2H6IA

W102t/y365f protein farnesyltransferase double mutant complexed with a geranylgeranylated ddptasacvls peptide product at 3.0a
Total Genus 131
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
131
sequence length
315
structure length
315
Chain Sequence
FVSLDSPSYVLYRDRAEWADIDPVPQNDGPNPVVQIIYSDKFRDVYDYFRAVLQRDERSERAFKLTRDAIELNAANYTVWHFRRVLLKSLQKDLHEEMNYITAIIEEQPKNYQVWHHRRVLVEWLRDPSQELEFIADILNQDAKNYHAWQHRQWVIQEFKLWDNELQYVDQLLKEDVRNNSVWNQRYFVISNTTGYNDRAVLEREVQYTLEMIKLVPHNESAWNYLKGILQDRGLSKYPNLLNQLLDLQPSHSSPYLIAFLVDIYEDMLENQCDNKEDILNKALELCEILAKEKDTIRKEYWRYIGRSLQSKHST
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protein farnesyltransferase/geranylgeranyltransferase type I
publication title Conversion of protein farnesyltransferase to a geranylgeranyltransferase.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 131
structure length 315
sequence length 315
ec nomenclature ec 2.5.1.58: Protein farnesyltransferase.
pdb deposition date 2006-05-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01239 PPTA Protein prenyltransferase alpha subunit repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.120 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Protein prenylyltransferase 2h6iA00
1JCQA 3HXEA 2F0YA 2R2LA 2H6GA 1LD7A 1LD8A 3DSSA 2H6IA 1N4RA 1D8DA 1TN7A 2ZISA 1TNZA 3Q73A 4EHMA 1N4PA 4GTPA 3PZ1A 3DSWA 1FT2A 1MZCA 3DPYA 4L9PA 3HXDA 3Q75A 1D8EA 3DRAA 3E37A 1FT1A 1O1RA 3Q7AA 1JCRA 1N94A 1S64A 1TNUA 4YDEA 3HXBA 3KSQA 4GTTA 3PZ4A 4GTQA 1NI1A 1TNYA 1KZPA 1KZOA 1O1TA 1LTXA 2H6HA 1N4SA 3DSTA 1N9AA 3HXFA 4MBGA 1FPPA 3E33A 1DCEA 2ZIRA 4GTOA 1TN6A 1TN8A 3KSLA 4LNBA 1N4QA 3DSUA 3Q79A 1N95A 1X81A 1NL4A 3EUVA 3Q7FA 4GTRA 3HXCA 3E30A 2IEJA 2H6FA 1O1SA 1SA4A 4GTVA 3DSVA 2BEDA 3SFXA 3E32A 3Q78A 1JCSA 4GTSA 1QBQA 3PZ3A 4YDOA 1SA5A 4GTMA 1TNBA 1TNOA 4LNGA 3SFYA 3C72A 3E34A 1S63A 3DSXA 3PZ2A 1O5MA 3EU5A
chains in the Genus database with same CATH superfamily
3MYVA 4ANXA 4U63A 2XQ0A 2DZNA 5FQ8A 2VSXE 1OXJA 2ZISA 3FWVA 4GZCA 3TXMA 2VSNA 2NSZA 3D9HA 3RU0A 3BQOA 3UXGA 2AXZA 2FO1E 1H2VC 3D9PA 4HOTA 2VGYA 5CECB 2GRPB 3FEXA 4YDEA 3CIAA 1NFIE 3CV0A 1DC2A 3K9IA 5AIJA 4HQDA 1A5EA 5EYPF 3QJZA 3UIPC 2I9CA 3MV3B 1UJJA 3QDNA 3L22A 1FPPA 3SBTB 1TN8A 2WXMA 3TXNA 4TUMA 4EQFA 3Q49B 3ZPJA 3U9WA 4J8DA 3FU0A 3PNLB 1MJ0A 4N3BA 1HU3A 3ABKE 3UIOC 2V5FA 3MKQB 3UINC 4GZDA 4YVQC 2QYJA 3B95A 3FEYA 5ENOD 2OCCE 3CSTA 3UM0A 3FU3A 2M63A 3R9MA 4BETA 4JHJA 4TXPA 4AVXA 1Z6TA 4HLEA 3DSSA 2RKKA 2OV8A 1SVXA 1OWMA 1BPOA 4X8QA 4G11A 3UKRG 2F37A 4LEUA 4NIKA 5ANLA 1H6KA 5AAOA 3LKUA 1SZ9A 3HVEB 3VTYA 2I6HA 3ESLA 2J8SD 4HOSA 4U96D 2I2OA 1OCCE 2Q7FA 2X6JA 3JQ1A 5FT9A 2QYUA 2AXVA 3KEAA 3RRMB 2RG8A 3SY2A 3B7BA 3L9TA 1G3NB 3L16A 1IQUA 1HXIA 4U0ZA 3SI5A 3CHQA 4O60A 1LTXA 4UWLA 4C48B 4XKBA 4K03A 1BD8A 1UN8A 4GYYA 2J49A 3MJWA 3UX4A 3R7RA 2X6KA 1X81A 2CFZA 3ZGQA 5CMWA 1E7UA 3QWWA 4PS7A 4FLBA 3SNXA 3D9OA 1K8KG 2BEDA 1HH8A 3MA5A 2AW6A 3FY4A 3AU4A 3HDXA 5AENA 3V79K 3ONKA 4UWKA 1NA3A 3LXUX 4ME2A 3I4RB 5G05C 4WNGA 2XENA 1WG0A 3ASGA 4YDYA 4CDMA 4EZLA 1S63A 4GB9A 3C5RA 1Q2ZA 3EU5A 2LXMA 1FVFA 3LY8A 4GAAA 5KCMA 2WXKA 4F1PA 3CVQA 3T8MA 1D9SA 5AJDA 1P5QA 4I1MA 3C3OA 4GU5A 2OEVA 2IFUA 4DX7D 3ML8A 1QQEA 4FU3A 3ISMC 1TEZA 4Z68A 2PQNA 3CVXA 1A17A 2LSUA 4M3OA 1IHGA 4GTTA 1NI1A 3WG7E 4L1BA 1UN9A 3F6QA 3CGHA 3T8KA 1TN6A 4ATGA 2L0TB 1SW6A 2A5EA 3VTXA 5EDSA 3ONLA 2IEJA 4FHJA 2BKKB 3TWSA 4FULA 1S0PA 2FO7A 2YNQA 4HRNA 4TV3A 2KBXA 4XI9A 1H6OA 3R9AB 3QAQA 1IHBA 4CEMA 3D9MA 4OYSA 1HX8A 1HG5A 1O5MA 1OCRE 4FJZA 4ZHBA 2WXFA 3HXEA 5ENNA 1RW2A 2GRRB 3IHYA 4K5CA 3S7FA 1OWNA 4B0ZA 5J08A 4JD2G 1TNZA 4GA0A 2WXQA 2LNIA 4GPKA 3OXFA 4Q69A 2IY0C 2DCPA 3ASFA 5DBKA 1ELWA 1EYHA 2IO3C 3IXEA 4WNEA 1O1RA 2IF4A 4G24A 1TJCA 2HR2A 1MX2A 4I1OB 4WWNA 1NA0A 3IBEA 3FUNA 5FINA 4WAFA 4N2QA 2VQ2A 5KNGA 2BTDA 1INZA 3FTVA 1H2TC 4BESA 3G2UA 1Z5SC 5G2NA 3QC1A 1NP7A 1N9AA 4K5BA 3T5VA 3ZIMA 4MBGA 4WWPA 3LY9A 4U0SA 1N0RA 1N4QA 3Q79A 4HRMB 5FTPA 2I1JA 5CBNA 3HXCA 2VTBA 4FHKA 2DYSE 4JC8A 3S2AA 4LERA 4N39A 2R5SA 2Y4TA 2GRLA 3QWVA 1Y8MA 1OUVA 5CRUA 3ZYKA 3S7JA 4AV7A 4U8YD 2L6BA 3DSXA 4L23A 1H2UA 1PC2A 3ZW3A 1OY3D 2F0YA 1UW4B 4L7TA 3TWQA 4CYMD 4Q94A 5DIZA 4W9RA 1D8DA 1TN7A 3DBSA 3FUJA 5ENRD 4IRUA 4HB5A 5CEAA 2PNNA 1EPUA 3RAUA 3DSWA 5LCWJ 2R05A 3BU8A 5JJ7A 5G04C 1FT1A 3FU6A 5HI7A 3NF1A 3Q7AA 1S64A 4RQIA 3W9FA 1BI7B 3T9KA 2XEEA 3TWXA 1E96B 3CKCA 3Q9NC 1QZ2A 1K3ZD 4GZ3A 4JHKA 3KEZA 4EPZA 3ZYQA 2IU1A 4ZFHA 2QFCA 2DZOA 4CCAA 2YINA 3PUJA 4B8AA 4HRLA 3CVNA 3ZHEA 4UWFA 1O1SA 1TJFA 3SZ7A 2BUGA 4F6RD 4YDWA 3UT8A 3FUDA 3E32A 3UM1A 2GRQB 1U3DA 1HF8A 1TNOA 1VDYA 3C3RA 3RKVA 1GW6A 1YMPA 4ANVA 4XKCA 2RFAA 5D0OD 4JL0A 1JWGA 2KATA 5BNWA 2H6IA 3UPVA 5C1DA 4L2LA 2XHEA 4LSZE 4GTPA 4ATZD 3CK9A 3QOUA 4A1GA 3HXDA 1D8EA 4GCNA 5E76A 4NACA 1SQMA 4E6HA 5EYLA 3V30A 2ZGDA 3W9GA 3CVUA 5A6CA 2CG3A 5JHBA 1BI8B 3RJVA 4O6FA 5BT1A 3MV2B 3AG4E 4I9EA 4HOUA 1E8ZA 2XZDG 1MYOA 3JXIA 3TWRA 1IKND 2CHXA 3EHNA 4AEZC 3FH5A 3IHVA 5JA4D 2XS8A 4LNUD 1BU9A 4KT6B 3PEUB 3I3NA 3G2TA 2B0OE 2I1KA 1B89A 4A3TA 4PH4B 4XIFA 2AXUA 2WQHA 4GMRA 4DX5D 2LXLA 2DYRE 3NBNB 2XS1A 5KJLA 2MYOA 3RO3A 2XZTG 5FZRA 4G26A 3FFLA 2CG2A 2P9IG 4UUCA 1BLXB 3OXLA 2J9QA 1IQRA 1U2VG 3FDHA 4RG9A 3I4GA 3EDTB 2KXPC 3PDNA 2WXIA 3PNTB 4DJAA 1MX6A 2PM6A 3APFA 2X3MA 3HG0D 4U95D 5FQ4A 1AP7A 2WMOA 4CRWA 3FUKA 4YVOA 2OOEA 4LG6A 3NQPA 4GPMA 4GMLA 2IJGX 2WXLA 1OCOE 3EHRA 4PS3A 4J8EA 3KSLA 4DRXE 4KVOA 4LNBA 4KVMA 4NRHB 3ULEG 4AJWA 4BERA 5EX3A 5B3SE 2AWIA 5EILA 3ZU7B 3FTZA 4ILHB 3ZNGA 3ZEFA 3Q4AB 1WDYA 4J8SA 4GTSA 3U66A 3BG0B 4EZJA 2VTBB 1QYMA 2KCVA 4CT4A 5ENQD 1Z3YA 4B8CB 3SHFA 2VYIA 4P29A 4YNDA 5EIDA 1HZ4A 4G25A 2F8XK 3JQ0A 2R59A 5LX8A 3AG3E 1LD7A 2UY1A 5AQ7A 3T5XA 2DWZA 4R7LA 4Y6WA 1YA0A 2CHZA 1MZCA 3PUKA 2WB2A 1E90A 2ETAA 3DPYA 4APOA 4KZCA 3TWUA 3LY7A 3ZXPA 4O1PA 2GRNB 4TRQA 1E7VA 2F8YA 3EIQC 2IO2C 5HRYA 1N94A 4CDRA 4XI0A 2BF0X 2X6IA 1OWPA 4ACLA 3GYZA 3EJNA 2P9KG 3JCKC 1H0AA 1TNYA 5KNHD 3SO8A 2V4LA 3CVVA 4PS8A 3RO2A 2XRZA 4GTOA 2YHCA 4UI9C 5LOZA 2J4DA 3CQGB 4J7WA 3UM2A 3E30A 4HNAD 3C3QA 5CRVA 5AJLA 3SFXA 5G05J 1OT8A 3VLDA 4YDOA 3ZHEB 4DX6D 4GZ5A 1HO8A 3V2OA 5BPPA 1TNBA 4K0RA 3DXKG 3PZ2A 3CQCB 4DX2A 4FJYA 4FA6A 2R2LA 4BSZB 3MX3A 3AU5A 2WXPA 2VSYA 3GZ2A 3ULQA 4EHMA 2XGOA 1OWLA 2HM8A 3PZ1A 3S7BA 4RVBA 2EIJE 2PQRA 2ZU6B 4M7CA 4L9PA 4BFRA 3FTSA 1N52A 5CMYA 3FTYA 1WY6A 4J8YA 3VLEA 3CKBA 3FH8A 3O4ZA 1JCRA 1TNUA 3OAWA 4JW1A 5ITZF 4ILIA 2XRYA 4CGVA 3CSFA 1E8YA 3DXMG 3FUEA 3UUXA 5H7PA 3KSQA 2XGSA 4AIFA 3DEOA 3RRNB 2WXNA 3JXJA 2EIKE 2YHEA 2A4ZA 4LCTA 4EECA 1JPLA 4EBAA 3DSUA 3UTMA 4GTRA 3Q7FA 3RIBA 3HYMB 4JZYA 2HE0A 4G8KA 4DI4A 5JHAA 2C2LA 2NXPA 3SD5A 2QY7A 1SA5A 1KPSB 4GTMA 3FUMA 4C0MA 4L2YA 3NAWA 3CHMA 4AY6A 4FC8A 4KMOA 1AWCB 3SFZA 3ZFWA 4UQZA 1JCQA 5LCWC 3OTNA 4GYOA 2J07A 3URZA 3AS4A 2C0LA 4ABNA 2FBNA 3RK6A 4HLLA 2HO1A 5ANRA 1FCHA 2X6FA 3C98A 3NOGD 2V0PA 3CR3A 5CHEE 3LPZA 3JUIA 3LYAA 4MS6A 2OVFA 2WXRA 4B93B 5IY5E 4TUUA 4GTQA 1YYHA 2OVBA 1UOHA 4BT9A 3UM3A 2CHWA 3FULA 3HXFA 3OXGA 4I2ZA 3E33A 2EINE 3VLFA 4JPSA 5KWDA 2NYJA 1E8WA 3UQ3A 5CEDB 1N95A 4JB8P 5KJMA 4HXIA 5T4YA 3FH7A 1HE8A 3LVRE 2H6FA 3LVQE 3CLJA 5LP0A 2WVIA 1TYQG 2DBAA 5BV1A 1QNFA 4N3CA 1JCSA 5T3RA 5CCLA 1V54E 4BTBA 3HHMA 2KCKA 3PEVB 1SZAA 4GZ6A 3DEPA 3SFYA 2E2EA 4I43A 3DPDA 4JVSA 4TXRA 3ZYMA 4HI8A 4HOQA 2MHKA 3ML9A 3NOCD 2WMNA 4FLHA 4B89A 4DK5A 3MEKA 1MQSA 5G04J 3CHSA 4Q96A 5CCMA 4GMJA 3LS8A 5FQ7A 3CK8A 4HBDA 3GZSA 1K1AA 2UY1B 3BUAA 4BTAA 2EILE 3CHPA 3UT4A 4I2WA 4HVBA 3Q5MA 4JXTA 5HQ8A 1IYGA 2L0IA 4UQYA 3ZRHA 1OWOA 3FHEA 3MZLB 4DLQA 2Y4UA 1ELKA 4XE0A 3DSTA 4OVUA 4XZ4A 5AQ9A 3L6AA 1W3BA 5ARGA 2WQ6A 2VSOE 3FP3A 3PS6A 1IXVA 3NZSA 1N54A 2IOSA 3UMVA 1XGWA 4AM9A 4GCOA 5AN8A 2ETBA 3DSVA 3GW4A 5D2MC 3SBSA 3ASHA 2FF4A 4EBAG 3AS5A 3LEWA 3MGBA 4ANWA 2XGMA 2XPZA 2P9LG 3C72A 4J6IA 4D10C 1JWFA 5BV0A 3L54A 3RSEG 1K1BA 2R02A 3TWWA 1Z3XA 2A5UA 5BUZA 4A63B 3B7TA 3ENEA 4G2VA 4IYPA 4ILGA 3CK7A 3KS2A 3TG5A 1UJKA 4F3VA 3HIZA 3APDA 3EU9A 4URKA 4KYOB 2KCLA 3AG2E 4OVVA 5JJ6A 4MLPA 2OEWA 3L13A 4J8FA 2C0MA 1RZ4A 3CVWA 4N3AA 4U04A 3PZDA 1HFAA 4B94A 2WQ7A 5D0QD 4H7XA 4UWGA 5HS0A 2KC7A 1Y6IA 5FJYA 3PVLA 4I6GA 4JA7A 1KZOA 4DX1A 3D9LA 1WM5A 2MRIA 4HS2A 2Y3AA 2J08A 3HRAA 3FTUA 2NC9A 2J4BA 4OAUC 2Y69E 3CHRA 2AVPA 3B13A 1NL4A 2GGFA 3U4TA 4F53A 3SQVA 3SGHA 3Q78A 1QBQA 1EDUA 1KT1A 1WAO1 3GZ1A 4I17A 4XX5A 5ENTD 2LO6A 2P58C 3B7RL 4K5AB 4LNGA 3L17A 2DVWA 2LSVA 5KBAA 3ULYA 1MHQA 3EIJA 5FQ6A 2FULA 1PAQA 4WNDA 2RFMA 1EF1C 3ESKA 4I6JA 3LJ3A 4APFA 3O48A 3PE3A 4CZ2D 3ZN3A 3ZKJA 3Q47B 4UI9K 3QNKA 4C9BB 4DI3A 4DLOA 2QZAA 3N71A 4HI9A 4LUNU 3RRUA 3LJNA 3CVLA 5JJTA 3HXBA 3QWPA 3D9NA 3LCAA 4RG6A 4N2SA 3TGOA 3D9IA 5BXOA 5JMND 3JYSA 4N5CA 4CGWA 3TWTA 2VGXA 2GW1A 1NZNA 3J5PA 5AARA 2J09A 3FU5A 2KZTA 3KD7A 3AS8A 1DCEA 2IOLA 4G1TA 3R7QA 4QFVA 5EKQD 3SF4A 4DPRA 3Q15A 5FZSA 4TXQA 3UKUG 4I9CA 3FUIA 3DWLG 5A23A 4DUIA 2L9BA 1SA4A 3L82A 5EX0A 3X2QE 3CHOA 1X5BA 3MKRA 5FZQA 3FUFA 1PY1A 3APCA 3U64A 2R17C 2V8SE 2FEZA 1MX4A 3PH0C 2XEVA 3P2BA 1LF8A 2IONA 3E34A 4AP2A 4NQ0A 2WXHA 4WNFA 4GA2A 4Y6CA 4AXHA 2JEKA 3IV0A 5FWQA 4U7EB 1N4RA 3MCXA 3PE4A 4I1AA 2LAIA 3IEGA 4J0UA 3V2XA 4KBQA 4WUYA 2RD0A 2WM9A 3PREA 4V3IA 2IQCA 2VJ8A 2XPIA 3CVPA 1FVHA 2B6CA 2PM7A 4ACKA 4A1SA 2WXGA 3TAXA 4IN3B 3TL5A 3G2SA 2R03A 5HKPA 3U3WA 4U0UA 3B7SA 3TJPA 2DIWA 3D9JA 1H6PA 4UWHA 3ASDA 5C2YA 3AJIA 2EQXA 3NZUA 1ZB1A 5AQBA 2XCCA 4UI9J 1N11A 3PZ4A 5BW8C 5FIOA 5M72A 5B1AE 4WWOA 4EZKA 3I5PA 3MKQA 3UT7A 2JLBA 2V5QC 4ANUA 2FI7A 3LDZA 2E0IA 4KZ0A 3TG4A 3QKYA 3FUHA 3KAEA 2WXOA 5AQAA 2WPVA 3ASNE 3TWVA 2CFUA 4F7AA 3WXXA 2P9PG 3PZ3A 4G23A 2AJAA 3QB2A 4O1OA 2ZGGA 3E4BA 1XNFA 4FADA 4U8VD 4C0EA 2BKGA 4NURA 4A3VA 2PL2A 4XEIG 2XEHA 2WXJA 3G2WA 2JABA 4I6EA 5B1BE 1V55E 3D3MA 3HVEA 1YCSB 3Q9UC 4MKTA 4RLYA 4BX9A 2ONDA 5CBOA 1HG2A 3Q75A 4AY5A 2ETCA 3QK0A 5E75A 3ZUVB 2LAHA 1TR4A 4GA1A 4UQXA 5A7DB 3JUEA 4JHRA 4A55A 5BXUA 1HS6A 3ABLE 2QC9A 1O1TA 2H6HA 1N4SA 2ZXWE 3P1UA 5T8IA 2ZIRA 5KJNA 3FTXA 3CVYA 3BEEA 2XCBA 4BSXA 3QARA 3UI2A 3ABME 3J5QB 1JUQA 2GROB 1DCQA 1N0QA 4GTVA 3NB2A 4BX8A 4BEPA 5LFAA 1L5JA 3G2VA 1DNPA 2Y0BG 4KXKB 2UWJG 2X38A 4MRUA 1ZU2A 4RSYA 3ZXSA 4HORA 3BG1B 4F1SA 4FP7A 4OAVB 2H6GA 1UG3A 1LD8A 4JA9A 1H19A 2HYZA 2X6HA 5ENSD 1ELRA 1E8XA 4LRZA 2PZIA 3EHQA 4H7YA 1DVPA 3Q73A 5CERB 2XPYA 1KLXA 2GRMA 1N4PA 1U3CA 3AG1E 2Y1LE 3AAAC 2P9SG 4HFGA 5J90A 4G8LA 1FT2A 4N5QA 2P9NG 3DRAA 5ARFA 3E37A 3S7DA 3CEQA 4BT8A 3EHMA 3D9KA 3ASOE 4CDNA 5EIBE 4BY6A 4U8HA 5D66A 3V31A 4GYWA 4IULA 4U07A 1OCZE 1KZPA 4PUCA 5EN5D 5KJKA 4JEUA 4E85A 5G55A 4AOFA 2VGXB 2KM4A 3EUVA 2P2CP 3B7UX 3ZVVA 4CT0A 1S70B 5AYWD 2KZTB 2MOWA 4BWRA 2V4HC 2YQ8A 2EIME 3L08A 4PDXA 2VGEA 3PRZA 4JEHA 3IKOB 1KT0A 4QQIA 1ZBPA 3FTWA 2ILRA 3ZYLA 2P9UG 2LUHA 5ENPD 2L6JA
chains in the Genus database with same CATH topology
1JCQA 3HXEA 2F0YA 2R2LA 2H6GA 1LD7A 1LD8A 3DSSA 2H6IA 1N4RA 1D8DA 1TN7A 2ZISA 1TNZA 3Q73A 4EHMA 1N4PA 4GTPA 3PZ1A 3DSWA 1FT2A 1MZCA 3DPYA 4L9PA 3HXDA 3Q75A 1D8EA 3DRAA 3E37A 1FT1A 1O1RA 3Q7AA 1JCRA 1N94A 1S64A 1TNUA 4YDEA 3HXBA 3KSQA 4GTTA 3PZ4A 4GTQA 1NI1A 1TNYA 1KZPA 1KZOA 1O1TA 1LTXA 2H6HA 1N4SA 3DSTA 1N9AA 3HXFA 4MBGA 1FPPA 3E33A 1DCEA 2ZIRA 4GTOA 1TN6A 1TN8A 3KSLA 4LNBA 1N4QA 3DSUA 3Q79A 1N95A 1X81A 1NL4A 3EUVA 3Q7FA 4GTRA 3HXCA 3E30A 2IEJA 2H6FA 1O1SA 1SA4A 4GTVA 3DSVA 2BEDA 3SFXA 3E32A 3Q78A 1JCSA 4GTSA 1QBQA 3PZ3A 4YDOA 1SA5A 4GTMA 1TNBA 1TNOA 4LNGA 3SFYA 3C72A 3E34A 1S63A 3DSXA 3PZ2A 1O5MA 3EU5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1JCQ A;  3HXE A;  2F0Y A;  2R2L A;  2H6G A;  1LD7 A;  1LD8 A;  3DSS A;  2H6I A;  1N4R A;  1D8D A;  1TN7 A;  2ZIS A;  1TNZ A;  3Q73 A;  4EHM A;  1N4P A;  4GTP A;  3PZ1 A;  3DSW A;  1FT2 A;  1MZC A;  3DPY A;  4L9P A;  3HXD A;  3Q75 A;  1D8E A;  3DRA A;  3E37 A;  1FT1 A;  1O1R A;  3Q7A A;  1JCR A;  1N94 A;  1S64 A;  1TNU A;  4YDE A;  3HXB A;  3KSQ A;  4GTT A;  3PZ4 A;  4GTQ A;  1NI1 A;  1TNY A;  1KZP A;  1KZO A;  1O1T A;  1LTX A;  2H6H A;  1N4S A;  3DST A;  1N9A A;  3HXF A;  4MBG A;  1FPP A;  3E33 A;  1DCE A;  2ZIR A;  4GTO A;  1TN6 A;  1TN8 A;  3KSL A;  4LNB A;  1N4Q A;  3DSU A;  3Q79 A;  1N95 A;  1X81 A;  1NL4 A;  3EUV A;  3Q7F A;  4GTR A;  3HXC A;  3E30 A;  2IEJ A;  2H6F A;  1O1S A;  1SA4 A;  4GTV A;  3DSV A;  2BED A;  3SFX A;  3E32 A;  3Q78 A;  1JCS A;  4GTS A;  1QBQ A;  3PZ3 A;  4YDO A;  1SA5 A;  4GTM A;  1TNB A;  1TNO A;  4LNG A;  3SFY A;  3C72 A;  3E34 A;  1S63 A;  3DSX A;  3PZ2 A;  1O5M A;  3EU5 A; 
#chains in the Genus database with same CATH topology
 3MYV A;  4ANX A;  4U63 A;  2XQ0 A;  2DZN A;  5FQ8 A;  2VSX E;  1OXJ A;  2ZIS A;  3FWV A;  4GZC A;  3TXM A;  2VSN A;  2NSZ A;  3D9H A;  3RU0 A;  3BQO A;  3UXG A;  2AXZ A;  2FO1 E;  1H2V C;  3D9P A;  4HOT A;  2VGY A;  5CEC B;  2GRP B;  3FEX A;  4YDE A;  3CIA A;  1NFI E;  3CV0 A;  1DC2 A;  3K9I A;  5AIJ A;  4HQD A;  1A5E A;  5EYP F;  3QJZ A;  3UIP C;  2I9C A;  3MV3 B;  1UJJ A;  3QDN A;  3L22 A;  1FPP A;  3SBT B;  1TN8 A;  2WXM A;  3TXN A;  4TUM A;  4EQF A;  3Q49 B;  3ZPJ A;  3U9W A;  4J8D A;  3FU0 A;  3PNL B;  1MJ0 A;  4N3B A;  1HU3 A;  3ABK E;  3UIO C;  2V5F A;  3MKQ B;  3UIN C;  4GZD A;  4YVQ C;  2QYJ A;  3B95 A;  3FEY A;  5ENO D;  2OCC E;  3CST A;  3UM0 A;  3FU3 A;  2M63 A;  3R9M A;  4BET A;  4JHJ A;  4TXP A;  4AVX A;  1Z6T A;  4HLE A;  3DSS A;  2RKK A;  2OV8 A;  1SVX A;  1OWM A;  1BPO A;  4X8Q A;  4G11 A;  3UKR G;  2F37 A;  4LEU A;  4NIK A;  5ANL A;  1H6K A;  5AAO A;  3LKU A;  1SZ9 A;  3HVE B;  3VTY A;  2I6H A;  3ESL A;  2J8S D;  4HOS A;  4U96 D;  2I2O A;  1OCC E;  2Q7F A;  2X6J A;  3JQ1 A;  5FT9 A;  2QYU A;  2AXV A;  3KEA A;  3RRM B;  2RG8 A;  3SY2 A;  3B7B A;  3L9T A;  1G3N B;  3L16 A;  1IQU A;  1HXI A;  4U0Z A;  3SI5 A;  3CHQ A;  4O60 A;  1LTX A;  4UWL A;  4C48 B;  4XKB A;  4K03 A;  1BD8 A;  1UN8 A;  4GYY A;  2J49 A;  3MJW A;  3UX4 A;  3R7R A;  2X6K A;  1X81 A;  2CFZ A;  3ZGQ A;  5CMW A;  1E7U A;  3QWW A;  4PS7 A;  4FLB A;  3SNX A;  3D9O A;  1K8K G;  2BED A;  1HH8 A;  3MA5 A;  2AW6 A;  3FY4 A;  3AU4 A;  3HDX A;  5AEN A;  3V79 K;  3ONK A;  4UWK A;  1NA3 A;  3LXU X;  4ME2 A;  3I4R B;  5G05 C;  4WNG A;  2XEN A;  1WG0 A;  3ASG A;  4YDY A;  4CDM A;  4EZL A;  1S63 A;  4GB9 A;  3C5R A;  1Q2Z A;  3EU5 A;  2LXM A;  1FVF A;  3LY8 A;  4GAA A;  5KCM A;  2WXK A;  4F1P A;  3CVQ A;  3T8M A;  1D9S A;  5AJD A;  1P5Q A;  4I1M A;  3C3O A;  4GU5 A;  2OEV A;  2IFU A;  4DX7 D;  3ML8 A;  1QQE A;  4FU3 A;  3ISM C;  1TEZ A;  4Z68 A;  2PQN A;  3CVX A;  1A17 A;  2LSU A;  4M3O A;  1IHG A;  4GTT A;  1NI1 A;  3WG7 E;  4L1B A;  1UN9 A;  3F6Q A;  3CGH A;  3T8K A;  1TN6 A;  4ATG A;  2L0T B;  1SW6 A;  2A5E A;  3VTX A;  5EDS A;  3ONL A;  2IEJ A;  4FHJ A;  2BKK B;  3TWS A;  4FUL A;  1S0P A;  2FO7 A;  2YNQ A;  4HRN A;  4TV3 A;  2KBX A;  4XI9 A;  1H6O A;  3R9A B;  3QAQ A;  1IHB A;  4CEM A;  3D9M A;  4OYS A;  1HX8 A;  1HG5 A;  1O5M A;  1OCR E;  4FJZ A;  4ZHB A;  2WXF A;  3HXE A;  5ENN A;  1RW2 A;  2GRR B;  3IHY A;  4K5C A;  3S7F A;  1OWN A;  4B0Z A;  5J08 A;  4JD2 G;  1TNZ A;  4GA0 A;  2WXQ A;  2LNI A;  4GPK A;  3OXF A;  4Q69 A;  2IY0 C;  2DCP A;  3ASF A;  5DBK A;  1ELW A;  1EYH A;  2IO3 C;  3IXE A;  4WNE A;  1O1R A;  2IF4 A;  4G24 A;  1TJC A;  2HR2 A;  1MX2 A;  4I1O B;  4WWN A;  1NA0 A;  3IBE A;  3FUN A;  5FIN A;  4WAF A;  4N2Q A;  2VQ2 A;  5KNG A;  2BTD A;  1INZ A;  3FTV A;  1H2T C;  4BES A;  3G2U A;  1Z5S C;  5G2N A;  3QC1 A;  1NP7 A;  1N9A A;  4K5B A;  3T5V A;  3ZIM A;  4MBG A;  4WWP A;  3LY9 A;  4U0S A;  1N0R A;  1N4Q A;  3Q79 A;  4HRM B;  5FTP A;  2I1J A;  5CBN A;  3HXC A;  2VTB A;  4FHK A;  2DYS E;  4JC8 A;  3S2A A;  4LER A;  4N39 A;  2R5S A;  2Y4T A;  2GRL A;  3QWV A;  1Y8M A;  1OUV A;  5CRU A;  3ZYK A;  3S7J A;  4AV7 A;  4U8Y D;  2L6B A;  3DSX A;  4L23 A;  1H2U A;  1PC2 A;  3ZW3 A;  1OY3 D;  2F0Y A;  1UW4 B;  4L7T A;  3TWQ A;  4CYM D;  4Q94 A;  5DIZ A;  4W9R A;  1D8D A;  1TN7 A;  3DBS A;  3FUJ A;  5ENR D;  4IRU A;  4HB5 A;  5CEA A;  2PNN A;  1EPU A;  3RAU A;  3DSW A;  5LCW J;  2R05 A;  3BU8 A;  5JJ7 A;  5G04 C;  1FT1 A;  3FU6 A;  5HI7 A;  3NF1 A;  3Q7A A;  1S64 A;  4RQI A;  3W9F A;  1BI7 B;  3T9K A;  2XEE A;  3TWX A;  1E96 B;  3CKC A;  3Q9N C;  1QZ2 A;  1K3Z D;  4GZ3 A;  4JHK A;  3KEZ A;  4EPZ A;  3ZYQ A;  2IU1 A;  4ZFH A;  2QFC A;  2DZO A;  4CCA A;  2YIN A;  3PUJ A;  4B8A A;  4HRL A;  3CVN A;  3ZHE A;  4UWF A;  1O1S A;  1TJF A;  3SZ7 A;  2BUG A;  4F6R D;  4YDW A;  3UT8 A;  3FUD A;  3E32 A;  3UM1 A;  2GRQ B;  1U3D A;  1HF8 A;  1TNO A;  1VDY A;  3C3R A;  3RKV A;  1GW6 A;  1YMP A;  4ANV A;  4XKC A;  2RFA A;  5D0O D;  4JL0 A;  1JWG A;  2KAT A;  5BNW A;  2H6I A;  3UPV A;  5C1D A;  4L2L A;  2XHE A;  4LSZ E;  4GTP A;  4ATZ D;  3CK9 A;  3QOU A;  4A1G A;  3HXD A;  1D8E A;  4GCN A;  5E76 A;  4NAC A;  1SQM A;  4E6H A;  5EYL A;  3V30 A;  2ZGD A;  3W9G A;  3CVU A;  5A6C A;  2CG3 A;  5JHB A;  1BI8 B;  3RJV A;  4O6F A;  5BT1 A;  3MV2 B;  3AG4 E;  4I9E A;  4HOU A;  1E8Z A;  2XZD G;  1MYO A;  3JXI A;  3TWR A;  1IKN D;  2CHX A;  3EHN A;  4AEZ C;  3FH5 A;  3IHV A;  5JA4 D;  2XS8 A;  4LNU D;  1BU9 A;  4KT6 B;  3PEU B;  3I3N A;  3G2T A;  2B0O E;  2I1K A;  1B89 A;  4A3T A;  4PH4 B;  4XIF A;  2AXU A;  2WQH A;  4GMR A;  4DX5 D;  2LXL A;  2DYR E;  3NBN B;  2XS1 A;  5KJL A;  2MYO A;  3RO3 A;  2XZT G;  5FZR A;  4G26 A;  3FFL A;  2CG2 A;  2P9I G;  4UUC A;  1BLX B;  3OXL A;  2J9Q A;  1IQR A;  1U2V G;  3FDH A;  4RG9 A;  3I4G A;  3EDT B;  2KXP C;  3PDN A;  2WXI A;  3PNT B;  4DJA A;  1MX6 A;  2PM6 A;  3APF A;  2X3M A;  3HG0 D;  4U95 D;  5FQ4 A;  1AP7 A;  2WMO A;  4CRW A;  3FUK A;  4YVO A;  2OOE A;  4LG6 A;  3NQP A;  4GPM A;  4GML A;  2IJG X;  2WXL A;  1OCO E;  3EHR A;  4PS3 A;  4J8E A;  3KSL A;  4DRX E;  4KVO A;  4LNB A;  4KVM A;  4NRH B;  3ULE G;  4AJW A;  4BER A;  5EX3 A;  5B3S E;  2AWI A;  5EIL A;  3ZU7 B;  3FTZ A;  4ILH B;  3ZNG A;  3ZEF A;  3Q4A B;  1WDY A;  4J8S A;  4GTS A;  3U66 A;  3BG0 B;  4EZJ A;  2VTB B;  1QYM A;  2KCV A;  4CT4 A;  5ENQ D;  1Z3Y A;  4B8C B;  3SHF A;  2VYI A;  4P29 A;  4YND A;  5EID A;  1HZ4 A;  4G25 A;  2F8X K;  3JQ0 A;  2R59 A;  5LX8 A;  3AG3 E;  1LD7 A;  2UY1 A;  5AQ7 A;  3T5X A;  2DWZ A;  4R7L A;  4Y6W A;  1YA0 A;  2CHZ A;  1MZC A;  3PUK A;  2WB2 A;  1E90 A;  2ETA A;  3DPY A;  4APO A;  4KZC A;  3TWU A;  3LY7 A;  3ZXP A;  4O1P A;  2GRN B;  4TRQ A;  1E7V A;  2F8Y A;  3EIQ C;  2IO2 C;  5HRY A;  1N94 A;  4CDR A;  4XI0 A;  2BF0 X;  2X6I A;  1OWP A;  4ACL A;  3GYZ A;  3EJN A;  2P9K G;  3JCK C;  1H0A A;  1TNY A;  5KNH D;  3SO8 A;  2V4L A;  3CVV A;  4PS8 A;  3RO2 A;  2XRZ A;  4GTO A;  2YHC A;  4UI9 C;  5LOZ A;  2J4D A;  3CQG B;  4J7W A;  3UM2 A;  3E30 A;  4HNA D;  3C3Q A;  5CRV A;  5AJL A;  3SFX A;  5G05 J;  1OT8 A;  3VLD A;  4YDO A;  3ZHE B;  4DX6 D;  4GZ5 A;  1HO8 A;  3V2O A;  5BPP A;  1TNB A;  4K0R A;  3DXK G;  3PZ2 A;  3CQC B;  4DX2 A;  4FJY A;  4FA6 A;  2R2L A;  4BSZ B;  3MX3 A;  3AU5 A;  2WXP A;  2VSY A;  3GZ2 A;  3ULQ A;  4EHM A;  2XGO A;  1OWL A;  2HM8 A;  3PZ1 A;  3S7B A;  4RVB A;  2EIJ E;  2PQR A;  2ZU6 B;  4M7C A;  4L9P A;  4BFR A;  3FTS A;  1N52 A;  5CMY A;  3FTY A;  1WY6 A;  4J8Y A;  3VLE A;  3CKB A;  3FH8 A;  3O4Z A;  1JCR A;  1TNU A;  3OAW A;  4JW1 A;  5ITZ F;  4ILI A;  2XRY A;  4CGV A;  3CSF A;  1E8Y A;  3DXM G;  3FUE A;  3UUX A;  5H7P A;  3KSQ A;  2XGS A;  4AIF A;  3DEO A;  3RRN B;  2WXN A;  3JXJ A;  2EIK E;  2YHE A;  2A4Z A;  4LCT A;  4EEC A;  1JPL A;  4EBA A;  3DSU A;  3UTM A;  4GTR A;  3Q7F A;  3RIB A;  3HYM B;  4JZY A;  2HE0 A;  4G8K A;  4DI4 A;  5JHA A;  2C2L A;  2NXP A;  3SD5 A;  2QY7 A;  1SA5 A;  1KPS B;  4GTM A;  3FUM A;  4C0M A;  4L2Y A;  3NAW A;  3CHM A;  4AY6 A;  4FC8 A;  4KMO A;  1AWC B;  3SFZ A;  3ZFW A;  4UQZ A;  1JCQ A;  5LCW C;  3OTN A;  4GYO A;  2J07 A;  3URZ A;  3AS4 A;  2C0L A;  4ABN A;  2FBN A;  3RK6 A;  4HLL A;  2HO1 A;  5ANR A;  1FCH A;  2X6F A;  3C98 A;  3NOG D;  2V0P A;  3CR3 A;  5CHE E;  3LPZ A;  3JUI A;  3LYA A;  4MS6 A;  2OVF A;  2WXR A;  4B93 B;  5IY5 E;  4TUU A;  4GTQ A;  1YYH A;  2OVB A;  1UOH A;  4BT9 A;  3UM3 A;  2CHW A;  3FUL A;  3HXF A;  3OXG A;  4I2Z A;  3E33 A;  2EIN E;  3VLF A;  4JPS A;  5KWD A;  2NYJ A;  1E8W A;  3UQ3 A;  5CED B;  1N95 A;  4JB8 P;  5KJM A;  4HXI A;  5T4Y A;  3FH7 A;  1HE8 A;  3LVR E;  2H6F A;  3LVQ E;  3CLJ A;  5LP0 A;  2WVI A;  1TYQ G;  2DBA A;  5BV1 A;  1QNF A;  4N3C A;  1JCS A;  5T3R A;  5CCL A;  1V54 E;  4BTB A;  3HHM A;  2KCK A;  3PEV B;  1SZA A;  4GZ6 A;  3DEP A;  3SFY A;  2E2E A;  4I43 A;  3DPD A;  4JVS A;  4TXR A;  3ZYM A;  4HI8 A;  4HOQ A;  2MHK A;  3ML9 A;  3NOC D;  2WMN A;  4FLH A;  4B89 A;  4DK5 A;  3MEK A;  1MQS A;  5G04 J;  3CHS A;  4Q96 A;  5CCM A;  4GMJ A;  3LS8 A;  5FQ7 A;  3CK8 A;  4HBD A;  3GZS A;  1K1A A;  2UY1 B;  3BUA A;  4BTA A;  2EIL E;  3CHP A;  3UT4 A;  4I2W A;  4HVB A;  3Q5M A;  4JXT A;  5HQ8 A;  1IYG A;  2L0I A;  4UQY A;  3ZRH A;  1OWO A;  3FHE A;  3MZL B;  4DLQ A;  2Y4U A;  1ELK A;  4XE0 A;  3DST A;  4OVU A;  4XZ4 A;  5AQ9 A;  3L6A A;  1W3B A;  5ARG A;  2WQ6 A;  2VSO E;  3FP3 A;  3PS6 A;  1IXV A;  3NZS A;  1N54 A;  2IOS A;  3UMV A;  1XGW A;  4AM9 A;  4GCO A;  5AN8 A;  2ETB A;  3DSV A;  3GW4 A;  5D2M C;  3SBS A;  3ASH A;  2FF4 A;  4EBA G;  3AS5 A;  3LEW A;  3MGB A;  4ANW A;  2XGM A;  2XPZ A;  2P9L G;  3C72 A;  4J6I A;  4D10 C;  1JWF A;  5BV0 A;  3L54 A;  3RSE G;  1K1B A;  2R02 A;  3TWW A;  1Z3X A;  2A5U A;  5BUZ A;  4A63 B;  3B7T A;  3ENE A;  4G2V A;  4IYP A;  4ILG A;  3CK7 A;  3KS2 A;  3TG5 A;  1UJK A;  4F3V A;  3HIZ A;  3APD A;  3EU9 A;  4URK A;  4KYO B;  2KCL A;  3AG2 E;  4OVV A;  5JJ6 A;  4MLP A;  2OEW A;  3L13 A;  4J8F A;  2C0M A;  1RZ4 A;  3CVW A;  4N3A A;  4U04 A;  3PZD A;  1HFA A;  4B94 A;  2WQ7 A;  5D0Q D;  4H7X A;  4UWG A;  5HS0 A;  2KC7 A;  1Y6I A;  5FJY A;  3PVL A;  4I6G A;  4JA7 A;  1KZO A;  4DX1 A;  3D9L A;  1WM5 A;  2MRI A;  4HS2 A;  2Y3A A;  2J08 A;  3HRA A;  3FTU A;  2NC9 A;  2J4B A;  4OAU C;  2Y69 E;  3CHR A;  2AVP A;  3B13 A;  1NL4 A;  2GGF A;  3U4T A;  4F53 A;  3SQV A;  3SGH A;  3Q78 A;  1QBQ A;  1EDU A;  1KT1 A;  1WAO 1;  3GZ1 A;  4I17 A;  4XX5 A;  5ENT D;  2LO6 A;  2P58 C;  3B7R L;  4K5A B;  4LNG A;  3L17 A;  2DVW A;  2LSV A;  5KBA A;  3ULY A;  1MHQ A;  3EIJ A;  5FQ6 A;  2FUL A;  1PAQ A;  4WND A;  2RFM A;  1EF1 C;  3ESK A;  4I6J A;  3LJ3 A;  4APF A;  3O48 A;  3PE3 A;  4CZ2 D;  3ZN3 A;  3ZKJ A;  3Q47 B;  4UI9 K;  3QNK A;  4C9B B;  4DI3 A;  4DLO A;  2QZA A;  3N71 A;  4HI9 A;  4LUN U;  3RRU A;  3LJN A;  3CVL A;  5JJT A;  3HXB A;  3QWP A;  3D9N A;  3LCA A;  4RG6 A;  4N2S A;  3TGO A;  3D9I A;  5BXO A;  5JMN D;  3JYS A;  4N5C A;  4CGW A;  3TWT A;  2VGX A;  2GW1 A;  1NZN A;  3J5P A;  5AAR A;  2J09 A;  3FU5 A;  2KZT A;  3KD7 A;  3AS8 A;  1DCE A;  2IOL A;  4G1T A;  3R7Q A;  4QFV A;  5EKQ D;  3SF4 A;  4DPR A;  3Q15 A;  5FZS A;  4TXQ A;  3UKU G;  4I9C A;  3FUI A;  3DWL G;  5A23 A;  4DUI A;  2L9B A;  1SA4 A;  3L82 A;  5EX0 A;  3X2Q E;  3CHO A;  1X5B A;  3MKR A;  5FZQ A;  3FUF A;  1PY1 A;  3APC A;  3U64 A;  2R17 C;  2V8S E;  2FEZ A;  1MX4 A;  3PH0 C;  2XEV A;  3P2B A;  1LF8 A;  2ION A;  3E34 A;  4AP2 A;  4NQ0 A;  2WXH A;  4WNF A;  4GA2 A;  4Y6C A;  4AXH A;  2JEK A;  3IV0 A;  5FWQ A;  4U7E B;  1N4R A;  3MCX A;  3PE4 A;  4I1A A;  2LAI A;  3IEG A;  4J0U A;  3V2X A;  4KBQ A;  4WUY A;  2RD0 A;  2WM9 A;  3PRE A;  4V3I A;  2IQC A;  2VJ8 A;  2XPI A;  3CVP A;  1FVH A;  2B6C A;  2PM7 A;  4ACK A;  4A1S A;  2WXG A;  3TAX A;  4IN3 B;  3TL5 A;  3G2S A;  2R03 A;  5HKP A;  3U3W A;  4U0U A;  3B7S A;  3TJP A;  2DIW A;  3D9J A;  1H6P A;  4UWH A;  3ASD A;  5C2Y A;  3AJI A;  2EQX A;  3NZU A;  1ZB1 A;  5AQB A;  2XCC A;  4UI9 J;  1N11 A;  3PZ4 A;  5BW8 C;  5FIO A;  5M72 A;  5B1A E;  4WWO A;  4EZK A;  3I5P A;  3MKQ A;  3UT7 A;  2JLB A;  2V5Q C;  4ANU A;  2FI7 A;  3LDZ A;  2E0I A;  4KZ0 A;  3TG4 A;  3QKY A;  3FUH A;  3KAE A;  2WXO A;  5AQA A;  2WPV A;  3ASN E;  3TWV A;  2CFU A;  4F7A A;  3WXX A;  2P9P G;  3PZ3 A;  4G23 A;  2AJA A;  3QB2 A;  4O1O A;  2ZGG A;  3E4B A;  1XNF A;  4FAD A;  4U8V D;  4C0E A;  2BKG A;  4NUR A;  4A3V A;  2PL2 A;  4XEI G;  2XEH A;  2WXJ A;  3G2W A;  2JAB A;  4I6E A;  5B1B E;  1V55 E;  3D3M A;  3HVE A;  1YCS B;  3Q9U C;  4MKT A;  4RLY A;  4BX9 A;  2OND A;  5CBO A;  1HG2 A;  3Q75 A;  4AY5 A;  2ETC A;  3QK0 A;  5E75 A;  3ZUV B;  2LAH A;  1TR4 A;  4GA1 A;  4UQX A;  5A7D B;  3JUE A;  4JHR A;  4A55 A;  5BXU A;  1HS6 A;  3ABL E;  2QC9 A;  1O1T A;  2H6H A;  1N4S A;  2ZXW E;  3P1U A;  5T8I A;  2ZIR A;  5KJN A;  3FTX A;  3CVY A;  3BEE A;  2XCB A;  4BSX A;  3QAR A;  3UI2 A;  3ABM E;  3J5Q B;  1JUQ A;  2GRO B;  1DCQ A;  1N0Q A;  4GTV A;  3NB2 A;  4BX8 A;  4BEP A;  5LFA A;  1L5J A;  3G2V A;  1DNP A;  2Y0B G;  4KXK B;  2UWJ G;  2X38 A;  4MRU A;  1ZU2 A;  4RSY A;  3ZXS A;  4HOR A;  3BG1 B;  4F1S A;  4FP7 A;  4OAV B;  2H6G A;  1UG3 A;  1LD8 A;  4JA9 A;  1H19 A;  2HYZ A;  2X6H A;  5ENS D;  1ELR A;  1E8X A;  4LRZ A;  2PZI A;  3EHQ A;  4H7Y A;  1DVP A;  3Q73 A;  5CER B;  2XPY A;  1KLX A;  2GRM A;  1N4P A;  1U3C A;  3AG1 E;  2Y1L E;  3AAA C;  2P9S G;  4HFG A;  5J90 A;  4G8L A;  1FT2 A;  4N5Q A;  2P9N G;  3DRA A;  5ARF A;  3E37 A;  3S7D A;  3CEQ A;  4BT8 A;  3EHM A;  3D9K A;  3ASO E;  4CDN A;  5EIB E;  4BY6 A;  4U8H A;  5D66 A;  3V31 A;  4GYW A;  4IUL A;  4U07 A;  1OCZ E;  1KZP A;  4PUC A;  5EN5 D;  5KJK A;  4JEU A;  4E85 A;  5G55 A;  4AOF A;  2VGX B;  2KM4 A;  3EUV A;  2P2C P;  3B7U X;  3ZVV A;  4CT0 A;  1S70 B;  5AYW D;  2KZT B;  2MOW A;  4BWR A;  2V4H C;  2YQ8 A;  2EIM E;  3L08 A;  4PDX A;  2VGE A;  3PRZ A;  4JEH A;  3IKO B;  1KT0 A;  4QQI A;  1ZBP A;  3FTW A;  2ILR A;  3ZYL A;  2P9U G;  2LUH A;  5ENP D;  2L6J A; 
#chains in the Genus database with same CATH homology
 1JCQ A;  3HXE A;  2F0Y A;  2R2L A;  2H6G A;  1LD7 A;  1LD8 A;  3DSS A;  2H6I A;  1N4R A;  1D8D A;  1TN7 A;  2ZIS A;  1TNZ A;  3Q73 A;  4EHM A;  1N4P A;  4GTP A;  3PZ1 A;  3DSW A;  1FT2 A;  1MZC A;  3DPY A;  4L9P A;  3HXD A;  3Q75 A;  1D8E A;  3DRA A;  3E37 A;  1FT1 A;  1O1R A;  3Q7A A;  1JCR A;  1N94 A;  1S64 A;  1TNU A;  4YDE A;  3HXB A;  3KSQ A;  4GTT A;  3PZ4 A;  4GTQ A;  1NI1 A;  1TNY A;  1KZP A;  1KZO A;  1O1T A;  1LTX A;  2H6H A;  1N4S A;  3DST A;  1N9A A;  3HXF A;  4MBG A;  1FPP A;  3E33 A;  1DCE A;  2ZIR A;  4GTO A;  1TN6 A;  1TN8 A;  3KSL A;  4LNB A;  1N4Q A;  3DSU A;  3Q79 A;  1N95 A;  1X81 A;  1NL4 A;  3EUV A;  3Q7F A;  4GTR A;  3HXC A;  3E30 A;  2IEJ A;  2H6F A;  1O1S A;  1SA4 A;  4GTV A;  3DSV A;  2BED A;  3SFX A;  3E32 A;  3Q78 A;  1JCS A;  4GTS A;  1QBQ A;  3PZ3 A;  4YDO A;  1SA5 A;  4GTM A;  1TNB A;  1TNO A;  4LNG A;  3SFY A;  3C72 A;  3E34 A;  1S63 A;  3DSX A;  3PZ2 A;  1O5M A;  3EU5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...