2H6QA

Histone h3 recognition and presentation by the wdr5 module of the mll1 complex
Total Genus 103
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
103
sequence length
304
structure length
304
Chain Sequence
VKPNYALKFTLAGHTKAVSSVKFSPNGEWLASSSADKLIKIWGAYDGKFEKTISGHKLGISDVAWSSDSNLLVSASDDKTLKIWDVSSGKCLKTLKGHSNYVFCCNFNPQSNLIVSGSFDESVRIWDVKTGKCLKTLPAHSDPVSAVHFNRDGSLIVSSSYDGLCRIWDTASGQCLKTLIDDDNPPVSFVKFSPNGKYILAATLDNTLKLWDYSKGKCLKTYTGHKNEKYCIFANFSVTGGKWIVSGSEDNLVYIWNLQTKEIVQKLQGHTDVVISTACHPTENIIASAALENDKTIKLWKSDC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords WD-repeat protein 5
publication title Histone H3 recognition and presentation by the WDR5 module of the MLL1 complex.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Gene regulation
total genus 103
structure length 304
sequence length 304
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-06-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00400 WD40 WD domain, G-beta repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 2h6qA00
4BUJC 4PNKB 3UR4A 4GM9A 3JROA 2UZXB 4QL1A 5CXBA 2W18A 4H5JA 4J0WA 4L3HD 5KDOB 5I5JA 2GNQA 4JSVC 3EI2B 2CN2A 2H47A 3C99A 4JT5C 3I8CA 5IT9g 5SXMA 4PXWA 2MTAH 5CXCB 2AGZA 4FAVD 4GQ2P 4O9DA 5FKQA 2P9NC 3RFGA 1K8KC 1N6FA 3I7HA 3OKTA 2OJYA 4AOWA 4ERYA 2IUVA 2P9KC 4O3TB 4FA5D 3EU7A 2CE9A 4J82A 3P4FA 3C5MA 4BH6A 3PXTD 3ULEC 4CI8A 5JWZA 3EWEA 3IIWA 1PEVA 3CFSB 5IC7A 3SLED 4PBYA 1GOTB 5GXIA 5HYNB 3JB9L 1RI6A 3U4YA 3JZGA 3EI4A 4D6VA 4O3UB 5I5MA 3EI2A 3RRMC 3SXTD 3UVOA 2HKMA 4I79A 3IKOA 2AH1A 2P9IC 4E54B 4A0BB 3GFCA 4IA9A 3OKYB 5C2VB 2I0RA 4H5IA 1R5MA 3KRWB 2CNXA 3CFVA 3VH0A 2I3TA 4JXMA 1N6EA 4X63B 5GMKn 2XL3A 3KRXB 3BWSA 5FKRA 3DM0A 3EMHA 2H3XA 4U7AA 2H14A 3E0CA 4FAND 4J77A 5HE0B 4GZ8A 2P9SC 4K3ID 2YNOA 4N14A 4OWRA 3N0DA 3J80g 3MZKA 5IJ7E 4PBZA 4CZYA 1P22A 4G56B 3SCYA 4A11B 3L4OD 4OZUA 3MKQA 4J81A 4ESGA 2TRCB 3C9CA 5EMJB 4A0AA 4GGDA 2HJ4A 2XYIA 1XKSA 1B9XA 1B9YA 2AGWA 1SQ9A 2Z2OA 3RFHA 2IAAA 3JAMg 4E54A 4A0BA 3SVWD 1ERJA 2UZYB 4A2MA 5THAA 2H6NA 4JT6C 1PI6A 4YVDA 5FKTA 5EM2A 1MG3A 3GREA 5IGOA 1JMXB 3MKSB 4O1QD 1NEXB 3BG0A 1TBGA 1VYHC 3RN0D 3JRPA 4J8BA 5H17A 4L3GD 2P9PC 2PBIB 2CN3A 4JD2C 4A2LA 4XYHA 1N6DA 3AL8B 5FLXg 2PM9B 2OVQB 5A2Qg 4CZVA 2IURA 2AQ5A 4FA9D 5C9ZB 5HE2B 4E5ZB 1A0RB 3UVKA 1L0QA 3PVWB 1GP2B 1GG2B 3JZNA 2H6KA 4J78A 1FWXA 3SJLD 3PSLA 3V7DB 2BCJB 4KFMB 3RSEC 2XL2A 2EBSA 1K32A 1MDAH 4O45A 5AMSA 3IJCA 4JSNC 1OMWB 3HFQA 3SHFA 3V9FA 2Q7QA 5EMLB 5FA5B 2HKRA 3RN1D 3MXXA 2OK4A 3ODTA 4GGCA 4ZN4A 3AFCA 4FB1D 3VA6A 4FA1D 2H9PA 2OIZA 2H9LA 4J86A 1JMZB 3SBRA 4GM3A 3AL8A 5EMKB 4J84A 3JZHA 2PM7B 2PM9A 3K27A 3MMYA 5CXCA 3OTTA 2AGLA 5AFU3 3SBQA 4GMBA 3SFZA 4K3JB 4E5ZA 2GC4A 4PC0A 4JSXC 4J79A 2H9NA 3JPXA 1SHYB 3F3PA 5EALA 1PBYB 4ES0A 3B7FA 3IIYA 5TEFA 2AGXA 2I3SA 4LGNA 4A08B 3OW8A 4LG8A 4XYIA 2HJBA 1MG2A 5AJAA 3UKRC 2YMUA 4J8GA 4ZOYA 2I0SA 3EG6A 4CC9A 3I89A 4X3EA 3UVMA 3VGZA 3AL9A 2G9AA 2OVRB 2IUQA 3CIKB 4J0XA 4CI2A 5HE1B 4GQBB 5FXYA 4A09B 3EI1B 5K1CC 4ZOVA 3PXWD 2H68A 3I7OA 4PSWB 4ERZA 4Y7RA 4J87A 2OVPB 3OKYA 5K19A 4CY2A 1OLZA 2XU7A 4J73A 2QXVA 3SWSD 5IGQA 4CY5A 2QC5A 3UVLA 4UI9R 4FWWA 3FM0A 4PSXB 3FRXA 3PSCB 4R7AB 3IJ1A 2HYEA 2H6QA 3BG1A 3DXMC 1PGUA 4EWRA 4X61B 2B5LA 4A08A 5GSAA 2Z2NA 2OK6A 3PVUB 3I7PA 2Z2PA 3EI3B 1U4CA 4QT8A 2YB8B 4JSPC 3EI4B 4LG9A 3C75H 3DSMA 3J81g 4A11A 3ORVD 4ERQA 3N0EA 5EAPA 2CE8A 3NVQA 4NSXA 3SMRA 2H9MA 3I2NA 3F3GA 4QRJA 2P9LC 4QQEA 5GXHA 1YFQA 4FHLA 4A09A 2CO0C 3EI1A 4IMMA 3I8EA 4TZ4A 2HXCA 4L9OA 2HESX 3PXSD 3PE7A 5HQGA 4FA4D 4ZOZA 2IWKA 2GC7A 5B4WA 2J57G 1U2VC 4U1EI 5H1MA 3SBPA 3OL2B 1S4UX 2B5MA 3FGBA 4ZOXA 3AH8B 3OKWA 5HE3B 4CZXA 3NVXA 3NVNA 4CI1A 5IJ8E 1NR0A 2P9UC 4A0AB 3ZWLB 5CYKB 3EI3A 4A7JA 3I7LA 3IJ0A 2J56H 2B5NA 4GM8A 2B4EA 2AGYA 4HDJA 3DXKC 3RLMD 3RMZD 4CY1A 5EARA 5EAMA 1XIPA 5C2WB 5I5IA 3L4MD 2CO0A 5CXBB 4AEZA 5EM2B 4X60B 4GQ1A 5FKSA 3MZLA 5FQDA 3V5WB 3I7NA 5TEEA 4XEIC 5TDHB 3K26A 4CY3A 1QNIA 2O9KA 2H13A 5TF2A 2BBKH 2I0TA 2IWFA 3UKUC 1GXRA 2YNPA 3I7KA 1TYQC 2YBAA 3UVNA 2J55H 1JOFA 3OL2A 3SN6B 1JJUB 4BL0A 4GGAA 2AH0A 4Y5RD 4D0KA 4Z8LA 3DWLC 2YNNA 2G99A 3A0FA 5EMMB 1Q47A 2PM6B 2IUPA 5CYKA 1SQJA 3F3FA 3W15A 4L1QD 4MK0B 1XHMA 4CI3A 5H14A
chains in the Genus database with same CATH superfamily
4O2WA 4BUJC 4PNKB 3UR4A 1A12A 4GM9A 3JROA 2UZXB 4QL1A 5CXBA 2W18A 4H5JA 4J0WA 1H2YA 2VZ3A 1H2ZA 3ZE1A 4L3HD 5KDOB 4WJKA 5I5JA 2GNQA 4JSVC 4RE5A 3EI2B 2CN2A 2H47A 3C99A 3ZE2A 4Z7OA 4BCBA 4JT5C 1JTDB 3DDUA 3I8CA 5IT9g 1YR2A 5SXMA 4PXWA 2MTAH 2WQ8A 5CXCB 2AGZA 4FAVD 5M5RA 4GQ2P 3IURA 4O9DA 5FKQA 2P9NC 1T2XA 3RFGA 1K8KC 1N6FA 3I7HA 3OKTA 2OJYA 4AOWA 4ERYA 1UOPA 2IUVA 2P9KC 2EIDA 4O3TB 3EU7A 4FA5D 2CE9A 4J82A 3P4FA 3O4HA 3NIGA 3C5MA 4BH6A 3PXTD 3ULEC 4CI8A 5JWZA 3EWEA 3IIWA 4G1MA 1PEVA 3K71A 3CFSB 5IC7A 3SLED 1UTCA 4PBYA 5HDBA 1GOTB 2VDRA 5GXIA 5HYNB 3GC3B 3JB9L 1RI6A 3U4YA 3JZGA 3EI4A 3FCSA 4D6VA 4O3UB 5I5MA 3EI2A 3RRMC 3SXTD 4WK0A 3UVOA 2HKMA 4I79A 3IKOA 2AH1A 2P9IC 2VDPA 1O6GA 4E54B 4A0BB 3GFCA 4IA9A 3OKYB 4DNWA 5C2VB 2I0RA 4H5IA 1R5MA 3KRWB 2CNXA 3CFVA 3MVDK 3VH0A 2I3TA 4JXMA 2XDWA 1N6EA 3O4GA 4X63B 5GMKn 2XL3A 3KRXB 3BWSA 5FKRA 1VE6A 3DM0A 1QFMA 3EMHA 2H3XA 4U7AA 2H14A 3E0CA 4AN0A 4FAND 4J77A 5HE0B 4GZ8A 3KCIA 3V4PA 2P9SC 4K3ID 2YNOA 4N14A 1H2XA 4OWRA 4G55A 3N0DA 3J80g 3MZKA 5IJ7E 4PBZA 4CZYA 1P22A 4G56B 3SCYA 4A11B 3L4OD 4OZUA 3MKQA 4J81A 4ESGA 2TRCB 3C9CA 5EMJB 4A0AA 4GGDA 2HJ4A 2XYIA 5M5TA 1I2MB 1XKSA 1B9XA 1B9YA 2AGWA 3QI0A 1SQ9A 2Z2OA 3RFHA 2IAAA 3MUNA 3T3PA 3JAMg 4E54A 4A0BA 3SVWD 1ERJA 2UZYB 4A2MA 5THAA 4DNUA 2H6NA 4JT6C 1PI6A 4YVDA 5FKTA 5EM2A 1MG3A 3GREA 5IGOA 3MKSB 1JMXB 2VDMA 4O1QD 1GOFA 4AMYA 1NEXB 3BG0A 1TBGA 1VYHC 3RN0D 3JRPA 4NAAA 4J8BA 5H17A 5M5VA 4L3GD 2P9PC 2PBIB 2CN3A 4JD2C 4A2LA 4XYHA 1N6DA 3AL8B 3O4JA 5FLXg 3NIDA 2PM9B 3V4VA 2OVQB 5A2Qg 4CZVA 2IURA 2AQ5A 4FA9D 5C9ZB 5HE2B 4E5ZB 2EIEA 3K6SA 1A0RB 3UVKA 1L0QA 3PVWB 5C86A 1GP2B 1GG2B 3JZNA 2H6KA 4J78A 1FWXA 3SJLD 1E5TA 1QFSA 3PSLA 5M61A 5M5SA 1H2WA 5FFGA 3V7DB 5E6SA 1E8NA 2BCJB 4KFMB 4UM8A 3RSEC 2XL2A 2EBSA 1K32A 1MDAH 3ZDXA 3T3MA 4O45A 5AMSA 3IJCA 4O02A 4JSNC 4BP9A 2HU5A 1OMWB 3HFQA 3SHFA 3V9FA 2Q7QA 5EMLB 5FA5B 2HKRA 3RN1D 3MXXA 4JHNA 2OK4A 3ODTA 4GGCA 4ZN4A 3AFCA 4FB1D 3VA6A 4FA1D 2VDNA 2H9PA 2OIZA 1UOOA 2H9LA 4J86A 1JMZB 3SBRA 3FCUA 4GM3A 4BP8A 3AL8A 2BKLA 5EMKB 4J84A 3JZHA 2PM7B 2PM9A 3K27A 3MMYA 5CXCA 3OTTA 4NC4A 2AGLA 5AFU3 3SBQA 4GMBA 3SFZA 4K3JB 4E5ZA 2GC4A 4PC0A 4JSXC 1E8MA 4J79A 2H9NA 3QHYB 3JPXA 4D9SA 1SHYB 3F3PA 5EALA 1PBYB 4ES0A 3B7FA 3IIYA 5TEFA 2AGXA 2I3SA 4LGNA 4A08B 3OW8A 4LG8A 4XYIA 2HJBA 1MG2A 5AJAA 3UKRC 2YMUA 4AN1A 2XZGA 4QAMA 4J8GA 1C9IA 4Z7NA 4ZOYA 5C92A 2I0SA 3IVMA 3EG6A 2JKXA 4CC9A 3I89A 4X3EA 3UVMA 3VGZA 4BCCA 3AL9A 2G9AA 5FFOA 2OVRB 2IUQA 3CIKB 4J0XA 2EICA 5HE1B 4CI2A 4GQBB 5FXYA 4A09B 3EI1B 5E6RA 5K1CC 3OF7A 4ZOVA 3PXWD 2H68A 3I7OA 4PSWB 4ERZA 4Y7RA 4J87A 2OVPB 3OKYA 5K19A 4CY2A 1OLZA 2XU7A 3IJEA 2QXVA 4J73A 3SWSD 4DNVA 2VDOA 5IGQA 4CY5A 2QC5A 2XE4A 3UVLA 4UI9R 1GOGA 3FM0A 4FWWA 4PSXB 3FRXA 3PSCB 4R7AB 3IJ1A 2QR5A 2HYEA 4Z7QA 2H6QA 3BG1A 4WK2A 3DXMC 1PGUA 4EWRA 4X61B 2B5LA 4A08A 5GSAA 2Z2NA 2OK6A 3PVUB 3I7PA 2Z2PA 3EI3B 1U4CA 4QT8A 2YB8B 4JSPC 3EI4B 5M5UA 4LG9A 3C75H 3DSMA 3MUOA 3J81g 4A11A 3VI4A 3ORVD 4ERQA 1JV2A 3N0EA 5EAPA 2CE8A 3NVQA 4NSXA 3SMRA 2H9MA 3I2NA 3F3GA 4QRJA 1VZ2A 2P9LC 4QQEA 3IUJA 1C9LA 5GXHA 1YFQA 4FHLA 4AMZA 4A09A 2CO0C 3EI1A 3VI3A 4IMMA 3I8EA 4L1MA 4TZ4A 2HXCA 4L9OA 2HESX 3PXSD 4UM9A 2EIBA 3PE7A 5HQGA 4BCDA 4FA4D 4ZOZA 2IWKA 2GC7A 4MMXA 1GOHA 5B4WA 2J57G 1U2VC 4U1EI 3ZE0A 5H1MA 3SBPA 1S4UX 3OL2B 2B5MA 3FGBA 4ZOXA 3IUMA 3AH8B 2VC2A 3IUQA 3OKWA 5HE3B 3IUNA 2VZ1A 4RE6A 2HU7A 4CZXA 3NVXA 3NVNA 4CI1A 3ZDYA 5IJ8E 1NR0A 2P9UC 1VE7A 4NENA 4A0AB 4JHPC 3ZWLB 5CYKB 3EI3A 4G1EA 3K72A 4A7JA 3I7LA 3IJ0A 2J56H 2B5NA 4GM8A 4IRZA 2B4EA 3NIFA 2AGYA 3EQ9A 4HDJA 1VZ3A 2QZPA 3DXKC 3GD1I 3RLMD 3RMZD 4CY1A 5EARA 1L5GA 5EAMA 3ZDZA 1XIPA 4NBMA 5C2WB 3L4MD 5I5IA 1BPOA 2CO0A 5CXBB 2VDKA 4AEZA 5EM2B 4X60B 4MMYA 4GQ1A 5FKSA 3MZLA 5FQDA 3V5WB 3I7NA 5TEEA 4XEIC 3EQ8A 5TDHB 3K26A 3IULA 3O4IA 4CY3A 1QNIA 2O9KA 1M1XA 2H13A 5TF2A 2BBKH 2I0TA 2IWFA 1U8CA 3UKUC 1GXRA 2VDQA 2VDLA 2YNPA 3I7KA 1TYQC 2YBAA 3UVNA 2J55H 4WK4A 1JOFA 1O6FA 3OL2A 3SN6B 3EQ7A 4AX4A 4MMZA 1JJUB 4BL0A 4GGAA 2AH0A 4Y5RD 4D0KA 4Z8LA 3DWLC 2YNNA 2G99A 2HU8A 3A0FA 5EMMB 1Q47A 2PM6B 2IUPA 1K3IA 5CYKA 1SQJA 1TYEA 3F3FA 3W15A 4L1QD 4MK0B 1UOQA 1XHMA 4CI3A 5H14A 5E6UA
chains in the Genus database with same CATH topology
4BUJC 4PNKB 3UR4A 4GM9A 3JROA 2UZXB 4QL1A 5CXBA 2W18A 4H5JA 4J0WA 4L3HD 5KDOB 5I5JA 2GNQA 4JSVC 3EI2B 2CN2A 2H47A 3C99A 4JT5C 3I8CA 5IT9g 5SXMA 4PXWA 2MTAH 5CXCB 2AGZA 4FAVD 4GQ2P 4O9DA 5FKQA 2P9NC 3RFGA 1K8KC 1N6FA 3I7HA 3OKTA 2OJYA 4AOWA 4ERYA 2IUVA 2P9KC 4O3TB 4FA5D 3EU7A 2CE9A 4J82A 3P4FA 3C5MA 4BH6A 3PXTD 3ULEC 4CI8A 5JWZA 3EWEA 3IIWA 1PEVA 3CFSB 5IC7A 3SLED 4PBYA 1GOTB 5GXIA 5HYNB 3JB9L 1RI6A 3U4YA 3JZGA 3EI4A 4D6VA 4O3UB 5I5MA 3EI2A 3RRMC 3SXTD 3UVOA 2HKMA 4I79A 3IKOA 2AH1A 2P9IC 4E54B 4A0BB 3GFCA 4IA9A 3OKYB 5C2VB 2I0RA 4H5IA 1R5MA 3KRWB 2CNXA 3CFVA 3VH0A 2I3TA 4JXMA 1N6EA 4X63B 5GMKn 2XL3A 3KRXB 3BWSA 5FKRA 3DM0A 3EMHA 2H3XA 4U7AA 2H14A 3E0CA 4FAND 4J77A 5HE0B 4GZ8A 2P9SC 4K3ID 2YNOA 4N14A 4OWRA 3N0DA 3J80g 3MZKA 5IJ7E 4PBZA 4CZYA 1P22A 4G56B 3SCYA 4A11B 3L4OD 4OZUA 3MKQA 4J81A 4ESGA 2TRCB 3C9CA 5EMJB 4A0AA 4GGDA 2HJ4A 2XYIA 1XKSA 1B9XA 1B9YA 2AGWA 1SQ9A 2Z2OA 3RFHA 2IAAA 3JAMg 4E54A 4A0BA 3SVWD 1ERJA 2UZYB 4A2MA 5THAA 2H6NA 4JT6C 1PI6A 4YVDA 5FKTA 5EM2A 1MG3A 3GREA 5IGOA 1JMXB 3MKSB 4O1QD 1NEXB 3BG0A 1TBGA 1VYHC 3RN0D 3JRPA 4J8BA 5H17A 4L3GD 2P9PC 2PBIB 2CN3A 4JD2C 4A2LA 4XYHA 1N6DA 3AL8B 5FLXg 2PM9B 2OVQB 5A2Qg 4CZVA 2IURA 2AQ5A 4FA9D 5C9ZB 5HE2B 4E5ZB 1A0RB 3UVKA 1L0QA 3PVWB 1GP2B 1GG2B 3JZNA 2H6KA 4J78A 1FWXA 3SJLD 3PSLA 3V7DB 2BCJB 4KFMB 3RSEC 2XL2A 2EBSA 1K32A 1MDAH 4O45A 5AMSA 3IJCA 4JSNC 1OMWB 3HFQA 3SHFA 3V9FA 2Q7QA 5EMLB 5FA5B 2HKRA 3RN1D 3MXXA 2OK4A 3ODTA 4GGCA 4ZN4A 3AFCA 4FB1D 3VA6A 4FA1D 2H9PA 2OIZA 2H9LA 4J86A 1JMZB 3SBRA 4GM3A 3AL8A 5EMKB 4J84A 3JZHA 2PM7B 2PM9A 3K27A 3MMYA 5CXCA 3OTTA 2AGLA 5AFU3 3SBQA 4GMBA 3SFZA 4K3JB 4E5ZA 2GC4A 4PC0A 4JSXC 4J79A 2H9NA 3JPXA 1SHYB 3F3PA 5EALA 1PBYB 4ES0A 3B7FA 3IIYA 5TEFA 2AGXA 2I3SA 4LGNA 4A08B 3OW8A 4LG8A 4XYIA 2HJBA 1MG2A 5AJAA 3UKRC 2YMUA 4J8GA 4ZOYA 2I0SA 3EG6A 4CC9A 3I89A 4X3EA 3UVMA 3VGZA 3AL9A 2G9AA 2OVRB 2IUQA 3CIKB 4J0XA 4CI2A 5HE1B 4GQBB 5FXYA 4A09B 3EI1B 5K1CC 4ZOVA 3PXWD 2H68A 3I7OA 4PSWB 4ERZA 4Y7RA 4J87A 2OVPB 3OKYA 5K19A 4CY2A 1OLZA 2XU7A 4J73A 2QXVA 3SWSD 5IGQA 4CY5A 2QC5A 3UVLA 4UI9R 4FWWA 3FM0A 4PSXB 3FRXA 3PSCB 4R7AB 3IJ1A 2HYEA 2H6QA 3BG1A 3DXMC 1PGUA 4EWRA 4X61B 2B5LA 4A08A 5GSAA 2Z2NA 2OK6A 3PVUB 3I7PA 2Z2PA 3EI3B 1U4CA 4QT8A 2YB8B 4JSPC 3EI4B 4LG9A 3C75H 3DSMA 3J81g 4A11A 3ORVD 4ERQA 3N0EA 5EAPA 2CE8A 3NVQA 4NSXA 3SMRA 2H9MA 3I2NA 3F3GA 4QRJA 2P9LC 4QQEA 5GXHA 1YFQA 4FHLA 4A09A 2CO0C 3EI1A 4IMMA 3I8EA 4TZ4A 2HXCA 4L9OA 2HESX 3PXSD 3PE7A 5HQGA 4FA4D 4ZOZA 2IWKA 2GC7A 5B4WA 2J57G 1U2VC 4U1EI 5H1MA 3SBPA 3OL2B 1S4UX 2B5MA 3FGBA 4ZOXA 3AH8B 3OKWA 5HE3B 4CZXA 3NVXA 3NVNA 4CI1A 5IJ8E 1NR0A 2P9UC 4A0AB 3ZWLB 5CYKB 3EI3A 4A7JA 3I7LA 3IJ0A 2J56H 2B5NA 4GM8A 2B4EA 2AGYA 4HDJA 3DXKC 3RLMD 3RMZD 4CY1A 5EARA 5EAMA 1XIPA 5C2WB 5I5IA 3L4MD 2CO0A 5CXBB 4AEZA 5EM2B 4X60B 4GQ1A 5FKSA 3MZLA 5FQDA 3V5WB 3I7NA 5TEEA 4XEIC 5TDHB 3K26A 4CY3A 1QNIA 2O9KA 2H13A 5TF2A 2BBKH 2I0TA 2IWFA 3UKUC 1GXRA 2YNPA 3I7KA 1TYQC 2YBAA 3UVNA 2J55H 1JOFA 3OL2A 3SN6B 1JJUB 4BL0A 4GGAA 2AH0A 4Y5RD 4D0KA 4Z8LA 3DWLC 2YNNA 2G99A 3A0FA 5EMMB 1Q47A 2PM6B 2IUPA 5CYKA 1SQJA 3F3FA 3W15A 4L1QD 4MK0B 1XHMA 4CI3A 5H14A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4BUJ C;  4PNK B;  3UR4 A;  4GM9 A;  3JRO A;  2UZX B;  4QL1 A;  5CXB A;  2W18 A;  4H5J A;  4J0W A;  4L3H D;  5KDO B;  5I5J A;  2GNQ A;  4JSV C;  3EI2 B;  2CN2 A;  2H47 A;  3C99 A;  4JT5 C;  3I8C A;  5IT9 g;  5SXM A;  4PXW A;  2MTA H;  5CXC B;  2AGZ A;  4FAV D;  4GQ2 P;  4O9D A;  5FKQ A;  2P9N C;  3RFG A;  1K8K C;  1N6F A;  3I7H A;  3OKT A;  2OJY A;  4AOW A;  4ERY A;  2IUV A;  2P9K C;  4O3T B;  4FA5 D;  3EU7 A;  2CE9 A;  4J82 A;  3P4F A;  3C5M A;  4BH6 A;  3PXT D;  3ULE C;  4CI8 A;  5JWZ A;  3EWE A;  3IIW A;  1PEV A;  3CFS B;  5IC7 A;  3SLE D;  4PBY A;  1GOT B;  5GXI A;  5HYN B;  3JB9 L;  1RI6 A;  3U4Y A;  3JZG A;  3EI4 A;  4D6V A;  4O3U B;  5I5M A;  3EI2 A;  3RRM C;  3SXT D;  3UVO A;  2HKM A;  4I79 A;  3IKO A;  2AH1 A;  2P9I C;  4E54 B;  4A0B B;  3GFC A;  4IA9 A;  3OKY B;  5C2V B;  2I0R A;  4H5I A;  1R5M A;  3KRW B;  2CNX A;  3CFV A;  3VH0 A;  2I3T A;  4JXM A;  1N6E A;  4X63 B;  5GMK n;  2XL3 A;  3KRX B;  3BWS A;  5FKR A;  3DM0 A;  3EMH A;  2H3X A;  4U7A A;  2H14 A;  3E0C A;  4FAN D;  4J77 A;  5HE0 B;  4GZ8 A;  2P9S C;  4K3I D;  2YNO A;  4N14 A;  4OWR A;  3N0D A;  3J80 g;  3MZK A;  5IJ7 E;  4PBZ A;  4CZY A;  1P22 A;  4G56 B;  3SCY A;  4A11 B;  3L4O D;  4OZU A;  3MKQ A;  4J81 A;  4ESG A;  2TRC B;  3C9C A;  5EMJ B;  4A0A A;  4GGD A;  2HJ4 A;  2XYI A;  1XKS A;  1B9X A;  1B9Y A;  2AGW A;  1SQ9 A;  2Z2O A;  3RFH A;  2IAA A;  3JAM g;  4E54 A;  4A0B A;  3SVW D;  1ERJ A;  2UZY B;  4A2M A;  5THA A;  2H6N A;  4JT6 C;  1PI6 A;  4YVD A;  5FKT A;  5EM2 A;  1MG3 A;  3GRE A;  5IGO A;  1JMX B;  3MKS B;  4O1Q D;  1NEX B;  3BG0 A;  1TBG A;  1VYH C;  3RN0 D;  3JRP A;  4J8B A;  5H17 A;  4L3G D;  2P9P C;  2PBI B;  2CN3 A;  4JD2 C;  4A2L A;  4XYH A;  1N6D A;  3AL8 B;  5FLX g;  2PM9 B;  2OVQ B;  5A2Q g;  4CZV A;  2IUR A;  2AQ5 A;  4FA9 D;  5C9Z B;  5HE2 B;  4E5Z B;  1A0R B;  3UVK A;  1L0Q A;  3PVW B;  1GP2 B;  1GG2 B;  3JZN A;  2H6K A;  4J78 A;  1FWX A;  3SJL D;  3PSL A;  3V7D B;  2BCJ B;  4KFM B;  3RSE C;  2XL2 A;  2EBS A;  1K32 A;  1MDA H;  4O45 A;  5AMS A;  3IJC A;  4JSN C;  1OMW B;  3HFQ A;  3SHF A;  3V9F A;  2Q7Q A;  5EML B;  5FA5 B;  2HKR A;  3RN1 D;  3MXX A;  2OK4 A;  3ODT A;  4GGC A;  4ZN4 A;  3AFC A;  4FB1 D;  3VA6 A;  4FA1 D;  2H9P A;  2OIZ A;  2H9L A;  4J86 A;  1JMZ B;  3SBR A;  4GM3 A;  3AL8 A;  5EMK B;  4J84 A;  3JZH A;  2PM7 B;  2PM9 A;  3K27 A;  3MMY A;  5CXC A;  3OTT A;  2AGL A;  5AFU 3;  3SBQ A;  4GMB A;  3SFZ A;  4K3J B;  4E5Z A;  2GC4 A;  4PC0 A;  4JSX C;  4J79 A;  2H9N A;  3JPX A;  1SHY B;  3F3P A;  5EAL A;  1PBY B;  4ES0 A;  3B7F A;  3IIY A;  5TEF A;  2AGX A;  2I3S A;  4LGN A;  4A08 B;  3OW8 A;  4LG8 A;  4XYI A;  2HJB A;  1MG2 A;  5AJA A;  3UKR C;  2YMU A;  4J8G A;  4ZOY A;  2I0S A;  3EG6 A;  4CC9 A;  3I89 A;  4X3E A;  3UVM A;  3VGZ A;  3AL9 A;  2G9A A;  2OVR B;  2IUQ A;  3CIK B;  4J0X A;  4CI2 A;  5HE1 B;  4GQB B;  5FXY A;  4A09 B;  3EI1 B;  5K1C C;  4ZOV A;  3PXW D;  2H68 A;  3I7O A;  4PSW B;  4ERZ A;  4Y7R A;  4J87 A;  2OVP B;  3OKY A;  5K19 A;  4CY2 A;  1OLZ A;  2XU7 A;  4J73 A;  2QXV A;  3SWS D;  5IGQ A;  4CY5 A;  2QC5 A;  3UVL A;  4UI9 R;  4FWW A;  3FM0 A;  4PSX B;  3FRX A;  3PSC B;  4R7A B;  3IJ1 A;  2HYE A;  2H6Q A;  3BG1 A;  3DXM C;  1PGU A;  4EWR A;  4X61 B;  2B5L A;  4A08 A;  5GSA A;  2Z2N A;  2OK6 A;  3PVU B;  3I7P A;  2Z2P A;  3EI3 B;  1U4C A;  4QT8 A;  2YB8 B;  4JSP C;  3EI4 B;  4LG9 A;  3C75 H;  3DSM A;  3J81 g;  4A11 A;  3ORV D;  4ERQ A;  3N0E A;  5EAP A;  2CE8 A;  3NVQ A;  4NSX A;  3SMR A;  2H9M A;  3I2N A;  3F3G A;  4QRJ A;  2P9L C;  4QQE A;  5GXH A;  1YFQ A;  4FHL A;  4A09 A;  2CO0 C;  3EI1 A;  4IMM A;  3I8E A;  4TZ4 A;  2HXC A;  4L9O A;  2HES X;  3PXS D;  3PE7 A;  5HQG A;  4FA4 D;  4ZOZ A;  2IWK A;  2GC7 A;  5B4W A;  2J57 G;  1U2V C;  4U1E I;  5H1M A;  3SBP A;  3OL2 B;  1S4U X;  2B5M A;  3FGB A;  4ZOX A;  3AH8 B;  3OKW A;  5HE3 B;  4CZX A;  3NVX A;  3NVN A;  4CI1 A;  5IJ8 E;  1NR0 A;  2P9U C;  4A0A B;  3ZWL B;  5CYK B;  3EI3 A;  4A7J A;  3I7L A;  3IJ0 A;  2J56 H;  2B5N A;  4GM8 A;  2B4E A;  2AGY A;  4HDJ A;  3DXK C;  3RLM D;  3RMZ D;  4CY1 A;  5EAR A;  5EAM A;  1XIP A;  5C2W B;  5I5I A;  3L4M D;  2CO0 A;  5CXB B;  4AEZ A;  5EM2 B;  4X60 B;  4GQ1 A;  5FKS A;  3MZL A;  5FQD A;  3V5W B;  3I7N A;  5TEE A;  4XEI C;  5TDH B;  3K26 A;  4CY3 A;  1QNI A;  2O9K A;  2H13 A;  5TF2 A;  2BBK H;  2I0T A;  2IWF A;  3UKU C;  1GXR A;  2YNP A;  3I7K A;  1TYQ C;  2YBA A;  3UVN A;  2J55 H;  1JOF A;  3OL2 A;  3SN6 B;  1JJU B;  4BL0 A;  4GGA A;  2AH0 A;  4Y5R D;  4D0K A;  4Z8L A;  3DWL C;  2YNN A;  2G99 A;  3A0F A;  5EMM B;  1Q47 A;  2PM6 B;  2IUP A;  5CYK A;  1SQJ A;  3F3F A;  3W15 A;  4L1Q D;  4MK0 B;  1XHM A;  4CI3 A;  5H14 A; 
#chains in the Genus database with same CATH topology
 4O2W A;  4BUJ C;  4PNK B;  3UR4 A;  1A12 A;  4GM9 A;  3JRO A;  2UZX B;  4QL1 A;  5CXB A;  2W18 A;  4H5J A;  4J0W A;  1H2Y A;  2VZ3 A;  1H2Z A;  3ZE1 A;  4L3H D;  5KDO B;  4WJK A;  5I5J A;  2GNQ A;  4JSV C;  4RE5 A;  3EI2 B;  2CN2 A;  2H47 A;  3C99 A;  3ZE2 A;  4Z7O A;  4BCB A;  4JT5 C;  1JTD B;  3DDU A;  3I8C A;  5IT9 g;  1YR2 A;  5SXM A;  4PXW A;  2MTA H;  2WQ8 A;  5CXC B;  2AGZ A;  4FAV D;  5M5R A;  4GQ2 P;  3IUR A;  4O9D A;  5FKQ A;  2P9N C;  1T2X A;  3RFG A;  1K8K C;  1N6F A;  3I7H A;  3OKT A;  2OJY A;  4AOW A;  4ERY A;  1UOP A;  2IUV A;  2P9K C;  2EID A;  4O3T B;  3EU7 A;  4FA5 D;  2CE9 A;  4J82 A;  3P4F A;  3O4H A;  3NIG A;  3C5M A;  4BH6 A;  3PXT D;  3ULE C;  4CI8 A;  5JWZ A;  3EWE A;  3IIW A;  4G1M A;  1PEV A;  3K71 A;  3CFS B;  5IC7 A;  3SLE D;  1UTC A;  4PBY A;  5HDB A;  1GOT B;  2VDR A;  5GXI A;  5HYN B;  3GC3 B;  3JB9 L;  1RI6 A;  3U4Y A;  3JZG A;  3EI4 A;  3FCS A;  4D6V A;  4O3U B;  5I5M A;  3EI2 A;  3RRM C;  3SXT D;  4WK0 A;  3UVO A;  2HKM A;  4I79 A;  3IKO A;  2AH1 A;  2P9I C;  2VDP A;  1O6G A;  4E54 B;  4A0B B;  3GFC A;  4IA9 A;  3OKY B;  4DNW A;  5C2V B;  2I0R A;  4H5I A;  1R5M A;  3KRW B;  2CNX A;  3CFV A;  3MVD K;  3VH0 A;  2I3T A;  4JXM A;  2XDW A;  1N6E A;  3O4G A;  4X63 B;  5GMK n;  2XL3 A;  3KRX B;  3BWS A;  5FKR A;  1VE6 A;  3DM0 A;  1QFM A;  3EMH A;  2H3X A;  4U7A A;  2H14 A;  3E0C A;  4AN0 A;  4FAN D;  4J77 A;  5HE0 B;  4GZ8 A;  3KCI A;  3V4P A;  2P9S C;  4K3I D;  2YNO A;  4N14 A;  1H2X A;  4OWR A;  4G55 A;  3N0D A;  3J80 g;  3MZK A;  5IJ7 E;  4PBZ A;  4CZY A;  1P22 A;  4G56 B;  3SCY A;  4A11 B;  3L4O D;  4OZU A;  3MKQ A;  4J81 A;  4ESG A;  2TRC B;  3C9C A;  5EMJ B;  4A0A A;  4GGD A;  2HJ4 A;  2XYI A;  5M5T A;  1I2M B;  1XKS A;  1B9X A;  1B9Y A;  2AGW A;  3QI0 A;  1SQ9 A;  2Z2O A;  3RFH A;  2IAA A;  3MUN A;  3T3P A;  3JAM g;  4E54 A;  4A0B A;  3SVW D;  1ERJ A;  2UZY B;  4A2M A;  5THA A;  4DNU A;  2H6N A;  4JT6 C;  1PI6 A;  4YVD A;  5FKT A;  5EM2 A;  1MG3 A;  3GRE A;  5IGO A;  3MKS B;  1JMX B;  2VDM A;  4O1Q D;  1GOF A;  4AMY A;  1NEX B;  3BG0 A;  1TBG A;  1VYH C;  3RN0 D;  3JRP A;  4NAA A;  4J8B A;  5H17 A;  5M5V A;  4L3G D;  2P9P C;  2PBI B;  2CN3 A;  4JD2 C;  4A2L A;  4XYH A;  1N6D A;  3AL8 B;  3O4J A;  5FLX g;  3NID A;  2PM9 B;  3V4V A;  2OVQ B;  5A2Q g;  4CZV A;  2IUR A;  2AQ5 A;  4FA9 D;  5C9Z B;  5HE2 B;  4E5Z B;  2EIE A;  3K6S A;  1A0R B;  3UVK A;  1L0Q A;  3PVW B;  5C86 A;  1GP2 B;  1GG2 B;  3JZN A;  2H6K A;  4J78 A;  1FWX A;  3SJL D;  1E5T A;  1QFS A;  3PSL A;  5M61 A;  5M5S A;  1H2W A;  5FFG A;  3V7D B;  5E6S A;  1E8N A;  2BCJ B;  4KFM B;  4UM8 A;  3RSE C;  2XL2 A;  2EBS A;  1K32 A;  1MDA H;  3ZDX A;  3T3M A;  4O45 A;  5AMS A;  3IJC A;  4O02 A;  4JSN C;  4BP9 A;  2HU5 A;  1OMW B;  3HFQ A;  3SHF A;  3V9F A;  2Q7Q A;  5EML B;  5FA5 B;  2HKR A;  3RN1 D;  3MXX A;  4JHN A;  2OK4 A;  3ODT A;  4GGC A;  4ZN4 A;  3AFC A;  4FB1 D;  3VA6 A;  4FA1 D;  2VDN A;  2H9P A;  2OIZ A;  1UOO A;  2H9L A;  4J86 A;  1JMZ B;  3SBR A;  3FCU A;  4GM3 A;  4BP8 A;  3AL8 A;  2BKL A;  5EMK B;  4J84 A;  3JZH A;  2PM7 B;  2PM9 A;  3K27 A;  3MMY A;  5CXC A;  3OTT A;  4NC4 A;  2AGL A;  5AFU 3;  3SBQ A;  4GMB A;  3SFZ A;  4K3J B;  4E5Z A;  2GC4 A;  4PC0 A;  4JSX C;  1E8M A;  4J79 A;  2H9N A;  3QHY B;  3JPX A;  4D9S A;  1SHY B;  3F3P A;  5EAL A;  1PBY B;  4ES0 A;  3B7F A;  3IIY A;  5TEF A;  2AGX A;  2I3S A;  4LGN A;  4A08 B;  3OW8 A;  4LG8 A;  4XYI A;  2HJB A;  1MG2 A;  5AJA A;  3UKR C;  2YMU A;  4AN1 A;  2XZG A;  4QAM A;  4J8G A;  1C9I A;  4Z7N A;  4ZOY A;  5C92 A;  2I0S A;  3IVM A;  3EG6 A;  2JKX A;  4CC9 A;  3I89 A;  4X3E A;  3UVM A;  3VGZ A;  4BCC A;  3AL9 A;  2G9A A;  5FFO A;  2OVR B;  2IUQ A;  3CIK B;  4J0X A;  2EIC A;  5HE1 B;  4CI2 A;  4GQB B;  5FXY A;  4A09 B;  3EI1 B;  5E6R A;  5K1C C;  3OF7 A;  4ZOV A;  3PXW D;  2H68 A;  3I7O A;  4PSW B;  4ERZ A;  4Y7R A;  4J87 A;  2OVP B;  3OKY A;  5K19 A;  4CY2 A;  1OLZ A;  2XU7 A;  3IJE A;  2QXV A;  4J73 A;  3SWS D;  4DNV A;  2VDO A;  5IGQ A;  4CY5 A;  2QC5 A;  2XE4 A;  3UVL A;  4UI9 R;  1GOG A;  3FM0 A;  4FWW A;  4PSX B;  3FRX A;  3PSC B;  4R7A B;  3IJ1 A;  2QR5 A;  2HYE A;  4Z7Q A;  2H6Q A;  3BG1 A;  4WK2 A;  3DXM C;  1PGU A;  4EWR A;  4X61 B;  2B5L A;  4A08 A;  5GSA A;  2Z2N A;  2OK6 A;  3PVU B;  3I7P A;  2Z2P A;  3EI3 B;  1U4C A;  4QT8 A;  2YB8 B;  4JSP C;  3EI4 B;  5M5U A;  4LG9 A;  3C75 H;  3DSM A;  3MUO A;  3J81 g;  4A11 A;  3VI4 A;  3ORV D;  4ERQ A;  1JV2 A;  3N0E A;  5EAP A;  2CE8 A;  3NVQ A;  4NSX A;  3SMR A;  2H9M A;  3I2N A;  3F3G A;  4QRJ A;  1VZ2 A;  2P9L C;  4QQE A;  3IUJ A;  1C9L A;  5GXH A;  1YFQ A;  4FHL A;  4AMZ A;  4A09 A;  2CO0 C;  3EI1 A;  3VI3 A;  4IMM A;  3I8E A;  4L1M A;  4TZ4 A;  2HXC A;  4L9O A;  2HES X;  3PXS D;  4UM9 A;  2EIB A;  3PE7 A;  5HQG A;  4BCD A;  4FA4 D;  4ZOZ A;  2IWK A;  2GC7 A;  4MMX A;  1GOH A;  5B4W A;  2J57 G;  1U2V C;  4U1E I;  3ZE0 A;  5H1M A;  3SBP A;  1S4U X;  3OL2 B;  2B5M A;  3FGB A;  4ZOX A;  3IUM A;  3AH8 B;  2VC2 A;  3IUQ A;  3OKW A;  5HE3 B;  3IUN A;  2VZ1 A;  4RE6 A;  2HU7 A;  4CZX A;  3NVX A;  3NVN A;  4CI1 A;  3ZDY A;  5IJ8 E;  1NR0 A;  2P9U C;  1VE7 A;  4NEN A;  4A0A B;  4JHP C;  3ZWL B;  5CYK B;  3EI3 A;  4G1E A;  3K72 A;  4A7J A;  3I7L A;  3IJ0 A;  2J56 H;  2B5N A;  4GM8 A;  4IRZ A;  2B4E A;  3NIF A;  2AGY A;  3EQ9 A;  4HDJ A;  1VZ3 A;  2QZP A;  3DXK C;  3GD1 I;  3RLM D;  3RMZ D;  4CY1 A;  5EAR A;  1L5G A;  5EAM A;  3ZDZ A;  1XIP A;  4NBM A;  5C2W B;  3L4M D;  5I5I A;  1BPO A;  2CO0 A;  5CXB B;  2VDK A;  4AEZ A;  5EM2 B;  4X60 B;  4MMY A;  4GQ1 A;  5FKS A;  3MZL A;  5FQD A;  3V5W B;  3I7N A;  5TEE A;  4XEI C;  3EQ8 A;  5TDH B;  3K26 A;  3IUL A;  3O4I A;  4CY3 A;  1QNI A;  2O9K A;  1M1X A;  2H13 A;  5TF2 A;  2BBK H;  2I0T A;  2IWF A;  1U8C A;  3UKU C;  1GXR A;  2VDQ A;  2VDL A;  2YNP A;  3I7K A;  1TYQ C;  2YBA A;  3UVN A;  2J55 H;  4WK4 A;  1JOF A;  1O6F A;  3OL2 A;  3SN6 B;  3EQ7 A;  4AX4 A;  4MMZ A;  1JJU B;  4BL0 A;  4GGA A;  2AH0 A;  4Y5R D;  4D0K A;  4Z8L A;  3DWL C;  2YNN A;  2G99 A;  2HU8 A;  3A0F A;  5EMM B;  1Q47 A;  2PM6 B;  2IUP A;  1K3I A;  5CYK A;  1SQJ A;  1TYE A;  3F3F A;  3W15 A;  4L1Q D;  4MK0 B;  1UOQ A;  1XHM A;  4CI3 A;  5H14 A;  5E6U A; 
#chains in the Genus database with same CATH homology
 4BUJ C;  4PNK B;  3UR4 A;  4GM9 A;  3JRO A;  2UZX B;  4QL1 A;  5CXB A;  2W18 A;  4H5J A;  4J0W A;  4L3H D;  5KDO B;  5I5J A;  2GNQ A;  4JSV C;  3EI2 B;  2CN2 A;  2H47 A;  3C99 A;  4JT5 C;  3I8C A;  5IT9 g;  5SXM A;  4PXW A;  2MTA H;  5CXC B;  2AGZ A;  4FAV D;  4GQ2 P;  4O9D A;  5FKQ A;  2P9N C;  3RFG A;  1K8K C;  1N6F A;  3I7H A;  3OKT A;  2OJY A;  4AOW A;  4ERY A;  2IUV A;  2P9K C;  4O3T B;  4FA5 D;  3EU7 A;  2CE9 A;  4J82 A;  3P4F A;  3C5M A;  4BH6 A;  3PXT D;  3ULE C;  4CI8 A;  5JWZ A;  3EWE A;  3IIW A;  1PEV A;  3CFS B;  5IC7 A;  3SLE D;  4PBY A;  1GOT B;  5GXI A;  5HYN B;  3JB9 L;  1RI6 A;  3U4Y A;  3JZG A;  3EI4 A;  4D6V A;  4O3U B;  5I5M A;  3EI2 A;  3RRM C;  3SXT D;  3UVO A;  2HKM A;  4I79 A;  3IKO A;  2AH1 A;  2P9I C;  4E54 B;  4A0B B;  3GFC A;  4IA9 A;  3OKY B;  5C2V B;  2I0R A;  4H5I A;  1R5M A;  3KRW B;  2CNX A;  3CFV A;  3VH0 A;  2I3T A;  4JXM A;  1N6E A;  4X63 B;  5GMK n;  2XL3 A;  3KRX B;  3BWS A;  5FKR A;  3DM0 A;  3EMH A;  2H3X A;  4U7A A;  2H14 A;  3E0C A;  4FAN D;  4J77 A;  5HE0 B;  4GZ8 A;  2P9S C;  4K3I D;  2YNO A;  4N14 A;  4OWR A;  3N0D A;  3J80 g;  3MZK A;  5IJ7 E;  4PBZ A;  4CZY A;  1P22 A;  4G56 B;  3SCY A;  4A11 B;  3L4O D;  4OZU A;  3MKQ A;  4J81 A;  4ESG A;  2TRC B;  3C9C A;  5EMJ B;  4A0A A;  4GGD A;  2HJ4 A;  2XYI A;  1XKS A;  1B9X A;  1B9Y A;  2AGW A;  1SQ9 A;  2Z2O A;  3RFH A;  2IAA A;  3JAM g;  4E54 A;  4A0B A;  3SVW D;  1ERJ A;  2UZY B;  4A2M A;  5THA A;  2H6N A;  4JT6 C;  1PI6 A;  4YVD A;  5FKT A;  5EM2 A;  1MG3 A;  3GRE A;  5IGO A;  1JMX B;  3MKS B;  4O1Q D;  1NEX B;  3BG0 A;  1TBG A;  1VYH C;  3RN0 D;  3JRP A;  4J8B A;  5H17 A;  4L3G D;  2P9P C;  2PBI B;  2CN3 A;  4JD2 C;  4A2L A;  4XYH A;  1N6D A;  3AL8 B;  5FLX g;  2PM9 B;  2OVQ B;  5A2Q g;  4CZV A;  2IUR A;  2AQ5 A;  4FA9 D;  5C9Z B;  5HE2 B;  4E5Z B;  1A0R B;  3UVK A;  1L0Q A;  3PVW B;  1GP2 B;  1GG2 B;  3JZN A;  2H6K A;  4J78 A;  1FWX A;  3SJL D;  3PSL A;  3V7D B;  2BCJ B;  4KFM B;  3RSE C;  2XL2 A;  2EBS A;  1K32 A;  1MDA H;  4O45 A;  5AMS A;  3IJC A;  4JSN C;  1OMW B;  3HFQ A;  3SHF A;  3V9F A;  2Q7Q A;  5EML B;  5FA5 B;  2HKR A;  3RN1 D;  3MXX A;  2OK4 A;  3ODT A;  4GGC A;  4ZN4 A;  3AFC A;  4FB1 D;  3VA6 A;  4FA1 D;  2H9P A;  2OIZ A;  2H9L A;  4J86 A;  1JMZ B;  3SBR A;  4GM3 A;  3AL8 A;  5EMK B;  4J84 A;  3JZH A;  2PM7 B;  2PM9 A;  3K27 A;  3MMY A;  5CXC A;  3OTT A;  2AGL A;  5AFU 3;  3SBQ A;  4GMB A;  3SFZ A;  4K3J B;  4E5Z A;  2GC4 A;  4PC0 A;  4JSX C;  4J79 A;  2H9N A;  3JPX A;  1SHY B;  3F3P A;  5EAL A;  1PBY B;  4ES0 A;  3B7F A;  3IIY A;  5TEF A;  2AGX A;  2I3S A;  4LGN A;  4A08 B;  3OW8 A;  4LG8 A;  4XYI A;  2HJB A;  1MG2 A;  5AJA A;  3UKR C;  2YMU A;  4J8G A;  4ZOY A;  2I0S A;  3EG6 A;  4CC9 A;  3I89 A;  4X3E A;  3UVM A;  3VGZ A;  3AL9 A;  2G9A A;  2OVR B;  2IUQ A;  3CIK B;  4J0X A;  4CI2 A;  5HE1 B;  4GQB B;  5FXY A;  4A09 B;  3EI1 B;  5K1C C;  4ZOV A;  3PXW D;  2H68 A;  3I7O A;  4PSW B;  4ERZ A;  4Y7R A;  4J87 A;  2OVP B;  3OKY A;  5K19 A;  4CY2 A;  1OLZ A;  2XU7 A;  4J73 A;  2QXV A;  3SWS D;  5IGQ A;  4CY5 A;  2QC5 A;  3UVL A;  4UI9 R;  4FWW A;  3FM0 A;  4PSX B;  3FRX A;  3PSC B;  4R7A B;  3IJ1 A;  2HYE A;  2H6Q A;  3BG1 A;  3DXM C;  1PGU A;  4EWR A;  4X61 B;  2B5L A;  4A08 A;  5GSA A;  2Z2N A;  2OK6 A;  3PVU B;  3I7P A;  2Z2P A;  3EI3 B;  1U4C A;  4QT8 A;  2YB8 B;  4JSP C;  3EI4 B;  4LG9 A;  3C75 H;  3DSM A;  3J81 g;  4A11 A;  3ORV D;  4ERQ A;  3N0E A;  5EAP A;  2CE8 A;  3NVQ A;  4NSX A;  3SMR A;  2H9M A;  3I2N A;  3F3G A;  4QRJ A;  2P9L C;  4QQE A;  5GXH A;  1YFQ A;  4FHL A;  4A09 A;  2CO0 C;  3EI1 A;  4IMM A;  3I8E A;  4TZ4 A;  2HXC A;  4L9O A;  2HES X;  3PXS D;  3PE7 A;  5HQG A;  4FA4 D;  4ZOZ A;  2IWK A;  2GC7 A;  5B4W A;  2J57 G;  1U2V C;  4U1E I;  5H1M A;  3SBP A;  3OL2 B;  1S4U X;  2B5M A;  3FGB A;  4ZOX A;  3AH8 B;  3OKW A;  5HE3 B;  4CZX A;  3NVX A;  3NVN A;  4CI1 A;  5IJ8 E;  1NR0 A;  2P9U C;  4A0A B;  3ZWL B;  5CYK B;  3EI3 A;  4A7J A;  3I7L A;  3IJ0 A;  2J56 H;  2B5N A;  4GM8 A;  2B4E A;  2AGY A;  4HDJ A;  3DXK C;  3RLM D;  3RMZ D;  4CY1 A;  5EAR A;  5EAM A;  1XIP A;  5C2W B;  5I5I A;  3L4M D;  2CO0 A;  5CXB B;  4AEZ A;  5EM2 B;  4X60 B;  4GQ1 A;  5FKS A;  3MZL A;  5FQD A;  3V5W B;  3I7N A;  5TEE A;  4XEI C;  5TDH B;  3K26 A;  4CY3 A;  1QNI A;  2O9K A;  2H13 A;  5TF2 A;  2BBK H;  2I0T A;  2IWF A;  3UKU C;  1GXR A;  2YNP A;  3I7K A;  1TYQ C;  2YBA A;  3UVN A;  2J55 H;  1JOF A;  3OL2 A;  3SN6 B;  1JJU B;  4BL0 A;  4GGA A;  2AH0 A;  4Y5R D;  4D0K A;  4Z8L A;  3DWL C;  2YNN A;  2G99 A;  3A0F A;  5EMM B;  1Q47 A;  2PM6 B;  2IUP A;  5CYK A;  1SQJ A;  3F3F A;  3W15 A;  4L1Q D;  4MK0 B;  1XHM A;  4CI3 A;  5H14 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...