2H6IA

W102t/y365f protein farnesyltransferase double mutant complexed with a geranylgeranylated ddptasacvls peptide product at 3.0a
Total Genus 131
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
131
sequence length
315
structure length
315
Chain Sequence
b'FVSLDSPSYVLYRDRAEWADIDPVPQNDGPNPVVQIIYSDKFRDVYDYFRAVLQRDERSERAFKLTRDAIELNAANYTVWHFRRVLLKSLQKDLHEEMNYITAIIEEQPKNYQVWHHRRVLVEWLRDPSQELEFIADILNQDAKNYHAWQHRQWVIQEFKLWDNELQYVDQLLKEDVRNNSVWNQRYFVISNTTGYNDRAVLEREVQYTLEMIKLVPHNESAWNYLKGILQDRGLSKYPNLLNQLLDLQPSHSSPYLIAFLVDIYEDMLENQCDNKEDILNKALELCEILAKEKDTIRKEYWRYIGRSLQSKHST'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protein farnesyltransferase/geranylgeranyltransferase type I
publication title Conversion of protein farnesyltransferase to a geranylgeranyltransferase.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 131
structure length 315
sequence length 315
ec nomenclature ec 2.5.1.58: Protein farnesyltransferase.
pdb deposition date 2006-05-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01239 PPTA Protein prenyltransferase alpha subunit repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.120 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Protein prenylyltransferase 2h6iA00
3SFYA 4GTVA 3HXEA 2H6HA 3DSTA 3E37A 3Q7AA 3Q7FA 1FPPA 1O1TA 3E33A 4YDOA 1SA5A 1FT1A 3KSLA 1N4SA 1TNUA 2F0YA 3PZ4A 1LD7A 1D8DA 2R2LA 1S64A 3PZ2A 1JCQA 3DPYA 1QBQA 1S63A 1LD8A 2BEDA 1KZOA 1FT2A 3DRAA 1D8EA 3PZ3A 1X81A 4GTRA 2H6FA 3E34A 4EHMA 4GTOA 3SFXA 3HXDA 3Q73A 3HXCA 3KSQA 1DCEA 3Q78A 4GTTA 4MBGA 1TN8A 2H6GA 3DSXA 4LNBA 1N4QA 3DSVA 1TNYA 1N4RA 1NI1A 4YDEA 3EU5A 3Q75A 2ZIRA 3PZ1A 4L9PA 1KZPA 4GTQA 1TNOA 1NL4A 3DSSA 1TN7A 1O1RA 4GTPA 3EUVA 2ZISA 1SA4A 1TNBA 2IEJA 3DSUA 4LNGA 3C72A 3E32A 1N94A 4GTMA 1JCSA 3HXBA 1N4PA 1N9AA 1TN6A 4GTSA 1JCRA 3Q79A 1TNZA 2H6IA 1O1SA 1O5MA 1N95A 1LTXA 3HXFA 3E30A 3DSWA 1MZCA
chains in the Genus database with same CATH superfamily
3FTZA 1U3CA 4MRUA 3C98A 4Q96A 4FJYA 3ZEFA 1XNFA 1UN9A 3CK9A 2IQCA 3P2BA 2VSXE 4TXRA 3D9NA 1NFIE 2VSNA 2WXHA 3ML9A 2Q7FA 2QYUA 2P9SG 3PZ3A 4DX7D 2QC9A 3GZ2A 1HX8A 1FVHA 3TWWA 3SD5A 3FULA 3PDNA 2AXUA 4TRQA 2OV8A 4I6JA 2DYRE 3L22A 3ABME 3R7QA 1HU3A 1A17A 3NB2A 4K5BA 4DJAA 3SQVA 2HE0A 4NRHB 3EHRA 4XEIG 3RKVA 2GROB 5A6CA 1Z5SC 1DCQA 1RW2A 2Y4TA 4CT4A 1TNBA 3LPZA 3CK7A 3IKOB 3ZN3A 5KWDA 3UKUG 5J08A 3FH8A 2XS1A 3TWSA 3VTYA 3V79K 4GMJA 2R59A 1E8ZA 5DIZA 4RSYA 1NP7A 1S70B 2QY7A 2P9UG 3ZYQA 1A5EA 1SZAA 2VTBB 3CK8A 3LKUA 5D2MC 3B7BA 1QZ2A 4HOSA 3AS8A 3TL5A 5LOZA 2PL2A 2WXRA 1S64A 4L2YA 4UWFA 4GA1A 3APDA 5KCMA 2PM7A 5ENNA 1FT2A 2ZXWE 2RD0A 1X81A 3TGOA 3RRMB 3UT7A 4I6EA 2VSOE 4HRNA 4EHMA 3T9KA 2ETBA 3Q78A 4P29A 4EBAA 3FUNA 4AJWA 4G1TA 1OXJA 3FTVA 2P58C 2B6CA 3FH5A 2E0IA 1INZA 1KZPA 1ZU2A 5AJLA 3JCKC 4TV3A 2KATA 4LRZA 4G11A 1WDYA 3PUJA 3D9LA 3G2VA 3DEPA 2DZOA 3VLDA 2IEJA 4DK5A 3S7FA 3SF4A 2XEHA 3C72A 3I4GA 3QWWA 3BU8A 4L2LA 2VJ8A 4ZHBA 2XGOA 3U3WA 4DLQA 2KBXA 5AARA 3OAWA 3RK6A 3PS6A 3D3MA 3PZDA 3CHRA 2BF0X 3UPVA 5ANLA 1Z3YA 3UM1A 2H6HA 3KAEA 4Q94A 3EIJA 2WXLA 4YDOA 4BERA 1OCZE 3D9HA 3CHSA 1TNUA 5KNHD 4Y6WA 5CMWA 2L0TB 4AM9A 1N54A 2VQ2A 5AYWD 1AWCB 4U8VD 4JZYA 4HOUA 5HRYA 5LFAA 2P2CP 1IQUA 5G04J 1D8EA 5LX8A 1HXIA 3TWXA 2UWJG 2WXNA 4AY6A 4G8LA 2LAIA 2P9KG 2R02A 4I17A 2IOSA 4ILIA 5ENPD 5JJ7A 4F53A 3SZ7A 4ME2A 3IHYA 3ZHEA 3LY9A 2BKKB 4UQYA 1NA3A 3SI5A 4A3TA 4C9BB 5T3RA 3CHMA 3ABKE 2PQNA 3FU6A 3P1UA 3S7BA 5ENOD 1KT0A 4TUMA 4BSZB 3DSUA 3PVLA 1P5QA 2L6BA 4B89A 3FUKA 4KZCA 2EILE 2VYIA 2EIKE 3W9FA 3AG3E 3CR3A 2GRMA 1UW4B 1O1SA 4JVSA 5CBOA 3PUKA 2C2LA 3Q4AB 4QFVA 4KMOA 3UXGA 2KZTB 2BTDA 5AENA 3GW4A 4BEPA 3APCA 1SQMA 4O60A 4GPKA 4G2VA 3NAWA 3SNXA 1KT1A 2R2LA 4FU3A 4U96D 2GRQB 2XHEA 4GA0A 5JA4D 2VGXA 4ABNA 3SHFA 2CHZA 3UX4A 3OTNA 4LCTA 1K1BA 2Y3AA 3RO2A 3LY7A 4GTTA 4UQZA 4I43A 5LCWC 3NBNB 4I2ZA 1DVPA 5C1DA 4GYWA 3PZ1A 4GCOA 3X2QE 4DI3A 5FQ7A 2ZISA 4BTAA 3TXNA 3I5PA 3JXJA 5FJYA 3MZLB 5CCMA 3D9JA 2V5QC 3FUDA 2C0LA 3JQ1A 1O5MA 3JUIA 3DSWA 4DX6D 2X6KA 2V4HC 3ABLE 3HHMA 4XZ4A 5FT9A 1K3ZD 1MYOA 4PS7A 3DSTA 3LEWA 3PNTB 4WWPA 3Q7AA 3Q7FA 1FPPA 2YNQA 5ENSD 3ZYMA 3E33A 4FP7A 2RFMA 1FT1A 1JUQA 4MS6A 3PZ4A 1E8YA 2XRYA 2J4BA 4O1PA 3ZYKA 4OAUC 1TEZA 4JEUA 1Y6IA 4J0UA 2HYZA 1KZOA 5CEDB 5JJTA 1E96B 2IJGX 3MGBA 2WVIA 2H6FA 3FEXA 3IBEA 3ESKA 3V2OA 3OXFA 3RJVA 5E75A 4AEZC 3Q47B 2IO3C 4GPMA 3V31A 1LF8A 4HRMB 4PUCA 2XENA 4IN3B 3FU0A 3CVUA 2WXJA 2YINA 5ENTD 4UUCA 1UOHA 4U07A 3FTSA 3ONLA 2WXFA 5JJ6A 3QB2A 3CVQA 1WY6A 2IY0C 1ELRA 5E76A 1TNOA 1TJCA 4U04A 3Q9UC 2MYOA 3FTXA 2YQ8A 4YVQC 3JQ0A 4EZJA 2OOEA 3GYZA 3ASNE 5FQ6A 3HDXA 1JCSA 4OVUA 1N0QA 4ACKA 5CRVA 4J6IA 4APOA 5FQ4A 3AG2E 3JYSA 4L23A 1YCSB 3EDTB 3EU9A 3SFZA 4CDNA 3GZ1A 3CSTA 5EX0A 3HYMB 2KM4A 2JABA 2GGFA 3ZGQA 4J8YA 1O1TA 3Q15A 4N2QA 4WNFA 4JA9A 2VTBA 4B8CB 4JC8A 3CIAA 1V54E 2LXMA 1MX4A 3QKYA 1S63A 1H6OA 1IHGA 3FUMA 3I4RB 1JWGA 2LUHA 4HNAD 4U0ZA 2LAHA 3ZVVA 4GYYA 4I1OB 2MHKA 5CCLA 3RRUA 4MLPA 5M72A 1WAO1 2R5SA 3FUEA 4DUIA 1MJ0A 2J8SD 3TWVA 3O4ZA 4XI9A 4A1SA 1N4RA 4M7CA 3Q75A 4LG6A 3V2XA 4CYMD 2A5UA 3LVQE 4UI9K 3CHQA 4I6GA 2C0MA 5CMYA 4URKA 3MA5A 3ONKA 3SBTB 3KD7A 3UI2A 4CT0A 3FFLA 3IV0A 3PE3A 3QNKA 4LNGA 5BXOA 3QJZA 1IXVA 3ESLA 2E2EA 5CECB 3FTYA 1H2TC 2X6HA 3HXFA 3FH7A 4G26A 1OY3D 3HRAA 3AS4A 4HLEA 3FU3A 4J8EA 2HR2A 2CHWA 4Q69A 3ULQA 3CHPA 2XRZA 4AXHA 1DNPA 3JXIA 2I1KA 1SZ9A 3ASGA 4EECA 4FJZA 3CQGB 3FTUA 4WWNA 4W9RA 1N4SA 4HRLA 3EHQA 3JUEA 3VTXA 4ATZD 2A5EA 2BEDA 1U2VG 1WM5A 3EJNA 2VSYA 4N39A 3T8MA 4UI9J 4OYSA 3ZXSA 4KBQA 4TXPA 3LDZA 4HVBA 3KSQA 4BY6A 3K9IA 5G2NA 5FZSA 2WXIA 2XCCA 1EYHA 2EQXA 2IONA 2XEVA 4B0ZA 2ZIRA 1OWLA 4J8FA 4L9PA 1ZBPA 3C3QA 2LSVA 3LJ3A 3NOGD 5KJMA 4IRUA 3E4BA 4A63B 3TWQA 3J5QB 5T4YA 4NACA 4GZCA 5ENRD 3QK0A 2J4DA 1ELKA 1H2UA 5BXUA 1K1AA 4DI4A 1OWMA 3KEAA 2R05A 4N5CA 1TNZA 2X38A 3CVYA 5FZRA 1LTXA 4GB9A 3EIQC 4NIKA 4DX5D 4FLBA 2FEZA 4CEMA 2GW1A 4HS2A 1SVXA 2DZNA 4JA7A 4JHRA 4KVMA 4N3BA 2KZTA 3L17A 3NF1A 1MHQA 3CVPA 4DX1A 4O1OA 5CBNA 4KZ0A 4N3AA 3DRAA 2JLBA 5J90A 3D9MA 4XI0A 5FTPA 2J49A 2L9BA 3HXDA 5BUZA 3Q73A 4HQDA 1HE8A 3CVWA 3LVRE 5CERB 1DC2A 2RFAA 1KLXA 2P9LG 4XX5A 3DWLG 3RSEG 2L0IA 4ANUA 4LNUD 4LEUA 2XPZA 2IO2C 2YHEA 2IU1A 2EINE 3Q49B 2NXPA 5BV1A 3FY4A 3CVNA 1SA4A 1OUVA 4E6HA 1BLXB 2P9IG 3SBSA 4K5AB 3AU5A 3ZYLA 5A23A 1GW6A 4F1SA 3ENEA 3Q79A 3QWPA 2KCLA 2LSUA 3PH0C 2WQHA 5FIOA 4ATGA 4J7WA 4GTVA 3AU4A 2WPVA 1ZB1A 4CRWA 2HO1A 2WXPA 3TWTA 4M3OA 1D8DA 3TJPA 1TYQG 2JEKA 4IULA 2X6IA 5G04C 5AAOA 5A7DB 4UWKA 5ENQD 3FP3A 5ARFA 1Y8MA 5EYLA 3U64A 5CHEE 4F1PA 4RQIA 3URZA 3G2SA 2J09A 2V5FA 2DYSE 3B7RL 3E34A 5LCWJ 4YDYA 3TXMA 4FULA 3AG4E 2IFUA 3LY8A 3UM3A 2DBAA 4U8HA 1DCEA 5T8IA 4F7AA 1TN8A 3MYVA 4BFRA 2CFUA 3PNLB 3RAUA 2DVWA 3EU5A 1KPSB 4FLHA 4KYOB 3DPDA 4GTQA 5B1BE 4K5CA 4HOQA 2J07A 3EUVA 3CEQA 4HBDA 3HG0D 3J5PA 4YNDA 4B93B 3B13A 1N9AA 2XPYA 2LXLA 5CEAA 1MX6A 2J9QA 2XGSA 3GZSA 1U3DA 2GRRB 2B0OE 5EN5D 1E90A 1N11A 2IF4A 5G05J 4CZ2D 4G24A 5AN8A 4I1AA 2NYJA 2F8XK 3VLFA 5BPPA 4HFGA 4JEHA 3LYAA 4I1MA 3ASOE 2OEVA 3DXMG 2Y69E 2XQ0A 3ZW3A 5AQAA 4GCNA 4UWHA 5FQ8A 3MV3B 1QQEA 2WMNA 3UT8A 1SW6A 2QYJA 3N71A 2FULA 5D66A 4GYOA 3T5XA 3UIOC 3D9PA 2WXGA 4F3VA 3W9GA 3QARA 3DXKG 2PZIA 4QQIA 3HXCA 3RO3A 3IXEA 1MQSA 4K0RA 3UIPC 3DSVA 5ITZF 3FUHA 4E85A 4ILGA 2X3MA 1WG0A 2DIWA 3L54A 4RLYA 2FO1E 2FO7A 2AVPA 1NZNA 2BKGA 2ILRA 4NQ0A 4PS3A 4TUUA 1W3BA 1H6PA 2PQRA 3DBSA 2DCPA 1VDYA 2OVBA 4GZ5A 4NURA 3PREA 3D9KA 3ULYA 1IKND 1ELWA 4G25A 2UY1B 4HORA 3TG4A 3PE4A 3RIBA 5JHAA 1PY1A 2XGMA 5ARGA 4ZFHA 1YA0A 2CG2A 3KSLA 4UWLA 3V30A 3CVLA 4OAVB 3DPYA 3DEOA 3G2TA 1N52A 2M63A 1OT8A 3FDHA 1IYGA 3B95A 3CHOA 2ETAA 3D9OA 2HM8A 4GTOA 3LJNA 2AXVA 3ZRHA 1RZ4A 3R9MA 5KJKA 2BUGA 3PEUB 5HI7A 3ASDA 2V8SE 1N4QA 1UG3A 4DRXE 1YYHA 4CDMA 3KEZA 4BETA 2XCBA 4HLLA 4IYPA 4HI9A 3MJWA 4U0UA 3BG0B 3TG5A 2NC9A 4U8YD 3ZNGA 4AIFA 4DLOA 5EIDA 4GMRA 4UWGA 1H2VC 3E32A 4JD2G 4BTBA 3HXBA 3ZU7B 3UM2A 4CDRA 5ANRA 2H6IA 2ZU6B 2PM6A 3L82A 2RKKA 1FVFA 1HH8A 3F6QA 3E30A 2GRPB 3FTWA 4ANXA 4XKCA 5EDSA 3BG1B 3SFYA 3L6AA 3B7UX 4N5QA 4EZLA 1HS6A 4WNEA 1BU9A 2I2OA 3CGHA 1SA5A 3ZPJA 4PH4B 4UQXA 4G23A 3AS5A 3CKBA 4LERA 1QBQA 2FI7A 3ML8A 1QYMA 4EPZA 4TXQA 2XZTG 3QAQA 5JHBA 3C3OA 5EYPF 3CVXA 1K8KG 4RG9A 3CLJA 4K03A 2QZAA 3MKQB 5IY5E 2OCCE 4ILHB 4MBGA 1QNFA 4JPSA 1N0RA 1E7VA 1TNYA 4YDEA 4R7LA 3IHVA 3L9TA 4EQFA 2WXKA 3HVEB 5FZQA 4JHJA 2AJAA 2R17C 5B3SE 5BNWA 2VGEA 4GZ3A 4GTPA 4HXIA 2CG3A 4JXTA 4BWRA 1TJFA 3L13A 3SGHA 2XZDG 5AQBA 1UN8A 4CGVA 4U95D 1OWOA 4GTMA 4PS8A 1BPOA 3OXLA 2NSZA 1XGWA 4KT6B 5G55A 3FUIA 4CGWA 4GZDA 2WXMA 5EILA 3ZXPA 3QWVA 4KXKB 2V0PA 1E7UA 3HXEA 4YVOA 2CFZA 3T5VA 1IHBA 3R7RA 3VLEA 2Y0BG 2CHXA 2AXZA 1EDUA 4A55A 3NZUA 5BV0A 2ZGDA 4UI9C 4BX9A 1LD8A 3LXUX 4J8DA 2MRIA 4HI8A 4FA6A 3UMVA 2X6JA 3ZKJA 2XEEA 4D10C 3SY2A 1Z6TA 2Y1LE 3TAXA 1OCCE 4JHKA 2KC7A 3PRZA 4GU5A 3MEKA 1B89A 3FHEA 1OWPA 3FWVA 3C5RA 1BI7B 4XIFA 4JW1A 3U66A 4LUNU 4KVOA 3Q9NC 2R03A 3NQPA 5FWQA 2I6HA 2RG8A 2WQ6A 5AIJA 4EZKA 1PC2A 2X6FA 2WXQA 4U63A 2WQ7A 5HKPA 2WXOA 1IQRA 3ULEG 4GA2A 2I1JA 1BI8B 3B7TA 3NZSA 1MX2A 3C3RA 3I3NA 3CVVA 3QC1A 2KXPC 5LP0A 3FUJA 1HO8A 1E8XA 3PZ2A 3HIZA 4MKTA 4BT8A 4U0SA 4A3VA 4C0EA 3SO8A 4CCAA 3QOUA 5D0QD 5B1AE 3T8KA 1PAQA 4GTRA 2QFCA 3UKRG 3L08A 5KBAA 4FHJA 3AAAC 2GRNB 3AJIA 3DSXA 3ZFWA 1HZ4A 3LCAA 4I2WA 2XPIA 4B8AA 2ONDA 4AVXA 4WNGA 3G2WA 1AP7A 3FU5A 1E8WA 4H7XA 5AQ9A 3ZUVB 4L7TA 4I9CA 4HOTA 4WAFA 3DSSA 2VGYA 3QDNA 2Y4UA 3WXXA 1OWNA 3WG7E 3KS2A 2J08A 1UJKA 4JB8P 1EPUA 1N94A 4WUYA 1UJJA 4J8SA 4B94A 1BD8A 1TN6A 1JPLA 4GTSA 3MX3A 4FHKA 3FUFA 3FEYA 2EIJE 4WWOA 1TR4A 1MZCA 3O48A 4YDWA 4DPRA 1HG5A 1D9SA 2OVFA 4BESA 3ASHA 5HQ8A 4ANWA 4BX8A 4L1BA 3S2AA 3E37A 3U4TA 4ACLA 1HFAA 4A1GA 2UY1A 2F0YA 2LO6A 4N3CA 1JCQA 4JL0A 2WM9A 1X5BA 3PEVB 3ASFA 2F37A 4GAAA 4WNDA 2P9PG 2L6JA 5KJNA 3MKRA 4F6RD 2FF4A 3MV2B 3BQOA 3SFXA 3UQ3A 3TWUA 3BEEA 4BT9A 3ZHEB 4AP2A 2FBNA 1G3NB 4GMLA 5BT1A 3ZIMA 1JWFA 4DX2A 3CV0A 4PDXA 3UINC 5JMND 4X8QA 5D0OD 1H6KA 2GRLA 3S7JA 2WB2A 3RU0A 1S0PA 1Q2ZA 5G05C 1L5JA 4AOFA 1YMPA 1FCHA 4LSZE 1HF8A 5KNGA 4Z68A 4APFA 3LS8A 3CSFA 4XE0A 1N95A 1OCOE 2EIME 4U7EB 2I9CA 1Z3XA 4O6FA 3MCXA 4C0MA 2KCVA 3CKCA 3UUXA 3U9WA 5EKQD 5DBKA 1LD7A 1NA0A 3CQCB 1HG2A 2VGXB 2KCKA 5AQ7A 3EHMA 4RVBA 4FADA 3D9IA 3NOCD 4FC8A 3TWRA 2IOLA 1V55E 3BUAA 5KJLA 2DWZA 3UTMA 1H0AA 5EIBE 5FINA 3UM0A 3Q5MA 2LNIA 2P9NG 4XKBA 4AV7A 1H19A 4AY5A 5BW8C 2WMOA 2F8YA 3OXGA 5H7PA 4H7YA 3UT4A 3EHNA 5CRUA 2A4ZA 2H6GA 4N2SA 3IEGA 1OCRE 4LNBA 2OEWA 1NI1A 4ANVA 3MKQA 3ISMC 2MOWA 2XS8A 5AJDA 2AW6A 3AG1E 1NL4A 4OVVA 3G2UA 3S7DA 3B7SA 1TN7A 2PNNA 3RRNB 1O1RA 2ZGGA 3APFA 3HVEA 3L16A 2YHCA 4BSXA 4V3IA 4GZ6A 1N4PA 5HS0A 5EX3A 4Y6CA 4EBAG 1JCRA 2V4LA 4RG6A 2ETCA 4G8KA 5C2YA 1EF1C 4HB5A 3R9AB 4C48B 2AWIA 4I9EA
chains in the Genus database with same CATH topology
3SFYA 4GTVA 3HXEA 2H6HA 3DSTA 3E37A 3Q7AA 3Q7FA 1FPPA 1O1TA 3E33A 4YDOA 1SA5A 1FT1A 3KSLA 1N4SA 1TNUA 2F0YA 3PZ4A 1LD7A 1D8DA 2R2LA 1S64A 3PZ2A 1JCQA 3DPYA 1QBQA 1S63A 1LD8A 2BEDA 1KZOA 1FT2A 3DRAA 1D8EA 3PZ3A 1X81A 4GTRA 2H6FA 3E34A 4EHMA 4GTOA 3SFXA 3HXDA 3Q73A 3HXCA 3KSQA 1DCEA 3Q78A 4GTTA 4MBGA 1TN8A 2H6GA 3DSXA 4LNBA 1N4QA 3DSVA 1TNYA 1N4RA 1NI1A 4YDEA 3EU5A 3Q75A 2ZIRA 3PZ1A 4L9PA 1KZPA 4GTQA 1TNOA 1NL4A 3DSSA 1TN7A 1O1RA 4GTPA 3EUVA 2ZISA 1SA4A 1TNBA 2IEJA 3DSUA 4LNGA 3C72A 3E32A 1N94A 4GTMA 1JCSA 3HXBA 1N4PA 1N9AA 1TN6A 4GTSA 1JCRA 3Q79A 1TNZA 2H6IA 1O1SA 1O5MA 1N95A 1LTXA 3HXFA 3E30A 3DSWA 1MZCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3SFY A;  4GTV A;  3HXE A;  2H6H A;  3DST A;  3E37 A;  3Q7A A;  3Q7F A;  1FPP A;  1O1T A;  3E33 A;  4YDO A;  1SA5 A;  1FT1 A;  3KSL A;  1N4S A;  1TNU A;  2F0Y A;  3PZ4 A;  1LD7 A;  1D8D A;  2R2L A;  1S64 A;  3PZ2 A;  1JCQ A;  3DPY A;  1QBQ A;  1S63 A;  1LD8 A;  2BED A;  1KZO A;  1FT2 A;  3DRA A;  1D8E A;  3PZ3 A;  1X81 A;  4GTR A;  2H6F A;  3E34 A;  4EHM A;  4GTO A;  3SFX A;  3HXD A;  3Q73 A;  3HXC A;  3KSQ A;  1DCE A;  3Q78 A;  4GTT A;  4MBG A;  1TN8 A;  2H6G A;  3DSX A;  4LNB A;  1N4Q A;  3DSV A;  1TNY A;  1N4R A;  1NI1 A;  4YDE A;  3EU5 A;  3Q75 A;  2ZIR A;  3PZ1 A;  4L9P A;  1KZP A;  4GTQ A;  1TNO A;  1NL4 A;  3DSS A;  1TN7 A;  1O1R A;  4GTP A;  3EUV A;  2ZIS A;  1SA4 A;  1TNB A;  2IEJ A;  3DSU A;  4LNG A;  3C72 A;  3E32 A;  1N94 A;  4GTM A;  1JCS A;  3HXB A;  1N4P A;  1N9A A;  1TN6 A;  4GTS A;  1JCR A;  3Q79 A;  1TNZ A;  2H6I A;  1O1S A;  1O5M A;  1N95 A;  1LTX A;  3HXF A;  3E30 A;  3DSW A;  1MZC A; 
#chains in the Genus database with same CATH topology
 3FTZ A;  1U3C A;  4MRU A;  3C98 A;  4Q96 A;  4FJY A;  3ZEF A;  1XNF A;  1UN9 A;  3CK9 A;  2IQC A;  3P2B A;  2VSX E;  4TXR A;  3D9N A;  1NFI E;  2VSN A;  2WXH A;  3ML9 A;  2Q7F A;  2QYU A;  2P9S G;  3PZ3 A;  4DX7 D;  2QC9 A;  3GZ2 A;  1HX8 A;  1FVH A;  3TWW A;  3SD5 A;  3FUL A;  3PDN A;  2AXU A;  4TRQ A;  2OV8 A;  4I6J A;  2DYR E;  3L22 A;  3ABM E;  3R7Q A;  1HU3 A;  1A17 A;  3NB2 A;  4K5B A;  4DJA A;  3SQV A;  2HE0 A;  4NRH B;  3EHR A;  4XEI G;  3RKV A;  2GRO B;  5A6C A;  1Z5S C;  1DCQ A;  1RW2 A;  2Y4T A;  4CT4 A;  1TNB A;  3LPZ A;  3CK7 A;  3IKO B;  3ZN3 A;  5KWD A;  3UKU G;  5J08 A;  3FH8 A;  2XS1 A;  3TWS A;  3VTY A;  3V79 K;  4GMJ A;  2R59 A;  1E8Z A;  5DIZ A;  4RSY A;  1NP7 A;  1S70 B;  2QY7 A;  2P9U G;  3ZYQ A;  1A5E A;  1SZA A;  2VTB B;  3CK8 A;  3LKU A;  5D2M C;  3B7B A;  1QZ2 A;  4HOS A;  3AS8 A;  3TL5 A;  5LOZ A;  2PL2 A;  2WXR A;  1S64 A;  4L2Y A;  4UWF A;  4GA1 A;  3APD A;  5KCM A;  2PM7 A;  5ENN A;  1FT2 A;  2ZXW E;  2RD0 A;  1X81 A;  3TGO A;  3RRM B;  3UT7 A;  4I6E A;  2VSO E;  4HRN A;  4EHM A;  3T9K A;  2ETB A;  3Q78 A;  4P29 A;  4EBA A;  3FUN A;  4AJW A;  4G1T A;  1OXJ A;  3FTV A;  2P58 C;  2B6C A;  3FH5 A;  2E0I A;  1INZ A;  1KZP A;  1ZU2 A;  5AJL A;  3JCK C;  4TV3 A;  2KAT A;  4LRZ A;  4G11 A;  1WDY A;  3PUJ A;  3D9L A;  3G2V A;  3DEP A;  2DZO A;  3VLD A;  2IEJ A;  4DK5 A;  3S7F A;  3SF4 A;  2XEH A;  3C72 A;  3I4G A;  3QWW A;  3BU8 A;  4L2L A;  2VJ8 A;  4ZHB A;  2XGO A;  3U3W A;  4DLQ A;  2KBX A;  5AAR A;  3OAW A;  3RK6 A;  3PS6 A;  3D3M A;  3PZD A;  3CHR A;  2BF0 X;  3UPV A;  5ANL A;  1Z3Y A;  3UM1 A;  2H6H A;  3KAE A;  4Q94 A;  3EIJ A;  2WXL A;  4YDO A;  4BER A;  1OCZ E;  3D9H A;  3CHS A;  1TNU A;  5KNH D;  4Y6W A;  5CMW A;  2L0T B;  4AM9 A;  1N54 A;  2VQ2 A;  5AYW D;  1AWC B;  4U8V D;  4JZY A;  4HOU A;  5HRY A;  5LFA A;  2P2C P;  1IQU A;  5G04 J;  1D8E A;  5LX8 A;  1HXI A;  3TWX A;  2UWJ G;  2WXN A;  4AY6 A;  4G8L A;  2LAI A;  2P9K G;  2R02 A;  4I17 A;  2IOS A;  4ILI A;  5ENP D;  5JJ7 A;  4F53 A;  3SZ7 A;  4ME2 A;  3IHY A;  3ZHE A;  3LY9 A;  2BKK B;  4UQY A;  1NA3 A;  3SI5 A;  4A3T A;  4C9B B;  5T3R A;  3CHM A;  3ABK E;  2PQN A;  3FU6 A;  3P1U A;  3S7B A;  5ENO D;  1KT0 A;  4TUM A;  4BSZ B;  3DSU A;  3PVL A;  1P5Q A;  2L6B A;  4B89 A;  3FUK A;  4KZC A;  2EIL E;  2VYI A;  2EIK E;  3W9F A;  3AG3 E;  3CR3 A;  2GRM A;  1UW4 B;  1O1S A;  4JVS A;  5CBO A;  3PUK A;  2C2L A;  3Q4A B;  4QFV A;  4KMO A;  3UXG A;  2KZT B;  2BTD A;  5AEN A;  3GW4 A;  4BEP A;  3APC A;  1SQM A;  4O60 A;  4GPK A;  4G2V A;  3NAW A;  3SNX A;  1KT1 A;  2R2L A;  4FU3 A;  4U96 D;  2GRQ B;  2XHE A;  4GA0 A;  5JA4 D;  2VGX A;  4ABN A;  3SHF A;  2CHZ A;  3UX4 A;  3OTN A;  4LCT A;  1K1B A;  2Y3A A;  3RO2 A;  3LY7 A;  4GTT A;  4UQZ A;  4I43 A;  5LCW C;  3NBN B;  4I2Z A;  1DVP A;  5C1D A;  4GYW A;  3PZ1 A;  4GCO A;  3X2Q E;  4DI3 A;  5FQ7 A;  2ZIS A;  4BTA A;  3TXN A;  3I5P A;  3JXJ A;  5FJY A;  3MZL B;  5CCM A;  3D9J A;  2V5Q C;  3FUD A;  2C0L A;  3JQ1 A;  1O5M A;  3JUI A;  3DSW A;  4DX6 D;  2X6K A;  2V4H C;  3ABL E;  3HHM A;  4XZ4 A;  5FT9 A;  1K3Z D;  1MYO A;  4PS7 A;  3DST A;  3LEW A;  3PNT B;  4WWP A;  3Q7A A;  3Q7F A;  1FPP A;  2YNQ A;  5ENS D;  3ZYM A;  3E33 A;  4FP7 A;  2RFM A;  1FT1 A;  1JUQ A;  4MS6 A;  3PZ4 A;  1E8Y A;  2XRY A;  2J4B A;  4O1P A;  3ZYK A;  4OAU C;  1TEZ A;  4JEU A;  1Y6I A;  4J0U A;  2HYZ A;  1KZO A;  5CED B;  5JJT A;  1E96 B;  2IJG X;  3MGB A;  2WVI A;  2H6F A;  3FEX A;  3IBE A;  3ESK A;  3V2O A;  3OXF A;  3RJV A;  5E75 A;  4AEZ C;  3Q47 B;  2IO3 C;  4GPM A;  3V31 A;  1LF8 A;  4HRM B;  4PUC A;  2XEN A;  4IN3 B;  3FU0 A;  3CVU A;  2WXJ A;  2YIN A;  5ENT D;  4UUC A;  1UOH A;  4U07 A;  3FTS A;  3ONL A;  2WXF A;  5JJ6 A;  3QB2 A;  3CVQ A;  1WY6 A;  2IY0 C;  1ELR A;  5E76 A;  1TNO A;  1TJC A;  4U04 A;  3Q9U C;  2MYO A;  3FTX A;  2YQ8 A;  4YVQ C;  3JQ0 A;  4EZJ A;  2OOE A;  3GYZ A;  3ASN E;  5FQ6 A;  3HDX A;  1JCS A;  4OVU A;  1N0Q A;  4ACK A;  5CRV A;  4J6I A;  4APO A;  5FQ4 A;  3AG2 E;  3JYS A;  4L23 A;  1YCS B;  3EDT B;  3EU9 A;  3SFZ A;  4CDN A;  3GZ1 A;  3CST A;  5EX0 A;  3HYM B;  2KM4 A;  2JAB A;  2GGF A;  3ZGQ A;  4J8Y A;  1O1T A;  3Q15 A;  4N2Q A;  4WNF A;  4JA9 A;  2VTB A;  4B8C B;  4JC8 A;  3CIA A;  1V54 E;  2LXM A;  1MX4 A;  3QKY A;  1S63 A;  1H6O A;  1IHG A;  3FUM A;  3I4R B;  1JWG A;  2LUH A;  4HNA D;  4U0Z A;  2LAH A;  3ZVV A;  4GYY A;  4I1O B;  2MHK A;  5CCL A;  3RRU A;  4MLP A;  5M72 A;  1WAO 1;  2R5S A;  3FUE A;  4DUI A;  1MJ0 A;  2J8S D;  3TWV A;  3O4Z A;  4XI9 A;  4A1S A;  1N4R A;  4M7C A;  3Q75 A;  4LG6 A;  3V2X A;  4CYM D;  2A5U A;  3LVQ E;  4UI9 K;  3CHQ A;  4I6G A;  2C0M A;  5CMY A;  4URK A;  3MA5 A;  3ONK A;  3SBT B;  3KD7 A;  3UI2 A;  4CT0 A;  3FFL A;  3IV0 A;  3PE3 A;  3QNK A;  4LNG A;  5BXO A;  3QJZ A;  1IXV A;  3ESL A;  2E2E A;  5CEC B;  3FTY A;  1H2T C;  2X6H A;  3HXF A;  3FH7 A;  4G26 A;  1OY3 D;  3HRA A;  3AS4 A;  4HLE A;  3FU3 A;  4J8E A;  2HR2 A;  2CHW A;  4Q69 A;  3ULQ A;  3CHP A;  2XRZ A;  4AXH A;  1DNP A;  3JXI A;  2I1K A;  1SZ9 A;  3ASG A;  4EEC A;  4FJZ A;  3CQG B;  3FTU A;  4WWN A;  4W9R A;  1N4S A;  4HRL A;  3EHQ A;  3JUE A;  3VTX A;  4ATZ D;  2A5E A;  2BED A;  1U2V G;  1WM5 A;  3EJN A;  2VSY A;  4N39 A;  3T8M A;  4UI9 J;  4OYS A;  3ZXS A;  4KBQ A;  4TXP A;  3LDZ A;  4HVB A;  3KSQ A;  4BY6 A;  3K9I A;  5G2N A;  5FZS A;  2WXI A;  2XCC A;  1EYH A;  2EQX A;  2ION A;  2XEV A;  4B0Z A;  2ZIR A;  1OWL A;  4J8F A;  4L9P A;  1ZBP A;  3C3Q A;  2LSV A;  3LJ3 A;  3NOG D;  5KJM A;  4IRU A;  3E4B A;  4A63 B;  3TWQ A;  3J5Q B;  5T4Y A;  4NAC A;  4GZC A;  5ENR D;  3QK0 A;  2J4D A;  1ELK A;  1H2U A;  5BXU A;  1K1A A;  4DI4 A;  1OWM A;  3KEA A;  2R05 A;  4N5C A;  1TNZ A;  2X38 A;  3CVY A;  5FZR A;  1LTX A;  4GB9 A;  3EIQ C;  4NIK A;  4DX5 D;  4FLB A;  2FEZ A;  4CEM A;  2GW1 A;  4HS2 A;  1SVX A;  2DZN A;  4JA7 A;  4JHR A;  4KVM A;  4N3B A;  2KZT A;  3L17 A;  3NF1 A;  1MHQ A;  3CVP A;  4DX1 A;  4O1O A;  5CBN A;  4KZ0 A;  4N3A A;  3DRA A;  2JLB A;  5J90 A;  3D9M A;  4XI0 A;  5FTP A;  2J49 A;  2L9B A;  3HXD A;  5BUZ A;  3Q73 A;  4HQD A;  1HE8 A;  3CVW A;  3LVR E;  5CER B;  1DC2 A;  2RFA A;  1KLX A;  2P9L G;  4XX5 A;  3DWL G;  3RSE G;  2L0I A;  4ANU A;  4LNU D;  4LEU A;  2XPZ A;  2IO2 C;  2YHE A;  2IU1 A;  2EIN E;  3Q49 B;  2NXP A;  5BV1 A;  3FY4 A;  3CVN A;  1SA4 A;  1OUV A;  4E6H A;  1BLX B;  2P9I G;  3SBS A;  4K5A B;  3AU5 A;  3ZYL A;  5A23 A;  1GW6 A;  4F1S A;  3ENE A;  3Q79 A;  3QWP A;  2KCL A;  2LSU A;  3PH0 C;  2WQH A;  5FIO A;  4ATG A;  4J7W A;  4GTV A;  3AU4 A;  2WPV A;  1ZB1 A;  4CRW A;  2HO1 A;  2WXP A;  3TWT A;  4M3O A;  1D8D A;  3TJP A;  1TYQ G;  2JEK A;  4IUL A;  2X6I A;  5G04 C;  5AAO A;  5A7D B;  4UWK A;  5ENQ D;  3FP3 A;  5ARF A;  1Y8M A;  5EYL A;  3U64 A;  5CHE E;  4F1P A;  4RQI A;  3URZ A;  3G2S A;  2J09 A;  2V5F A;  2DYS E;  3B7R L;  3E34 A;  5LCW J;  4YDY A;  3TXM A;  4FUL A;  3AG4 E;  2IFU A;  3LY8 A;  3UM3 A;  2DBA A;  4U8H A;  1DCE A;  5T8I A;  4F7A A;  1TN8 A;  3MYV A;  4BFR A;  2CFU A;  3PNL B;  3RAU A;  2DVW A;  3EU5 A;  1KPS B;  4FLH A;  4KYO B;  3DPD A;  4GTQ A;  5B1B E;  4K5C A;  4HOQ A;  2J07 A;  3EUV A;  3CEQ A;  4HBD A;  3HG0 D;  3J5P A;  4YND A;  4B93 B;  3B13 A;  1N9A A;  2XPY A;  2LXL A;  5CEA A;  1MX6 A;  2J9Q A;  2XGS A;  3GZS A;  1U3D A;  2GRR B;  2B0O E;  5EN5 D;  1E90 A;  1N11 A;  2IF4 A;  5G05 J;  4CZ2 D;  4G24 A;  5AN8 A;  4I1A A;  2NYJ A;  2F8X K;  3VLF A;  5BPP A;  4HFG A;  4JEH A;  3LYA A;  4I1M A;  3ASO E;  2OEV A;  3DXM G;  2Y69 E;  2XQ0 A;  3ZW3 A;  5AQA A;  4GCN A;  4UWH A;  5FQ8 A;  3MV3 B;  1QQE A;  2WMN A;  3UT8 A;  1SW6 A;  2QYJ A;  3N71 A;  2FUL A;  5D66 A;  4GYO A;  3T5X A;  3UIO C;  3D9P A;  2WXG A;  4F3V A;  3W9G A;  3QAR A;  3DXK G;  2PZI A;  4QQI A;  3HXC A;  3RO3 A;  3IXE A;  1MQS A;  4K0R A;  3UIP C;  3DSV A;  5ITZ F;  3FUH A;  4E85 A;  4ILG A;  2X3M A;  1WG0 A;  2DIW A;  3L54 A;  4RLY A;  2FO1 E;  2FO7 A;  2AVP A;  1NZN A;  2BKG A;  2ILR A;  4NQ0 A;  4PS3 A;  4TUU A;  1W3B A;  1H6P A;  2PQR A;  3DBS A;  2DCP A;  1VDY A;  2OVB A;  4GZ5 A;  4NUR A;  3PRE A;  3D9K A;  3ULY A;  1IKN D;  1ELW A;  4G25 A;  2UY1 B;  4HOR A;  3TG4 A;  3PE4 A;  3RIB A;  5JHA A;  1PY1 A;  2XGM A;  5ARG A;  4ZFH A;  1YA0 A;  2CG2 A;  3KSL A;  4UWL A;  3V30 A;  3CVL A;  4OAV B;  3DPY A;  3DEO A;  3G2T A;  1N52 A;  2M63 A;  1OT8 A;  3FDH A;  1IYG A;  3B95 A;  3CHO A;  2ETA A;  3D9O A;  2HM8 A;  4GTO A;  3LJN A;  2AXV A;  3ZRH A;  1RZ4 A;  3R9M A;  5KJK A;  2BUG A;  3PEU B;  5HI7 A;  3ASD A;  2V8S E;  1N4Q A;  1UG3 A;  4DRX E;  1YYH A;  4CDM A;  3KEZ A;  4BET A;  2XCB A;  4HLL A;  4IYP A;  4HI9 A;  3MJW A;  4U0U A;  3BG0 B;  3TG5 A;  2NC9 A;  4U8Y D;  3ZNG A;  4AIF A;  4DLO A;  5EID A;  4GMR A;  4UWG A;  1H2V C;  3E32 A;  4JD2 G;  4BTB A;  3HXB A;  3ZU7 B;  3UM2 A;  4CDR A;  5ANR A;  2H6I A;  2ZU6 B;  2PM6 A;  3L82 A;  2RKK A;  1FVF A;  1HH8 A;  3F6Q A;  3E30 A;  2GRP B;  3FTW A;  4ANX A;  4XKC A;  5EDS A;  3BG1 B;  3SFY A;  3L6A A;  3B7U X;  4N5Q A;  4EZL A;  1HS6 A;  4WNE A;  1BU9 A;  2I2O A;  3CGH A;  1SA5 A;  3ZPJ A;  4PH4 B;  4UQX A;  4G23 A;  3AS5 A;  3CKB A;  4LER A;  1QBQ A;  2FI7 A;  3ML8 A;  1QYM A;  4EPZ A;  4TXQ A;  2XZT G;  3QAQ A;  5JHB A;  3C3O A;  5EYP F;  3CVX A;  1K8K G;  4RG9 A;  3CLJ A;  4K03 A;  2QZA A;  3MKQ B;  5IY5 E;  2OCC E;  4ILH B;  4MBG A;  1QNF A;  4JPS A;  1N0R A;  1E7V A;  1TNY A;  4YDE A;  4R7L A;  3IHV A;  3L9T A;  4EQF A;  2WXK A;  3HVE B;  5FZQ A;  4JHJ A;  2AJA A;  2R17 C;  5B3S E;  5BNW A;  2VGE A;  4GZ3 A;  4GTP A;  4HXI A;  2CG3 A;  4JXT A;  4BWR A;  1TJF A;  3L13 A;  3SGH A;  2XZD G;  5AQB A;  1UN8 A;  4CGV A;  4U95 D;  1OWO A;  4GTM A;  4PS8 A;  1BPO A;  3OXL A;  2NSZ A;  1XGW A;  4KT6 B;  5G55 A;  3FUI A;  4CGW A;  4GZD A;  2WXM A;  5EIL A;  3ZXP A;  3QWV A;  4KXK B;  2V0P A;  1E7U A;  3HXE A;  4YVO A;  2CFZ A;  3T5V A;  1IHB A;  3R7R A;  3VLE A;  2Y0B G;  2CHX A;  2AXZ A;  1EDU A;  4A55 A;  3NZU A;  5BV0 A;  2ZGD A;  4UI9 C;  4BX9 A;  1LD8 A;  3LXU X;  4J8D A;  2MRI A;  4HI8 A;  4FA6 A;  3UMV A;  2X6J A;  3ZKJ A;  2XEE A;  4D10 C;  3SY2 A;  1Z6T A;  2Y1L E;  3TAX A;  1OCC E;  4JHK A;  2KC7 A;  3PRZ A;  4GU5 A;  3MEK A;  1B89 A;  3FHE A;  1OWP A;  3FWV A;  3C5R A;  1BI7 B;  4XIF A;  4JW1 A;  3U66 A;  4LUN U;  4KVO A;  3Q9N C;  2R03 A;  3NQP A;  5FWQ A;  2I6H A;  2RG8 A;  2WQ6 A;  5AIJ A;  4EZK A;  1PC2 A;  2X6F A;  2WXQ A;  4U63 A;  2WQ7 A;  5HKP A;  2WXO A;  1IQR A;  3ULE G;  4GA2 A;  2I1J A;  1BI8 B;  3B7T A;  3NZS A;  1MX2 A;  3C3R A;  3I3N A;  3CVV A;  3QC1 A;  2KXP C;  5LP0 A;  3FUJ A;  1HO8 A;  1E8X A;  3PZ2 A;  3HIZ A;  4MKT A;  4BT8 A;  4U0S A;  4A3V A;  4C0E A;  3SO8 A;  4CCA A;  3QOU A;  5D0Q D;  5B1A E;  3T8K A;  1PAQ A;  4GTR A;  2QFC A;  3UKR G;  3L08 A;  5KBA A;  4FHJ A;  3AAA C;  2GRN B;  3AJI A;  3DSX A;  3ZFW A;  1HZ4 A;  3LCA A;  4I2W A;  2XPI A;  4B8A A;  2OND A;  4AVX A;  4WNG A;  3G2W A;  1AP7 A;  3FU5 A;  1E8W A;  4H7X A;  5AQ9 A;  3ZUV B;  4L7T A;  4I9C A;  4HOT A;  4WAF A;  3DSS A;  2VGY A;  3QDN A;  2Y4U A;  3WXX A;  1OWN A;  3WG7 E;  3KS2 A;  2J08 A;  1UJK A;  4JB8 P;  1EPU A;  1N94 A;  4WUY A;  1UJJ A;  4J8S A;  4B94 A;  1BD8 A;  1TN6 A;  1JPL A;  4GTS A;  3MX3 A;  4FHK A;  3FUF A;  3FEY A;  2EIJ E;  4WWO A;  1TR4 A;  1MZC A;  3O48 A;  4YDW A;  4DPR A;  1HG5 A;  1D9S A;  2OVF A;  4BES A;  3ASH A;  5HQ8 A;  4ANW A;  4BX8 A;  4L1B A;  3S2A A;  3E37 A;  3U4T A;  4ACL A;  1HFA A;  4A1G A;  2UY1 A;  2F0Y A;  2LO6 A;  4N3C A;  1JCQ A;  4JL0 A;  2WM9 A;  1X5B A;  3PEV B;  3ASF A;  2F37 A;  4GAA A;  4WND A;  2P9P G;  2L6J A;  5KJN A;  3MKR A;  4F6R D;  2FF4 A;  3MV2 B;  3BQO A;  3SFX A;  3UQ3 A;  3TWU A;  3BEE A;  4BT9 A;  3ZHE B;  4AP2 A;  2FBN A;  1G3N B;  4GML A;  5BT1 A;  3ZIM A;  1JWF A;  4DX2 A;  3CV0 A;  4PDX A;  3UIN C;  5JMN D;  4X8Q A;  5D0O D;  1H6K A;  2GRL A;  3S7J A;  2WB2 A;  3RU0 A;  1S0P A;  1Q2Z A;  5G05 C;  1L5J A;  4AOF A;  1YMP A;  1FCH A;  4LSZ E;  1HF8 A;  5KNG A;  4Z68 A;  4APF A;  3LS8 A;  3CSF A;  4XE0 A;  1N95 A;  1OCO E;  2EIM E;  4U7E B;  2I9C A;  1Z3X A;  4O6F A;  3MCX A;  4C0M A;  2KCV A;  3CKC A;  3UUX A;  3U9W A;  5EKQ D;  5DBK A;  1LD7 A;  1NA0 A;  3CQC B;  1HG2 A;  2VGX B;  2KCK A;  5AQ7 A;  3EHM A;  4RVB A;  4FAD A;  3D9I A;  3NOC D;  4FC8 A;  3TWR A;  2IOL A;  1V55 E;  3BUA A;  5KJL A;  2DWZ A;  3UTM A;  1H0A A;  5EIB E;  5FIN A;  3UM0 A;  3Q5M A;  2LNI A;  2P9N G;  4XKB A;  4AV7 A;  1H19 A;  4AY5 A;  5BW8 C;  2WMO A;  2F8Y A;  3OXG A;  5H7P A;  4H7Y A;  3UT4 A;  3EHN A;  5CRU A;  2A4Z A;  2H6G A;  4N2S A;  3IEG A;  1OCR E;  4LNB A;  2OEW A;  1NI1 A;  4ANV A;  3MKQ A;  3ISM C;  2MOW A;  2XS8 A;  5AJD A;  2AW6 A;  3AG1 E;  1NL4 A;  4OVV A;  3G2U A;  3S7D A;  3B7S A;  1TN7 A;  2PNN A;  3RRN B;  1O1R A;  2ZGG A;  3APF A;  3HVE A;  3L16 A;  2YHC A;  4BSX A;  4V3I A;  4GZ6 A;  1N4P A;  5HS0 A;  5EX3 A;  4Y6C A;  4EBA G;  1JCR A;  2V4L A;  4RG6 A;  2ETC A;  4G8K A;  5C2Y A;  1EF1 C;  4HB5 A;  3R9A B;  4C48 B;  2AWI A;  4I9E A; 
#chains in the Genus database with same CATH homology
 3SFY A;  4GTV A;  3HXE A;  2H6H A;  3DST A;  3E37 A;  3Q7A A;  3Q7F A;  1FPP A;  1O1T A;  3E33 A;  4YDO A;  1SA5 A;  1FT1 A;  3KSL A;  1N4S A;  1TNU A;  2F0Y A;  3PZ4 A;  1LD7 A;  1D8D A;  2R2L A;  1S64 A;  3PZ2 A;  1JCQ A;  3DPY A;  1QBQ A;  1S63 A;  1LD8 A;  2BED A;  1KZO A;  1FT2 A;  3DRA A;  1D8E A;  3PZ3 A;  1X81 A;  4GTR A;  2H6F A;  3E34 A;  4EHM A;  4GTO A;  3SFX A;  3HXD A;  3Q73 A;  3HXC A;  3KSQ A;  1DCE A;  3Q78 A;  4GTT A;  4MBG A;  1TN8 A;  2H6G A;  3DSX A;  4LNB A;  1N4Q A;  3DSV A;  1TNY A;  1N4R A;  1NI1 A;  4YDE A;  3EU5 A;  3Q75 A;  2ZIR A;  3PZ1 A;  4L9P A;  1KZP A;  4GTQ A;  1TNO A;  1NL4 A;  3DSS A;  1TN7 A;  1O1R A;  4GTP A;  3EUV A;  2ZIS A;  1SA4 A;  1TNB A;  2IEJ A;  3DSU A;  4LNG A;  3C72 A;  3E32 A;  1N94 A;  4GTM A;  1JCS A;  3HXB A;  1N4P A;  1N9A A;  1TN6 A;  4GTS A;  1JCR A;  3Q79 A;  1TNZ A;  2H6I A;  1O1S A;  1O5M A;  1N95 A;  1LTX A;  3HXF A;  3E30 A;  3DSW A;  1MZC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...