2H6IA

W102t/y365f protein farnesyltransferase double mutant complexed with a geranylgeranylated ddptasacvls peptide product at 3.0a
Total Genus 131
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
131
sequence length
315
structure length
315
Chain Sequence
FVSLDSPSYVLYRDRAEWADIDPVPQNDGPNPVVQIIYSDKFRDVYDYFRAVLQRDERSERAFKLTRDAIELNAANYTVWHFRRVLLKSLQKDLHEEMNYITAIIEEQPKNYQVWHHRRVLVEWLRDPSQELEFIADILNQDAKNYHAWQHRQWVIQEFKLWDNELQYVDQLLKEDVRNNSVWNQRYFVISNTTGYNDRAVLEREVQYTLEMIKLVPHNESAWNYLKGILQDRGLSKYPNLLNQLLDLQPSHSSPYLIAFLVDIYEDMLENQCDNKEDILNKALELCEILAKEKDTIRKEYWRYIGRSLQSKHST
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Conversion of protein farnesyltransferase to a geranylgeranyltransferase.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords Protein farnesyltransferase/geranylgeranyltransferase type I
total genus 131
structure length 315
sequence length 315
ec nomenclature ec 2.5.1.58: Protein farnesyltransferase.
pdb deposition date 2006-05-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01239 PPTA Protein prenyltransferase alpha subunit repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.120 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Protein prenylyltransferase 2h6iA00
1LTXA 1D8EA 1SA4A 4EHMA 3EUVA 4YDEA 3DSUA 1JCQA 1N95A 3E32A 2ZIRA 1FPPA 1N4SA 1O1RA 3HXBA 3Q79A 3DSSA 1O1TA 1O5MA 4GTMA 1FT2A 3E30A 3Q78A 4GTPA 1LD8A 1QBQA 4GTOA 2IEJA 3C72A 2H6IA 4LNGA 4GTVA 3Q7AA 1D8DA 3DSVA 3Q75A 1JCSA 1N94A 1SA5A 1KZOA 1TN8A 3DPYA 1N9AA 3KSLA 3SFYA 3HXEA 3DSXA 1TN6A 1O1SA 1LD7A 2F0YA 3DSWA 1TNBA 1JCRA 3PZ1A 1N4PA 3EU5A 3PZ3A 3DSTA 4GTTA 1DCEA 1TNOA 3HXCA 1TNZA 4YDOA 1TNUA 1S64A 4MBGA 1MZCA 2ZISA 2BEDA 1FT1A 1N4RA 3Q73A 3PZ2A 4GTQA 1N4QA 2H6FA 1X81A 3DRAA 4LNBA 1NI1A 1S63A 3PZ4A 4L9PA 3SFXA 1TN7A 3HXFA 3HXDA 4GTRA 3E37A 2H6GA 3E34A 3E33A 1TNYA 3KSQA 1KZPA 1NL4A 3Q7FA 2H6HA 4GTSA 2R2LA
chains in the Genus database with same CATH superfamily
4KBQA 4BX9A 2VYIA 4GYYA 3PRZA 5G05J 3LXUX 2VJ8A 1WG0A 3NZSA 5ENRD 4I9EA 1E7UA 2ETCA 3LYAA 3ZPJA 4GTOA 5ANLA 5HI7A 4G23A 3D9PA 3SQVA 4XZ4A 1LF8A 1MJ0A 4U0SA 1MX4A 2X3MA 3CVPA 4HB5A 2P9LG 3L13A 3RK6A 5G2NA 4F1PA 3FUIA 1SZAA 4LRZA 2VTBB 4HVBA 3SZ7A 4EZJA 3LVQE 5EX0A 3FUHA 3QWWA 3RRMB 1H6OA 4F3VA 4GTTA 2J9QA 3MV3B 3UT8A 3FUKA 2ZISA 4DX1A 2BF0X 3QK0A 3CVWA 2UWJG 4HI9A 4E85A 4IRUA 3SO8A 5FQ7A 3JQ0A 3SFZA 3SFXA 5LCWC 4ANWA 3CIAA 2X6KA 3HVEB 3R7RA 4LCTA 1YA0A 2WPVA 3TAXA 5DIZA 2ONDA 3I4GA 2WXIA 3ONLA 4KXKB 2OCCE 5G55A 2R2LA 2XQ0A 3SF4A 5M72A 2XCCA 1BI8B 5EKQD 5BXUA 4CDRA 5EYPF 1JCQA 3LJ3A 1O1RA 5AN8A 3L9TA 3Q78A 4ACLA 5ARGA 2EINE 3C98A 2OVFA 2XGSA 4TXQA 4OVVA 3L82A 4OVUA 3DSVA 2WXLA 3Q15A 2IO2C 4DX5D 4KVOA 3S2AA 1YMPA 4AEZC 4HRLA 3PNLB 4WWNA 3ZIMA 1MQSA 3CVQA 3OXFA 5AQ9A 2HM8A 3VLDA 4CT0A 3DWLG 4K5BA 2PZIA 3QKYA 1OWNA 1KLXA 3UM0A 2FEZA 2ZGGA 1HXIA 4U7EB 2X38A 4AOFA 4AY6A 3D9HA 1IQRA 5J90A 3ABME 3C3RA 5T8IA 2MRIA 1X5BA 4YDWA 4RVBA 2A5EA 1NA3A 1S63A 4MS6A 4PS7A 1DVPA 3V30A 1HG5A 3B13A 1NP7A 4C0MA 4H7XA 4NIKA 4HNAD 3HVEA 3ZW3A 3LJNA 4I2WA 3ASFA 3Q47B 2VGXB 4J7WA 4RG9A 3FTVA 4B8CB 4HOUA 2XZDG 4PS3A 3UIOC 4CDMA 4XI9A 2A5UA 4KMOA 2DBAA 2OV8A 4Y6WA 3DSSA 2R05A 5LX8A 2VQ2A 3O48A 4A3VA 4GTPA 1UJKA 3GZ1A 3ONKA 4ILHB 3PNTB 3CVYA 4B0ZA 2X6JA 4TXPA 5CRVA 3CHSA 3F6QA 4BTAA 4BESA 4JA9A 2XGMA 3G2UA 3B7TA 3D9NA 2GRMA 3KSLA 4UUCA 3DXKG 3AU5A 4DX7D 3E4BA 4DX2A 4IYPA 3W9FA 4WNDA 1O1SA 5G04C 3VTYA 1QNFA 1JCRA 5C2YA 3ZYQA 3ZEFA 3T8KA 5BW8C 2ETBA 3RO2A 2R5SA 3VLEA 1B89A 4A3TA 2LUHA 4C48B 3GW4A 4BWRA 2F8YA 3IHVA 3QJZA 4LERA 3SGHA 4EECA 5A7DB 2RKKA 2UY1B 1OWOA 2VSOE 3ASNE 3UMVA 4DLQA 4KT6B 3NOGD 1QYMA 4B93B 3UT4A 3PDNA 1S0PA 3ZN3A 4HQDA 3ZU7B 3O4ZA 2GW1A 3KSQA 1PAQA 3G2WA 1E96B 3MX3A 1AP7A 2YQ8A 1D9SA 3CHOA 4GMLA 3DXMG 1D8EA 2VSXE 3EU9A 3UIPC 4U8HA 4APFA 2RFAA 4FU3A 3VLFA 1ZU2A 2VGEA 3RAUA 1G3NB 3V2OA 3Q7AA 3FTUA 2IOLA 3MCXA 3GZ2A 4O1PA 3ZKJA 1H0AA 1EDUA 2LXLA 1Z3XA 1H6PA 2VGXA 1U2VG 3CQGB 1JUQA 4APOA 5KWDA 5IY5E 1OUVA 1YCSB 1ZB1A 3L22A 3DSWA 3IBEA 4XKCA 1UN8A 1TNBA 3BUAA 1OY3D 4WUYA 2F8XK 4N3BA 1DCEA 1TNOA 4Q94A 4GYOA 4GYWA 4OAVB 5A6CA 3MYVA 1SW6A 3PE3A 1TJCA 5E75A 2DWZA 4HI8A 1FT1A 1HO8A 2IQCA 3AG3E 3ABLE 5FZRA 2OEWA 3DPDA 3B7BA 4AP2A 5BXOA 3UM3A 1H2TC 3EDTB 2L6BA 2OEVA 3L6AA 3V31A 2LSVA 4J8SA 2L0TB 3KEZA 3PUJA 1UJJA 4V3IA 3EUVA 4GCNA 1XGWA 3FU6A 1RW2A 3ZYLA 4LNUD 4UI9J 5HS0A 3LY8A 1E90A 4JPSA 4FP7A 5B1AE 4NQ0A 1H6KA 3B95A 3LEWA 2VTBA 4NRHB 4O1OA 3SBSA 3DPYA 1EPUA 4HS2A 1HS6A 2KM4A 3V79K 2GRPB 3FU0A 4I2ZA 2VSNA 3C3OA 2P9IG 2WXHA 5D0OD 1BI7B 4M7CA 1INZA 2WXNA 4UWFA 3BEEA 3ZRHA 4N5CA 5D66A 5LOZA 4GTQA 1N4QA 4XX5A 2H6FA 5BV0A 4EZKA 4N5QA 4L7TA 2C0LA 3X2QE 3TXNA 3I3NA 2L9BA 4RLYA 4UI9C 3QAQA 3IEGA 4BY6A 1TNYA 4G1TA 4AM9A 3U66A 1DNPA 2P9PG 5A23A 3VTXA 3TWUA 2PQNA 3FP3A 2DIWA 1L5JA 2KXPC 2ZU6B 2IONA 1N4SA 4GTMA 3EIJA 3ENEA 2WXKA 3T5VA 3BG1B 2ZXWE 4K0RA 1OT8A 5C1DA 2HR2A 3JYSA 3R9AB 3EJNA 4N3CA 2KC7A 3JUIA 5ENNA 1SA5A 4W9RA 1PC2A 1TN8A 3L16A 5CMYA 1N9AA 5KJNA 3S7DA 3TJPA 3ZHEB 5CEAA 3UM1A 3TWQA 1LD7A 1K8KG 4IN3B 4H7YA 3ESKA 4M3OA 5T3RA 1H2VC 2VGYA 2IU1A 1KT0A 1IHGA 2C0MA 3D9OA 5BNWA 3FH5A 3IXEA 1MZCA 2UY1A 4ZFHA 3CLJA 5KNHD 3RIBA 2CFUA 4F53A 1TYQG 2LAIA 3FH8A 4B94A 1K3ZD 4BX8A 3CEQA 4UWLA 3E34A 4CCAA 3R7QA 4F1SA 3PUKA 3AG4E 5AAOA 2AXZA 2FBNA 2YINA 3D9MA 5AJLA 1QZ2A 2EIJE 1NA0A 1LTXA 3EIQC 3NB2A 2AXVA 2AVPA 3UUXA 3AU4A 2XZTG 3AAAC 2E0IA 3LS8A 3ASDA 2ILRA 3TWVA 1ELWA 2WXFA 5KJKA 4BTBA 5JJTA 3IV0A 4YNDA 1D8DA 2J4DA 1YYHA 1E8XA 2MHKA 4GAAA 3MEKA 1WDYA 5BUZA 3LY7A 3UPVA 4UQXA 1HU3A 3HXEA 5BPPA 3P1UA 2FULA 3S7FA 4N2SA 3UM2A 4UWGA 4MKTA 3EU5A 4GMRA 4UI9K 5AARA 1BU9A 4YDOA 3FU5A 3FTWA 3LY9A 2EIME 2M63A 5ENSD 3KAEA 3HYMB 3SNXA 3B7UX 5AIJA 4FLBA 2XRYA 5CEDB 4CDNA 1OCOE 1K1AA 3MA5A 1Q2ZA 2L0IA 3E37A 2ETAA 2H6GA 3Q4AB 3PVLA 1NL4A 1JWGA 4JHRA 5JHBA 3RKVA 3PZDA 1EF1C 3SY2A 1SA4A 1FVFA 3BU8A 1FPPA 1A17A 2C2LA 4NACA 4TUUA 2XEHA 4ATZD 2B0OE 4I43A 3TG4A 4JEUA 2X6HA 2R17C 3ZXSA 4N3AA 3CHPA 1V54E 1KZOA 4K03A 4RG6A 1SZ9A 4JVSA 3D9JA 2LO6A 3MKQA 2F37A 3GYZA 3B7SA 4EQFA 2WXGA 1TNUA 3UT7A 4HOSA 4Q96A 2IF4A 4MRUA 1HF8A 4J6IA 4B89A 3TG5A 1KPSB 5FWQA 3LVRE 4GPKA 3HXDA 4GZ5A 4PS8A 5BV1A 2NYJA 4U07A 3AS4A 2I1JA 3ZFWA 3FTSA 1SQMA 5AQAA 3FY4A 1N54A 4IULA 5EIDA 4DI3A 5FQ4A 4E6HA 1FT2A 3URZA 1LD8A 3CK7A 3C72A 5HKPA 2LNIA 3RRUA 2YNQA 3TXMA 4GMJA 3FEXA 3G2SA 4R7LA 4L2LA 3NZUA 1WY6A 3OXGA 4A63B 3FULA 4A55A 1OWLA 3ZUVB 1IKND 3MV2B 5JJ7A 1XNFA 5HRYA 3RJVA 4GZ3A 1A5EA 3P2BA 2EILE 1TN6A 3RSEG 1SVXA 3FUMA 2CHWA 4UWHA 3HIZA 1N4PA 2EIKE 2Y3AA 3DSTA 4CRWA 4G11A 3CSTA 2GRQB 2J4BA 2KCLA 2BEDA 2IFUA 4LEUA 3SI5A 4P29A 4LSZE 3DRAA 3WG7E 4I1MA 1MX6A 3SBTB 2J49A 3L17A 3PEUB 3CHQA 3FWVA 4AIFA 4G24A 3GZSA 1BD8A 2Y4UA 2P9SG 2GGFA 2XPYA 5E76A 3KEAA 3PEVB 3IKOB 4GTSA 4RSYA 3SHFA 4ANVA 5KCMA 4KVMA 2NC9A 4YDEA 4JC8A 3DSUA 2RD0A 3E32A 3JQ1A 5FZQA 3JXIA 2KCVA 4BT8A 1IYGA 1JWFA 4TUMA 2BKGA 3E30A 4G2VA 5B3SE 1QBQA 2IEJA 3Q5MA 5EN5D 1DC2A 4WAFA 2I2OA 3EHNA 3TWRA 4JXTA 4PDXA 3DBSA 2I9CA 2QZAA 4L2YA 3J5PA 2MOWA 3SFYA 2DVWA 3L54A 1U3DA 5DBKA 4UQYA 3UI2A 2PM7A 2WXJA 2FF4A 2NSZA 2WQ6A 3PZ1A 5ITZF 3PZ3A 4ILGA 3QWPA 3ULQA 3ZHEA 4DUIA 4FJZA 1V55E 4MBGA 4AVXA 4GU5A 2GRLA 3FUFA 4ME2A 3NOCD 4N39A 4F6RD 3TWWA 4QQIA 2LAHA 3OAWA 2PL2A 1NZNA 3OXLA 5CERB 4EZLA 5G04J 4XKBA 4HRMB 4URKA 2DZNA 4GTRA 4JB8P 2DYSE 2J08A 3PH0C 1KZPA 4U0UA 4JL0A 5FINA 5FJYA 2AXUA 1NFIE 4J8EA 1MHQA 3OTNA 2WXRA 3CKBA 4EHMA 2YHEA 4PUCA 4LG6A 1N95A 5D2MC 2HE0A 1FVHA 4WWPA 4WNFA 5EIBE 3T8MA 3KD7A 4J8YA 1EYHA 4L23A 3PREA 3APFA 2H6IA 2WB2A 4GTVA 4C0EA 2QC9A 4J8FA 4EBAA 4NURA 4I9CA 3QARA 1JCSA 3ASOE 4EPZA 2ZGDA 3ZXPA 3TGOA 1ELKA 4J8DA 3DSXA 4GCOA 1Y6IA 2QY7A 1H19A 2P2CP 4U63A 3N71A 4AXHA 4ABNA 3PE4A 4U8VD 5T4YA 3EHQA 4GB9A 5LCWJ 5D0QD 4QFVA 2AJAA 3FUJA 2JLBA 4FLHA 1KT1A 3FU3A 2Y1LE 3FHEA 3DEPA 4KYOB 3U9WA 3RRNB 2QYUA 4JW1A 4ATGA 2E2EA 1Z5SC 2EQXA 3TWTA 3IHYA 4DPRA 1HE8A 3Q7FA 4I6EA 1TJFA 3EHMA 5ENQD 5EILA 3NAWA 3NBNB 2IO3C 2KZTA 5FQ8A 4FC8A 5CBNA 1HX8A 3CVUA 3FUEA 3AJIA 1OXJA 3AG1E 2WXOA 3MKRA 4MLPA 3ESLA 4DI4A 3RO3A 4FJYA 2DYRE 3CSFA 3C5RA 4BERA 3FUNA 4YVQC 5KBAA 5KJLA 2J09A 4HXIA 2CG2A 5G05C 1Y8MA 2P58C 3CK8A 4HFGA 2P9UG 2LSUA 3B7RL 2L6JA 5FZSA 5CECB 3FDHA 3S7BA 4C9BB 4WWOA 1Z6TA 3QNKA 3ML8A 4HRNA 4CT4A 3AG2E 1OWPA 5CRUA 1S70B 3T9KA 2QYJA 5BT1A 3U64A 2AWIA 3ZGQA 2FI7A 4AY5A 2DZOA 2PM6A 1N4RA 1X81A 5AQBA 3PS6A 4BFRA 3FTYA 1NI1A 4XIFA 3ZNGA 3HRAA 3UKUG 4FULA 3UTMA 4GA0A 3MZLB 2CG3A 3LCAA 2V4HC 2YHCA 2HO1A 5JJ6A 2DCPA 2NXPA 4ZHBA 4WNGA 3CHMA 3MJWA 3I4RB 1E7VA 2LXMA 5AYWD 3S7JA 5LFAA 3HXBA 2KCKA 3Q79A 5CBOA 1K1BA 4PH4B 3ULYA 2Y4TA 2P9NG 3D9KA 1HZ4A 3FUDA 1H2UA 3BQOA 4GZ6A 2OVBA 3QDNA 4N2QA 1N94A 5EX3A 1N0RA 4JD2G 2WXQA 4CYMD 4TXRA 3D3MA 1Z3YA 2KATA 2BKKB 1ELRA 2XHEA 4L1BA 4U8YD 3CVXA 4G26A 4Z68A 4UQZA 4OAUC 5KJMA 2R03A 2XS1A 3CGHA 3LKUA 1TNZA 4HBDA 3FH7A 3K9IA 4U95D 3FTZA 3L08A 4LNBA 4RQIA 3UQ3A 2KZTB 2JEKA 1IHBA 4HOTA 3UKRG 3NF1A 3RU0A 4BETA 2V5QC 5FT9A 1TN7A 3HXFA 4AV7A 4TV3A 2MYOA 4HLLA 4XEIG 5HQ8A 4BEPA 4JA7A 4A1GA 4JEHA 3G2VA 1IQUA 5KNGA 4ANXA 2B6CA 5AQ7A 1WM5A 2IOSA 2VSYA 3CV0A 1WAO1 2XEVA 3D9IA 4GZDA 4JHJA 2X6FA 3U4TA 4G8KA 4EBAG 5ENOD 4FADA 3MGBA 3TWXA 4ACKA 3UX4A 3JCKC 5ENTD 3Q75A 3QWVA 5J08A 2J8SD 3I5PA 4BSXA 4DX6D 2A4ZA 2GRNB 4Y6CA 3ZYKA 1E8WA 2R59A 4I6GA 4LUNU 3KS2A 4JZYA 4WNEA 2I6HA 3C3QA 2F0YA 5EDSA 4O6FA 1PY1A 3Q9NC 3T5XA 4CEMA 1N11A 5H7PA 1BLXB 1S64A 4K5CA 3FFLA 2R02A 3Q73A 3PZ2A 5B1BE 3U3WA 2FO1E 2XRZA 3AS8A 2WMNA 4L9PA 3PZ4A 1TR4A 4O60A 5ANRA 1UN9A 4CZ2D 4GPMA 3ASGA 3CR3A 2PNNA 2XENA 3ISMC 4G8LA 1MX2A 3APDA 3E33A 3JXJA 3LPZA 3DEOA 1P5QA 4OYSA 2WQ7A 2V4LA 1VDYA 3ZVVA 2AW6A 2H6HA 2V0PA 4KZCA 4CGWA 2GROB 1ZBPA 1IXVA 2KBXA 4X8QA 2XS8A 4CGVA 3D9LA 2XPZA 3ASHA 3FTXA 4G25A 1UOHA 4ILIA 4B8AA 2ZIRA 3EHRA 4XI0A 3UINC 3V2XA 4GZCA 4U04A 4A1SA 2V5FA 1O1TA 1O5MA 2XPIA 1U3CA 2RG8A 4LNGA 4ANUA 5AENA 1GW6A 2X6IA 2RFMA 3AS5A 5JHAA 4DRXE 3R9MA 3HDXA 3BG0B 3HHMA 2Q7FA 3QOUA 2XEEA 4XE0A 2Y0BG 3TL5A 5JA4D 2OOEA 2WVIA 1OWMA 3QC1A 5ARFA 2HYZA 1HG2A 3HXCA 4BT9A 5FQ6A 3CQCB 4DLOA 4U0ZA 5FTPA 1JPLA 3LDZA 3ULEG 4FA6A 4GA1A 1N52A 4DJAA 2WMOA 4YDYA 5ENPD 3UXGA 2P9KG 3ML9A 4I1AA 3WXXA 3JUEA 2BTDA 1TEZA 1E8ZA 3TWSA 2QFCA 1OCCE 3CVVA 1MYOA 1W3BA 1E8YA 1HH8A 3HG0D 4HOQA 1N0QA 2CHXA 3APCA 2BUGA 4I17A 4DK5A 4K5AB 2JABA 2GRRB 2WQHA 3Q49B 4D10C 1BPOA 4Q69A 2XCBA 1FCHA 4JHKA 3MKQB 5AJDA 3ABKE 3ZYMA 3CK9A 1QQEA 1OCRE 3CKCA 4J0UA 4I1OB 2I1KA 1HFAA 3J5QB 5FIOA 1RZ4A 3CHRA 3CVLA 4F7AA 2CHZA 5LP0A 4FHJA 2J07A 1DCQA 3Q9UC 2WXMA 4AJWA 3W9GA 1OCZE 5CCMA 2CFZA 2WM9A 5CCLA 3FEYA 4HLEA 2XGOA 4UWKA 3QB2A 2WXPA 3NQPA 2IY0C 5JMND 3CVNA 4I6JA 5EYLA 4YVOA 1UW4B 1UG3A 4GA2A 2V8SE 2PQRA 4U96D 4HORA 3SD5A 5CMWA 4BSZB 4FHKA 2FO7A 2Y69E 4TRQA 1AWCB 2IJGX 5CHEE 4KZ0A 3G2TA
chains in the Genus database with same CATH topology
1LTXA 1D8EA 1SA4A 4EHMA 3EUVA 4YDEA 3DSUA 1JCQA 1N95A 3E32A 2ZIRA 1FPPA 1N4SA 1O1RA 3HXBA 3Q79A 3DSSA 1O1TA 1O5MA 4GTMA 1FT2A 3E30A 3Q78A 4GTPA 1LD8A 1QBQA 4GTOA 2IEJA 3C72A 2H6IA 4LNGA 4GTVA 3Q7AA 1D8DA 3DSVA 3Q75A 1JCSA 1N94A 1SA5A 1KZOA 1TN8A 3DPYA 1N9AA 3KSLA 3SFYA 3HXEA 3DSXA 1TN6A 1O1SA 1LD7A 2F0YA 3DSWA 1TNBA 1JCRA 3PZ1A 1N4PA 3EU5A 3PZ3A 3DSTA 4GTTA 1DCEA 1TNOA 3HXCA 1TNZA 4YDOA 1TNUA 1S64A 4MBGA 1MZCA 2ZISA 2BEDA 1FT1A 1N4RA 3Q73A 3PZ2A 4GTQA 1N4QA 2H6FA 1X81A 3DRAA 4LNBA 1NI1A 1S63A 3PZ4A 4L9PA 3SFXA 1TN7A 3HXFA 3HXDA 4GTRA 3E37A 2H6GA 3E34A 3E33A 1TNYA 3KSQA 1KZPA 1NL4A 3Q7FA 2H6HA 4GTSA 2R2LA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1LTX A;  1D8E A;  1SA4 A;  4EHM A;  3EUV A;  4YDE A;  3DSU A;  1JCQ A;  1N95 A;  3E32 A;  2ZIR A;  1FPP A;  1N4S A;  1O1R A;  3HXB A;  3Q79 A;  3DSS A;  1O1T A;  1O5M A;  4GTM A;  1FT2 A;  3E30 A;  3Q78 A;  4GTP A;  1LD8 A;  1QBQ A;  4GTO A;  2IEJ A;  3C72 A;  2H6I A;  4LNG A;  4GTV A;  3Q7A A;  1D8D A;  3DSV A;  3Q75 A;  1JCS A;  1N94 A;  1SA5 A;  1KZO A;  1TN8 A;  3DPY A;  1N9A A;  3KSL A;  3SFY A;  3HXE A;  3DSX A;  1TN6 A;  1O1S A;  1LD7 A;  2F0Y A;  3DSW A;  1TNB A;  1JCR A;  3PZ1 A;  1N4P A;  3EU5 A;  3PZ3 A;  3DST A;  4GTT A;  1DCE A;  1TNO A;  3HXC A;  1TNZ A;  4YDO A;  1TNU A;  1S64 A;  4MBG A;  1MZC A;  2ZIS A;  2BED A;  1FT1 A;  1N4R A;  3Q73 A;  3PZ2 A;  4GTQ A;  1N4Q A;  2H6F A;  1X81 A;  3DRA A;  4LNB A;  1NI1 A;  1S63 A;  3PZ4 A;  4L9P A;  3SFX A;  1TN7 A;  3HXF A;  3HXD A;  4GTR A;  3E37 A;  2H6G A;  3E34 A;  3E33 A;  1TNY A;  3KSQ A;  1KZP A;  1NL4 A;  3Q7F A;  2H6H A;  4GTS A;  2R2L A; 
#chains in the Genus database with same CATH topology
 4KBQ A;  4BX9 A;  2VYI A;  4GYY A;  3PRZ A;  5G05 J;  3LXU X;  2VJ8 A;  1WG0 A;  3NZS A;  5ENR D;  4I9E A;  1E7U A;  2ETC A;  3LYA A;  3ZPJ A;  4GTO A;  5ANL A;  5HI7 A;  4G23 A;  3D9P A;  3SQV A;  4XZ4 A;  1LF8 A;  1MJ0 A;  4U0S A;  1MX4 A;  2X3M A;  3CVP A;  4HB5 A;  2P9L G;  3L13 A;  3RK6 A;  5G2N A;  4F1P A;  3FUI A;  1SZA A;  4LRZ A;  2VTB B;  4HVB A;  3SZ7 A;  4EZJ A;  3LVQ E;  5EX0 A;  3FUH A;  3QWW A;  3RRM B;  1H6O A;  4F3V A;  4GTT A;  2J9Q A;  3MV3 B;  3UT8 A;  3FUK A;  2ZIS A;  4DX1 A;  2BF0 X;  3QK0 A;  3CVW A;  2UWJ G;  4HI9 A;  4E85 A;  4IRU A;  3SO8 A;  5FQ7 A;  3JQ0 A;  3SFZ A;  3SFX A;  5LCW C;  4ANW A;  3CIA A;  2X6K A;  3HVE B;  3R7R A;  4LCT A;  1YA0 A;  2WPV A;  3TAX A;  5DIZ A;  2OND A;  3I4G A;  2WXI A;  3ONL A;  4KXK B;  2OCC E;  5G55 A;  2R2L A;  2XQ0 A;  3SF4 A;  5M72 A;  2XCC A;  1BI8 B;  5EKQ D;  5BXU A;  4CDR A;  5EYP F;  1JCQ A;  3LJ3 A;  1O1R A;  5AN8 A;  3L9T A;  3Q78 A;  4ACL A;  5ARG A;  2EIN E;  3C98 A;  2OVF A;  2XGS A;  4TXQ A;  4OVV A;  3L82 A;  4OVU A;  3DSV A;  2WXL A;  3Q15 A;  2IO2 C;  4DX5 D;  4KVO A;  3S2A A;  1YMP A;  4AEZ C;  4HRL A;  3PNL B;  4WWN A;  3ZIM A;  1MQS A;  3CVQ A;  3OXF A;  5AQ9 A;  2HM8 A;  3VLD A;  4CT0 A;  3DWL G;  4K5B A;  2PZI A;  3QKY A;  1OWN A;  1KLX A;  3UM0 A;  2FEZ A;  2ZGG A;  1HXI A;  4U7E B;  2X38 A;  4AOF A;  4AY6 A;  3D9H A;  1IQR A;  5J90 A;  3ABM E;  3C3R A;  5T8I A;  2MRI A;  1X5B A;  4YDW A;  4RVB A;  2A5E A;  1NA3 A;  1S63 A;  4MS6 A;  4PS7 A;  1DVP A;  3V30 A;  1HG5 A;  3B13 A;  1NP7 A;  4C0M A;  4H7X A;  4NIK A;  4HNA D;  3HVE A;  3ZW3 A;  3LJN A;  4I2W A;  3ASF A;  3Q47 B;  2VGX B;  4J7W A;  4RG9 A;  3FTV A;  4B8C B;  4HOU A;  2XZD G;  4PS3 A;  3UIO C;  4CDM A;  4XI9 A;  2A5U A;  4KMO A;  2DBA A;  2OV8 A;  4Y6W A;  3DSS A;  2R05 A;  5LX8 A;  2VQ2 A;  3O48 A;  4A3V A;  4GTP A;  1UJK A;  3GZ1 A;  3ONK A;  4ILH B;  3PNT B;  3CVY A;  4B0Z A;  2X6J A;  4TXP A;  5CRV A;  3CHS A;  3F6Q A;  4BTA A;  4BES A;  4JA9 A;  2XGM A;  3G2U A;  3B7T A;  3D9N A;  2GRM A;  3KSL A;  4UUC A;  3DXK G;  3AU5 A;  4DX7 D;  3E4B A;  4DX2 A;  4IYP A;  3W9F A;  4WND A;  1O1S A;  5G04 C;  3VTY A;  1QNF A;  1JCR A;  5C2Y A;  3ZYQ A;  3ZEF A;  3T8K A;  5BW8 C;  2ETB A;  3RO2 A;  2R5S A;  3VLE A;  1B89 A;  4A3T A;  2LUH A;  4C48 B;  3GW4 A;  4BWR A;  2F8Y A;  3IHV A;  3QJZ A;  4LER A;  3SGH A;  4EEC A;  5A7D B;  2RKK A;  2UY1 B;  1OWO A;  2VSO E;  3ASN E;  3UMV A;  4DLQ A;  4KT6 B;  3NOG D;  1QYM A;  4B93 B;  3UT4 A;  3PDN A;  1S0P A;  3ZN3 A;  4HQD A;  3ZU7 B;  3O4Z A;  2GW1 A;  3KSQ A;  1PAQ A;  3G2W A;  1E96 B;  3MX3 A;  1AP7 A;  2YQ8 A;  1D9S A;  3CHO A;  4GML A;  3DXM G;  1D8E A;  2VSX E;  3EU9 A;  3UIP C;  4U8H A;  4APF A;  2RFA A;  4FU3 A;  3VLF A;  1ZU2 A;  2VGE A;  3RAU A;  1G3N B;  3V2O A;  3Q7A A;  3FTU A;  2IOL A;  3MCX A;  3GZ2 A;  4O1P A;  3ZKJ A;  1H0A A;  1EDU A;  2LXL A;  1Z3X A;  1H6P A;  2VGX A;  1U2V G;  3CQG B;  1JUQ A;  4APO A;  5KWD A;  5IY5 E;  1OUV A;  1YCS B;  1ZB1 A;  3L22 A;  3DSW A;  3IBE A;  4XKC A;  1UN8 A;  1TNB A;  3BUA A;  1OY3 D;  4WUY A;  2F8X K;  4N3B A;  1DCE A;  1TNO A;  4Q94 A;  4GYO A;  4GYW A;  4OAV B;  5A6C A;  3MYV A;  1SW6 A;  3PE3 A;  1TJC A;  5E75 A;  2DWZ A;  4HI8 A;  1FT1 A;  1HO8 A;  2IQC A;  3AG3 E;  3ABL E;  5FZR A;  2OEW A;  3DPD A;  3B7B A;  4AP2 A;  5BXO A;  3UM3 A;  1H2T C;  3EDT B;  2L6B A;  2OEV A;  3L6A A;  3V31 A;  2LSV A;  4J8S A;  2L0T B;  3KEZ A;  3PUJ A;  1UJJ A;  4V3I A;  3EUV A;  4GCN A;  1XGW A;  3FU6 A;  1RW2 A;  3ZYL A;  4LNU D;  4UI9 J;  5HS0 A;  3LY8 A;  1E90 A;  4JPS A;  4FP7 A;  5B1A E;  4NQ0 A;  1H6K A;  3B95 A;  3LEW A;  2VTB A;  4NRH B;  4O1O A;  3SBS A;  3DPY A;  1EPU A;  4HS2 A;  1HS6 A;  2KM4 A;  3V79 K;  2GRP B;  3FU0 A;  4I2Z A;  2VSN A;  3C3O A;  2P9I G;  2WXH A;  5D0O D;  1BI7 B;  4M7C A;  1INZ A;  2WXN A;  4UWF A;  3BEE A;  3ZRH A;  4N5C A;  5D66 A;  5LOZ A;  4GTQ A;  1N4Q A;  4XX5 A;  2H6F A;  5BV0 A;  4EZK A;  4N5Q A;  4L7T A;  2C0L A;  3X2Q E;  3TXN A;  3I3N A;  2L9B A;  4RLY A;  4UI9 C;  3QAQ A;  3IEG A;  4BY6 A;  1TNY A;  4G1T A;  4AM9 A;  3U66 A;  1DNP A;  2P9P G;  5A23 A;  3VTX A;  3TWU A;  2PQN A;  3FP3 A;  2DIW A;  1L5J A;  2KXP C;  2ZU6 B;  2ION A;  1N4S A;  4GTM A;  3EIJ A;  3ENE A;  2WXK A;  3T5V A;  3BG1 B;  2ZXW E;  4K0R A;  1OT8 A;  5C1D A;  2HR2 A;  3JYS A;  3R9A B;  3EJN A;  4N3C A;  2KC7 A;  3JUI A;  5ENN A;  1SA5 A;  4W9R A;  1PC2 A;  1TN8 A;  3L16 A;  5CMY A;  1N9A A;  5KJN A;  3S7D A;  3TJP A;  3ZHE B;  5CEA A;  3UM1 A;  3TWQ A;  1LD7 A;  1K8K G;  4IN3 B;  4H7Y A;  3ESK A;  4M3O A;  5T3R A;  1H2V C;  2VGY A;  2IU1 A;  1KT0 A;  1IHG A;  2C0M A;  3D9O A;  5BNW A;  3FH5 A;  3IXE A;  1MZC A;  2UY1 A;  4ZFH A;  3CLJ A;  5KNH D;  3RIB A;  2CFU A;  4F53 A;  1TYQ G;  2LAI A;  3FH8 A;  4B94 A;  1K3Z D;  4BX8 A;  3CEQ A;  4UWL A;  3E34 A;  4CCA A;  3R7Q A;  4F1S A;  3PUK A;  3AG4 E;  5AAO A;  2AXZ A;  2FBN A;  2YIN A;  3D9M A;  5AJL A;  1QZ2 A;  2EIJ E;  1NA0 A;  1LTX A;  3EIQ C;  3NB2 A;  2AXV A;  2AVP A;  3UUX A;  3AU4 A;  2XZT G;  3AAA C;  2E0I A;  3LS8 A;  3ASD A;  2ILR A;  3TWV A;  1ELW A;  2WXF A;  5KJK A;  4BTB A;  5JJT A;  3IV0 A;  4YND A;  1D8D A;  2J4D A;  1YYH A;  1E8X A;  2MHK A;  4GAA A;  3MEK A;  1WDY A;  5BUZ A;  3LY7 A;  3UPV A;  4UQX A;  1HU3 A;  3HXE A;  5BPP A;  3P1U A;  2FUL A;  3S7F A;  4N2S A;  3UM2 A;  4UWG A;  4MKT A;  3EU5 A;  4GMR A;  4UI9 K;  5AAR A;  1BU9 A;  4YDO A;  3FU5 A;  3FTW A;  3LY9 A;  2EIM E;  2M63 A;  5ENS D;  3KAE A;  3HYM B;  3SNX A;  3B7U X;  5AIJ A;  4FLB A;  2XRY A;  5CED B;  4CDN A;  1OCO E;  1K1A A;  3MA5 A;  1Q2Z A;  2L0I A;  3E37 A;  2ETA A;  2H6G A;  3Q4A B;  3PVL A;  1NL4 A;  1JWG A;  4JHR A;  5JHB A;  3RKV A;  3PZD A;  1EF1 C;  3SY2 A;  1SA4 A;  1FVF A;  3BU8 A;  1FPP A;  1A17 A;  2C2L A;  4NAC A;  4TUU A;  2XEH A;  4ATZ D;  2B0O E;  4I43 A;  3TG4 A;  4JEU A;  2X6H A;  2R17 C;  3ZXS A;  4N3A A;  3CHP A;  1V54 E;  1KZO A;  4K03 A;  4RG6 A;  1SZ9 A;  4JVS A;  3D9J A;  2LO6 A;  3MKQ A;  2F37 A;  3GYZ A;  3B7S A;  4EQF A;  2WXG A;  1TNU A;  3UT7 A;  4HOS A;  4Q96 A;  2IF4 A;  4MRU A;  1HF8 A;  4J6I A;  4B89 A;  3TG5 A;  1KPS B;  5FWQ A;  3LVR E;  4GPK A;  3HXD A;  4GZ5 A;  4PS8 A;  5BV1 A;  2NYJ A;  4U07 A;  3AS4 A;  2I1J A;  3ZFW A;  3FTS A;  1SQM A;  5AQA A;  3FY4 A;  1N54 A;  4IUL A;  5EID A;  4DI3 A;  5FQ4 A;  4E6H A;  1FT2 A;  3URZ A;  1LD8 A;  3CK7 A;  3C72 A;  5HKP A;  2LNI A;  3RRU A;  2YNQ A;  3TXM A;  4GMJ A;  3FEX A;  3G2S A;  4R7L A;  4L2L A;  3NZU A;  1WY6 A;  3OXG A;  4A63 B;  3FUL A;  4A55 A;  1OWL A;  3ZUV B;  1IKN D;  3MV2 B;  5JJ7 A;  1XNF A;  5HRY A;  3RJV A;  4GZ3 A;  1A5E A;  3P2B A;  2EIL E;  1TN6 A;  3RSE G;  1SVX A;  3FUM A;  2CHW A;  4UWH A;  3HIZ A;  1N4P A;  2EIK E;  2Y3A A;  3DST A;  4CRW A;  4G11 A;  3CST A;  2GRQ B;  2J4B A;  2KCL A;  2BED A;  2IFU A;  4LEU A;  3SI5 A;  4P29 A;  4LSZ E;  3DRA A;  3WG7 E;  4I1M A;  1MX6 A;  3SBT B;  2J49 A;  3L17 A;  3PEU B;  3CHQ A;  3FWV A;  4AIF A;  4G24 A;  3GZS A;  1BD8 A;  2Y4U A;  2P9S G;  2GGF A;  2XPY A;  5E76 A;  3KEA A;  3PEV B;  3IKO B;  4GTS A;  4RSY A;  3SHF A;  4ANV A;  5KCM A;  4KVM A;  2NC9 A;  4YDE A;  4JC8 A;  3DSU A;  2RD0 A;  3E32 A;  3JQ1 A;  5FZQ A;  3JXI A;  2KCV A;  4BT8 A;  1IYG A;  1JWF A;  4TUM A;  2BKG A;  3E30 A;  4G2V A;  5B3S E;  1QBQ A;  2IEJ A;  3Q5M A;  5EN5 D;  1DC2 A;  4WAF A;  2I2O A;  3EHN A;  3TWR A;  4JXT A;  4PDX A;  3DBS A;  2I9C A;  2QZA A;  4L2Y A;  3J5P A;  2MOW A;  3SFY A;  2DVW A;  3L54 A;  1U3D A;  5DBK A;  4UQY A;  3UI2 A;  2PM7 A;  2WXJ A;  2FF4 A;  2NSZ A;  2WQ6 A;  3PZ1 A;  5ITZ F;  3PZ3 A;  4ILG A;  3QWP A;  3ULQ A;  3ZHE A;  4DUI A;  4FJZ A;  1V55 E;  4MBG A;  4AVX A;  4GU5 A;  2GRL A;  3FUF A;  4ME2 A;  3NOC D;  4N39 A;  4F6R D;  3TWW A;  4QQI A;  2LAH A;  3OAW A;  2PL2 A;  1NZN A;  3OXL A;  5CER B;  4EZL A;  5G04 J;  4XKB A;  4HRM B;  4URK A;  2DZN A;  4GTR A;  4JB8 P;  2DYS E;  2J08 A;  3PH0 C;  1KZP A;  4U0U A;  4JL0 A;  5FIN A;  5FJY A;  2AXU A;  1NFI E;  4J8E A;  1MHQ A;  3OTN A;  2WXR A;  3CKB A;  4EHM A;  2YHE A;  4PUC A;  4LG6 A;  1N95 A;  5D2M C;  2HE0 A;  1FVH A;  4WWP A;  4WNF A;  5EIB E;  3T8M A;  3KD7 A;  4J8Y A;  1EYH A;  4L23 A;  3PRE A;  3APF A;  2H6I A;  2WB2 A;  4GTV A;  4C0E A;  2QC9 A;  4J8F A;  4EBA A;  4NUR A;  4I9C A;  3QAR A;  1JCS A;  3ASO E;  4EPZ A;  2ZGD A;  3ZXP A;  3TGO A;  1ELK A;  4J8D A;  3DSX A;  4GCO A;  1Y6I A;  2QY7 A;  1H19 A;  2P2C P;  4U63 A;  3N71 A;  4AXH A;  4ABN A;  3PE4 A;  4U8V D;  5T4Y A;  3EHQ A;  4GB9 A;  5LCW J;  5D0Q D;  4QFV A;  2AJA A;  3FUJ A;  2JLB A;  4FLH A;  1KT1 A;  3FU3 A;  2Y1L E;  3FHE A;  3DEP A;  4KYO B;  3U9W A;  3RRN B;  2QYU A;  4JW1 A;  4ATG A;  2E2E A;  1Z5S C;  2EQX A;  3TWT A;  3IHY A;  4DPR A;  1HE8 A;  3Q7F A;  4I6E A;  1TJF A;  3EHM A;  5ENQ D;  5EIL A;  3NAW A;  3NBN B;  2IO3 C;  2KZT A;  5FQ8 A;  4FC8 A;  5CBN A;  1HX8 A;  3CVU A;  3FUE A;  3AJI A;  1OXJ A;  3AG1 E;  2WXO A;  3MKR A;  4MLP A;  3ESL A;  4DI4 A;  3RO3 A;  4FJY A;  2DYR E;  3CSF A;  3C5R A;  4BER A;  3FUN A;  4YVQ C;  5KBA A;  5KJL A;  2J09 A;  4HXI A;  2CG2 A;  5G05 C;  1Y8M A;  2P58 C;  3CK8 A;  4HFG A;  2P9U G;  2LSU A;  3B7R L;  2L6J A;  5FZS A;  5CEC B;  3FDH A;  3S7B A;  4C9B B;  4WWO A;  1Z6T A;  3QNK A;  3ML8 A;  4HRN A;  4CT4 A;  3AG2 E;  1OWP A;  5CRU A;  1S70 B;  3T9K A;  2QYJ A;  5BT1 A;  3U64 A;  2AWI A;  3ZGQ A;  2FI7 A;  4AY5 A;  2DZO A;  2PM6 A;  1N4R A;  1X81 A;  5AQB A;  3PS6 A;  4BFR A;  3FTY A;  1NI1 A;  4XIF A;  3ZNG A;  3HRA A;  3UKU G;  4FUL A;  3UTM A;  4GA0 A;  3MZL B;  2CG3 A;  3LCA A;  2V4H C;  2YHC A;  2HO1 A;  5JJ6 A;  2DCP A;  2NXP A;  4ZHB A;  4WNG A;  3CHM A;  3MJW A;  3I4R B;  1E7V A;  2LXM A;  5AYW D;  3S7J A;  5LFA A;  3HXB A;  2KCK A;  3Q79 A;  5CBO A;  1K1B A;  4PH4 B;  3ULY A;  2Y4T A;  2P9N G;  3D9K A;  1HZ4 A;  3FUD A;  1H2U A;  3BQO A;  4GZ6 A;  2OVB A;  3QDN A;  4N2Q A;  1N94 A;  5EX3 A;  1N0R A;  4JD2 G;  2WXQ A;  4CYM D;  4TXR A;  3D3M A;  1Z3Y A;  2KAT A;  2BKK B;  1ELR A;  2XHE A;  4L1B A;  4U8Y D;  3CVX A;  4G26 A;  4Z68 A;  4UQZ A;  4OAU C;  5KJM A;  2R03 A;  2XS1 A;  3CGH A;  3LKU A;  1TNZ A;  4HBD A;  3FH7 A;  3K9I A;  4U95 D;  3FTZ A;  3L08 A;  4LNB A;  4RQI A;  3UQ3 A;  2KZT B;  2JEK A;  1IHB A;  4HOT A;  3UKR G;  3NF1 A;  3RU0 A;  4BET A;  2V5Q C;  5FT9 A;  1TN7 A;  3HXF A;  4AV7 A;  4TV3 A;  2MYO A;  4HLL A;  4XEI G;  5HQ8 A;  4BEP A;  4JA7 A;  4A1G A;  4JEH A;  3G2V A;  1IQU A;  5KNG A;  4ANX A;  2B6C A;  5AQ7 A;  1WM5 A;  2IOS A;  2VSY A;  3CV0 A;  1WAO 1;  2XEV A;  3D9I A;  4GZD A;  4JHJ A;  2X6F A;  3U4T A;  4G8K A;  4EBA G;  5ENO D;  4FAD A;  3MGB A;  3TWX A;  4ACK A;  3UX4 A;  3JCK C;  5ENT D;  3Q75 A;  3QWV A;  5J08 A;  2J8S D;  3I5P A;  4BSX A;  4DX6 D;  2A4Z A;  2GRN B;  4Y6C A;  3ZYK A;  1E8W A;  2R59 A;  4I6G A;  4LUN U;  3KS2 A;  4JZY A;  4WNE A;  2I6H A;  3C3Q A;  2F0Y A;  5EDS A;  4O6F A;  1PY1 A;  3Q9N C;  3T5X A;  4CEM A;  1N11 A;  5H7P A;  1BLX B;  1S64 A;  4K5C A;  3FFL A;  2R02 A;  3Q73 A;  3PZ2 A;  5B1B E;  3U3W A;  2FO1 E;  2XRZ A;  3AS8 A;  2WMN A;  4L9P A;  3PZ4 A;  1TR4 A;  4O60 A;  5ANR A;  1UN9 A;  4CZ2 D;  4GPM A;  3ASG A;  3CR3 A;  2PNN A;  2XEN A;  3ISM C;  4G8L A;  1MX2 A;  3APD A;  3E33 A;  3JXJ A;  3LPZ A;  3DEO A;  1P5Q A;  4OYS A;  2WQ7 A;  2V4L A;  1VDY A;  3ZVV A;  2AW6 A;  2H6H A;  2V0P A;  4KZC A;  4CGW A;  2GRO B;  1ZBP A;  1IXV A;  2KBX A;  4X8Q A;  2XS8 A;  4CGV A;  3D9L A;  2XPZ A;  3ASH A;  3FTX A;  4G25 A;  1UOH A;  4ILI A;  4B8A A;  2ZIR A;  3EHR A;  4XI0 A;  3UIN C;  3V2X A;  4GZC A;  4U04 A;  4A1S A;  2V5F A;  1O1T A;  1O5M A;  2XPI A;  1U3C A;  2RG8 A;  4LNG A;  4ANU A;  5AEN A;  1GW6 A;  2X6I A;  2RFM A;  3AS5 A;  5JHA A;  4DRX E;  3R9M A;  3HDX A;  3BG0 B;  3HHM A;  2Q7F A;  3QOU A;  2XEE A;  4XE0 A;  2Y0B G;  3TL5 A;  5JA4 D;  2OOE A;  2WVI A;  1OWM A;  3QC1 A;  5ARF A;  2HYZ A;  1HG2 A;  3HXC A;  4BT9 A;  5FQ6 A;  3CQC B;  4DLO A;  4U0Z A;  5FTP A;  1JPL A;  3LDZ A;  3ULE G;  4FA6 A;  4GA1 A;  1N52 A;  4DJA A;  2WMO A;  4YDY A;  5ENP D;  3UXG A;  2P9K G;  3ML9 A;  4I1A A;  3WXX A;  3JUE A;  2BTD A;  1TEZ A;  1E8Z A;  3TWS A;  2QFC A;  1OCC E;  3CVV A;  1MYO A;  1W3B A;  1E8Y A;  1HH8 A;  3HG0 D;  4HOQ A;  1N0Q A;  2CHX A;  3APC A;  2BUG A;  4I17 A;  4DK5 A;  4K5A B;  2JAB A;  2GRR B;  2WQH A;  3Q49 B;  4D10 C;  1BPO A;  4Q69 A;  2XCB A;  1FCH A;  4JHK A;  3MKQ B;  5AJD A;  3ABK E;  3ZYM A;  3CK9 A;  1QQE A;  1OCR E;  3CKC A;  4J0U A;  4I1O B;  2I1K A;  1HFA A;  3J5Q B;  5FIO A;  1RZ4 A;  3CHR A;  3CVL A;  4F7A A;  2CHZ A;  5LP0 A;  4FHJ A;  2J07 A;  1DCQ A;  3Q9U C;  2WXM A;  4AJW A;  3W9G A;  1OCZ E;  5CCM A;  2CFZ A;  2WM9 A;  5CCL A;  3FEY A;  4HLE A;  2XGO A;  4UWK A;  3QB2 A;  2WXP A;  3NQP A;  2IY0 C;  5JMN D;  3CVN A;  4I6J A;  5EYL A;  4YVO A;  1UW4 B;  1UG3 A;  4GA2 A;  2V8S E;  2PQR A;  4U96 D;  4HOR A;  3SD5 A;  5CMW A;  4BSZ B;  4FHK A;  2FO7 A;  2Y69 E;  4TRQ A;  1AWC B;  2IJG X;  5CHE E;  4KZ0 A;  3G2T A; 
#chains in the Genus database with same CATH homology
 1LTX A;  1D8E A;  1SA4 A;  4EHM A;  3EUV A;  4YDE A;  3DSU A;  1JCQ A;  1N95 A;  3E32 A;  2ZIR A;  1FPP A;  1N4S A;  1O1R A;  3HXB A;  3Q79 A;  3DSS A;  1O1T A;  1O5M A;  4GTM A;  1FT2 A;  3E30 A;  3Q78 A;  4GTP A;  1LD8 A;  1QBQ A;  4GTO A;  2IEJ A;  3C72 A;  2H6I A;  4LNG A;  4GTV A;  3Q7A A;  1D8D A;  3DSV A;  3Q75 A;  1JCS A;  1N94 A;  1SA5 A;  1KZO A;  1TN8 A;  3DPY A;  1N9A A;  3KSL A;  3SFY A;  3HXE A;  3DSX A;  1TN6 A;  1O1S A;  1LD7 A;  2F0Y A;  3DSW A;  1TNB A;  1JCR A;  3PZ1 A;  1N4P A;  3EU5 A;  3PZ3 A;  3DST A;  4GTT A;  1DCE A;  1TNO A;  3HXC A;  1TNZ A;  4YDO A;  1TNU A;  1S64 A;  4MBG A;  1MZC A;  2ZIS A;  2BED A;  1FT1 A;  1N4R A;  3Q73 A;  3PZ2 A;  4GTQ A;  1N4Q A;  2H6F A;  1X81 A;  3DRA A;  4LNB A;  1NI1 A;  1S63 A;  3PZ4 A;  4L9P A;  3SFX A;  1TN7 A;  3HXF A;  3HXD A;  4GTR A;  3E37 A;  2H6G A;  3E34 A;  3E33 A;  1TNY A;  3KSQ A;  1KZP A;  1NL4 A;  3Q7F A;  2H6H A;  4GTS A;  2R2L A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...