2H6KA

Histone h3 recognition and presentation by the wdr5 module of the mll1 complex
Total Genus 103
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
103
sequence length
305
structure length
305
Chain Sequence
PVKPNYALKFTLAGHTKAVSSVKFSPNGEWLASSSADKLIKIWGAYDGKFEKTISGHKLGISDVAWSSDSNLLVSASDDKTLKIWDVSSGKCLKTLKGHSNYVFCCNFNPQSNLIVSGSFDESVRIWDVKTGKCLKTLPAHSDPVSAVHFNRDGSLIVSSSYDGLCRIWDTASGQCLKTLIDDDNPPVSFVKFSPNGKYILAATLDNTLKLWDYSKGKCLKTYTGHKNEKYCIFANFSVTGGKWIVSGSEDNLVYIWNLQTKEIVQKLQGHTDVVISTACHPTENIIASAALENDKTIKLWKSDC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords WD-repeat protein 5
publication title Histone H3 recognition and presentation by the WDR5 module of the MLL1 complex.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Gene regulation
total genus 103
structure length 305
sequence length 305
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-05-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00400 WD40 WD domain, G-beta repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 2h6kA00
2J56H 4PSXB 5FKRA 4A08A 3C5MA 3I89A 5GSAA 2OVPB 2YBAA 5FKQA 3I7KA 3JRPA 5C2VB 3A0FA 4FA9D 4X60B 1N6DA 4GGCA 2YNNA 5K19A 4A0AA 3GFCA 4X61B 3PSLA 4G56B 2EBSA 4Z8LA 1S4UX 3CIKB 5AFU3 3SHFA 2H9LA 3UVLA 4CZVA 4QQEA 4CY2A 1SQJA 5EMJB 4GZ8A 3UVMA 3UR4A 3ULEC 3W15A 2IWKA 4YVDA 4U1EI 4JD2C 4GGDA 5KDOB 4J84A 5FXYA 4XEIC 2IAAA 2HXCA 2AGYA 3FM0A 3PXSD 2J55H 2B5NA 1PGUA 4R7AB 3F3FA 2I3SA 5THAA 3OL2B 3I7OA 3J81g 5FKTA 2PBIB 2I0SA 2HJ4A 1B9XA 2GC4A 2AGXA 4A7JA 4JSNC 3EI3A 1QNIA 1JOFA 4O45A 4ERYA 1XIPA 2I0TA 3K26A 2CE9A 4L3HD 4D6VA 5EAMA 1JJUB 3IJCA 3I7NA 5CYKB 3EI2A 4O9DA 2HESX 5CXBA 1GG2B 1SQ9A 4CZXA 2AH1A 3C99A 4CI2A 5FKSA 4GQBB 3IKOA 4J73A 3MMYA 2P9PC 3JZGA 1K8KC 3JPXA 1NEXB 5I5IA 1GXRA 3SBPA 4FB1D 5IT9g 5IGQA 5JWZA 4A0BB 4ERZA 2P9NC 4JT5C 3VGZA 4MK0B 4IA9A 3AH8B 3UKUC 5SXMA 3KRXB 3SFZA 4GM9A 2H6QA 3RN0D 4J8GA 2H6KA 3MZLA 4ERQA 4E5ZB 3IJ0A 3SMRA 3RN1D 4L1QD 2AGWA 3JAMg 4CY5A 5IJ7E 2P9IC 4L9OA 5EAPA 2QXVA 3NVNA 3VH0A 3DXKC 3EU7A 4UI9R 2H9NA 2YB8B 1Q47A 3OL2A 5EM2A 5HE3B 4FA4D 4GM8A 3J80g 3SVWD 4O1QD 2BBKH 3SXTD 1PBYB 4H5JA 5EMLB 3RMZD 4ESGA 4LGNA 5EMKB 1P22A 3DXMC 3SBQA 4CZYA 2IUQA 2XYIA 3DWLC 4J79A 5CYKA 3V9FA 3MKSB 1ERJA 2UZYB 4AOWA 4O3TB 4K3JB 3AL8A 3PSCB 3EI1A 3L4MD 4L3GD 4QRJA 4JSXC 5AMSA 1U2VC 1A0RB 3BWSA 3C9CA 4A0BA 5H1MA 1R5MA 3NVQA 2H14A 3OW8A 2Z2OA 5B4WA 1JMZB 1N6EA 3JB9L 2IUPA 2IUVA 4PSWB 3SJLD 3MXXA 2P9SC 4CY1A 4LG8A 3UVNA 3UVOA 2P9KC 4E5ZA 2B5MA 4PNKB 5EARA 3C75H 3EG6A 3PXWD 2XL3A 5I5JA 3RLMD 4JXMA 4A2MA 5C2WB 2AGLA 4J78A 5A2Qg 5IC7A 4PC0A 2P9UC 4TZ4A 3K27A 4XYIA 2GNQA 4CY3A 4PXWA 3RRMC 4I79A 1XHMA 3PVUB 5HE2B 4BL0A 5HQGA 4D0KA 3N0DA 3I2NA 2CE8A 4X63B 2H9PA 3PE7A 3I8EA 2YMUA 4A11B 3CFVA 4CI1A 5FA5B 3DM0A 1MG3A 1GOTB 4FA5D 2CN3A 3FGBA 4XYHA 2H6NA 4Y7RA 4FWWA 5HE1B 3I7PA 4CC9A 3PVWB 3OKYB 2OVQB 2HKRA 3V7DB 4ZN4A 3ODTA 4J0XA 1PI6A 3SN6B 4PBYA 5H17A 2XL2A 3RFGA 3BG0A 1PEVA 3PXTD 3UVKA 3IJ1A 4X3EA 2H47A 2G9AA 5FLXg 1XKSA 3MZKA 2B5LA 1B9YA 4H5IA 2HYEA 3F3PA 3JROA 3BG1A 3E0CA 1TYQC 4EWRA 2H68A 3I7LA 4A09B 5C9ZB 3DSMA 4J87A 5IGOA 4OZUA 3AFCA 2G99A 3I7HA 4BH6A 5CXCB 3RFHA 3EMHA 4Y5RD 5HYNB 4BUJC 5K1CC 5GXHA 3KRWB 4QL1A 3F3GA 2OK4A 4J0WA 2HJBA 2P9LC 2Z2PA 2CO0A 3UKRC 3U4YA 4J86A 4GQ2P 2CO0C 3NVXA 3FRXA 4PBZA 1JMXB 5GXIA 4A11A 3B7FA 3OKWA 4J82A 3SCYA 4JSPC 3IIWA 2BCJB 5I5MA 4AEZA 1OLZA 1N6FA 2W18A 3OKTA 4E54B 2Q7QA 2HKMA 3JZNA 4IMMA 5HE0B 1RI6A 3OKYA 5H14A 2I0RA 3I8CA 2PM9B 3EI4B 4ZOXA 4OWRA 4GGAA 2QC5A 1TBGA 4ZOZA 4J81A 3SBRA 4N14A 2B4EA 4U7AA 4GM3A 3HFQA 4J77A 3N0EA 3L4OD 3ORVD 1L0QA 4CI8A 3V5WB 2I3TA 4NSXA 5EM2B 3SWSD 3AL9A 1MDAH 5TF2A 4HDJA 5EALA 5EMMB 4A08B 4FAVD 2OK6A 3VA6A 4A09A 4K3ID 3ZWLB 4GMBA 2O9KA 2PM6B 3RSEC 2OVRB 2AQ5A 4KFMB 3OTTA 5TDHB 4A0AB 5CXCA 3JZHA 3MKQA 2GC7A 2CNXA 1K32A 2IWFA 4CI3A 2H9MA 2YNOA 1GP2B 2PM7B 2XU7A 1U4CA 2H3XA 3AL8B 2H13A 3EI1B 2Z2NA 2IURA 2MTAH 4ES0A 2AH0A 5FQDA 3CFSB 4JSVC 5AJAA 2UZXB 3GREA 1YFQA 3P4FA 4ZOVA 2YNPA 4QT8A 4FHLA 4A2LA 5TEFA 3EWEA 2OJYA 4O3UB 1FWXA 1MG2A 4LG9A 5TEEA 4E54A 4J8BA 2OIZA 2TRCB 5IJ8E 2AGZA 2PM9A 1OMWB 4FA1D 3EI4A 4FAND 3EI3B 4JT6C 4ZOYA 1NR0A 1SHYB 2CN2A 3SLED 1VYHC 2J57G 3IIYA 5GMKn 4GQ1A 3EI2B 5CXBB
chains in the Genus database with same CATH superfamily
1O6FA 2J56H 4PSXB 2VDMA 1H2ZA 4QAMA 5FKRA 3V4PA 4A08A 3C5MA 4MMZA 3I89A 3OF7A 5GSAA 4BP9A 2OVPB 2YBAA 1BPOA 5FKQA 3I7KA 3JRPA 5C2VB 5FFGA 1QFMA 3A0FA 4FA9D 2VDRA 4X60B 1N6DA 4GGCA 2YNNA 5K19A 4A0AA 3GFCA 4X61B 4G1MA 2EIDA 3PSLA 4D9SA 4G56B 2EBSA 4AN1A 3GD1I 4Z8LA 1S4UX 3CIKB 5AFU3 3SHFA 2H9LA 3UVLA 4CZVA 4QQEA 4CY2A 1SQJA 5EMJB 3IURA 4GZ8A 3UVMA 3UR4A 3ULEC 3W15A 2IWKA 4YVDA 4U1EI 4JD2C 4JHNA 4GGDA 5KDOB 4J84A 5M5TA 3V4VA 5FXYA 4XEIC 2IAAA 2HXCA 2AGYA 3FM0A 3PXSD 2VDOA 2J55H 2B5NA 1T2XA 1PGUA 4R7AB 4BP8A 1L5GA 3F3FA 2I3SA 5THAA 3OL2B 4AX4A 3I7OA 5HDBA 3J81g 5FKTA 2PBIB 2I0SA 2HJ4A 1B9XA 2GC4A 2AGXA 4A7JA 4JSNC 3EI3A 1QNIA 3QHYB 4Z7OA 1JOFA 4O45A 4UM9A 4ERYA 1XIPA 2I0TA 3K26A 2CE9A 4L3HD 4D6VA 5EAMA 1JJUB 3IJCA 3I7NA 5CYKB 3EI2A 1C9LA 4O9DA 3K71A 2HESX 5CXBA 1GG2B 1K3IA 1SQ9A 4CZXA 2AH1A 2VC2A 3ZDZA 3C99A 4CI2A 5FKSA 4GQBB 3IKOA 2VDLA 4J73A 3MMYA 2P9PC 3JZGA 3O4JA 4AN0A 1K8KC 3JPXA 3IUNA 1NEXB 5I5IA 4WJKA 1GXRA 3SBPA 4FB1D 5IT9g 5IGQA 5JWZA 4A0BB 4ERZA 2P9NC 3T3PA 4JT5C 2VDQA 3EQ9A 3VGZA 4MK0B 4IA9A 3ZE0A 3AH8B 3QI0A 3UKUC 5SXMA 1H2XA 3KRXB 3SFZA 4GM9A 2H6QA 1O6GA 1VE7A 3IJEA 3RN0D 4J8GA 2H6KA 3MZLA 4ERQA 4E5ZB 3IJ0A 3SMRA 3RN1D 4L1QD 1TYEA 2AGWA 3JAMg 4CY5A 5IJ7E 3KCIA 1E8MA 2P9IC 4L9OA 5EAPA 2QXVA 3NVNA 4NBMA 2HU8A 3VH0A 3DXKC 3EU7A 1U8CA 4UI9R 2H9NA 2YB8B 1Q47A 3OL2A 2EICA 5EM2A 5HE3B 4O2WA 2HU5A 4FA4D 4GM8A 3J80g 1VZ3A 4NENA 3IUJA 3VI4A 3SVWD 4O1QD 4O02A 2BBKH 5M5VA 3SXTD 1PBYB 1GOGA 4H5JA 5EMLB 5M61A 3RMZD 4ESGA 4LGNA 5EMKB 1P22A 3DXMC 4AMZA 2VDPA 2VZ3A 3SBQA 4CZYA 2IUQA 2XYIA 3DWLC 3IUMA 4J79A 5CYKA 3V9FA 3MKSB 1ERJA 2UZYB 2XE4A 4AOWA 4O3TB 4K3JB 3NIDA 3AL8A 3PSCB 3EI1A 3EQ7A 2VDNA 3K72A 2WQ8A 3L4MD 3O4IA 4L3GD 4QRJA 3IUQA 4JSXC 4Z7NA 5AMSA 1U2VC 1A0RB 3BWSA 3C9CA 4WK2A 4RE5A 5C92A 4A0BA 5H1MA 1R5MA 3NVQA 3MUNA 2H14A 3VI3A 3OW8A 2Z2OA 5B4WA 1JMZB 1N6EA 3JB9L 1UOQA 2IUPA 2IUVA 4PSWB 3SJLD 5FFOA 3MXXA 2P9SC 4CY1A 4LG8A 3UVNA 3K6SA 3UVOA 2P9KC 4E5ZA 2B5MA 1GOHA 4PNKB 5EARA 3C75H 3EG6A 3PXWD 2XL3A 5I5JA 3RLMD 4JXMA 4A2MA 5C2WB 2AGLA 3IVMA 2VDKA 4J78A 5A2Qg 5IC7A 4PC0A 2P9UC 4TZ4A 5E6UA 1YR2A 5E6SA 3K27A 4XYIA 1JTDB 2GNQA 3ZDXA 4CY3A 4PXWA 3RRMC 4I79A 2JKXA 3O4GA 3MVDK 1XHMA 3PVUB 5HE2B 4BL0A 5HQGA 4D0KA 3N0DA 3I2NA 2CE8A 4X63B 3NIFA 2H9PA 3PE7A 3I8EA 2YMUA 4A11B 3CFVA 4CI1A 1A12A 4G55A 3DM0A 1MG3A 1GOTB 5FA5B 4FA5D 2CN3A 3FGBA 4XYHA 2H6NA 4Y7RA 4FWWA 5HE1B 4MMYA 5E6RA 3I7PA 4CC9A 3PVWB 3OKYB 2OVQB 2HKRA 3V7DB 4ZN4A 3ODTA 4J0XA 1PI6A 3SN6B 4PBYA 5H17A 4IRZA 2XL2A 3RFGA 2QZPA 3BG0A 1PEVA 3PXTD 3UVKA 3IJ1A 4X3EA 2H47A 2G9AA 5FLXg 1XKSA 3MZKA 2B5LA 1B9YA 1H2WA 2HU7A 3O4HA 4H5IA 2HYEA 3EQ8A 2XDWA 1GOFA 3F3PA 3JROA 3BG1A 3E0CA 4WK4A 1TYQC 4EWRA 2H68A 3I7LA 4A09B 5C9ZB 3DSMA 4J87A 5IGOA 4OZUA 3AFCA 2G99A 3I7HA 4BH6A 5CXCB 1UOOA 3RFHA 3EMHA 4Y5RD 5HYNB 4BUJC 5M5SA 3MUOA 5K1CC 5GXHA 4Z7QA 4G1EA 3KRWB 4QL1A 2EIEA 3F3GA 1I2MB 2OK4A 3DDUA 4J0WA 2HJBA 2P9LC 2Z2PA 5M5UA 2CO0A 3UKRC 3U4YA 4J86A 4JHPC 4GQ2P 2CO0C 3NVXA 3FRXA 4PBZA 1JMXB 5GXIA 4A11A 3B7FA 3OKWA 4J82A 4DNVA 3SCYA 4JSPC 3IIWA 2BCJB 4NC4A 5I5MA 4BCBA 4AEZA 1OLZA 1N6FA 2W18A 1VZ2A 3OKTA 4E54B 2Q7QA 2HKMA 3JZNA 4IMMA 5HE0B 1RI6A 3OKYA 5H14A 2I0RA 3I8CA 2PM9B 3EI4B 4ZOXA 4OWRA 4GGAA 2QC5A 1TBGA 4ZOZA 4J81A 3SBRA 4N14A 3ZE1A 2B4EA 3IULA 4U7AA 4GM3A 4BCCA 3HFQA 4J77A 4RE6A 1H2YA 3N0EA 3L4OD 3ORVD 1L0QA 4CI8A 3V5WB 2I3TA 4NSXA 1VE6A 5EM2B 3SWSD 3AL9A 1MDAH 5TF2A 4HDJA 5EALA 5EMMB 4A08B 4FAVD 2OK6A 3VA6A 4L1MA 4A09A 4K3ID 3ZWLB 4GMBA 2O9KA 2PM6B 3RSEC 3FCUA 2OVRB 1M1XA 2AQ5A 4KFMB 3OTTA 5TDHB 4A0AB 4NAAA 3JZHA 5CXCA 3ZDYA 2EIBA 3MKQA 2GC7A 2CNXA 1K32A 2IWFA 1E5TA 4CI3A 2H9MA 2YNOA 2VZ1A 1GP2B 2PM7B 2XU7A 2XZGA 3GC3B 1E8NA 1U4CA 2H3XA 3AL8B 4DNWA 2H13A 3EI1B 2Z2NA 2IURA 3NIGA 1UTCA 2MTAH 1C9IA 4UM8A 3ZE2A 4ES0A 2AH0A 5FQDA 5M5RA 4AMYA 1QFSA 3CFSB 4JSVC 5AJAA 4DNUA 2UZXB 3GREA 1YFQA 3FCSA 3P4FA 4ZOVA 2YNPA 4QT8A 4FHLA 4A2LA 5TEFA 3EWEA 2OJYA 4O3UB 1FWXA 3T3MA 4MMXA 1MG2A 4LG9A 5TEEA 4E54A 4J8BA 2OIZA 2TRCB 5IJ8E 2AGZA 1UOPA 4WK0A 2PM9A 1OMWB 4BCDA 4FA1D 3EI4A 4FAND 3EI3B 4JT6C 5C86A 4ZOYA 1NR0A 2QR5A 1SHYB 2CN2A 3SLED 1VYHC 1JV2A 2J57G 3IIYA 5GMKn 4GQ1A 3EI2B 2BKLA 5CXBB
chains in the Genus database with same CATH topology
2J56H 4PSXB 5FKRA 4A08A 3C5MA 3I89A 5GSAA 2OVPB 2YBAA 5FKQA 3I7KA 3JRPA 5C2VB 3A0FA 4FA9D 4X60B 1N6DA 4GGCA 2YNNA 5K19A 4A0AA 3GFCA 4X61B 3PSLA 4G56B 2EBSA 4Z8LA 1S4UX 3CIKB 5AFU3 3SHFA 2H9LA 3UVLA 4CZVA 4QQEA 4CY2A 1SQJA 5EMJB 4GZ8A 3UVMA 3UR4A 3ULEC 3W15A 2IWKA 4YVDA 4U1EI 4JD2C 4GGDA 5KDOB 4J84A 5FXYA 4XEIC 2IAAA 2HXCA 2AGYA 3FM0A 3PXSD 2J55H 2B5NA 1PGUA 4R7AB 3F3FA 2I3SA 5THAA 3OL2B 3I7OA 3J81g 5FKTA 2PBIB 2I0SA 2HJ4A 1B9XA 2GC4A 2AGXA 4A7JA 4JSNC 3EI3A 1QNIA 1JOFA 4O45A 4ERYA 1XIPA 2I0TA 3K26A 2CE9A 4L3HD 4D6VA 5EAMA 1JJUB 3IJCA 3I7NA 5CYKB 3EI2A 4O9DA 2HESX 5CXBA 1GG2B 1SQ9A 4CZXA 2AH1A 3C99A 4CI2A 5FKSA 4GQBB 3IKOA 4J73A 3MMYA 2P9PC 3JZGA 1K8KC 3JPXA 1NEXB 5I5IA 1GXRA 3SBPA 4FB1D 5IT9g 5IGQA 5JWZA 4A0BB 4ERZA 2P9NC 4JT5C 3VGZA 4MK0B 4IA9A 3AH8B 3UKUC 5SXMA 3KRXB 3SFZA 4GM9A 2H6QA 3RN0D 4J8GA 2H6KA 3MZLA 4ERQA 4E5ZB 3IJ0A 3SMRA 3RN1D 4L1QD 2AGWA 3JAMg 4CY5A 5IJ7E 2P9IC 4L9OA 5EAPA 2QXVA 3NVNA 3VH0A 3DXKC 3EU7A 4UI9R 2H9NA 2YB8B 1Q47A 3OL2A 5EM2A 5HE3B 4FA4D 4GM8A 3J80g 3SVWD 4O1QD 2BBKH 3SXTD 1PBYB 4H5JA 5EMLB 3RMZD 4ESGA 4LGNA 5EMKB 1P22A 3DXMC 3SBQA 4CZYA 2IUQA 2XYIA 3DWLC 4J79A 5CYKA 3V9FA 3MKSB 1ERJA 2UZYB 4AOWA 4O3TB 4K3JB 3AL8A 3PSCB 3EI1A 3L4MD 4L3GD 4QRJA 4JSXC 5AMSA 1U2VC 1A0RB 3BWSA 3C9CA 4A0BA 5H1MA 1R5MA 3NVQA 2H14A 3OW8A 2Z2OA 5B4WA 1JMZB 1N6EA 3JB9L 2IUPA 2IUVA 4PSWB 3SJLD 3MXXA 2P9SC 4CY1A 4LG8A 3UVNA 3UVOA 2P9KC 4E5ZA 2B5MA 4PNKB 5EARA 3C75H 3EG6A 3PXWD 2XL3A 5I5JA 3RLMD 4JXMA 4A2MA 5C2WB 2AGLA 4J78A 5A2Qg 5IC7A 4PC0A 2P9UC 4TZ4A 3K27A 4XYIA 2GNQA 4CY3A 4PXWA 3RRMC 4I79A 1XHMA 3PVUB 5HE2B 4BL0A 5HQGA 4D0KA 3N0DA 3I2NA 2CE8A 4X63B 2H9PA 3PE7A 3I8EA 2YMUA 4A11B 3CFVA 4CI1A 5FA5B 3DM0A 1MG3A 1GOTB 4FA5D 2CN3A 3FGBA 4XYHA 2H6NA 4Y7RA 4FWWA 5HE1B 3I7PA 4CC9A 3PVWB 3OKYB 2OVQB 2HKRA 3V7DB 4ZN4A 3ODTA 4J0XA 1PI6A 3SN6B 4PBYA 5H17A 2XL2A 3RFGA 3BG0A 1PEVA 3PXTD 3UVKA 3IJ1A 4X3EA 2H47A 2G9AA 5FLXg 1XKSA 3MZKA 2B5LA 1B9YA 4H5IA 2HYEA 3F3PA 3JROA 3BG1A 3E0CA 1TYQC 4EWRA 2H68A 3I7LA 4A09B 5C9ZB 3DSMA 4J87A 5IGOA 4OZUA 3AFCA 2G99A 3I7HA 4BH6A 5CXCB 3RFHA 3EMHA 4Y5RD 5HYNB 4BUJC 5K1CC 5GXHA 3KRWB 4QL1A 3F3GA 2OK4A 4J0WA 2HJBA 2P9LC 2Z2PA 2CO0A 3UKRC 3U4YA 4J86A 4GQ2P 2CO0C 3NVXA 3FRXA 4PBZA 1JMXB 5GXIA 4A11A 3B7FA 3OKWA 4J82A 3SCYA 4JSPC 3IIWA 2BCJB 5I5MA 4AEZA 1OLZA 1N6FA 2W18A 3OKTA 4E54B 2Q7QA 2HKMA 3JZNA 4IMMA 5HE0B 1RI6A 3OKYA 5H14A 2I0RA 3I8CA 2PM9B 3EI4B 4ZOXA 4OWRA 4GGAA 2QC5A 1TBGA 4ZOZA 4J81A 3SBRA 4N14A 2B4EA 4U7AA 4GM3A 3HFQA 4J77A 3N0EA 3L4OD 3ORVD 1L0QA 4CI8A 3V5WB 2I3TA 4NSXA 5EM2B 3SWSD 3AL9A 1MDAH 5TF2A 4HDJA 5EALA 5EMMB 4A08B 4FAVD 2OK6A 3VA6A 4A09A 4K3ID 3ZWLB 4GMBA 2O9KA 2PM6B 3RSEC 2OVRB 2AQ5A 4KFMB 3OTTA 5TDHB 4A0AB 5CXCA 3JZHA 3MKQA 2GC7A 2CNXA 1K32A 2IWFA 4CI3A 2H9MA 2YNOA 1GP2B 2PM7B 2XU7A 1U4CA 2H3XA 3AL8B 2H13A 3EI1B 2Z2NA 2IURA 2MTAH 4ES0A 2AH0A 5FQDA 3CFSB 4JSVC 5AJAA 2UZXB 3GREA 1YFQA 3P4FA 4ZOVA 2YNPA 4QT8A 4FHLA 4A2LA 5TEFA 3EWEA 2OJYA 4O3UB 1FWXA 1MG2A 4LG9A 5TEEA 4E54A 4J8BA 2OIZA 2TRCB 5IJ8E 2AGZA 2PM9A 1OMWB 4FA1D 3EI4A 4FAND 3EI3B 4JT6C 4ZOYA 1NR0A 1SHYB 2CN2A 3SLED 1VYHC 2J57G 3IIYA 5GMKn 4GQ1A 3EI2B 5CXBB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2J56 H;  4PSX B;  5FKR A;  4A08 A;  3C5M A;  3I89 A;  5GSA A;  2OVP B;  2YBA A;  5FKQ A;  3I7K A;  3JRP A;  5C2V B;  3A0F A;  4FA9 D;  4X60 B;  1N6D A;  4GGC A;  2YNN A;  5K19 A;  4A0A A;  3GFC A;  4X61 B;  3PSL A;  4G56 B;  2EBS A;  4Z8L A;  1S4U X;  3CIK B;  5AFU 3;  3SHF A;  2H9L A;  3UVL A;  4CZV A;  4QQE A;  4CY2 A;  1SQJ A;  5EMJ B;  4GZ8 A;  3UVM A;  3UR4 A;  3ULE C;  3W15 A;  2IWK A;  4YVD A;  4U1E I;  4JD2 C;  4GGD A;  5KDO B;  4J84 A;  5FXY A;  4XEI C;  2IAA A;  2HXC A;  2AGY A;  3FM0 A;  3PXS D;  2J55 H;  2B5N A;  1PGU A;  4R7A B;  3F3F A;  2I3S A;  5THA A;  3OL2 B;  3I7O A;  3J81 g;  5FKT A;  2PBI B;  2I0S A;  2HJ4 A;  1B9X A;  2GC4 A;  2AGX A;  4A7J A;  4JSN C;  3EI3 A;  1QNI A;  1JOF A;  4O45 A;  4ERY A;  1XIP A;  2I0T A;  3K26 A;  2CE9 A;  4L3H D;  4D6V A;  5EAM A;  1JJU B;  3IJC A;  3I7N A;  5CYK B;  3EI2 A;  4O9D A;  2HES X;  5CXB A;  1GG2 B;  1SQ9 A;  4CZX A;  2AH1 A;  3C99 A;  4CI2 A;  5FKS A;  4GQB B;  3IKO A;  4J73 A;  3MMY A;  2P9P C;  3JZG A;  1K8K C;  3JPX A;  1NEX B;  5I5I A;  1GXR A;  3SBP A;  4FB1 D;  5IT9 g;  5IGQ A;  5JWZ A;  4A0B B;  4ERZ A;  2P9N C;  4JT5 C;  3VGZ A;  4MK0 B;  4IA9 A;  3AH8 B;  3UKU C;  5SXM A;  3KRX B;  3SFZ A;  4GM9 A;  2H6Q A;  3RN0 D;  4J8G A;  2H6K A;  3MZL A;  4ERQ A;  4E5Z B;  3IJ0 A;  3SMR A;  3RN1 D;  4L1Q D;  2AGW A;  3JAM g;  4CY5 A;  5IJ7 E;  2P9I C;  4L9O A;  5EAP A;  2QXV A;  3NVN A;  3VH0 A;  3DXK C;  3EU7 A;  4UI9 R;  2H9N A;  2YB8 B;  1Q47 A;  3OL2 A;  5EM2 A;  5HE3 B;  4FA4 D;  4GM8 A;  3J80 g;  3SVW D;  4O1Q D;  2BBK H;  3SXT D;  1PBY B;  4H5J A;  5EML B;  3RMZ D;  4ESG A;  4LGN A;  5EMK B;  1P22 A;  3DXM C;  3SBQ A;  4CZY A;  2IUQ A;  2XYI A;  3DWL C;  4J79 A;  5CYK A;  3V9F A;  3MKS B;  1ERJ A;  2UZY B;  4AOW A;  4O3T B;  4K3J B;  3AL8 A;  3PSC B;  3EI1 A;  3L4M D;  4L3G D;  4QRJ A;  4JSX C;  5AMS A;  1U2V C;  1A0R B;  3BWS A;  3C9C A;  4A0B A;  5H1M A;  1R5M A;  3NVQ A;  2H14 A;  3OW8 A;  2Z2O A;  5B4W A;  1JMZ B;  1N6E A;  3JB9 L;  2IUP A;  2IUV A;  4PSW B;  3SJL D;  3MXX A;  2P9S C;  4CY1 A;  4LG8 A;  3UVN A;  3UVO A;  2P9K C;  4E5Z A;  2B5M A;  4PNK B;  5EAR A;  3C75 H;  3EG6 A;  3PXW D;  2XL3 A;  5I5J A;  3RLM D;  4JXM A;  4A2M A;  5C2W B;  2AGL A;  4J78 A;  5A2Q g;  5IC7 A;  4PC0 A;  2P9U C;  4TZ4 A;  3K27 A;  4XYI A;  2GNQ A;  4CY3 A;  4PXW A;  3RRM C;  4I79 A;  1XHM A;  3PVU B;  5HE2 B;  4BL0 A;  5HQG A;  4D0K A;  3N0D A;  3I2N A;  2CE8 A;  4X63 B;  2H9P A;  3PE7 A;  3I8E A;  2YMU A;  4A11 B;  3CFV A;  4CI1 A;  5FA5 B;  3DM0 A;  1MG3 A;  1GOT B;  4FA5 D;  2CN3 A;  3FGB A;  4XYH A;  2H6N A;  4Y7R A;  4FWW A;  5HE1 B;  3I7P A;  4CC9 A;  3PVW B;  3OKY B;  2OVQ B;  2HKR A;  3V7D B;  4ZN4 A;  3ODT A;  4J0X A;  1PI6 A;  3SN6 B;  4PBY A;  5H17 A;  2XL2 A;  3RFG A;  3BG0 A;  1PEV A;  3PXT D;  3UVK A;  3IJ1 A;  4X3E A;  2H47 A;  2G9A A;  5FLX g;  1XKS A;  3MZK A;  2B5L A;  1B9Y A;  4H5I A;  2HYE A;  3F3P A;  3JRO A;  3BG1 A;  3E0C A;  1TYQ C;  4EWR A;  2H68 A;  3I7L A;  4A09 B;  5C9Z B;  3DSM A;  4J87 A;  5IGO A;  4OZU A;  3AFC A;  2G99 A;  3I7H A;  4BH6 A;  5CXC B;  3RFH A;  3EMH A;  4Y5R D;  5HYN B;  4BUJ C;  5K1C C;  5GXH A;  3KRW B;  4QL1 A;  3F3G A;  2OK4 A;  4J0W A;  2HJB A;  2P9L C;  2Z2P A;  2CO0 A;  3UKR C;  3U4Y A;  4J86 A;  4GQ2 P;  2CO0 C;  3NVX A;  3FRX A;  4PBZ A;  1JMX B;  5GXI A;  4A11 A;  3B7F A;  3OKW A;  4J82 A;  3SCY A;  4JSP C;  3IIW A;  2BCJ B;  5I5M A;  4AEZ A;  1OLZ A;  1N6F A;  2W18 A;  3OKT A;  4E54 B;  2Q7Q A;  2HKM A;  3JZN A;  4IMM A;  5HE0 B;  1RI6 A;  3OKY A;  5H14 A;  2I0R A;  3I8C A;  2PM9 B;  3EI4 B;  4ZOX A;  4OWR A;  4GGA A;  2QC5 A;  1TBG A;  4ZOZ A;  4J81 A;  3SBR A;  4N14 A;  2B4E A;  4U7A A;  4GM3 A;  3HFQ A;  4J77 A;  3N0E A;  3L4O D;  3ORV D;  1L0Q A;  4CI8 A;  3V5W B;  2I3T A;  4NSX A;  5EM2 B;  3SWS D;  3AL9 A;  1MDA H;  5TF2 A;  4HDJ A;  5EAL A;  5EMM B;  4A08 B;  4FAV D;  2OK6 A;  3VA6 A;  4A09 A;  4K3I D;  3ZWL B;  4GMB A;  2O9K A;  2PM6 B;  3RSE C;  2OVR B;  2AQ5 A;  4KFM B;  3OTT A;  5TDH B;  4A0A B;  5CXC A;  3JZH A;  3MKQ A;  2GC7 A;  2CNX A;  1K32 A;  2IWF A;  4CI3 A;  2H9M A;  2YNO A;  1GP2 B;  2PM7 B;  2XU7 A;  1U4C A;  2H3X A;  3AL8 B;  2H13 A;  3EI1 B;  2Z2N A;  2IUR A;  2MTA H;  4ES0 A;  2AH0 A;  5FQD A;  3CFS B;  4JSV C;  5AJA A;  2UZX B;  3GRE A;  1YFQ A;  3P4F A;  4ZOV A;  2YNP A;  4QT8 A;  4FHL A;  4A2L A;  5TEF A;  3EWE A;  2OJY A;  4O3U B;  1FWX A;  1MG2 A;  4LG9 A;  5TEE A;  4E54 A;  4J8B A;  2OIZ A;  2TRC B;  5IJ8 E;  2AGZ A;  2PM9 A;  1OMW B;  4FA1 D;  3EI4 A;  4FAN D;  3EI3 B;  4JT6 C;  4ZOY A;  1NR0 A;  1SHY B;  2CN2 A;  3SLE D;  1VYH C;  2J57 G;  3IIY A;  5GMK n;  4GQ1 A;  3EI2 B;  5CXB B; 
#chains in the Genus database with same CATH topology
 1O6F A;  2J56 H;  4PSX B;  2VDM A;  1H2Z A;  4QAM A;  5FKR A;  3V4P A;  4A08 A;  3C5M A;  4MMZ A;  3I89 A;  3OF7 A;  5GSA A;  4BP9 A;  2OVP B;  2YBA A;  1BPO A;  5FKQ A;  3I7K A;  3JRP A;  5C2V B;  5FFG A;  1QFM A;  3A0F A;  4FA9 D;  2VDR A;  4X60 B;  1N6D A;  4GGC A;  2YNN A;  5K19 A;  4A0A A;  3GFC A;  4X61 B;  4G1M A;  2EID A;  3PSL A;  4D9S A;  4G56 B;  2EBS A;  4AN1 A;  3GD1 I;  4Z8L A;  1S4U X;  3CIK B;  5AFU 3;  3SHF A;  2H9L A;  3UVL A;  4CZV A;  4QQE A;  4CY2 A;  1SQJ A;  5EMJ B;  3IUR A;  4GZ8 A;  3UVM A;  3UR4 A;  3ULE C;  3W15 A;  2IWK A;  4YVD A;  4U1E I;  4JD2 C;  4JHN A;  4GGD A;  5KDO B;  4J84 A;  5M5T A;  3V4V A;  5FXY A;  4XEI C;  2IAA A;  2HXC A;  2AGY A;  3FM0 A;  3PXS D;  2VDO A;  2J55 H;  2B5N A;  1T2X A;  1PGU A;  4R7A B;  4BP8 A;  1L5G A;  3F3F A;  2I3S A;  5THA A;  3OL2 B;  4AX4 A;  3I7O A;  5HDB A;  3J81 g;  5FKT A;  2PBI B;  2I0S A;  2HJ4 A;  1B9X A;  2GC4 A;  2AGX A;  4A7J A;  4JSN C;  3EI3 A;  1QNI A;  3QHY B;  4Z7O A;  1JOF A;  4O45 A;  4UM9 A;  4ERY A;  1XIP A;  2I0T A;  3K26 A;  2CE9 A;  4L3H D;  4D6V A;  5EAM A;  1JJU B;  3IJC A;  3I7N A;  5CYK B;  3EI2 A;  1C9L A;  4O9D A;  3K71 A;  2HES X;  5CXB A;  1GG2 B;  1K3I A;  1SQ9 A;  4CZX A;  2AH1 A;  2VC2 A;  3ZDZ A;  3C99 A;  4CI2 A;  5FKS A;  4GQB B;  3IKO A;  2VDL A;  4J73 A;  3MMY A;  2P9P C;  3JZG A;  3O4J A;  4AN0 A;  1K8K C;  3JPX A;  3IUN A;  1NEX B;  5I5I A;  4WJK A;  1GXR A;  3SBP A;  4FB1 D;  5IT9 g;  5IGQ A;  5JWZ A;  4A0B B;  4ERZ A;  2P9N C;  3T3P A;  4JT5 C;  2VDQ A;  3EQ9 A;  3VGZ A;  4MK0 B;  4IA9 A;  3ZE0 A;  3AH8 B;  3QI0 A;  3UKU C;  5SXM A;  1H2X A;  3KRX B;  3SFZ A;  4GM9 A;  2H6Q A;  1O6G A;  1VE7 A;  3IJE A;  3RN0 D;  4J8G A;  2H6K A;  3MZL A;  4ERQ A;  4E5Z B;  3IJ0 A;  3SMR A;  3RN1 D;  4L1Q D;  1TYE A;  2AGW A;  3JAM g;  4CY5 A;  5IJ7 E;  3KCI A;  1E8M A;  2P9I C;  4L9O A;  5EAP A;  2QXV A;  3NVN A;  4NBM A;  2HU8 A;  3VH0 A;  3DXK C;  3EU7 A;  1U8C A;  4UI9 R;  2H9N A;  2YB8 B;  1Q47 A;  3OL2 A;  2EIC A;  5EM2 A;  5HE3 B;  4O2W A;  2HU5 A;  4FA4 D;  4GM8 A;  3J80 g;  1VZ3 A;  4NEN A;  3IUJ A;  3VI4 A;  3SVW D;  4O1Q D;  4O02 A;  2BBK H;  5M5V A;  3SXT D;  1PBY B;  1GOG A;  4H5J A;  5EML B;  5M61 A;  3RMZ D;  4ESG A;  4LGN A;  5EMK B;  1P22 A;  3DXM C;  4AMZ A;  2VDP A;  2VZ3 A;  3SBQ A;  4CZY A;  2IUQ A;  2XYI A;  3DWL C;  3IUM A;  4J79 A;  5CYK A;  3V9F A;  3MKS B;  1ERJ A;  2UZY B;  2XE4 A;  4AOW A;  4O3T B;  4K3J B;  3NID A;  3AL8 A;  3PSC B;  3EI1 A;  3EQ7 A;  2VDN A;  3K72 A;  2WQ8 A;  3L4M D;  3O4I A;  4L3G D;  4QRJ A;  3IUQ A;  4JSX C;  4Z7N A;  5AMS A;  1U2V C;  1A0R B;  3BWS A;  3C9C A;  4WK2 A;  4RE5 A;  5C92 A;  4A0B A;  5H1M A;  1R5M A;  3NVQ A;  3MUN A;  2H14 A;  3VI3 A;  3OW8 A;  2Z2O A;  5B4W A;  1JMZ B;  1N6E A;  3JB9 L;  1UOQ A;  2IUP A;  2IUV A;  4PSW B;  3SJL D;  5FFO A;  3MXX A;  2P9S C;  4CY1 A;  4LG8 A;  3UVN A;  3K6S A;  3UVO A;  2P9K C;  4E5Z A;  2B5M A;  1GOH A;  4PNK B;  5EAR A;  3C75 H;  3EG6 A;  3PXW D;  2XL3 A;  5I5J A;  3RLM D;  4JXM A;  4A2M A;  5C2W B;  2AGL A;  3IVM A;  2VDK A;  4J78 A;  5A2Q g;  5IC7 A;  4PC0 A;  2P9U C;  4TZ4 A;  5E6U A;  1YR2 A;  5E6S A;  3K27 A;  4XYI A;  1JTD B;  2GNQ A;  3ZDX A;  4CY3 A;  4PXW A;  3RRM C;  4I79 A;  2JKX A;  3O4G A;  3MVD K;  1XHM A;  3PVU B;  5HE2 B;  4BL0 A;  5HQG A;  4D0K A;  3N0D A;  3I2N A;  2CE8 A;  4X63 B;  3NIF A;  2H9P A;  3PE7 A;  3I8E A;  2YMU A;  4A11 B;  3CFV A;  4CI1 A;  1A12 A;  4G55 A;  3DM0 A;  1MG3 A;  1GOT B;  5FA5 B;  4FA5 D;  2CN3 A;  3FGB A;  4XYH A;  2H6N A;  4Y7R A;  4FWW A;  5HE1 B;  4MMY A;  5E6R A;  3I7P A;  4CC9 A;  3PVW B;  3OKY B;  2OVQ B;  2HKR A;  3V7D B;  4ZN4 A;  3ODT A;  4J0X A;  1PI6 A;  3SN6 B;  4PBY A;  5H17 A;  4IRZ A;  2XL2 A;  3RFG A;  2QZP A;  3BG0 A;  1PEV A;  3PXT D;  3UVK A;  3IJ1 A;  4X3E A;  2H47 A;  2G9A A;  5FLX g;  1XKS A;  3MZK A;  2B5L A;  1B9Y A;  1H2W A;  2HU7 A;  3O4H A;  4H5I A;  2HYE A;  3EQ8 A;  2XDW A;  1GOF A;  3F3P A;  3JRO A;  3BG1 A;  3E0C A;  4WK4 A;  1TYQ C;  4EWR A;  2H68 A;  3I7L A;  4A09 B;  5C9Z B;  3DSM A;  4J87 A;  5IGO A;  4OZU A;  3AFC A;  2G99 A;  3I7H A;  4BH6 A;  5CXC B;  1UOO A;  3RFH A;  3EMH A;  4Y5R D;  5HYN B;  4BUJ C;  5M5S A;  3MUO A;  5K1C C;  5GXH A;  4Z7Q A;  4G1E A;  3KRW B;  4QL1 A;  2EIE A;  3F3G A;  1I2M B;  2OK4 A;  3DDU A;  4J0W A;  2HJB A;  2P9L C;  2Z2P A;  5M5U A;  2CO0 A;  3UKR C;  3U4Y A;  4J86 A;  4JHP C;  4GQ2 P;  2CO0 C;  3NVX A;  3FRX A;  4PBZ A;  1JMX B;  5GXI A;  4A11 A;  3B7F A;  3OKW A;  4J82 A;  4DNV A;  3SCY A;  4JSP C;  3IIW A;  2BCJ B;  4NC4 A;  5I5M A;  4BCB A;  4AEZ A;  1OLZ A;  1N6F A;  2W18 A;  1VZ2 A;  3OKT A;  4E54 B;  2Q7Q A;  2HKM A;  3JZN A;  4IMM A;  5HE0 B;  1RI6 A;  3OKY A;  5H14 A;  2I0R A;  3I8C A;  2PM9 B;  3EI4 B;  4ZOX A;  4OWR A;  4GGA A;  2QC5 A;  1TBG A;  4ZOZ A;  4J81 A;  3SBR A;  4N14 A;  3ZE1 A;  2B4E A;  3IUL A;  4U7A A;  4GM3 A;  4BCC A;  3HFQ A;  4J77 A;  4RE6 A;  1H2Y A;  3N0E A;  3L4O D;  3ORV D;  1L0Q A;  4CI8 A;  3V5W B;  2I3T A;  4NSX A;  1VE6 A;  5EM2 B;  3SWS D;  3AL9 A;  1MDA H;  5TF2 A;  4HDJ A;  5EAL A;  5EMM B;  4A08 B;  4FAV D;  2OK6 A;  3VA6 A;  4L1M A;  4A09 A;  4K3I D;  3ZWL B;  4GMB A;  2O9K A;  2PM6 B;  3RSE C;  3FCU A;  2OVR B;  1M1X A;  2AQ5 A;  4KFM B;  3OTT A;  5TDH B;  4A0A B;  4NAA A;  3JZH A;  5CXC A;  3ZDY A;  2EIB A;  3MKQ A;  2GC7 A;  2CNX A;  1K32 A;  2IWF A;  1E5T A;  4CI3 A;  2H9M A;  2YNO A;  2VZ1 A;  1GP2 B;  2PM7 B;  2XU7 A;  2XZG A;  3GC3 B;  1E8N A;  1U4C A;  2H3X A;  3AL8 B;  4DNW A;  2H13 A;  3EI1 B;  2Z2N A;  2IUR A;  3NIG A;  1UTC A;  2MTA H;  1C9I A;  4UM8 A;  3ZE2 A;  4ES0 A;  2AH0 A;  5FQD A;  5M5R A;  4AMY A;  1QFS A;  3CFS B;  4JSV C;  5AJA A;  4DNU A;  2UZX B;  3GRE A;  1YFQ A;  3FCS A;  3P4F A;  4ZOV A;  2YNP A;  4QT8 A;  4FHL A;  4A2L A;  5TEF A;  3EWE A;  2OJY A;  4O3U B;  1FWX A;  3T3M A;  4MMX A;  1MG2 A;  4LG9 A;  5TEE A;  4E54 A;  4J8B A;  2OIZ A;  2TRC B;  5IJ8 E;  2AGZ A;  1UOP A;  4WK0 A;  2PM9 A;  1OMW B;  4BCD A;  4FA1 D;  3EI4 A;  4FAN D;  3EI3 B;  4JT6 C;  5C86 A;  4ZOY A;  1NR0 A;  2QR5 A;  1SHY B;  2CN2 A;  3SLE D;  1VYH C;  1JV2 A;  2J57 G;  3IIY A;  5GMK n;  4GQ1 A;  3EI2 B;  2BKL A;  5CXB B; 
#chains in the Genus database with same CATH homology
 2J56 H;  4PSX B;  5FKR A;  4A08 A;  3C5M A;  3I89 A;  5GSA A;  2OVP B;  2YBA A;  5FKQ A;  3I7K A;  3JRP A;  5C2V B;  3A0F A;  4FA9 D;  4X60 B;  1N6D A;  4GGC A;  2YNN A;  5K19 A;  4A0A A;  3GFC A;  4X61 B;  3PSL A;  4G56 B;  2EBS A;  4Z8L A;  1S4U X;  3CIK B;  5AFU 3;  3SHF A;  2H9L A;  3UVL A;  4CZV A;  4QQE A;  4CY2 A;  1SQJ A;  5EMJ B;  4GZ8 A;  3UVM A;  3UR4 A;  3ULE C;  3W15 A;  2IWK A;  4YVD A;  4U1E I;  4JD2 C;  4GGD A;  5KDO B;  4J84 A;  5FXY A;  4XEI C;  2IAA A;  2HXC A;  2AGY A;  3FM0 A;  3PXS D;  2J55 H;  2B5N A;  1PGU A;  4R7A B;  3F3F A;  2I3S A;  5THA A;  3OL2 B;  3I7O A;  3J81 g;  5FKT A;  2PBI B;  2I0S A;  2HJ4 A;  1B9X A;  2GC4 A;  2AGX A;  4A7J A;  4JSN C;  3EI3 A;  1QNI A;  1JOF A;  4O45 A;  4ERY A;  1XIP A;  2I0T A;  3K26 A;  2CE9 A;  4L3H D;  4D6V A;  5EAM A;  1JJU B;  3IJC A;  3I7N A;  5CYK B;  3EI2 A;  4O9D A;  2HES X;  5CXB A;  1GG2 B;  1SQ9 A;  4CZX A;  2AH1 A;  3C99 A;  4CI2 A;  5FKS A;  4GQB B;  3IKO A;  4J73 A;  3MMY A;  2P9P C;  3JZG A;  1K8K C;  3JPX A;  1NEX B;  5I5I A;  1GXR A;  3SBP A;  4FB1 D;  5IT9 g;  5IGQ A;  5JWZ A;  4A0B B;  4ERZ A;  2P9N C;  4JT5 C;  3VGZ A;  4MK0 B;  4IA9 A;  3AH8 B;  3UKU C;  5SXM A;  3KRX B;  3SFZ A;  4GM9 A;  2H6Q A;  3RN0 D;  4J8G A;  2H6K A;  3MZL A;  4ERQ A;  4E5Z B;  3IJ0 A;  3SMR A;  3RN1 D;  4L1Q D;  2AGW A;  3JAM g;  4CY5 A;  5IJ7 E;  2P9I C;  4L9O A;  5EAP A;  2QXV A;  3NVN A;  3VH0 A;  3DXK C;  3EU7 A;  4UI9 R;  2H9N A;  2YB8 B;  1Q47 A;  3OL2 A;  5EM2 A;  5HE3 B;  4FA4 D;  4GM8 A;  3J80 g;  3SVW D;  4O1Q D;  2BBK H;  3SXT D;  1PBY B;  4H5J A;  5EML B;  3RMZ D;  4ESG A;  4LGN A;  5EMK B;  1P22 A;  3DXM C;  3SBQ A;  4CZY A;  2IUQ A;  2XYI A;  3DWL C;  4J79 A;  5CYK A;  3V9F A;  3MKS B;  1ERJ A;  2UZY B;  4AOW A;  4O3T B;  4K3J B;  3AL8 A;  3PSC B;  3EI1 A;  3L4M D;  4L3G D;  4QRJ A;  4JSX C;  5AMS A;  1U2V C;  1A0R B;  3BWS A;  3C9C A;  4A0B A;  5H1M A;  1R5M A;  3NVQ A;  2H14 A;  3OW8 A;  2Z2O A;  5B4W A;  1JMZ B;  1N6E A;  3JB9 L;  2IUP A;  2IUV A;  4PSW B;  3SJL D;  3MXX A;  2P9S C;  4CY1 A;  4LG8 A;  3UVN A;  3UVO A;  2P9K C;  4E5Z A;  2B5M A;  4PNK B;  5EAR A;  3C75 H;  3EG6 A;  3PXW D;  2XL3 A;  5I5J A;  3RLM D;  4JXM A;  4A2M A;  5C2W B;  2AGL A;  4J78 A;  5A2Q g;  5IC7 A;  4PC0 A;  2P9U C;  4TZ4 A;  3K27 A;  4XYI A;  2GNQ A;  4CY3 A;  4PXW A;  3RRM C;  4I79 A;  1XHM A;  3PVU B;  5HE2 B;  4BL0 A;  5HQG A;  4D0K A;  3N0D A;  3I2N A;  2CE8 A;  4X63 B;  2H9P A;  3PE7 A;  3I8E A;  2YMU A;  4A11 B;  3CFV A;  4CI1 A;  5FA5 B;  3DM0 A;  1MG3 A;  1GOT B;  4FA5 D;  2CN3 A;  3FGB A;  4XYH A;  2H6N A;  4Y7R A;  4FWW A;  5HE1 B;  3I7P A;  4CC9 A;  3PVW B;  3OKY B;  2OVQ B;  2HKR A;  3V7D B;  4ZN4 A;  3ODT A;  4J0X A;  1PI6 A;  3SN6 B;  4PBY A;  5H17 A;  2XL2 A;  3RFG A;  3BG0 A;  1PEV A;  3PXT D;  3UVK A;  3IJ1 A;  4X3E A;  2H47 A;  2G9A A;  5FLX g;  1XKS A;  3MZK A;  2B5L A;  1B9Y A;  4H5I A;  2HYE A;  3F3P A;  3JRO A;  3BG1 A;  3E0C A;  1TYQ C;  4EWR A;  2H68 A;  3I7L A;  4A09 B;  5C9Z B;  3DSM A;  4J87 A;  5IGO A;  4OZU A;  3AFC A;  2G99 A;  3I7H A;  4BH6 A;  5CXC B;  3RFH A;  3EMH A;  4Y5R D;  5HYN B;  4BUJ C;  5K1C C;  5GXH A;  3KRW B;  4QL1 A;  3F3G A;  2OK4 A;  4J0W A;  2HJB A;  2P9L C;  2Z2P A;  2CO0 A;  3UKR C;  3U4Y A;  4J86 A;  4GQ2 P;  2CO0 C;  3NVX A;  3FRX A;  4PBZ A;  1JMX B;  5GXI A;  4A11 A;  3B7F A;  3OKW A;  4J82 A;  3SCY A;  4JSP C;  3IIW A;  2BCJ B;  5I5M A;  4AEZ A;  1OLZ A;  1N6F A;  2W18 A;  3OKT A;  4E54 B;  2Q7Q A;  2HKM A;  3JZN A;  4IMM A;  5HE0 B;  1RI6 A;  3OKY A;  5H14 A;  2I0R A;  3I8C A;  2PM9 B;  3EI4 B;  4ZOX A;  4OWR A;  4GGA A;  2QC5 A;  1TBG A;  4ZOZ A;  4J81 A;  3SBR A;  4N14 A;  2B4E A;  4U7A A;  4GM3 A;  3HFQ A;  4J77 A;  3N0E A;  3L4O D;  3ORV D;  1L0Q A;  4CI8 A;  3V5W B;  2I3T A;  4NSX A;  5EM2 B;  3SWS D;  3AL9 A;  1MDA H;  5TF2 A;  4HDJ A;  5EAL A;  5EMM B;  4A08 B;  4FAV D;  2OK6 A;  3VA6 A;  4A09 A;  4K3I D;  3ZWL B;  4GMB A;  2O9K A;  2PM6 B;  3RSE C;  2OVR B;  2AQ5 A;  4KFM B;  3OTT A;  5TDH B;  4A0A B;  5CXC A;  3JZH A;  3MKQ A;  2GC7 A;  2CNX A;  1K32 A;  2IWF A;  4CI3 A;  2H9M A;  2YNO A;  1GP2 B;  2PM7 B;  2XU7 A;  1U4C A;  2H3X A;  3AL8 B;  2H13 A;  3EI1 B;  2Z2N A;  2IUR A;  2MTA H;  4ES0 A;  2AH0 A;  5FQD A;  3CFS B;  4JSV C;  5AJA A;  2UZX B;  3GRE A;  1YFQ A;  3P4F A;  4ZOV A;  2YNP A;  4QT8 A;  4FHL A;  4A2L A;  5TEF A;  3EWE A;  2OJY A;  4O3U B;  1FWX A;  1MG2 A;  4LG9 A;  5TEE A;  4E54 A;  4J8B A;  2OIZ A;  2TRC B;  5IJ8 E;  2AGZ A;  2PM9 A;  1OMW B;  4FA1 D;  3EI4 A;  4FAN D;  3EI3 B;  4JT6 C;  4ZOY A;  1NR0 A;  1SHY B;  2CN2 A;  3SLE D;  1VYH C;  2J57 G;  3IIY A;  5GMK n;  4GQ1 A;  3EI2 B;  5CXB B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...