L E;  3RRM B;  1ZU2 A;  4YDE A;  1N4P A;  1ZBP A;  4KXK B;  4TUU A;  3MKR A;  3T5X A;  2IOL A;  4CT0 A;  3AG4 E;  4U0S A;  3ABM E;  4GTP A;  3WXX A;  3TG5 A;  2KM4 A;  3UMV A;  5AIJ A;  3JXI A;  4Q69 A;  2LUH A;  3UIP C;  3PE3 A;  5JJ6 A;  3I4R B;  3AS4 A;  5KJN A;  1JWG A;  1Q2Z A;  4K5B A;  3VTY A;  4GAA A;  4I1O B;  2XEE A;  1L5J A;  2C0L A;  4QQI A;  3TWV A;  4L1B A;  3S2A A;  4YDW A;  3ZNG A;  3MV3 B;  3CHP A;  1KZP A;  1TR4 A;  5A23 A;  4BEP A;  2M63 A;  1A17 A;  1YYH A;  1TN8 A;  4V3I A;  5FQ8 A;  2XQ0 A;  4TRQ A;  2QYU A;  3ZVV A;  2GGF A;  4NRH B;  1IQR A;  1XNF A;  3CHQ A;  3D9L A;  5AJD A;  2LXL A;  5KJK A;  3TWU A;  4BES A;  4C9B B;  5A7D B;  3FTY A;  2WXR A;  3ASO E;  1QQE A;  3MJW A;  2V5F A;  2PNN A;  3FH7 A;  4JD2 G;  3LVQ E;  4UQZ A;  2UY1 B;  4G1T A;  1ELR A;  4U63 A;  3E30 A;  4CEM A;  1N54 A;  1SQM A;  2LSU A;  3DWL G;  3DEO A;  2EIK E;  4F6R D;  4HFG A;  4UI9 C;  4GTM A;  2QYJ A;  1H0A A;  4YVQ C;  4HI8 A;  3FTV A;  4KT6 B;  1K1A A; 
#chains in the Genus database with same CATH homology
 1TN6 A;  3Q7A A;  4GTT A;  2H6I A;  3KSL A;  4YDE A;  1N4P A;  1TN7 A;  2H6F A;  4GTV A;  2R2L A;  3PZ1 A;  1NI1 A;  1FPP A;  1TNZ A;  3Q79 A;  2IEJ A;  1O1S A;  1JCQ A;  3DRA A;  4GTP A;  2F0Y A;  1N9A A;  4YDO A;  3KSQ A;  3DST A;  3EU5 A;  3DSW A;  3HXE A;  3Q7F A;  3DSU A;  1TNY A;  1N4Q A;  1S63 A;  2ZIR A;  3DSV A;  3EUV A;  1N95 A;  4GTO A;  1N94 A;  4GTR A;  1SA4 A;  3DPY A;  1QBQ A;  3HXF A;  3PZ3 A;  4EHM A;  1KZP A;  1FT2 A;  3HXD A;  3PZ2 A;  3HXB A;  4L9P A;  1TN8 A;  1LD8 A;  1NL4 A;  1JCS A;  1LTX A;  3Q78 A;  1MZC A;  1SA5 A;  2H6G A;  1O1R A;  4LNB A;  3Q73 A;  1DCE A;  4GTQ A;  1X81 A;  3C72 A;  1S64 A;  4GTS A;  3E30 A;  3DSX A;  2BED A;  3E33 A;  1TNO A;  1LD7 A;  1JCR A;  1D8D A;  1N4S A;  1TNB A;  3Q75 A;  3E34 A;  3E37 A;  4LNG A;  1D8E A;  3HXC A;  3SFY A;  1KZO A;  1FT1 A;  3DSS A;  2ZIS A;  1O5M A;  2H6H A;  4GTM A;  1O1T A;  3SFX A;  1TNU A;  1N4R A;  4MBG A;  3E32 A;  3PZ4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...