2H6XA

Crystal structure of thioredoxin wild type in hexagonal (p61) space group
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
108
structure length
108
Chain Sequence
b'SDKIIHLTDDSFDTDVLKADGAILVDFWAEWCGPCKMIAPILDEIADEYQGKLTVAKLNIDQNPGTAPKYGIRGIPTLLLFKNGEVAATKVGALSKGQLKEFLDANLA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Thioredoxin
publication title Crystal Structure of Thioredoxin Wild Type in Hexagonal (p61) Space Group
rcsb
source organism Escherichia coli
molecule tags Electron transport
total genus 31
structure length 108
sequence length 108
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-06-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00085 Thioredoxin Thioredoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 2h6xA00
3DVWA 1OYJA 3WT2A 1BX9A 2MMAA 3IOSA 5GSSA 1GH2A 4L5OA 4IQAA 7GSSA 5GAPD 1SYXA 3TDGA 1XWAA 1ZMAA 2HZFA 3EURA 4O92A 1R7HA 3LYKA 3VPTA 4YAPA 4ML1A 1OC9B 1TU7A 3FR3A 2OACA 2I1UA 2VCWA 3APQA 3HCZA 4V2NA 4WF4A 1AW9A 3TJKA 2H0IA 1JZWA 4IVFA 1KEBA 2VCXA 1M7TA 1O6JA 3KMNA 2R5GA 1B8XA 3HJPA 3ZITA 4FYCA 1TU8A 1K0CA 3ZIVA 3F6DA 3BCKA 3UOMA 1T4ZA 2LJAA 1T3BA 4MK3A 6GSXA 1G0TA 1SU9A 2LRCA 3U5RE 4G19A 6GSVA 3UVTA 1XVQA 3DD3A 2GZZA 4KUNA 3LJRA 1G6YA 3FK8A 3GUSA 4ZIJA 1ON4A 1EV4A 2FUG2 2AUVA 3DXBA 3BCIA 4D73B 2I3YA 1ST9A 5DBQA 1UC7A 4LA1A 1SL2B 5IMDA 3US3A 1AXDA 4GSNA 3D4TA 3VI5A 1XXUA 4H86A 2B5XA 2F9SA 3RHBA 2H6ZA 4N10A 1ERWA 5D96A 4JRRA 2C1YA 1DUGA 1GTBA 3ISOA 5IPHA 4ZL7A 5J41A 2ZNMA 2QGVA 4O5RA 2E0QA 2K18A 2M46A 4MABA 2O87A 4EO3A 1VF3A 2VL2A 5AISA 2QC7A 2H1GA 1AQXA 1V2AA 3LXTA 3GSSA 1GTUA 2M72A 5GZZB 1VGLA 1Z6NA 4ZL9A 5ECKB 3GTUB 1PRXA 4JEDA 3UIWA 2IFQB 2E2GA 2V6OA 2LJRA 3UL3A 3TGZA 2M80A 4WEYA 1UVZA 3DMLA 5EL8A 2Z9SA 2B5EA 3L9VA 4ACSA 3RAZA 4KCEA 3QAWA 1QQ2A 1V9WA 4F2IA 2YWNA 3HKRA 1U3IA 2CA8A 2OKAA 3FHKA 3GV1A 3A2VA 2P5RA 1X5EA 3AY8A 2C3NA 4ECBA 4IHUA 4ZL8A 4ZB8A 1EGOA 2WB9A 2PVOC 5EPFA 1GTAA 4PXOA 4EKZA 2LTKA 4YH2A 5DDLA 2CQ9A 5J9BA 5ECQB 1Z9HA 4OMVA 1PA3A 3KTBA 4I2UA 4TR3A 2GZYA 2DJ1A 1Q4JA 2H71A 3IR4A 4GF0A 2YZHA 5D93A 1J0FA 5JCUA 1SENA 18GSA 3P8WA 3TUEA 1WPIA 5ECHB 3BD2A 3MAKA 3W8JA 1WWJA 5ECIB 3ZVJD 3TCOA 2PWJA 2H30A 2P5QA 5J4UA 2H70A 1GSQA 2HRNA 1K3OA 3IA1A 4BL7A 2TIRA 3QAGA 2RUFA 5FWGA 1KNGA 1BYEA 3FRCA 3E0UA 4HU9A 3U6VA 4YAVA 2WRTA 1DSBA 1LU4A 6GSYA 1TDIA 2WULA 2CVDA 2OE0A 1W89A 2OE1A 1QXHA 1OVNA 5HR0A 3UBKA 2L6CA 2C8UA 3R2QA 3W6GA 3A5WA 3D21A 4N0ZA 1R5AA 2FNOA 2F3MA 2YV7A 2KLXA 1M9BA 1ZYEA 4MA9A 1FAAA 2PU9C 4V2LA 1OAZA 3A3TA 3ZRDA 1MD4A 2MYGA 1AIUA 1ILOA 2FWHA 5KN0A 5F05A 2YN1A 2JSYA 1X0RA 4TOPA 2GSTA 4MZBA 1TI3A 5HFGA 1I9DA 17GSA 5DQSA 5HR3A 5G5EA 1K0MA 3OR5A 5EY6A 3LGCA 2K6VA 3ME7A 1ML6A 2HXKA 1M9AA 3EE2A 3QR6A 2JSZA 1ZZYA 2MMNA 1F9MA 2PPTA 22GSA 1F6MC 5KN1A 2VCTA 3ERWA 2HZEB 3IK9A 4DEJA 2MMOA 1GSYA 1E2YA 2OBIA 3FW2A 4ZB6A 3HYPA 2PBJA 4FYBA 5DAKA 1XW6A 4MPFA 4N0VA 3IXRA 3FEUA 5D9VA 2JU5A 4XS4A 2L5OA 1TRWA 2V6KA 3KEBA 1ABAA 1ZOFA 1SJ6A 2JZRA 2IPAA 4NHWA 1SK1A 2CZ2A 4GTUA 1S3DA 3MWHA 5IO0A 1B4PA 3UVHA 2BJXA 4EC0A 1F37A 3GL3A 5A4UA 1GUHA 3F9UA 1Z7RA 1XWGA 1TRSA 2YP6A 2EIRA 1YF1A 1GP1A 5DCHA 2MBSA 3WYWA 1TTZA 4NV5A 4PGTA 2ON5A 3EU3A 3EC3A 5D9WA 4TR4A 3UMAA 4KCAA 2WDUA 4HU7A 1CQGA 2PUKC 1T1VA 4DVCA 4MH2A 6GSTA 4OFTA 3C1RA 3FZ4A 13GSA 2YCDA 4OCFA 3LXZA 1GUKA 2H1BA 3GH6A 2H01A 3Q74A 2VUPA 3NIVA 1JZOA 1TP9A 3WT1A 2FWGA 1HYUA 2FA4A 2GT5A 2IMEA 4MF7A 1AQVA 3HD5A 4V1Ag 4TKYA 5A4VA 5DALB 2FY6A 4MPGA 5KEJA 1J08A 3TKQA 4X0XA 5DQYA 5ECPB 3C7MA 5DCGA 6GSUA 3D0ZA 2OE3A 3F0IA 4NWYA 4GSTA 1EZKA 1TW9A 3O76A 3GYKA 4JU5A 3TKSC 3VI7A 3P7XA 1NHYA 4ECIA 3EWLA 4KE3A 2FLSA 20GSA 1A8YA 1X9MB 4KSOA 4FH8A 2GGTA 4YQMA 3VWWA 5IMVA 2F8FA 2WJUA 4DSSB 2O85A 2IMFA 1VF4A 2IJYA 1NSWA 3VK9A 3QDNA 2FGXA 3HZ4A 3KTLA 2R4VA 2CAIA 4XRAA 5L71A 2CVBA 1Q98A 4WXTA 1X5CA 2PGTA 3CTGA 4GQCA 5F8BA 4E8HA 3CRTA 3UEMA 4QL9A 4I6XA 3ZTLA 2AHEA 5ID2B 2L6DA 1SYRA 1K0DA 5D9XA 1QFNA 1TK0B 4ZBBA 4G9HA 1HQOA 2DJ2A 4MDCA 2GQLA 2X99A 1R4WA 3IK7A 3TJBA 3G7YA 2AB6A 2LEGA 5HFKA 1C72A 4AJ8A 2GQMA 3HXSA 2C4JA 1B9XC 1OKDA 2K9FA 5AIVA 3VPQA 4MP4A 5AGYA 3VLNA 4NPBA 3FY7A 4WKWA 3HHVA 2X8CA 3ZFLA 4HUAA 2C0FA 5IPGA 1G6WA 2L4QA 4FIWA 3RHCA 4ML6A 4PUFC 1VF2A 2RM6A 4HI7A 1OC9A 4IP1A 2X8HA 3APSA 4PQHA 4TRXA 1Z7PA 2LUSA 5ENUA 2HRFA 1GLQA 5G1KA 4XHMA 3H1NA 5CRWA 11GSA 4JBBA 3FKFA 1GRXA 3EMPA 5IO2A 5FHIA 5IIZA 1HD2A 3NOFA 3F4SA 3F4TA 3VWUA 1PL1A 3P2AA 4POBA 2N5BA 1WOUA 3J7Yk 4IS0A 1PL2A 2AYTA 5G30A 1TRUA 3IHQA 3I9V2 5D8IA 5C04A 1B48A 2LQOA 2H1DA 1YEPA 2LS5A 5B8AA 4TN8A 2V2GA 4F82A 1BQ7A 4D73A 2R6KA 3ZYWA 2VCZA 4FYUA 4IELA 4KX4A 5HR1A 2GVPA 1F2EA 1URMA 2JZSA 3GURA 4HEA2 4AF2A 4GWRA 4KW6A 5CP1A 4TXVA 4WETA 1V40A 1B4QA 4XCSA 3EVIA 1JHBA 2B1LA 2X64A 3M3MA 4HZ2A 3PH9A 2VOCA 4HS1A 4XTSA 3C1SA 3P90A 3H4KA 4ILFA 2XC2A 5CRDA 4TW5A 2DJJA 2MMZA 4OD7A 1TK8B 1T7PB 1PN9A 4RI7A 4GQFA 4EDYA 1GSFA 3G9BA 3V1WA 3GTUA 3EINA 1GSDA 2NDOA 2IFQA 2E7PA 4K9ZA 3LORA 5JWQB 1K0BA 1H75A 2NPBA 1E6BA 3EU4A 2V32A 3APOA 4F0CA 1GTIA 1KBNA 3HA9A 1GLPA 1QGVA 5COHA 4X43A 1SKWB 2AAWA 5GSTA 3FZ5A 3GIXA 4IKHA 4EDZA 2TRCP 4RQXA 1FO5A 2YJHA 3KJYA 3A2XA 3C73A 1F3BA 2H76A 1XWBA 2WFCA 2AJQB 1MDIA 1I5GA 2C80A 3CMIA 3KD0A 1M0UA 4EVMA 2GLRA 4I97A 1XOBA 4EUYA 4WR4A 1XIYA 2FWEA 4JE1A 3FZ9A 1QK8A 2CV4A 5AN1A 4MH3A 4HJ2A 4TR0A 1XFLA 1G7EA 1FHEA 1Y25A 3KGKA 3CRUA 3D4MA 2IMKA 2B6MA 2C3TA 2GSSA 3D22A 1MDKA 4RUVA 1QMVA 2DLXA 2WS2A 3D5JA 4TVEA 2G0FA 3F4RA 5D73A 2YWOA 1CQHA 1EP7A 4MCUA 1GNWA 2IWTA 3UARA 2YJ7A 2H66A 2G2QA 4AJ7A 4EL1A 1DE1A 2NTOA 4K7OA 3LEFA 2FA8A 3W8SA 1JZDA 3TKSA 1PD21 4HJMA 2FCHA 4Q5FA 2R37A 3KH7A 5A5KA 1T8EB 2IIYA 2OA7A 2MZCA 4K0GA 1ACVA 1JZRA 2WCIA 4O7HA 5JWRB 2H6XA 2LV3A 2EIOA 2DC5A 3GL5A 2DJ3A 2H73A 5FT3A 4ECCA 1GWCA 1MDJA 2VL9A 2I81A 3SWLA 5LNKe 2HSHA 3ZZXA 2FHEA 4I8BA 5B6MA 1XCCA 2WZ9A 3TJJA 2KP1A 1O73A 4K2DA 2C0GA 2L59A 5ECNB 1OE7A 1AAZA 5CAXA 3GX0A 3PR8A 2HZEA 3KMOA 1U87A 3HY2A 1EGRA 4G2EA 3I69A 1K3LA 1PQNA 2VL2C 5ELGA 2ZUPA 5DVBA 1A0RP 4PURA 3TKRA 1FVJA 3HVSA 2GQKA 3I43A 2LSTA 2VD1A 4PNFA 4NMUA 3DYRA 4Z7XA 3IAS2 2CZ3A 3LYPA 2ES7A 1AUCA 1USBA 2XPDA 2KHPA 5G31A 4J2FA 1FB6A 4PX1A 2O7KA 3IPZA 4V2MA 3KM6A 5CYYA 2I4AA 2IMDA 1F3AA 4MZWA 4CW9A 4ZBAA 4MF5A 3GH9A 1GSSA 1OE8A 1KTEA 2N5AA 4IQ1A 3MDKA 4HQSA 4BVXA 4V1Ap 4GRFA 10GSA 1YZXA 1V98A 5ECOB 2RM5A 3VWXA 2IMIA 3KZQA 1XOAA 5ELAA 2DIZA 1EEJA 2H1AA 2MBTA 3QAVA 5H5RA 1YJ6A 3IV4A 14GSA 2ZCTA 1QUWA 2OADA 2O89A 3LSZA 3TKPA 4IJIA 5DJMA 3M0FA 3M8NA 4XS6A 1U3AA 2H19A 1ZL9A 1W4VA 4F9ZA 3GKNA 1O8XA 2RLIA 4BVYA 3GNJA 5DALA 3G7JA 3CXGA 1YEXA 1M99A 3TJFA 2P0GA 1UA5A 2J23A 1XWKA 2C0EA 1WJKA 4Q5QA 1B9YC 4TXOB 4K7NA 3DKSA 1PGTA 5F06A 5J5NA 2CVKA 3GHAA 5IQYA 4ZB9A 4IP6A 4L0UA 2VLTA 1DE2A 4X1UA 1YQ1A 2VLUA 1N2AA 1EP8A 3ZL5A 2CT6A 3QPMA 5HFIA 2HFDA 2B7JA 3ZFBA 1M2DA 2YOIA 4GCIA 4NXIA 1UN2A 4AJ6A 4OO4A 1ERTA 4I2TA 4KA0A 4MJEA 4N30A 4TR1B 3VURA 3QCPA 1K3YA 1GUMA 2VL3A 2B1KA 1XW5A 3GKKA 4I5QA 5J3RA 2VD0A 3S9FA 1NW2A 2D2ZA 5CREA 3LQ7A 1R26A 2V41A 1WE0A 3RDWA 5J9CA 5ID2A 3HDCA 4XIHA 2NBSA 5E59A 3GKXA 3BOAA 5G2ZA 2P31A 4LMVA 1THXA 3ZMLA 4ZBDA 4OWYA 3KH9A 1PKZA 5C00A 3KP9A 1O81A 4IGJA 3F3QA 1HNBA 2A2SA 4K8MA 5B8BA 1G7OA 1V57A 5B6NA 4WF5A 2GT6A 1K0AA 2LRTA 5HQPA 6GSSA 4OO5A 3FR9A 1V58A 1BG5A 1MEKA 1U6TA 1A2MA 3WD6A 4BA7A 2DJ0A 4RQRA 4LMWA 2BMXA 4KDYA 2LNTA 4CHSA 1J9BA 1SD9A 2FWFA 4L5LA 3M9KA 2C3QA 3MSZA 1TOFA 2XBQA 3ZREA 2LKUA 2PVQA 5IMAA 1NM3A 4KAEA 1ZGNA 1PX6A 2YWIA 3E9JB 1X9SB 2HYXA 4KH7A 5IMFA 4RI6A 4MLYA 3PINA 4HZ4A 1A8LA 5IOXA 4K7IA 5AIXA 4EE0A 2ALBA 2H8LA 3RPPA 3DGQA 2L5LA 2H72A 4YQUA 1N8JA 2QKEA 2A2RA 2DMLA 2O8VB 5IMCA 1FOVA 2VCQA 3IC4A 3J7Yb 3L0HA 2A4VA 1IYHA 3HJMA 3L78A 1X5DA 5F07A 4G10A 3DEXA 2F8AA 1A23A 3K8NA 4KDXA 3IAM2 3ERFA 2B7KA 1M2AA 1A2JA 1EEMA 2PN8A 3UAPA 2HE3A 4PUAA 2YANA 1TK5B 3IBHA 1Y6EA 4IBPA 4MJCA 3RBTA 2DMMA 1T00A 1SK2A 3CSJA 2EIQA 1K0OA 2HNLA 5LD0A 3WGXA 1K0NA 4IJ3A 1GULA 2X8GA 2H6YA 3GFKA 1SD8A 8GSSA 4AGSA 3WGEA 4CDOA 2RIIA 5JCWA 4L8EA 2K8SA 1JLVA 4ISDA 1YKAA 2LJKA 2XBIA 1LBKA 1SL1B 4XS1A 1A2LA 4PQIA 1ERVA 2GSQA 3FR6A 5ECRB 3QD9A 3GN3A 1GSEA 3N9JA 5DJLA 5GAND 1PX7A 1FB0A 3H8QA 1LJRA 4NAXA 4GXZA 1Z3EA 1YF0A 3Q19A 2XPEA 5D9TA 1OC3A 3L4NA 3HJOA 3TRPA 1WMJA 4JR4A 3RPNA 3Q18A 4ZILA 3HVXA 1R5PA 2GDRA 4KNDA 2HT9A 2GZPA 5E4WA 5JWOB 1VRSD 1JFUA 2VM2A 1MD3A 2ON7A 3DWVA 3F8UA 5IOWA 2RUEA 3ED3A 1PMTA 3L9UA 4NV2A 1GL8A 1EWXA 1O8WA 2B3SA 5KN3A 1BAYA 2H0HA 1O85A 1RQMA 1YKCA 3C8EA 4POLA 2NVLA 1RW1A 4MMMA 4Q5NA 4BWSA 3DIEA 4K0NA 1XPVA 4WR5A 1OKTA 2PERA 2VM1A 1A0FA 2VO4A 3H79A 3QMXA 3D6IA 3Q6OA 3F6FA 1NHOA 3DVXA 12GSA 3KCMA 1AQWA 3UJ1A 4ECJA 3QFAC 2R3XA 3QOUA 2R2JA 3ERGA 3TKSE 5CO3A 3BBYA 4OFMA 3GSTA 4WBRD 4L0WA 1HNCA 4J56E 3IE3A 2FD3A 1SKSB 2VCVA 4J57E 4KGIA 4F03A 5ECMB 3MNGA 1XVWA 3GKMA 1H4OA 2DSAA 2EC4A 2N5FA 1TI1A 2GS3A 1EV9A 1XW9A 1Z5YE 3N5OA 2H74A 1SL0B 19GSA 3G7IA 4MJAA 5B7CA 2GSRA 3TJGA 3LG6A 4QL7A 3LFLA 3M1GA 1YY7A 3JCML 4POKA 3TOTA 1TKDB 2B5YA 4DSRA 3BJ5A 3CSIA 3HVVA 3C71A 2DBCA 2YV9A 4KB3A 3ZMKA 4LLRA 4BPYA 1M2BA 3E3EA 3TRXA 3GA4A 1SKRB 4EXJA 1FW1A 3KP8A 1ZYQB 2JADA 2HSYA 2CX3A 3CBUA 4IW9A 1PKWA 1RK4A 3I6AA 9GSSA 3ME8A 3FZAA 1SK0A 1BJXA 2VLVA 3A2WA 3F3RA 3O3TA 4PNGA 2VIMA 1WIKA 2K8VA 1WRYA 4F0BA 5JCGA 4OFNA 2C0DA 1X9WB 5IM9A 16GSA 4N11A 1BEDA 4ID0A 4KDUA 4LL1B 2YZUA 3WGDA 3EYTA 3CSHA 3F63A 4NHZA 2CX4A 2CAQA 2QSIA 1A24A 5G1LA 1TJDA 1MTCA 2HLSA 3QFBC 2JL4A 4IN0A 1EOGA 5DAKB 1SJZA 1TRVA 3KIJA 3DRNA 4MZCA 2REMA 3KXOA 5ECSA 4XS4B 3TB2A 2YNXA 5IMZA 3IRAA 5CRHA 4Q5RA 3ZIJA 2JACA 4DSQA 5EVOA 1HNAA 1XZOA 2KP2A 2DJKA 4HOJA 1THOA 3ZVJA 1XWCA 5KN2A 2L4CA 5CNWA 4GSSA 4WBJA 3TRQA 1DBYA 1OC8A 4MF6A 3UBLA 1ZCPA 4POMA 2JZTA 5A4WA 3CTFA 4TXOA 3SBCA 1VF1A 4GLTA 2YPMA 4JR6A 4O32A 1YDKA 2LQQA 2V1MA 5H5SA 2BTOT 1WP0A 1EOHA 1AC1A 2IN3A 2WGRA 1T4YA 3L9SA 1ERUA 3TOUA 4DSSA 2F51A 2KUCA 2LNSA 5LCZA 3PGTA 3FYGA 3VWVA 4PQ1A 1S3AA 2J9HA 3LWAA 4BWQA 2DIYA 4K6XA 3GMFA 1XBSA 5H5QA 2YWMA 4XRDA 1S3CA 2AV4A 4K1FA 2VAFA 4TR1A 1TXXA 2TRXA 3VFIA 3GRXA 4P3YB 4KSMA 3O6TA 5ABRA 3HZ8A 3H93A 2OJLA 2KOKA 2IL3A 3CYNA 2HI7A 3GX8A 2PMTA 5INYA 1GSUA 2OBKA 4HQZA 5HR2A 4EF0A 1JLWA 3NZNA 2I9HA 4OCEA 1GNEA 2H0GA 1SJIA 3IDVA 2GTUA 3EMXA 5CRGA 4YQVA 1PSQA 2L57A 5G5FA 1FVKA 4FO5A 4HDEA 4ZXGA 1Z6MA 2LRNA 1O7UA 1IYIA 4QQ7A 2XHFA 3ZLPA 4E8EA 2H75A 2E2MA 4JZQA 1U88A 1FG4A 4ULXA 3M9JA 5ECLB 4MJBA 6GSWA 5F0GA 4LL4B
chains in the Genus database with same CATH superfamily
3DVWA 1OYJA 3WT2A 1BX9A 2MMAA 3IOSA 5GSSA 1GH2A 4L5OA 2R0PA 4IQAA 7GSSA 5GAPD 1SYXA 3TDGA 1XWAA 1ZMAA 2HZFA 3EURA 4O92A 4HSCX 1R7HA 3LYKA 3VPTA 4YAPA 4ML1A 1OC9B 1TU7A 3FR3A 2OACA 2I1UA 2VCWA 3APQA 3HCZA 4V2NA 4WF4A 1AW9A 3TJKA 2R0GA 2H0IA 1JZWA 4X4JA 4IVFA 1KEBA 2VCXA 1M7TA 1O6JA 3KMNA 2R5GA 1B8XA 3HJPA 3ZITA 4FYCA 1TU8A 1K0CA 3ZIVA 3F6DA 3BCKA 3UOMA 1T4ZA 2LJAA 1T3BA 4MK3A 6GSXA 1G0TA 1SU9A 2LRCA 3U5RE 4G19A 6GSVA 3UVTA 1XVQA 3DD3A 2GZZA 4KUNA 3LJRA 1G6YA 3FK8A 3GUSA 4ZIJA 1ON4A 1EV4A 2FUG2 2AUVA 3DXBA 3BCIA 4D73B 2I3YA 1ST9A 5DBQA 1UC7A 4LA1A 1SL2B 5IMDA 3US3A 1AXDA 4GSNA 3D4TA 3VI5A 1XXUA 4H86A 2B5XA 2F9SA 3RHBA 2H6ZA 4N10A 1ERWA 5D96A 4JRRA 2C1YA 1DUGA 1GTBA 3ISOA 5IPHA 4ZL7A 5J41A 2ZNMA 2QGVA 4O5RA 2E0QA 2K18A 2M46A 4MABA 2O87A 4EO3A 1VF3A 2VL2A 5AISA 2QC7A 2H1GA 1AQXA 1V2AA 3LXTA 3GSSA 1GTUA 2M72A 5GZZB 1VGLA 1Z6NA 4ZL9A 5ECKB 3GTUB 1PRXA 4JEDA 3UIWA 2IFQB 3PPUA 5KOXA 2E2GA 2V6OA 2LJRA 3UL3A 3TGZA 2M80A 4WEYA 1UVZA 3DMLA 5EL8A 2Z9SA 2B5EA 3L9VA 4ACSA 3RAZA 4KCEA 3QAWA 1QQ2A 1V9WA 4F2IA 2YWNA 4PTSA 3HKRA 1U3IA 2CA8A 2OKAA 3FHKA 3GV1A 3A2VA 2P5RA 1X5EA 3AY8A 2C3NA 4ECBA 4IHUA 4ZL8A 4ZB8A 1EGOA 2WB9A 2PVOC 5EPFA 1GTAA 4PXOA 4EKZA 2LTKA 4YH2A 5DDLA 2CQ9A 5J9BA 5ECQB 1Z9HA 4OMVA 1PA3A 3KTBA 4I2UA 4TR3A 2GZYA 2DJ1A 1Q4JA 2H71A 3IR4A 4GF0A 2HSMA 2YZHA 5D93A 1J0FA 5JCUA 1SENA 18GSA 3HVNA 3P8WA 3TUEA 1WPIA 5ECHB 3BD2A 3MAKA 3W8JA 1WWJA 5ECIB 3ZVJD 3TCOA 2PWJA 2QA2A 2H30A 2P5QA 5J4UA 2H70A 1GSQA 2HRNA 1K3OA 3IA1A 4BL7A 2TIRA 3QAGA 2RUFA 5FWGA 1KNGA 1BYEA 3FRCA 3E0UA 4HU9A 3U6VA 4YAVA 2WRTA 1DSBA 1LU4A 6GSYA 1TDIA 2WULA 2CVDA 3MIXA 2OE0A 1W89A 2OE1A 4EIPA 1QXHA 1OVNA 5HR0A 3UBKA 2L6CA 2C8UA 3R2QA 3W6GA 3A5WA 3D21A 4N0ZA 1R5AA 2FNOA 2F3MA 2YV7A 2KLXA 1M9BA 4K5SA 1ZYEA 4MA9A 1FAAA 2PU9C 4V2LA 1OAZA 3A3TA 3ZRDA 1MD4A 2MYGA 1AIUA 1ILOA 2FWHA 5KN0A 5F05A 2YN1A 2JSYA 1X0RA 4TOPA 2GSTA 4MZBA 1TI3A 4K2XA 5HFGA 1I9DA 17GSA 5DQSA 5HR3A 5G5EA 1K0MA 3OR5A 5EY6A 3LGCA 2K6VA 3ME7A 1ML6A 2HXKA 1M9AA 3EE2A 3QR6A 2JSZA 1ZZYA 2MMNA 1F9MA 2PPTA 22GSA 1F6MC 1PN0A 2VCTA 5KN1A 3ERWA 2HZEB 3IK9A 4DEJA 2MMOA 1GSYA 1E2YA 2OBIA 3FW2A 4ZB6A 3HYPA 2PBJA 4FYBA 5DAKA 1XW6A 4MPFA 4N0VA 3IXRA 3FEUA 5D9VA 2JU5A 4XS4A 2L5OA 1TRWA 2V6KA 3KEBA 1ABAA 4FQUA 1ZOFA 1SJ6A 2JZRA 2IPAA 4NHWA 1SK1A 1S3RA 2CZ2A 4GTUA 1S3DA 3MWHA 5IO0A 1B4PA 3UVHA 2BJXA 4EC0A 1F37A 3GL3A 5A4UA 1GUHA 3F9UA 1Z7RA 1XWGA 1TRSA 2YP6A 4BVXB 2EIRA 1YF1A 1GP1A 5DCHA 2MBSA 3WYWA 1TTZA 4NV5A 4PGTA 2ON5A 3EU3A 3EC3A 5D9WA 4TR4A 3UMAA 4KCAA 2WDUA 4HU7A 4CY8A 1CQGA 2PUKC 1T1VA 4DVCA 4MH2A 6GSTA 4OFTA 3C1RA 3FZ4A 13GSA 2YCDA 4OCFA 3LXZA 1GUKA 2H1BA 3GH6A 2H01A 3Q74A 2VUPA 3NIVA 1JZOA 1TP9A 3WT1A 4EIQA 2FWGA 1HYUA 2FA4A 2GT5A 2IMEA 4MF7A 4O5UA 1AQVA 4BVYB 3HD5A 4V1Ag 4TKYA 5A4VA 5DALB 2FY6A 4MPGA 5KEJA 1J08A 3TKQA 4X0XA 5DQYA 5ECPB 3C7MA 5DCGA 6GSUA 3D0ZA 2OE3A 3F0IA 4NWYA 4GSTA 1EZKA 1TW9A 3O76A 3GYKA 4JU5A 3TKSC 3VI7A 3P7XA 1NHYA 4ECIA 3EWLA 4KE3A 2FLSA 20GSA 1A8YA 1X9MB 4KSOA 4FH8A 2GGTA 4YQMA 3VWWA 5IMVA 2F8FA 2WJUA 4DSSB 2O85A 2IMFA 1VF4A 2IJYA 1NSWA 3VK9A 3QDNA 2FGXA 1PFOA 3HZ4A 3KTLA 2R4VA 2CAIA 4XRAA 5L71A 2CVBA 1Q98A 4WXTA 1X5CA 2PGTA 3CTGA 4GQCA 5F8BA 4E8HA 3CRTA 3UEMA 4QL9A 4I6XA 3ZTLA 2AHEA 5ID2B 2L6DA 1SYRA 1K0DA 5D9XA 1QFNA 1TK0B 4ZBBA 4G9HA 1HQOA 2DJ2A 4MDCA 2GQLA 2X99A 1R4WA 3IK7A 3TJBA 3IC8A 3G7YA 2AB6A 2LEGA 5HFKA 1C72A 4AJ8A 2GQMA 3HXSA 2C4JA 2DKHA 1B9XC 1OKDA 2K9FA 4USSA 5AIVA 3VPQA 4MP4A 5AGYA 3VLNA 4NPBA 3FY7A 4WKWA 3HHVA 2X8CA 3ZFLA 4HUAA 2C0FA 5IPGA 1G6WA 2L4QA 4FIWA 4O5QA 4ML6A 4PUFC 3RHCA 1VF2A 2RM6A 4HI7A 1OC9A 4IP1A 2X8HA 3APSA 4PQHA 4TRXA 1Z7PA 2LUSA 5ENUA 2HRFA 1GLQA 3A5IA 5G1KA 4XHMA 3H1NA 5CRWA 11GSA 4JBBA 3FKFA 1GRXA 4A5PA 3EMPA 5IO2A 4YKFA 5FHIA 5IIZA 1HD2A 3NOFA 3F4SA 3F4TA 3VWUA 3R3EA 1PL1A 3P2AA 4POBA 2N5BA 1WOUA 3J7Yk 5BRTA 4IS0A 1PL2A 2AYTA 5G30A 1TRUA 3IHQA 3I9V2 5D8IA 5C04A 3LW9A 1B48A 2LQOA 2H1DA 1YEPA 4K5RA 4G0LA 2LS5A 5B8AA 4TN8A 2V2GA 4F82A 1BQ7A 4D73A 2R6KA 3ZYWA 2VCZA 4FYUA 4IELA 4KX4A 5HR1A 2GVPA 1F2EA 1URMA 2JZSA 3GURA 4HEA2 4AF2A 4GWRA 4KW6A 5CP1A 4TXVA 4WETA 1V40A 1B4QA 4XCSA 3EVIA 1JHBA 2B1LA 2X64A 3M3MA 4HZ2A 3PH9A 2VOCA 4KF9A 4HS1A 4XTSA 3C1SA 3P90A 3H4KA 4ILFA 2XC2A 5CRDA 4TW5A 2DJJA 2MMZA 4OD7A 1TK8B 1T7PB 1PN9A 4RI7A 4GQFA 4EDYA 1GSFA 3G9BA 3V1WA 3GTUA 3EINA 1GSDA 2NDOA 2IFQA 2E7PA 4K9ZA 3LORA 5JWQB 1K0BA 1H75A 2NPBA 1E6BA 3EU4A 2V32A 3APOA 4F0CA 1GTIA 1KBNA 3HA9A 1GLPA 1QGVA 5COHA 4X43A 1SKWB 2AAWA 5GSTA 3FZ5A 3GIXA 4EDZA 2TRCP 4RQXA 1FO5A 2YJHA 3KJYA 3A2XA 3C73A 1F3BA 2H76A 1XWBA 2WFCA 2AJQB 1MDIA 1I5GA 4ICYA 2C80A 3CMIA 3KD0A 1M0UA 4EVMA 3IHGA 2GLRA 4I97A 1XOBA 4EUYA 4WR4A 1XIYA 2FWEA 4JE1A 3FZ9A 1QK8A 2CV4A 5AN1A 4MH3A 4HJ2A 4TR0A 4BIKA 1XFLA 1G7EA 1FHEA 1Y25A 3KGKA 3CRUA 4Z2TA 3D4MA 2IMKA 2B6MA 2C3TA 2GSSA 3D22A 1MDKA 4RUVA 1QMVA 2DLXA 1M3JA 2WS2A 3D5JA 4TVEA 2G0FA 3F4RA 5D73A 2YWOA 1CQHA 4Z2RA 1EP7A 4MCUA 1GNWA 2IWTA 3UARA 2YJ7A 2H66A 2G2QA 4AJ7A 4EL1A 1DE1A 1FOHA 2NTOA 4K7OA 2R0CA 3LEFA 2FA8A 3W8SA 1JZDA 3TKSA 1PD21 4HJMA 2FCHA 4Q5FA 2R37A 3KH7A 5A5KA 1T8EB 2IIYA 2OA7A 2MZCA 4K0GA 1ACVA 1JZRA 2WCIA 4O7HA 5JWRB 2H6XA 2LV3A 2EIOA 2DC5A 3GL5A 2DJ3A 2H73A 5FT3A 4ECCA 1GWCA 1MDJA 2VL9A 2I81A 3SWLA 5LNKe 2HSHA 5KOWA 3ZZXA 2FHEA 4I8BA 5B6MA 1XCCA 2WZ9A 3TJJA 2KP1A 1O73A 4K2DA 2C0GA 2L59A 5ECNB 1OE7A 1AAZA 5CAXA 3GX0A 3PR8A 2HZEA 3KMOA 1U87A 3HY2A 1EGRA 4G2EA 3I69A 1K3LA 1PQNA 2VL2C 5ELGA 2ZUPA 5DVBA 1A0RP 4PURA 3TKRA 1FVJA 3HVSA 2GQKA 3I43A 2LSTA 2VD1A 4PNFA 1XG8A 4NMUA 3DYRA 4Z7XA 3IAS2 2CZ3A 3LYPA 2ES7A 1AUCA 1USBA 2XPDA 2KHPA 5G31A 4J2FA 1FB6A 4PX1A 2O7KA 3IPZA 4V2MA 3KM6A 5CYYA 2I4AA 2IMDA 1F3AA 4MZWA 4CW9A 4ZBAA 4MF5A 3GH9A 1GSSA 1OE8A 1KTEA 2N5AA 4IQ1A 3MDKA 4HQSA 4BVXA 4V1Ap 4GRFA 10GSA 1YZXA 1V98A 5ECOB 2RM5A 3VWXA 2IMIA 3KZQA 1XOAA 5ELAA 2DIZA 1EEJA 2H1AA 2MBTA 3QAVA 5H5RA 1YJ6A 3IV4A 14GSA 2ZCTA 1QUWA 2OADA 2O89A 3LSZA 3TKPA 4IJIA 5DJMA 3M0FA 3M8NA 4XS6A 1U3AA 4G0KA 2H19A 1ZL9A 1W4VA 4F9ZA 3GKNA 1O8XA 2RLIA 4BVYA 3GNJA 5DALA 3G7JA 3CXGA 1YEXA 1M99A 3TJFA 2P0GA 1UA5A 2J23A 1XWKA 2C0EA 1WJKA 4Q5QA 1B9YC 4TXOB 4K7NA 3DKSA 1PGTA 5F06A 5J5NA 2CVKA 3GHAA 5IQYA 4ZB9A 4IP6A 4L0UA 2VLTA 1DE2A 4X1UA 1YQ1A 2VLUA 1N2AA 1EP8A 3ZL5A 2CT6A 3QPMA 5HFIA 2HFDA 2B7JA 3ZFBA 1M2DA 2YOIA 4GCIA 4NXIA 1UN2A 4AJ6A 4OO4A 1ERTA 4I2TA 4KA0A 4MJEA 4N30A 4TR1B 3VURA 3QCPA 1K3YA 1GUMA 2VL3A 2B1KA 1XW5A 3GKKA 4I5QA 5J3RA 2VD0A 3S9FA 1NW2A 2D2ZA 2A4HA 5CREA 3LQ7A 1R26A 2V41A 1WE0A 3RDWA 5J9CA 5ID2A 3HDCA 4XIHA 2NBSA 5E59A 3GKXA 3BOAA 5G2ZA 2P31A 4LMVA 1THXA 3ZMLA 4ZBDA 4OWYA 3KH9A 1PKZA 5C00A 3KP9A 1O81A 4IGJA 3F3QA 1HNBA 2A2SA 4K8MA 5B8BA 1G7OA 1V57A 5B6NA 4WF5A 2GT6A 1K0AA 2LRTA 5HQPA 6GSSA 4OO5A 3FR9A 1V58A 1BG5A 1MEKA 1U6TA 1A2MA 3WD6A 4BA7A 2DJ0A 4RQRA 4LMWA 2BMXA 4KDYA 2LNTA 4CHSA 1J9BA 1SD9A 2FWFA 4L5LA 3M9KA 2C3QA 3MSZA 1TOFA 2XBQA 3ZREA 2LKUA 2PVQA 5IMAA 1NM3A 4KAEA 1ZGNA 1PX6A 2YWIA 3E9JB 1X9SB 2HYXA 4KH7A 5IMFA 4RI6A 4YKGA 4MLYA 3PINA 4HZ4A 1A8LA 5IOXA 4K7IA 5AIXA 4EE0A 2ALBA 2H8LA 3RPPA 3DGQA 2L5LA 2H72A 4YQUA 1N8JA 2QKEA 2A2RA 2DMLA 2O8VB 5IMCA 1FOVA 2VCQA 3IC4A 3J7Yb 3L0HA 2A4VA 1IYHA 3HJMA 3L78A 1X5DA 5F07A 4G10A 3DEXA 2F8AA 1A23A 3K8NA 4KDXA 3IAM2 3ERFA 2B7KA 1M2AA 1A2JA 1EEMA 2DKIA 2PN8A 3UAPA 2HE3A 4PUAA 2YANA 1TK5B 3IBHA 1Y6EA 4IBPA 4MJCA 3RBTA 2DMMA 1T00A 1SK2A 3CSJA 2EIQA 1K0OA 2HNLA 5LD0A 3WGXA 1K0NA 4IJ3A 1GULA 2X8GA 2H6YA 3GFKA 1SD8A 8GSSA 4AGSA 3WGEA 4Z2UA 4CDOA 2RIIA 5JCWA 4L8EA 2K8SA 1JLVA 4ISDA 1YKAA 2LJKA 3CQFA 2XBIA 1LBKA 1SL1B 4XS1A 1A2LA 4PQIA 1ERVA 2GSQA 3FR6A 5ECRB 3QD9A 3GN3A 1GSEA 3N9JA 5DJLA 5GAND 1PX7A 1FB0A 3H8QA 1LJRA 4NAXA 4GXZA 1Z3EA 1YF0A 3Q19A 2XPEA 5D9TA 1OC3A 3L4NA 3HJOA 3TRPA 1WMJA 4JR4A 3RPNA 3Q18A 4ZILA 3HVXA 1R5PA 2GDRA 4KNDA 2UZ8A 2HT9A 2GZPA 5E4WA 5JWOB 1VRSD 1JFUA 2VM2A 1MD3A 2ON7A 3DWVA 3F8UA 5IOWA 2RUEA 3ED3A 1PMTA 3L9UA 4NV2A 1GL8A 1EWXA 1ZYNA 1O8WA 2B3SA 5KN3A 1BAYA 2H0HA 1O85A 1RQMA 1YKCA 3C8EA 4POLA 2NVLA 1RW1A 4MMMA 4Q5NA 4BWSA 3DIEA 4K0NA 1XPVA 4WR5A 1OKTA 2PERA 2VM1A 1A0FA 2VO4A 3H79A 3QMXA 3D6IA 3Q6OA 3F6FA 1NHOA 3DVXA 12GSA 3KCMA 1AQWA 3UJ1A 4ECJA 3QFAC 3EPTA 2R3XA 3QOUA 4MNNA 2R2JA 3ERGA 3TKSE 5CO3A 3BBYA 4OFMA 3GSTA 4WBRD 4L0WA 1HNCA 4J56E 3IE3A 5F0GA 2FD3A 1SKSB 2VCVA 4J57E 4KGIA 4F03A 2HRKA 5ECMB 3MNGA 1XVWA 3GKMA 1H4OA 2DSAA 2EC4A 2N5FA 1TI1A 2GS3A 1EV9A 1XW9A 1Z5YE 4BL7B 3N5OA 2H74A 1SL0B 19GSA 3G7IA 4MJAA 5B7CA 2GSRA 3TJGA 3LG6A 4QL7A 3LFLA 3M1GA 1YY7A 3JCML 4POKA 3TOTA 1TKDB 2B5YA 4DSRA 3BJ5A 3CSIA 3HVVA 3C71A 2DBCA 2YV9A 4KB3A 3ZMKA 4LLRA 4BPYA 1M2BA 3E3EA 3TRXA 3GA4A 1SKRB 4EXJA 1FW1A 3KP8A 1ZYQB 2JADA 2HSYA 3FMWA 2CX3A 3CBUA 4IW9A 1PKWA 1RK4A 3I6AA 9GSSA 3ME8A 3FZAA 1SK0A 1BJXA 2VLVA 3A2WA 3F3RA 2QA1A 3O3TA 4PNGA 2VIMA 1WIKA 2K8VA 1WRYA 4F0BA 5JCGA 4OFNA 2C0DA 1X9WB 5IM9A 16GSA 4N11A 1BEDA 4ID0A 4KDUA 4LL1B 2YZUA 3WGDA 3EYTA 3CSHA 3F63A 4NHZA 2CX4A 2CAQA 2QSIA 1A24A 5G1LA 1TJDA 4G0IA 1MTCA 2HLSA 3QFBC 2JL4A 4IN0A 1EOGA 5DAKB 1SJZA 1TRVA 3KIJA 3DRNA 4MZCA 2REMA 5BMUA 3KXOA 1M3IA 5ECSA 4XS4B 3TB2A 2YNXA 5IMZA 3IRAA 5CRHA 2X4AA 4Q5RA 3ZIJA 2JACA 4DSQA 5EVOA 1HNAA 1XZOA 2KP2A 2DJKA 4HOJA 1THOA 3ZVJA 1XWCA 5KN2A 2L4CA 5CNWA 4GSSA 4WBJA 3TRQA 1DBYA 1OC8A 4MF6A 3MYDA 3UBLA 1ZCPA 4POMA 2JZTA 5A4WA 3CTFA 4TXOA 3SBCA 1VF1A 1ZYPA 4GLTA 2YPMA 4JR6A 4O32A 1YDKA 2LQQA 2V1MA 5H5SA 2BTOT 1WP0A 1EOHA 1AC1A 2IN3A 2WGRA 1T4YA 3L9SA 1ERUA 3TOUA 4DSSA 2F51A 2KUCA 2LNSA 5LCZA 3PGTA 3FYGA 3VWVA 4PQ1A 1S3AA 2J9HA 3LWAA 4BWQA 2DIYA 4K6XA 3GMFA 1XBSA 5H5QA 2YWMA 4XRDA 1S3CA 2AV4A 4K1FA 2VAFA 4TR1A 1TXXA 2TRXA 3VFIA 3GRXA 4P3YB 4KSMA 3O6TA 5ABRA 3HZ8A 3H93A 2OJLA 2KOKA 2IL3A 3CYNA 2HI7A 3GX8A 2PMTA 5INYA 1GSUA 2OBKA 4HQZA 5HR2A 4EF0A 1JLWA 3NZNA 2I9HA 4OCEA 2HRAA 1GNEA 2A2PA 2H0GA 1SJIA 3IDVA 2X49A 2GTUA 3EMXA 5CRGA 4YQVA 1PSQA 2L57A 5G5FA 1FVKA 4FO5A 4HDEA 4ZXGA 1Z6MA 2LRNA 1O7UA 1IYIA 4QQ7A 2XHFA 3ZLPA 4E8EA 2H75A 2E2MA 4JZQA 1U88A 4CY6A 1FG4A 4ULXA 3M9JA 5ECLB 4MJBA 6GSWA 4IKHA 4LL4B
chains in the Genus database with same CATH topology
3DVWA 1OYJA 3WT2A 1BX9A 2MMAA 3IOSA 5GSSA 1GH2A 4L5OA 2R0PA 4IQAA 7GSSA 5GAPD 1SYXA 3TDGA 1XWAA 1ZMAA 2HZFA 3EURA 4O92A 1R7HA 3LYKA 3VPTA 4YAPA 4ML1A 1OC9B 1TU7A 3FR3A 2OACA 2I1UA 2VCWA 3APQA 3HCZA 4V2NA 4WF4A 1AW9A 3TJKA 2R0GA 2H0IA 1JZWA 4X4JA 4IVFA 1KEBA 2VCXA 1M7TA 1O6JA 3KMNA 2R5GA 1B8XA 3HJPA 3ZITA 4FYCA 1TU8A 1K0CA 3ZIVA 3F6DA 3BCKA 3UOMA 1T4ZA 2LJAA 1T3BA 4MK3A 6GSXA 1G0TA 1SU9A 2LRCA 3U5RE 4G19A 6GSVA 3UVTA 1XVQA 3DD3A 2GZZA 4KUNA 3LJRA 1G6YA 3FK8A 3GUSA 4ZIJA 1ON4A 1EV4A 2FUG2 2AUVA 3DXBA 3BCIA 4D73B 2I3YA 1ST9A 5DBQA 1UC7A 4LA1A 1SL2B 5IMDA 3US3A 1AXDA 4GSNA 3D4TA 3VI5A 1XXUA 4H86A 2B5XA 2F9SA 3RHBA 2H6ZA 4N10A 1ERWA 5D96A 4JRRA 2C1YA 1DUGA 1GTBA 3ISOA 5IPHA 4ZL7A 5J41A 2ZNMA 2QGVA 4O5RA 2E0QA 2K18A 2M46A 4MABA 2O87A 4EO3A 1VF3A 2VL2A 5AISA 2QC7A 2H1GA 1AQXA 1V2AA 3LXTA 3GSSA 1GTUA 2M72A 5GZZB 1VGLA 1Z6NA 4ZL9A 5ECKB 3GTUB 1PRXA 4JEDA 3UIWA 2IFQB 3PPUA 5KOXA 2E2GA 2V6OA 2LJRA 3UL3A 3TGZA 2M80A 4WEYA 1UVZA 3DMLA 5EL8A 2Z9SA 2B5EA 3L9VA 4ACSA 3RAZA 4KCEA 3QAWA 1QQ2A 1V9WA 4F2IA 2YWNA 4PTSA 3HKRA 1U3IA 2CA8A 2OKAA 3FHKA 3GV1A 3A2VA 2P5RA 1X5EA 3AY8A 2C3NA 4ECBA 4IHUA 4ZL8A 4ZB8A 1EGOA 2WB9A 2PVOC 5EPFA 1GTAA 4PXOA 4EKZA 2LTKA 4YH2A 5DDLA 2CQ9A 5J9BA 5ECQB 1Z9HA 4OMVA 1PA3A 3KTBA 4I2UA 4TR3A 2GZYA 2DJ1A 1Q4JA 2H71A 3IR4A 4GF0A 2HSMA 2YZHA 5D93A 1J0FA 5JCUA 1SENA 18GSA 3P8WA 3TUEA 1WPIA 5ECHB 3BD2A 3MAKA 3W8JA 1WWJA 5ECIB 3ZVJD 3TCOA 2PWJA 2QA2A 2H30A 2P5QA 5J4UA 2H70A 1GSQA 2HRNA 1K3OA 3IA1A 4BL7A 2TIRA 3QAGA 2RUFA 5FWGA 1KNGA 1BYEA 3FRCA 3E0UA 4HU9A 3U6VA 4YAVA 2WRTA 1DSBA 1LU4A 6GSYA 1TDIA 2WULA 2CVDA 3MIXA 2OE0A 1W89A 2OE1A 4EIPA 1QXHA 1OVNA 5HR0A 3UBKA 2L6CA 2C8UA 3R2QA 3W6GA 3A5WA 3D21A 4N0ZA 1R5AA 2FNOA 2F3MA 2YV7A 2KLXA 1M9BA 4K5SA 1ZYEA 4MA9A 1FAAA 2PU9C 4V2LA 1OAZA 3A3TA 3ZRDA 1MD4A 2MYGA 1AIUA 1ILOA 2FWHA 5KN0A 5F05A 2YN1A 2JSYA 1X0RA 4TOPA 2GSTA 4MZBA 1TI3A 4K2XA 5HFGA 1I9DA 17GSA 5DQSA 5HR3A 5G5EA 1K0MA 3OR5A 5EY6A 3LGCA 2K6VA 3ME7A 1ML6A 2HXKA 1M9AA 3EE2A 3QR6A 2JSZA 1ZZYA 2MMNA 1F9MA 2PPTA 22GSA 1F6MC 1PN0A 2VCTA 5KN1A 3ERWA 2HZEB 3IK9A 4DEJA 2MMOA 1GSYA 1E2YA 2OBIA 3FW2A 4ZB6A 3HYPA 2PBJA 4FYBA 5DAKA 1XW6A 4MPFA 4N0VA 3IXRA 3FEUA 5D9VA 2JU5A 4XS4A 2L5OA 1TRWA 2V6KA 3KEBA 1ABAA 4FQUA 1ZOFA 1SJ6A 2JZRA 2IPAA 4NHWA 1SK1A 2CZ2A 4GTUA 1S3DA 3MWHA 5IO0A 1B4PA 3UVHA 2BJXA 4EC0A 1F37A 3GL3A 5A4UA 1GUHA 3F9UA 1Z7RA 1XWGA 1TRSA 2YP6A 4BVXB 2EIRA 1YF1A 1GP1A 5DCHA 2MBSA 3WYWA 1TTZA 4NV5A 4PGTA 2ON5A 3EU3A 3EC3A 5D9WA 4TR4A 3UMAA 4KCAA 2WDUA 4HU7A 4CY8A 1CQGA 2PUKC 1T1VA 4DVCA 4MH2A 6GSTA 4OFTA 3C1RA 3FZ4A 13GSA 2YCDA 4OCFA 3LXZA 1GUKA 2H1BA 3GH6A 2H01A 3Q74A 2VUPA 3NIVA 1JZOA 1TP9A 3WT1A 4EIQA 2FWGA 1HYUA 2FA4A 2GT5A 2IMEA 4MF7A 4O5UA 1AQVA 4BVYB 3HD5A 4V1Ag 4TKYA 5A4VA 5DALB 2FY6A 4MPGA 5KEJA 1J08A 3TKQA 4X0XA 5DQYA 5ECPB 3C7MA 5DCGA 6GSUA 3D0ZA 2OE3A 3F0IA 4NWYA 4GSTA 1EZKA 1TW9A 3O76A 3GYKA 4JU5A 3TKSC 3VI7A 3P7XA 1NHYA 4ECIA 3EWLA 4KE3A 2FLSA 20GSA 1A8YA 1X9MB 4KSOA 4FH8A 2GGTA 4YQMA 3VWWA 5IMVA 2F8FA 2WJUA 4DSSB 2O85A 2IMFA 1VF4A 2IJYA 1NSWA 3VK9A 3QDNA 2FGXA 3HZ4A 3KTLA 2R4VA 2CAIA 4XRAA 5L71A 2CVBA 1Q98A 4WXTA 1X5CA 2PGTA 3CTGA 4GQCA 5F8BA 4E8HA 3CRTA 3UEMA 4QL9A 4I6XA 3ZTLA 2AHEA 5ID2B 2L6DA 1SYRA 1K0DA 5D9XA 1QFNA 1TK0B 4ZBBA 4G9HA 1HQOA 2DJ2A 4MDCA 2GQLA 2X99A 1R4WA 3IK7A 3TJBA 3IC8A 3G7YA 2AB6A 2LEGA 5HFKA 1C72A 4AJ8A 2GQMA 3HXSA 2C4JA 2DKHA 1B9XC 1OKDA 2K9FA 4USSA 5AIVA 3VPQA 4MP4A 5AGYA 3VLNA 4NPBA 3FY7A 4WKWA 3HHVA 2X8CA 3ZFLA 4HUAA 2C0FA 5IPGA 1G6WA 2L4QA 4FIWA 4O5QA 4ML6A 4PUFC 3RHCA 1VF2A 2RM6A 4HI7A 1OC9A 4IP1A 2X8HA 3APSA 4PQHA 4TRXA 1Z7PA 2LUSA 5ENUA 2HRFA 1GLQA 3A5IA 5G1KA 4XHMA 3H1NA 5CRWA 11GSA 4JBBA 3FKFA 1GRXA 4A5PA 3EMPA 5IO2A 4YKFA 5FHIA 5IIZA 1HD2A 3NOFA 3F4SA 3F4TA 3VWUA 3R3EA 1PL1A 3P2AA 4POBA 2N5BA 1WOUA 3J7Yk 5BRTA 4IS0A 1PL2A 2AYTA 5G30A 1TRUA 3IHQA 3I9V2 5D8IA 5C04A 3LW9A 1B48A 2LQOA 2H1DA 1YEPA 4K5RA 4G0LA 2LS5A 5B8AA 4TN8A 2V2GA 4F82A 1BQ7A 4D73A 2R6KA 3ZYWA 2VCZA 4FYUA 4IELA 4KX4A 5HR1A 2GVPA 1F2EA 1URMA 2JZSA 3GURA 4HEA2 4AF2A 4GWRA 4KW6A 5CP1A 4TXVA 4WETA 1V40A 1B4QA 4XCSA 3EVIA 1JHBA 2B1LA 2X64A 3M3MA 4HZ2A 3PH9A 2VOCA 4KF9A 4HS1A 4XTSA 3C1SA 3P90A 3H4KA 4ILFA 2XC2A 5CRDA 4TW5A 2DJJA 2MMZA 4OD7A 1TK8B 1T7PB 1PN9A 4RI7A 4GQFA 4EDYA 1GSFA 3G9BA 3V1WA 3GTUA 3EINA 1GSDA 2NDOA 2IFQA 2E7PA 4K9ZA 3LORA 5JWQB 1K0BA 1H75A 2NPBA 1E6BA 3EU4A 2V32A 3APOA 4F0CA 1GTIA 1KBNA 3HA9A 1GLPA 1QGVA 5COHA 4X43A 1SKWB 2AAWA 5GSTA 3FZ5A 3GIXA 4EDZA 2TRCP 4RQXA 1FO5A 2YJHA 3KJYA 3A2XA 3C73A 1F3BA 2H76A 1XWBA 2WFCA 2AJQB 1MDIA 1I5GA 4ICYA 2C80A 3CMIA 3KD0A 1M0UA 4EVMA 3IHGA 2GLRA 4I97A 1XOBA 4EUYA 4WR4A 1XIYA 2FWEA 4JE1A 3FZ9A 1QK8A 2CV4A 5AN1A 4MH3A 4HJ2A 4TR0A 1XFLA 1G7EA 1FHEA 1Y25A 3KGKA 3CRUA 4Z2TA 3D4MA 2IMKA 2B6MA 2C3TA 2GSSA 3D22A 1MDKA 4RUVA 1QMVA 2DLXA 2WS2A 3D5JA 4TVEA 2G0FA 3F4RA 5D73A 2YWOA 1CQHA 4Z2RA 1EP7A 4MCUA 1GNWA 2IWTA 3UARA 2YJ7A 2H66A 2G2QA 4AJ7A 4EL1A 1DE1A 1FOHA 2NTOA 4K7OA 2R0CA 3LEFA 2FA8A 3W8SA 1JZDA 3TKSA 1PD21 4HJMA 2FCHA 4Q5FA 2R37A 3KH7A 5A5KA 1T8EB 2IIYA 2OA7A 2MZCA 4K0GA 1ACVA 1JZRA 2WCIA 4O7HA 5JWRB 2H6XA 2LV3A 2EIOA 2DC5A 3GL5A 2DJ3A 2H73A 5FT3A 4ECCA 1GWCA 1MDJA 2VL9A 2I81A 3SWLA 5LNKe 2HSHA 5KOWA 3ZZXA 2FHEA 4I8BA 5B6MA 1XCCA 2WZ9A 3TJJA 2KP1A 1O73A 4K2DA 2C0GA 2L59A 5ECNB 1OE7A 1AAZA 5CAXA 3GX0A 3PR8A 2HZEA 3KMOA 1U87A 3HY2A 1EGRA 4G2EA 3I69A 1K3LA 1PQNA 2VL2C 5ELGA 2ZUPA 5DVBA 1A0RP 4PURA 3TKRA 1FVJA 3HVSA 2GQKA 3I43A 2LSTA 2VD1A 4PNFA 4NMUA 3DYRA 4Z7XA 3IAS2 2CZ3A 3LYPA 2ES7A 1AUCA 1USBA 2XPDA 2KHPA 5G31A 4J2FA 1FB6A 4PX1A 2O7KA 3IPZA 4V2MA 3KM6A 5CYYA 2I4AA 2IMDA 1F3AA 4MZWA 4CW9A 4ZBAA 4MF5A 3GH9A 1GSSA 1OE8A 1KTEA 2N5AA 4IQ1A 3MDKA 4HQSA 4BVXA 4V1Ap 4GRFA 10GSA 1YZXA 1V98A 5ECOB 2RM5A 3VWXA 2IMIA 3KZQA 1XOAA 5ELAA 2DIZA 1EEJA 2H1AA 2MBTA 3QAVA 5H5RA 1YJ6A 3IV4A 14GSA 2ZCTA 1QUWA 2OADA 2O89A 3LSZA 3TKPA 4IJIA 5DJMA 3M0FA 3M8NA 4XS6A 1U3AA 4G0KA 2H19A 1ZL9A 1W4VA 4F9ZA 3GKNA 1O8XA 2RLIA 4BVYA 3GNJA 5DALA 3G7JA 3CXGA 1YEXA 1M99A 3TJFA 2P0GA 1UA5A 2J23A 1XWKA 2C0EA 1WJKA 4Q5QA 1B9YC 4TXOB 4K7NA 3DKSA 1PGTA 5F06A 5J5NA 2CVKA 3GHAA 5IQYA 4ZB9A 4IP6A 4L0UA 2VLTA 1DE2A 4X1UA 1YQ1A 2VLUA 1N2AA 1EP8A 3ZL5A 2CT6A 3QPMA 5HFIA 2HFDA 2B7JA 3ZFBA 1M2DA 2YOIA 4GCIA 4NXIA 1UN2A 4AJ6A 4OO4A 1ERTA 4I2TA 4KA0A 4MJEA 4N30A 4TR1B 3VURA 3QCPA 1K3YA 1GUMA 2VL3A 2B1KA 1XW5A 3GKKA 4I5QA 5J3RA 2VD0A 3S9FA 1NW2A 2D2ZA 2A4HA 5CREA 3LQ7A 1R26A 2V41A 1WE0A 3RDWA 5J9CA 5ID2A 3HDCA 4XIHA 2NBSA 5E59A 3GKXA 3BOAA 5G2ZA 2P31A 4LMVA 1THXA 3ZMLA 4ZBDA 4OWYA 3KH9A 1PKZA 5C00A 3KP9A 1O81A 4IGJA 3F3QA 1HNBA 2A2SA 4K8MA 5B8BA 1G7OA 1V57A 5B6NA 4WF5A 2GT6A 1K0AA 2LRTA 5HQPA 6GSSA 4OO5A 3FR9A 1V58A 1BG5A 1MEKA 1U6TA 1A2MA 3WD6A 4BA7A 2DJ0A 4RQRA 4LMWA 2BMXA 4KDYA 2LNTA 4CHSA 1J9BA 1SD9A 2FWFA 4L5LA 3M9KA 2C3QA 3MSZA 1TOFA 2XBQA 3ZREA 2LKUA 2PVQA 5IMAA 1NM3A 4KAEA 1ZGNA 1PX6A 2YWIA 3E9JB 1X9SB 2HYXA 4KH7A 5IMFA 4RI6A 4YKGA 4MLYA 3PINA 4HZ4A 1A8LA 5IOXA 4K7IA 5AIXA 4EE0A 2ALBA 2H8LA 3RPPA 3DGQA 2L5LA 2H72A 4YQUA 1N8JA 2QKEA 2A2RA 2DMLA 2O8VB 5IMCA 1FOVA 2VCQA 3IC4A 3J7Yb 3L0HA 2A4VA 1IYHA 3HJMA 3L78A 1X5DA 5F07A 4G10A 3DEXA 2F8AA 1A23A 3K8NA 4KDXA 3IAM2 3ERFA 2B7KA 1M2AA 1A2JA 1EEMA 2DKIA 2PN8A 3UAPA 2HE3A 4PUAA 2YANA 1TK5B 3IBHA 1Y6EA 4IBPA 4MJCA 3RBTA 2DMMA 1T00A 1SK2A 3CSJA 2EIQA 1K0OA 2HNLA 5LD0A 3WGXA 1K0NA 4IJ3A 1GULA 2X8GA 2H6YA 3GFKA 1SD8A 8GSSA 4AGSA 3WGEA 4Z2UA 4CDOA 2RIIA 5JCWA 4L8EA 2K8SA 1JLVA 4ISDA 1YKAA 2LJKA 2XBIA 1LBKA 1SL1B 4XS1A 1A2LA 4PQIA 1ERVA 2GSQA 3FR6A 5ECRB 3QD9A 3GN3A 1GSEA 3N9JA 5DJLA 5GAND 1PX7A 1FB0A 3H8QA 1LJRA 4NAXA 4GXZA 1Z3EA 1YF0A 3Q19A 2XPEA 5D9TA 1OC3A 3L4NA 3HJOA 3TRPA 1WMJA 4JR4A 3RPNA 3Q18A 4ZILA 3HVXA 1R5PA 2GDRA 4KNDA 2UZ8A 2HT9A 2GZPA 5E4WA 5JWOB 1VRSD 1JFUA 2VM2A 1MD3A 2ON7A 3DWVA 3F8UA 5IOWA 2RUEA 3ED3A 1PMTA 3L9UA 4NV2A 1GL8A 1EWXA 1ZYNA 1O8WA 2B3SA 5KN3A 1BAYA 2H0HA 1O85A 1RQMA 1YKCA 3C8EA 4POLA 2NVLA 1RW1A 4MMMA 4Q5NA 4BWSA 3DIEA 4K0NA 1XPVA 4WR5A 1OKTA 2PERA 2VM1A 1A0FA 2VO4A 3H79A 3QMXA 3D6IA 3Q6OA 3F6FA 1NHOA 3DVXA 12GSA 3KCMA 1AQWA 3UJ1A 4ECJA 3QFAC 3EPTA 2R3XA 3QOUA 4MNNA 2R2JA 3ERGA 3TKSE 5CO3A 3BBYA 4OFMA 3GSTA 4WBRD 4L0WA 1HNCA 4J56E 3IE3A 5F0GA 2FD3A 1SKSB 2VCVA 4J57E 4KGIA 4F03A 2HRKA 5ECMB 3MNGA 1XVWA 3GKMA 1H4OA 2DSAA 2EC4A 2N5FA 1TI1A 2GS3A 1EV9A 1XW9A 1Z5YE 4BL7B 3N5OA 2H74A 1SL0B 19GSA 3G7IA 4MJAA 5B7CA 2GSRA 3TJGA 3LG6A 4QL7A 3LFLA 3M1GA 1YY7A 3JCML 4POKA 3TOTA 1TKDB 2B5YA 4DSRA 3BJ5A 3CSIA 3HVVA 3C71A 2DBCA 2YV9A 4KB3A 3ZMKA 4LLRA 4BPYA 1M2BA 3E3EA 3TRXA 3GA4A 1SKRB 4EXJA 1FW1A 3KP8A 1ZYQB 2JADA 2HSYA 3FMWA 2CX3A 3CBUA 4IW9A 1PKWA 1RK4A 3I6AA 9GSSA 3ME8A 3FZAA 1SK0A 1BJXA 2VLVA 3A2WA 3F3RA 2QA1A 3O3TA 4PNGA 2VIMA 1WIKA 2K8VA 1WRYA 4F0BA 5JCGA 4OFNA 2C0DA 1X9WB 5IM9A 16GSA 4N11A 1BEDA 4ID0A 4KDUA 4LL1B 2YZUA 3WGDA 3EYTA 3CSHA 3F63A 4NHZA 2CX4A 2CAQA 2QSIA 1A24A 5G1LA 1TJDA 4G0IA 1MTCA 2HLSA 3QFBC 2JL4A 4IN0A 1EOGA 5DAKB 1SJZA 1TRVA 3KIJA 3DRNA 4MZCA 2REMA 5BMUA 3KXOA 5ECSA 4XS4B 3TB2A 2YNXA 5IMZA 3IRAA 5CRHA 2X4AA 4Q5RA 3ZIJA 2JACA 4DSQA 5EVOA 1HNAA 1XZOA 2KP2A 2DJKA 4HOJA 1THOA 3ZVJA 1XWCA 5KN2A 2L4CA 5CNWA 4GSSA 4WBJA 3TRQA 1DBYA 1OC8A 4MF6A 3MYDA 3UBLA 1ZCPA 4POMA 2JZTA 5A4WA 3CTFA 4TXOA 3SBCA 1VF1A 1ZYPA 4GLTA 2YPMA 4JR6A 4O32A 1YDKA 2LQQA 2V1MA 5H5SA 2BTOT 1WP0A 1EOHA 1AC1A 2IN3A 2WGRA 1T4YA 3L9SA 1ERUA 3TOUA 4DSSA 2F51A 2KUCA 2LNSA 5LCZA 3PGTA 3FYGA 3VWVA 4PQ1A 1S3AA 2J9HA 3LWAA 4BWQA 2DIYA 4K6XA 3GMFA 1XBSA 5H5QA 2YWMA 4XRDA 1S3CA 2AV4A 4K1FA 2VAFA 4TR1A 1TXXA 2TRXA 3VFIA 3GRXA 4P3YB 4KSMA 3O6TA 5ABRA 3HZ8A 3H93A 2OJLA 2KOKA 2IL3A 3CYNA 2HI7A 3GX8A 2PMTA 5INYA 1GSUA 2OBKA 4HQZA 5HR2A 4EF0A 1JLWA 3NZNA 2I9HA 4OCEA 2HRAA 1GNEA 2A2PA 2H0GA 1SJIA 3IDVA 2X49A 2GTUA 3EMXA 5CRGA 4YQVA 1PSQA 2L57A 5G5FA 1FVKA 4FO5A 4HDEA 4ZXGA 1Z6MA 2LRNA 1O7UA 1IYIA 4QQ7A 2XHFA 3ZLPA 4E8EA 2H75A 2E2MA 4JZQA 1U88A 4CY6A 1FG4A 4ULXA 3M9JA 5ECLB 4MJBA 6GSWA 4IKHA 4LL4B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3DVW A;  1OYJ A;  3WT2 A;  1BX9 A;  2MMA A;  3IOS A;  5GSS A;  1GH2 A;  4L5O A;  4IQA A;  7GSS A;  5GAP D;  1SYX A;  3TDG A;  1XWA A;  1ZMA A;  2HZF A;  3EUR A;  4O92 A;  1R7H A;  3LYK A;  3VPT A;  4YAP A;  4ML1 A;  1OC9 B;  1TU7 A;  3FR3 A;  2OAC A;  2I1U A;  2VCW A;  3APQ A;  3HCZ A;  4V2N A;  4WF4 A;  1AW9 A;  3TJK A;  2H0I A;  1JZW A;  4IVF A;  1KEB A;  2VCX A;  1M7T A;  1O6J A;  3KMN A;  2R5G A;  1B8X A;  3HJP A;  3ZIT A;  4FYC A;  1TU8 A;  1K0C A;  3ZIV A;  3F6D A;  3BCK A;  3UOM A;  1T4Z A;  2LJA A;  1T3B A;  4MK3 A;  6GSX A;  1G0T A;  1SU9 A;  2LRC A;  3U5R E;  4G19 A;  6GSV A;  3UVT A;  1XVQ A;  3DD3 A;  2GZZ A;  4KUN A;  3LJR A;  1G6Y A;  3FK8 A;  3GUS A;  4ZIJ A;  1ON4 A;  1EV4 A;  2FUG 2;  2AUV A;  3DXB A;  3BCI A;  4D73 B;  2I3Y A;  1ST9 A;  5DBQ A;  1UC7 A;  4LA1 A;  1SL2 B;  5IMD A;  3US3 A;  1AXD A;  4GSN A;  3D4T A;  3VI5 A;  1XXU A;  4H86 A;  2B5X A;  2F9S A;  3RHB A;  2H6Z A;  4N10 A;  1ERW A;  5D96 A;  4JRR A;  2C1Y A;  1DUG A;  1GTB A;  3ISO A;  5IPH A;  4ZL7 A;  5J41 A;  2ZNM A;  2QGV A;  4O5R A;  2E0Q A;  2K18 A;  2M46 A;  4MAB A;  2O87 A;  4EO3 A;  1VF3 A;  2VL2 A;  5AIS A;  2QC7 A;  2H1G A;  1AQX A;  1V2A A;  3LXT A;  3GSS A;  1GTU A;  2M72 A;  5GZZ B;  1VGL A;  1Z6N A;  4ZL9 A;  5ECK B;  3GTU B;  1PRX A;  4JED A;  3UIW A;  2IFQ B;  2E2G A;  2V6O A;  2LJR A;  3UL3 A;  3TGZ A;  2M80 A;  4WEY A;  1UVZ A;  3DML A;  5EL8 A;  2Z9S A;  2B5E A;  3L9V A;  4ACS A;  3RAZ A;  4KCE A;  3QAW A;  1QQ2 A;  1V9W A;  4F2I A;  2YWN A;  3HKR A;  1U3I A;  2CA8 A;  2OKA A;  3FHK A;  3GV1 A;  3A2V A;  2P5R A;  1X5E A;  3AY8 A;  2C3N A;  4ECB A;  4IHU A;  4ZL8 A;  4ZB8 A;  1EGO A;  2WB9 A;  2PVO C;  5EPF A;  1GTA A;  4PXO A;  4EKZ A;  2LTK A;  4YH2 A;  5DDL A;  2CQ9 A;  5J9B A;  5ECQ B;  1Z9H A;  4OMV A;  1PA3 A;  3KTB A;  4I2U A;  4TR3 A;  2GZY A;  2DJ1 A;  1Q4J A;  2H71 A;  3IR4 A;  4GF0 A;  2YZH A;  5D93 A;  1J0F A;  5JCU A;  1SEN A;  18GS A;  3P8W A;  3TUE A;  1WPI A;  5ECH B;  3BD2 A;  3MAK A;  3W8J A;  1WWJ A;  5ECI B;  3ZVJ D;  3TCO A;  2PWJ A;  2H30 A;  2P5Q A;  5J4U A;  2H70 A;  1GSQ A;  2HRN A;  1K3O A;  3IA1 A;  4BL7 A;  2TIR A;  3QAG A;  2RUF A;  5FWG A;  1KNG A;  1BYE A;  3FRC A;  3E0U A;  4HU9 A;  3U6V A;  4YAV A;  2WRT A;  1DSB A;  1LU4 A;  6GSY A;  1TDI A;  2WUL A;  2CVD A;  2OE0 A;  1W89 A;  2OE1 A;  1QXH A;  1OVN A;  5HR0 A;  3UBK A;  2L6C A;  2C8U A;  3R2Q A;  3W6G A;  3A5W A;  3D21 A;  4N0Z A;  1R5A A;  2FNO A;  2F3M A;  2YV7 A;  2KLX A;  1M9B A;  1ZYE A;  4MA9 A;  1FAA A;  2PU9 C;  4V2L A;  1OAZ A;  3A3T A;  3ZRD A;  1MD4 A;  2MYG A;  1AIU A;  1ILO A;  2FWH A;  5KN0 A;  5F05 A;  2YN1 A;  2JSY A;  1X0R A;  4TOP A;  2GST A;  4MZB A;  1TI3 A;  5HFG A;  1I9D A;  17GS A;  5DQS A;  5HR3 A;  5G5E A;  1K0M A;  3OR5 A;  5EY6 A;  3LGC A;  2K6V A;  3ME7 A;  1ML6 A;  2HXK A;  1M9A A;  3EE2 A;  3QR6 A;  2JSZ A;  1ZZY A;  2MMN A;  1F9M A;  2PPT A;  22GS A;  1F6M C;  5KN1 A;  2VCT A;  3ERW A;  2HZE B;  3IK9 A;  4DEJ A;  2MMO A;  1GSY A;  1E2Y A;  2OBI A;  3FW2 A;  4ZB6 A;  3HYP A;  2PBJ A;  4FYB A;  5DAK A;  1XW6 A;  4MPF A;  4N0V A;  3IXR A;  3FEU A;  5D9V A;  2JU5 A;  4XS4 A;  2L5O A;  1TRW A;  2V6K A;  3KEB A;  1ABA A;  1ZOF A;  1SJ6 A;  2JZR A;  2IPA A;  4NHW A;  1SK1 A;  2CZ2 A;  4GTU A;  1S3D A;  3MWH A;  5IO0 A;  1B4P A;  3UVH A;  2BJX A;  4EC0 A;  1F37 A;  3GL3 A;  5A4U A;  1GUH A;  3F9U A;  1Z7R A;  1XWG A;  1TRS A;  2YP6 A;  2EIR A;  1YF1 A;  1GP1 A;  5DCH A;  2MBS A;  3WYW A;  1TTZ A;  4NV5 A;  4PGT A;  2ON5 A;  3EU3 A;  3EC3 A;  5D9W A;  4TR4 A;  3UMA A;  4KCA A;  2WDU A;  4HU7 A;  1CQG A;  2PUK C;  1T1V A;  4DVC A;  4MH2 A;  6GST A;  4OFT A;  3C1R A;  3FZ4 A;  13GS A;  2YCD A;  4OCF A;  3LXZ A;  1GUK A;  2H1B A;  3GH6 A;  2H01 A;  3Q74 A;  2VUP A;  3NIV A;  1JZO A;  1TP9 A;  3WT1 A;  2FWG A;  1HYU A;  2FA4 A;  2GT5 A;  2IME A;  4MF7 A;  1AQV A;  3HD5 A;  4V1A g;  4TKY A;  5A4V A;  5DAL B;  2FY6 A;  4MPG A;  5KEJ A;  1J08 A;  3TKQ A;  4X0X A;  5DQY A;  5ECP B;  3C7M A;  5DCG A;  6GSU A;  3D0Z A;  2OE3 A;  3F0I A;  4NWY A;  4GST A;  1EZK A;  1TW9 A;  3O76 A;  3GYK A;  4JU5 A;  3TKS C;  3VI7 A;  3P7X A;  1NHY A;  4ECI A;  3EWL A;  4KE3 A;  2FLS A;  20GS A;  1A8Y A;  1X9M B;  4KSO A;  4FH8 A;  2GGT A;  4YQM A;  3VWW A;  5IMV A;  2F8F A;  2WJU A;  4DSS B;  2O85 A;  2IMF A;  1VF4 A;  2IJY A;  1NSW A;  3VK9 A;  3QDN A;  2FGX A;  3HZ4 A;  3KTL A;  2R4V A;  2CAI A;  4XRA A;  5L71 A;  2CVB A;  1Q98 A;  4WXT A;  1X5C A;  2PGT A;  3CTG A;  4GQC A;  5F8B A;  4E8H A;  3CRT A;  3UEM A;  4QL9 A;  4I6X A;  3ZTL A;  2AHE A;  5ID2 B;  2L6D A;  1SYR A;  1K0D A;  5D9X A;  1QFN A;  1TK0 B;  4ZBB A;  4G9H A;  1HQO A;  2DJ2 A;  4MDC A;  2GQL A;  2X99 A;  1R4W A;  3IK7 A;  3TJB A;  3G7Y A;  2AB6 A;  2LEG A;  5HFK A;  1C72 A;  4AJ8 A;  2GQM A;  3HXS A;  2C4J A;  1B9X C;  1OKD A;  2K9F A;  5AIV A;  3VPQ A;  4MP4 A;  5AGY A;  3VLN A;  4NPB A;  3FY7 A;  4WKW A;  3HHV A;  2X8C A;  3ZFL A;  4HUA A;  2C0F A;  5IPG A;  1G6W A;  2L4Q A;  4FIW A;  3RHC A;  4ML6 A;  4PUF C;  1VF2 A;  2RM6 A;  4HI7 A;  1OC9 A;  4IP1 A;  2X8H A;  3APS A;  4PQH A;  4TRX A;  1Z7P A;  2LUS A;  5ENU A;  2HRF A;  1GLQ A;  5G1K A;  4XHM A;  3H1N A;  5CRW A;  11GS A;  4JBB A;  3FKF A;  1GRX A;  3EMP A;  5IO2 A;  5FHI A;  5IIZ A;  1HD2 A;  3NOF A;  3F4S A;  3F4T A;  3VWU A;  1PL1 A;  3P2A A;  4POB A;  2N5B A;  1WOU A;  3J7Y k;  4IS0 A;  1PL2 A;  2AYT A;  5G30 A;  1TRU A;  3IHQ A;  3I9V 2;  5D8I A;  5C04 A;  1B48 A;  2LQO A;  2H1D A;  1YEP A;  2LS5 A;  5B8A A;  4TN8 A;  2V2G A;  4F82 A;  1BQ7 A;  4D73 A;  2R6K A;  3ZYW A;  2VCZ A;  4FYU A;  4IEL A;  4KX4 A;  5HR1 A;  2GVP A;  1F2E A;  1URM A;  2JZS A;  3GUR A;  4HEA 2;  4AF2 A;  4GWR A;  4KW6 A;  5CP1 A;  4TXV A;  4WET A;  1V40 A;  1B4Q A;  4XCS A;  3EVI A;  1JHB A;  2B1L A;  2X64 A;  3M3M A;  4HZ2 A;  3PH9 A;  2VOC A;  4HS1 A;  4XTS A;  3C1S A;  3P90 A;  3H4K A;  4ILF A;  2XC2 A;  5CRD A;  4TW5 A;  2DJJ A;  2MMZ A;  4OD7 A;  1TK8 B;  1T7P B;  1PN9 A;  4RI7 A;  4GQF A;  4EDY A;  1GSF A;  3G9B A;  3V1W A;  3GTU A;  3EIN A;  1GSD A;  2NDO A;  2IFQ A;  2E7P A;  4K9Z A;  3LOR A;  5JWQ B;  1K0B A;  1H75 A;  2NPB A;  1E6B A;  3EU4 A;  2V32 A;  3APO A;  4F0C A;  1GTI A;  1KBN A;  3HA9 A;  1GLP A;  1QGV A;  5COH A;  4X43 A;  1SKW B;  2AAW A;  5GST A;  3FZ5 A;  3GIX A;  4IKH A;  4EDZ A;  2TRC P;  4RQX A;  1FO5 A;  2YJH A;  3KJY A;  3A2X A;  3C73 A;  1F3B A;  2H76 A;  1XWB A;  2WFC A;  2AJQ B;  1MDI A;  1I5G A;  2C80 A;  3CMI A;  3KD0 A;  1M0U A;  4EVM A;  2GLR A;  4I97 A;  1XOB A;  4EUY A;  4WR4 A;  1XIY A;  2FWE A;  4JE1 A;  3FZ9 A;  1QK8 A;  2CV4 A;  5AN1 A;  4MH3 A;  4HJ2 A;  4TR0 A;  1XFL A;  1G7E A;  1FHE A;  1Y25 A;  3KGK A;  3CRU A;  3D4M A;  2IMK A;  2B6M A;  2C3T A;  2GSS A;  3D22 A;  1MDK A;  4RUV A;  1QMV A;  2DLX A;  2WS2 A;  3D5J A;  4TVE A;  2G0F A;  3F4R A;  5D73 A;  2YWO A;  1CQH A;  1EP7 A;  4MCU A;  1GNW A;  2IWT A;  3UAR A;  2YJ7 A;  2H66 A;  2G2Q A;  4AJ7 A;  4EL1 A;  1DE1 A;  2NTO A;  4K7O A;  3LEF A;  2FA8 A;  3W8S A;  1JZD A;  3TKS A;  1PD2 1;  4HJM A;  2FCH A;  4Q5F A;  2R37 A;  3KH7 A;  5A5K A;  1T8E B;  2IIY A;  2OA7 A;  2MZC A;  4K0G A;  1ACV A;  1JZR A;  2WCI A;  4O7H A;  5JWR B;  2H6X A;  2LV3 A;  2EIO A;  2DC5 A;  3GL5 A;  2DJ3 A;  2H73 A;  5FT3 A;  4ECC A;  1GWC A;  1MDJ A;  2VL9 A;  2I81 A;  3SWL A;  5LNK e;  2HSH A;  3ZZX A;  2FHE A;  4I8B A;  5B6M A;  1XCC A;  2WZ9 A;  3TJJ A;  2KP1 A;  1O73 A;  4K2D A;  2C0G A;  2L59 A;  5ECN B;  1OE7 A;  1AAZ A;  5CAX A;  3GX0 A;  3PR8 A;  2HZE A;  3KMO A;  1U87 A;  3HY2 A;  1EGR A;  4G2E A;  3I69 A;  1K3L A;  1PQN A;  2VL2 C;  5ELG A;  2ZUP A;  5DVB A;  1A0R P;  4PUR A;  3TKR A;  1FVJ A;  3HVS A;  2GQK A;  3I43 A;  2LST A;  2VD1 A;  4PNF A;  4NMU A;  3DYR A;  4Z7X A;  3IAS 2;  2CZ3 A;  3LYP A;  2ES7 A;  1AUC A;  1USB A;  2XPD A;  2KHP A;  5G31 A;  4J2F A;  1FB6 A;  4PX1 A;  2O7K A;  3IPZ A;  4V2M A;  3KM6 A;  5CYY A;  2I4A A;  2IMD A;  1F3A A;  4MZW A;  4CW9 A;  4ZBA A;  4MF5 A;  3GH9 A;  1GSS A;  1OE8 A;  1KTE A;  2N5A A;  4IQ1 A;  3MDK A;  4HQS A;  4BVX A;  4V1A p;  4GRF A;  10GS A;  1YZX A;  1V98 A;  5ECO B;  2RM5 A;  3VWX A;  2IMI A;  3KZQ A;  1XOA A;  5ELA A;  2DIZ A;  1EEJ A;  2H1A A;  2MBT A;  3QAV A;  5H5R A;  1YJ6 A;  3IV4 A;  14GS A;  2ZCT A;  1QUW A;  2OAD A;  2O89 A;  3LSZ A;  3TKP A;  4IJI A;  5DJM A;  3M0F A;  3M8N A;  4XS6 A;  1U3A A;  2H19 A;  1ZL9 A;  1W4V A;  4F9Z A;  3GKN A;  1O8X A;  2RLI A;  4BVY A;  3GNJ A;  5DAL A;  3G7J A;  3CXG A;  1YEX A;  1M99 A;  3TJF A;  2P0G A;  1UA5 A;  2J23 A;  1XWK A;  2C0E A;  1WJK A;  4Q5Q A;  1B9Y C;  4TXO B;  4K7N A;  3DKS A;  1PGT A;  5F06 A;  5J5N A;  2CVK A;  3GHA A;  5IQY A;  4ZB9 A;  4IP6 A;  4L0U A;  2VLT A;  1DE2 A;  4X1U A;  1YQ1 A;  2VLU A;  1N2A A;  1EP8 A;  3ZL5 A;  2CT6 A;  3QPM A;  5HFI A;  2HFD A;  2B7J A;  3ZFB A;  1M2D A;  2YOI A;  4GCI A;  4NXI A;  1UN2 A;  4AJ6 A;  4OO4 A;  1ERT A;  4I2T A;  4KA0 A;  4MJE A;  4N30 A;  4TR1 B;  3VUR A;  3QCP A;  1K3Y A;  1GUM A;  2VL3 A;  2B1K A;  1XW5 A;  3GKK A;  4I5Q A;  5J3R A;  2VD0 A;  3S9F A;  1NW2 A;  2D2Z A;  5CRE A;  3LQ7 A;  1R26 A;  2V41 A;  1WE0 A;  3RDW A;  5J9C A;  5ID2 A;  3HDC A;  4XIH A;  2NBS A;  5E59 A;  3GKX A;  3BOA A;  5G2Z A;  2P31 A;  4LMV A;  1THX A;  3ZML A;  4ZBD A;  4OWY A;  3KH9 A;  1PKZ A;  5C00 A;  3KP9 A;  1O81 A;  4IGJ A;  3F3Q A;  1HNB A;  2A2S A;  4K8M A;  5B8B A;  1G7O A;  1V57 A;  5B6N A;  4WF5 A;  2GT6 A;  1K0A A;  2LRT A;  5HQP A;  6GSS A;  4OO5 A;  3FR9 A;  1V58 A;  1BG5 A;  1MEK A;  1U6T A;  1A2M A;  3WD6 A;  4BA7 A;  2DJ0 A;  4RQR A;  4LMW A;  2BMX A;  4KDY A;  2LNT A;  4CHS A;  1J9B A;  1SD9 A;  2FWF A;  4L5L A;  3M9K A;  2C3Q A;  3MSZ A;  1TOF A;  2XBQ A;  3ZRE A;  2LKU A;  2PVQ A;  5IMA A;  1NM3 A;  4KAE A;  1ZGN A;  1PX6 A;  2YWI A;  3E9J B;  1X9S B;  2HYX A;  4KH7 A;  5IMF A;  4RI6 A;  4MLY A;  3PIN A;  4HZ4 A;  1A8L A;  5IOX A;  4K7I A;  5AIX A;  4EE0 A;  2ALB A;  2H8L A;  3RPP A;  3DGQ A;  2L5L A;  2H72 A;  4YQU A;  1N8J A;  2QKE A;  2A2R A;  2DML A;  2O8V B;  5IMC A;  1FOV A;  2VCQ A;  3IC4 A;  3J7Y b;  3L0H A;  2A4V A;  1IYH A;  3HJM A;  3L78 A;  1X5D A;  5F07 A;  4G10 A;  3DEX A;  2F8A A;  1A23 A;  3K8N A;  4KDX A;  3IAM 2;  3ERF A;  2B7K A;  1M2A A;  1A2J A;  1EEM A;  2PN8 A;  3UAP A;  2HE3 A;  4PUA A;  2YAN A;  1TK5 B;  3IBH A;  1Y6E A;  4IBP A;  4MJC A;  3RBT A;  2DMM A;  1T00 A;  1SK2 A;  3CSJ A;  2EIQ A;  1K0O A;  2HNL A;  5LD0 A;  3WGX A;  1K0N A;  4IJ3 A;  1GUL A;  2X8G A;  2H6Y A;  3GFK A;  1SD8 A;  8GSS A;  4AGS A;  3WGE A;  4CDO A;  2RII A;  5JCW A;  4L8E A;  2K8S A;  1JLV A;  4ISD A;  1YKA A;  2LJK A;  2XBI A;  1LBK A;  1SL1 B;  4XS1 A;  1A2L A;  4PQI A;  1ERV A;  2GSQ A;  3FR6 A;  5ECR B;  3QD9 A;  3GN3 A;  1GSE A;  3N9J A;  5DJL A;  5GAN D;  1PX7 A;  1FB0 A;  3H8Q A;  1LJR A;  4NAX A;  4GXZ A;  1Z3E A;  1YF0 A;  3Q19 A;  2XPE A;  5D9T A;  1OC3 A;  3L4N A;  3HJO A;  3TRP A;  1WMJ A;  4JR4 A;  3RPN A;  3Q18 A;  4ZIL A;  3HVX A;  1R5P A;  2GDR A;  4KND A;  2HT9 A;  2GZP A;  5E4W A;  5JWO B;  1VRS D;  1JFU A;  2VM2 A;  1MD3 A;  2ON7 A;  3DWV A;  3F8U A;  5IOW A;  2RUE A;  3ED3 A;  1PMT A;  3L9U A;  4NV2 A;  1GL8 A;  1EWX A;  1O8W A;  2B3S A;  5KN3 A;  1BAY A;  2H0H A;  1O85 A;  1RQM A;  1YKC A;  3C8E A;  4POL A;  2NVL A;  1RW1 A;  4MMM A;  4Q5N A;  4BWS A;  3DIE A;  4K0N A;  1XPV A;  4WR5 A;  1OKT A;  2PER A;  2VM1 A;  1A0F A;  2VO4 A;  3H79 A;  3QMX A;  3D6I A;  3Q6O A;  3F6F A;  1NHO A;  3DVX A;  12GS A;  3KCM A;  1AQW A;  3UJ1 A;  4ECJ A;  3QFA C;  2R3X A;  3QOU A;  2R2J A;  3ERG A;  3TKS E;  5CO3 A;  3BBY A;  4OFM A;  3GST A;  4WBR D;  4L0W A;  1HNC A;  4J56 E;  3IE3 A;  2FD3 A;  1SKS B;  2VCV A;  4J57 E;  4KGI A;  4F03 A;  5ECM B;  3MNG A;  1XVW A;  3GKM A;  1H4O A;  2DSA A;  2EC4 A;  2N5F A;  1TI1 A;  2GS3 A;  1EV9 A;  1XW9 A;  1Z5Y E;  3N5O A;  2H74 A;  1SL0 B;  19GS A;  3G7I A;  4MJA A;  5B7C A;  2GSR A;  3TJG A;  3LG6 A;  4QL7 A;  3LFL A;  3M1G A;  1YY7 A;  3JCM L;  4POK A;  3TOT A;  1TKD B;  2B5Y A;  4DSR A;  3BJ5 A;  3CSI A;  3HVV A;  3C71 A;  2DBC A;  2YV9 A;  4KB3 A;  3ZMK A;  4LLR A;  4BPY A;  1M2B A;  3E3E A;  3TRX A;  3GA4 A;  1SKR B;  4EXJ A;  1FW1 A;  3KP8 A;  1ZYQ B;  2JAD A;  2HSY A;  2CX3 A;  3CBU A;  4IW9 A;  1PKW A;  1RK4 A;  3I6A A;  9GSS A;  3ME8 A;  3FZA A;  1SK0 A;  1BJX A;  2VLV A;  3A2W A;  3F3R A;  3O3T A;  4PNG A;  2VIM A;  1WIK A;  2K8V A;  1WRY A;  4F0B A;  5JCG A;  4OFN A;  2C0D A;  1X9W B;  5IM9 A;  16GS A;  4N11 A;  1BED A;  4ID0 A;  4KDU A;  4LL1 B;  2YZU A;  3WGD A;  3EYT A;  3CSH A;  3F63 A;  4NHZ A;  2CX4 A;  2CAQ A;  2QSI A;  1A24 A;  5G1L A;  1TJD A;  1MTC A;  2HLS A;  3QFB C;  2JL4 A;  4IN0 A;  1EOG A;  5DAK B;  1SJZ A;  1TRV A;  3KIJ A;  3DRN A;  4MZC A;  2REM A;  3KXO A;  5ECS A;  4XS4 B;  3TB2 A;  2YNX A;  5IMZ A;  3IRA A;  5CRH A;  4Q5R A;  3ZIJ A;  2JAC A;  4DSQ A;  5EVO A;  1HNA A;  1XZO A;  2KP2 A;  2DJK A;  4HOJ A;  1THO A;  3ZVJ A;  1XWC A;  5KN2 A;  2L4C A;  5CNW A;  4GSS A;  4WBJ A;  3TRQ A;  1DBY A;  1OC8 A;  4MF6 A;  3UBL A;  1ZCP A;  4POM A;  2JZT A;  5A4W A;  3CTF A;  4TXO A;  3SBC A;  1VF1 A;  4GLT A;  2YPM A;  4JR6 A;  4O32 A;  1YDK A;  2LQQ A;  2V1M A;  5H5S A;  2BTO T;  1WP0 A;  1EOH A;  1AC1 A;  2IN3 A;  2WGR A;  1T4Y A;  3L9S A;  1ERU A;  3TOU A;  4DSS A;  2F51 A;  2KUC A;  2LNS A;  5LCZ A;  3PGT A;  3FYG A;  3VWV A;  4PQ1 A;  1S3A A;  2J9H A;  3LWA A;  4BWQ A;  2DIY A;  4K6X A;  3GMF A;  1XBS A;  5H5Q A;  2YWM A;  4XRD A;  1S3C A;  2AV4 A;  4K1F A;  2VAF A;  4TR1 A;  1TXX A;  2TRX A;  3VFI A;  3GRX A;  4P3Y B;  4KSM A;  3O6T A;  5ABR A;  3HZ8 A;  3H93 A;  2OJL A;  2KOK A;  2IL3 A;  3CYN A;  2HI7 A;  3GX8 A;  2PMT A;  5INY A;  1GSU A;  2OBK A;  4HQZ A;  5HR2 A;  4EF0 A;  1JLW A;  3NZN A;  2I9H A;  4OCE A;  1GNE A;  2H0G A;  1SJI A;  3IDV A;  2GTU A;  3EMX A;  5CRG A;  4YQV A;  1PSQ A;  2L57 A;  5G5F A;  1FVK A;  4FO5 A;  4HDE A;  4ZXG A;  1Z6M A;  2LRN A;  1O7U A;  1IYI A;  4QQ7 A;  2XHF A;  3ZLP A;  4E8E A;  2H75 A;  2E2M A;  4JZQ A;  1U88 A;  1FG4 A;  4ULX A;  3M9J A;  5ECL B;  4MJB A;  6GSW A;  5F0G A;  4LL4 B; 
#chains in the Genus database with same CATH topology
 3DVW A;  1OYJ A;  3WT2 A;  1BX9 A;  2MMA A;  3IOS A;  5GSS A;  1GH2 A;  4L5O A;  2R0P A;  4IQA A;  7GSS A;  5GAP D;  1SYX A;  3TDG A;  1XWA A;  1ZMA A;  2HZF A;  3EUR A;  4O92 A;  4HSC X;  1R7H A;  3LYK A;  3VPT A;  4YAP A;  4ML1 A;  1OC9 B;  1TU7 A;  3FR3 A;  2OAC A;  2I1U A;  2VCW A;  3APQ A;  3HCZ A;  4V2N A;  4WF4 A;  1AW9 A;  3TJK A;  2R0G A;  2H0I A;  1JZW A;  4X4J A;  4IVF A;  1KEB A;  2VCX A;  1M7T A;  1O6J A;  3KMN A;  2R5G A;  1B8X A;  3HJP A;  3ZIT A;  4FYC A;  1TU8 A;  1K0C A;  3ZIV A;  3F6D A;  3BCK A;  3UOM A;  1T4Z A;  2LJA A;  1T3B A;  4MK3 A;  6GSX A;  1G0T A;  1SU9 A;  2LRC A;  3U5R E;  4G19 A;  6GSV A;  3UVT A;  1XVQ A;  3DD3 A;  2GZZ A;  4KUN A;  3LJR A;  1G6Y A;  3FK8 A;  3GUS A;  4ZIJ A;  1ON4 A;  1EV4 A;  2FUG 2;  2AUV A;  3DXB A;  3BCI A;  4D73 B;  2I3Y A;  1ST9 A;  5DBQ A;  1UC7 A;  4LA1 A;  1SL2 B;  5IMD A;  3US3 A;  1AXD A;  4GSN A;  3D4T A;  3VI5 A;  1XXU A;  4H86 A;  2B5X A;  2F9S A;  3RHB A;  2H6Z A;  4N10 A;  1ERW A;  5D96 A;  4JRR A;  2C1Y A;  1DUG A;  1GTB A;  3ISO A;  5IPH A;  4ZL7 A;  5J41 A;  2ZNM A;  2QGV A;  4O5R A;  2E0Q A;  2K18 A;  2M46 A;  4MAB A;  2O87 A;  4EO3 A;  1VF3 A;  2VL2 A;  5AIS A;  2QC7 A;  2H1G A;  1AQX A;  1V2A A;  3LXT A;  3GSS A;  1GTU A;  2M72 A;  5GZZ B;  1VGL A;  1Z6N A;  4ZL9 A;  5ECK B;  3GTU B;  1PRX A;  4JED A;  3UIW A;  2IFQ B;  3PPU A;  5KOX A;  2E2G A;  2V6O A;  2LJR A;  3UL3 A;  3TGZ A;  2M80 A;  4WEY A;  1UVZ A;  3DML A;  5EL8 A;  2Z9S A;  2B5E A;  3L9V A;  4ACS A;  3RAZ A;  4KCE A;  3QAW A;  1QQ2 A;  1V9W A;  4F2I A;  2YWN A;  4PTS A;  3HKR A;  1U3I A;  2CA8 A;  2OKA A;  3FHK A;  3GV1 A;  3A2V A;  2P5R A;  1X5E A;  3AY8 A;  2C3N A;  4ECB A;  4IHU A;  4ZL8 A;  4ZB8 A;  1EGO A;  2WB9 A;  2PVO C;  5EPF A;  1GTA A;  4PXO A;  4EKZ A;  2LTK A;  4YH2 A;  5DDL A;  2CQ9 A;  5J9B A;  5ECQ B;  1Z9H A;  4OMV A;  1PA3 A;  3KTB A;  4I2U A;  4TR3 A;  2GZY A;  2DJ1 A;  1Q4J A;  2H71 A;  3IR4 A;  4GF0 A;  2HSM A;  2YZH A;  5D93 A;  1J0F A;  5JCU A;  1SEN A;  18GS A;  3HVN A;  3P8W A;  3TUE A;  1WPI A;  5ECH B;  3BD2 A;  3MAK A;  3W8J A;  1WWJ A;  5ECI B;  3ZVJ D;  3TCO A;  2PWJ A;  2QA2 A;  2H30 A;  2P5Q A;  5J4U A;  2H70 A;  1GSQ A;  2HRN A;  1K3O A;  3IA1 A;  4BL7 A;  2TIR A;  3QAG A;  2RUF A;  5FWG A;  1KNG A;  1BYE A;  3FRC A;  3E0U A;  4HU9 A;  3U6V A;  4YAV A;  2WRT A;  1DSB A;  1LU4 A;  6GSY A;  1TDI A;  2WUL A;  2CVD A;  3MIX A;  2OE0 A;  1W89 A;  2OE1 A;  4EIP A;  1QXH A;  1OVN A;  5HR0 A;  3UBK A;  2L6C A;  2C8U A;  3R2Q A;  3W6G A;  3A5W A;  3D21 A;  4N0Z A;  1R5A A;  2FNO A;  2F3M A;  2YV7 A;  2KLX A;  1M9B A;  4K5S A;  1ZYE A;  4MA9 A;  1FAA A;  2PU9 C;  4V2L A;  1OAZ A;  3A3T A;  3ZRD A;  1MD4 A;  2MYG A;  1AIU A;  1ILO A;  2FWH A;  5KN0 A;  5F05 A;  2YN1 A;  2JSY A;  1X0R A;  4TOP A;  2GST A;  4MZB A;  1TI3 A;  4K2X A;  5HFG A;  1I9D A;  17GS A;  5DQS A;  5HR3 A;  5G5E A;  1K0M A;  3OR5 A;  5EY6 A;  3LGC A;  2K6V A;  3ME7 A;  1ML6 A;  2HXK A;  1M9A A;  3EE2 A;  3QR6 A;  2JSZ A;  1ZZY A;  2MMN A;  1F9M A;  2PPT A;  22GS A;  1F6M C;  1PN0 A;  2VCT A;  5KN1 A;  3ERW A;  2HZE B;  3IK9 A;  4DEJ A;  2MMO A;  1GSY A;  1E2Y A;  2OBI A;  3FW2 A;  4ZB6 A;  3HYP A;  2PBJ A;  4FYB A;  5DAK A;  1XW6 A;  4MPF A;  4N0V A;  3IXR A;  3FEU A;  5D9V A;  2JU5 A;  4XS4 A;  2L5O A;  1TRW A;  2V6K A;  3KEB A;  1ABA A;  4FQU A;  1ZOF A;  1SJ6 A;  2JZR A;  2IPA A;  4NHW A;  1SK1 A;  1S3R A;  2CZ2 A;  4GTU A;  1S3D A;  3MWH A;  5IO0 A;  1B4P A;  3UVH A;  2BJX A;  4EC0 A;  1F37 A;  3GL3 A;  5A4U A;  1GUH A;  3F9U A;  1Z7R A;  1XWG A;  1TRS A;  2YP6 A;  4BVX B;  2EIR A;  1YF1 A;  1GP1 A;  5DCH A;  2MBS A;  3WYW A;  1TTZ A;  4NV5 A;  4PGT A;  2ON5 A;  3EU3 A;  3EC3 A;  5D9W A;  4TR4 A;  3UMA A;  4KCA A;  2WDU A;  4HU7 A;  4CY8 A;  1CQG A;  2PUK C;  1T1V A;  4DVC A;  4MH2 A;  6GST A;  4OFT A;  3C1R A;  3FZ4 A;  13GS A;  2YCD A;  4OCF A;  3LXZ A;  1GUK A;  2H1B A;  3GH6 A;  2H01 A;  3Q74 A;  2VUP A;  3NIV A;  1JZO A;  1TP9 A;  3WT1 A;  4EIQ A;  2FWG A;  1HYU A;  2FA4 A;  2GT5 A;  2IME A;  4MF7 A;  4O5U A;  1AQV A;  4BVY B;  3HD5 A;  4V1A g;  4TKY A;  5A4V A;  5DAL B;  2FY6 A;  4MPG A;  5KEJ A;  1J08 A;  3TKQ A;  4X0X A;  5DQY A;  5ECP B;  3C7M A;  5DCG A;  6GSU A;  3D0Z A;  2OE3 A;  3F0I A;  4NWY A;  4GST A;  1EZK A;  1TW9 A;  3O76 A;  3GYK A;  4JU5 A;  3TKS C;  3VI7 A;  3P7X A;  1NHY A;  4ECI A;  3EWL A;  4KE3 A;  2FLS A;  20GS A;  1A8Y A;  1X9M B;  4KSO A;  4FH8 A;  2GGT A;  4YQM A;  3VWW A;  5IMV A;  2F8F A;  2WJU A;  4DSS B;  2O85 A;  2IMF A;  1VF4 A;  2IJY A;  1NSW A;  3VK9 A;  3QDN A;  2FGX A;  1PFO A;  3HZ4 A;  3KTL A;  2R4V A;  2CAI A;  4XRA A;  5L71 A;  2CVB A;  1Q98 A;  4WXT A;  1X5C A;  2PGT A;  3CTG A;  4GQC A;  5F8B A;  4E8H A;  3CRT A;  3UEM A;  4QL9 A;  4I6X A;  3ZTL A;  2AHE A;  5ID2 B;  2L6D A;  1SYR A;  1K0D A;  5D9X A;  1QFN A;  1TK0 B;  4ZBB A;  4G9H A;  1HQO A;  2DJ2 A;  4MDC A;  2GQL A;  2X99 A;  1R4W A;  3IK7 A;  3TJB A;  3IC8 A;  3G7Y A;  2AB6 A;  2LEG A;  5HFK A;  1C72 A;  4AJ8 A;  2GQM A;  3HXS A;  2C4J A;  2DKH A;  1B9X C;  1OKD A;  2K9F A;  4USS A;  5AIV A;  3VPQ A;  4MP4 A;  5AGY A;  3VLN A;  4NPB A;  3FY7 A;  4WKW A;  3HHV A;  2X8C A;  3ZFL A;  4HUA A;  2C0F A;  5IPG A;  1G6W A;  2L4Q A;  4FIW A;  4O5Q A;  4ML6 A;  4PUF C;  3RHC A;  1VF2 A;  2RM6 A;  4HI7 A;  1OC9 A;  4IP1 A;  2X8H A;  3APS A;  4PQH A;  4TRX A;  1Z7P A;  2LUS A;  5ENU A;  2HRF A;  1GLQ A;  3A5I A;  5G1K A;  4XHM A;  3H1N A;  5CRW A;  11GS A;  4JBB A;  3FKF A;  1GRX A;  4A5P A;  3EMP A;  5IO2 A;  4YKF A;  5FHI A;  5IIZ A;  1HD2 A;  3NOF A;  3F4S A;  3F4T A;  3VWU A;  3R3E A;  1PL1 A;  3P2A A;  4POB A;  2N5B A;  1WOU A;  3J7Y k;  5BRT A;  4IS0 A;  1PL2 A;  2AYT A;  5G30 A;  1TRU A;  3IHQ A;  3I9V 2;  5D8I A;  5C04 A;  3LW9 A;  1B48 A;  2LQO A;  2H1D A;  1YEP A;  4K5R A;  4G0L A;  2LS5 A;  5B8A A;  4TN8 A;  2V2G A;  4F82 A;  1BQ7 A;  4D73 A;  2R6K A;  3ZYW A;  2VCZ A;  4FYU A;  4IEL A;  4KX4 A;  5HR1 A;  2GVP A;  1F2E A;  1URM A;  2JZS A;  3GUR A;  4HEA 2;  4AF2 A;  4GWR A;  4KW6 A;  5CP1 A;  4TXV A;  4WET A;  1V40 A;  1B4Q A;  4XCS A;  3EVI A;  1JHB A;  2B1L A;  2X64 A;  3M3M A;  4HZ2 A;  3PH9 A;  2VOC A;  4KF9 A;  4HS1 A;  4XTS A;  3C1S A;  3P90 A;  3H4K A;  4ILF A;  2XC2 A;  5CRD A;  4TW5 A;  2DJJ A;  2MMZ A;  4OD7 A;  1TK8 B;  1T7P B;  1PN9 A;  4RI7 A;  4GQF A;  4EDY A;  1GSF A;  3G9B A;  3V1W A;  3GTU A;  3EIN A;  1GSD A;  2NDO A;  2IFQ A;  2E7P A;  4K9Z A;  3LOR A;  5JWQ B;  1K0B A;  1H75 A;  2NPB A;  1E6B A;  3EU4 A;  2V32 A;  3APO A;  4F0C A;  1GTI A;  1KBN A;  3HA9 A;  1GLP A;  1QGV A;  5COH A;  4X43 A;  1SKW B;  2AAW A;  5GST A;  3FZ5 A;  3GIX A;  4EDZ A;  2TRC P;  4RQX A;  1FO5 A;  2YJH A;  3KJY A;  3A2X A;  3C73 A;  1F3B A;  2H76 A;  1XWB A;  2WFC A;  2AJQ B;  1MDI A;  1I5G A;  4ICY A;  2C80 A;  3CMI A;  3KD0 A;  1M0U A;  4EVM A;  3IHG A;  2GLR A;  4I97 A;  1XOB A;  4EUY A;  4WR4 A;  1XIY A;  2FWE A;  4JE1 A;  3FZ9 A;  1QK8 A;  2CV4 A;  5AN1 A;  4MH3 A;  4HJ2 A;  4TR0 A;  4BIK A;  1XFL A;  1G7E A;  1FHE A;  1Y25 A;  3KGK A;  3CRU A;  4Z2T A;  3D4M A;  2IMK A;  2B6M A;  2C3T A;  2GSS A;  3D22 A;  1MDK A;  4RUV A;  1QMV A;  2DLX A;  1M3J A;  2WS2 A;  3D5J A;  4TVE A;  2G0F A;  3F4R A;  5D73 A;  2YWO A;  1CQH A;  4Z2R A;  1EP7 A;  4MCU A;  1GNW A;  2IWT A;  3UAR A;  2YJ7 A;  2H66 A;  2G2Q A;  4AJ7 A;  4EL1 A;  1DE1 A;  1FOH A;  2NTO A;  4K7O A;  2R0C A;  3LEF A;  2FA8 A;  3W8S A;  1JZD A;  3TKS A;  1PD2 1;  4HJM A;  2FCH A;  4Q5F A;  2R37 A;  3KH7 A;  5A5K A;  1T8E B;  2IIY A;  2OA7 A;  2MZC A;  4K0G A;  1ACV A;  1JZR A;  2WCI A;  4O7H A;  5JWR B;  2H6X A;  2LV3 A;  2EIO A;  2DC5 A;  3GL5 A;  2DJ3 A;  2H73 A;  5FT3 A;  4ECC A;  1GWC A;  1MDJ A;  2VL9 A;  2I81 A;  3SWL A;  5LNK e;  2HSH A;  5KOW A;  3ZZX A;  2FHE A;  4I8B A;  5B6M A;  1XCC A;  2WZ9 A;  3TJJ A;  2KP1 A;  1O73 A;  4K2D A;  2C0G A;  2L59 A;  5ECN B;  1OE7 A;  1AAZ A;  5CAX A;  3GX0 A;  3PR8 A;  2HZE A;  3KMO A;  1U87 A;  3HY2 A;  1EGR A;  4G2E A;  3I69 A;  1K3L A;  1PQN A;  2VL2 C;  5ELG A;  2ZUP A;  5DVB A;  1A0R P;  4PUR A;  3TKR A;  1FVJ A;  3HVS A;  2GQK A;  3I43 A;  2LST A;  2VD1 A;  4PNF A;  1XG8 A;  4NMU A;  3DYR A;  4Z7X A;  3IAS 2;  2CZ3 A;  3LYP A;  2ES7 A;  1AUC A;  1USB A;  2XPD A;  2KHP A;  5G31 A;  4J2F A;  1FB6 A;  4PX1 A;  2O7K A;  3IPZ A;  4V2M A;  3KM6 A;  5CYY A;  2I4A A;  2IMD A;  1F3A A;  4MZW A;  4CW9 A;  4ZBA A;  4MF5 A;  3GH9 A;  1GSS A;  1OE8 A;  1KTE A;  2N5A A;  4IQ1 A;  3MDK A;  4HQS A;  4BVX A;  4V1A p;  4GRF A;  10GS A;  1YZX A;  1V98 A;  5ECO B;  2RM5 A;  3VWX A;  2IMI A;  3KZQ A;  1XOA A;  5ELA A;  2DIZ A;  1EEJ A;  2H1A A;  2MBT A;  3QAV A;  5H5R A;  1YJ6 A;  3IV4 A;  14GS A;  2ZCT A;  1QUW A;  2OAD A;  2O89 A;  3LSZ A;  3TKP A;  4IJI A;  5DJM A;  3M0F A;  3M8N A;  4XS6 A;  1U3A A;  4G0K A;  2H19 A;  1ZL9 A;  1W4V A;  4F9Z A;  3GKN A;  1O8X A;  2RLI A;  4BVY A;  3GNJ A;  5DAL A;  3G7J A;  3CXG A;  1YEX A;  1M99 A;  3TJF A;  2P0G A;  1UA5 A;  2J23 A;  1XWK A;  2C0E A;  1WJK A;  4Q5Q A;  1B9Y C;  4TXO B;  4K7N A;  3DKS A;  1PGT A;  5F06 A;  5J5N A;  2CVK A;  3GHA A;  5IQY A;  4ZB9 A;  4IP6 A;  4L0U A;  2VLT A;  1DE2 A;  4X1U A;  1YQ1 A;  2VLU A;  1N2A A;  1EP8 A;  3ZL5 A;  2CT6 A;  3QPM A;  5HFI A;  2HFD A;  2B7J A;  3ZFB A;  1M2D A;  2YOI A;  4GCI A;  4NXI A;  1UN2 A;  4AJ6 A;  4OO4 A;  1ERT A;  4I2T A;  4KA0 A;  4MJE A;  4N30 A;  4TR1 B;  3VUR A;  3QCP A;  1K3Y A;  1GUM A;  2VL3 A;  2B1K A;  1XW5 A;  3GKK A;  4I5Q A;  5J3R A;  2VD0 A;  3S9F A;  1NW2 A;  2D2Z A;  2A4H A;  5CRE A;  3LQ7 A;  1R26 A;  2V41 A;  1WE0 A;  3RDW A;  5J9C A;  5ID2 A;  3HDC A;  4XIH A;  2NBS A;  5E59 A;  3GKX A;  3BOA A;  5G2Z A;  2P31 A;  4LMV A;  1THX A;  3ZML A;  4ZBD A;  4OWY A;  3KH9 A;  1PKZ A;  5C00 A;  3KP9 A;  1O81 A;  4IGJ A;  3F3Q A;  1HNB A;  2A2S A;  4K8M A;  5B8B A;  1G7O A;  1V57 A;  5B6N A;  4WF5 A;  2GT6 A;  1K0A A;  2LRT A;  5HQP A;  6GSS A;  4OO5 A;  3FR9 A;  1V58 A;  1BG5 A;  1MEK A;  1U6T A;  1A2M A;  3WD6 A;  4BA7 A;  2DJ0 A;  4RQR A;  4LMW A;  2BMX A;  4KDY A;  2LNT A;  4CHS A;  1J9B A;  1SD9 A;  2FWF A;  4L5L A;  3M9K A;  2C3Q A;  3MSZ A;  1TOF A;  2XBQ A;  3ZRE A;  2LKU A;  2PVQ A;  5IMA A;  1NM3 A;  4KAE A;  1ZGN A;  1PX6 A;  2YWI A;  3E9J B;  1X9S B;  2HYX A;  4KH7 A;  5IMF A;  4RI6 A;  4YKG A;  4MLY A;  3PIN A;  4HZ4 A;  1A8L A;  5IOX A;  4K7I A;  5AIX A;  4EE0 A;  2ALB A;  2H8L A;  3RPP A;  3DGQ A;  2L5L A;  2H72 A;  4YQU A;  1N8J A;  2QKE A;  2A2R A;  2DML A;  2O8V B;  5IMC A;  1FOV A;  2VCQ A;  3IC4 A;  3J7Y b;  3L0H A;  2A4V A;  1IYH A;  3HJM A;  3L78 A;  1X5D A;  5F07 A;  4G10 A;  3DEX A;  2F8A A;  1A23 A;  3K8N A;  4KDX A;  3IAM 2;  3ERF A;  2B7K A;  1M2A A;  1A2J A;  1EEM A;  2DKI A;  2PN8 A;  3UAP A;  2HE3 A;  4PUA A;  2YAN A;  1TK5 B;  3IBH A;  1Y6E A;  4IBP A;  4MJC A;  3RBT A;  2DMM A;  1T00 A;  1SK2 A;  3CSJ A;  2EIQ A;  1K0O A;  2HNL A;  5LD0 A;  3WGX A;  1K0N A;  4IJ3 A;  1GUL A;  2X8G A;  2H6Y A;  3GFK A;  1SD8 A;  8GSS A;  4AGS A;  3WGE A;  4Z2U A;  4CDO A;  2RII A;  5JCW A;  4L8E A;  2K8S A;  1JLV A;  4ISD A;  1YKA A;  2LJK A;  3CQF A;  2XBI A;  1LBK A;  1SL1 B;  4XS1 A;  1A2L A;  4PQI A;  1ERV A;  2GSQ A;  3FR6 A;  5ECR B;  3QD9 A;  3GN3 A;  1GSE A;  3N9J A;  5DJL A;  5GAN D;  1PX7 A;  1FB0 A;  3H8Q A;  1LJR A;  4NAX A;  4GXZ A;  1Z3E A;  1YF0 A;  3Q19 A;  2XPE A;  5D9T A;  1OC3 A;  3L4N A;  3HJO A;  3TRP A;  1WMJ A;  4JR4 A;  3RPN A;  3Q18 A;  4ZIL A;  3HVX A;  1R5P A;  2GDR A;  4KND A;  2UZ8 A;  2HT9 A;  2GZP A;  5E4W A;  5JWO B;  1VRS D;  1JFU A;  2VM2 A;  1MD3 A;  2ON7 A;  3DWV A;  3F8U A;  5IOW A;  2RUE A;  3ED3 A;  1PMT A;  3L9U A;  4NV2 A;  1GL8 A;  1EWX A;  1ZYN A;  1O8W A;  2B3S A;  5KN3 A;  1BAY A;  2H0H A;  1O85 A;  1RQM A;  1YKC A;  3C8E A;  4POL A;  2NVL A;  1RW1 A;  4MMM A;  4Q5N A;  4BWS A;  3DIE A;  4K0N A;  1XPV A;  4WR5 A;  1OKT A;  2PER A;  2VM1 A;  1A0F A;  2VO4 A;  3H79 A;  3QMX A;  3D6I A;  3Q6O A;  3F6F A;  1NHO A;  3DVX A;  12GS A;  3KCM A;  1AQW A;  3UJ1 A;  4ECJ A;  3QFA C;  3EPT A;  2R3X A;  3QOU A;  4MNN A;  2R2J A;  3ERG A;  3TKS E;  5CO3 A;  3BBY A;  4OFM A;  3GST A;  4WBR D;  4L0W A;  1HNC A;  4J56 E;  3IE3 A;  5F0G A;  2FD3 A;  1SKS B;  2VCV A;  4J57 E;  4KGI A;  4F03 A;  2HRK A;  5ECM B;  3MNG A;  1XVW A;  3GKM A;  1H4O A;  2DSA A;  2EC4 A;  2N5F A;  1TI1 A;  2GS3 A;  1EV9 A;  1XW9 A;  1Z5Y E;  4BL7 B;  3N5O A;  2H74 A;  1SL0 B;  19GS A;  3G7I A;  4MJA A;  5B7C A;  2GSR A;  3TJG A;  3LG6 A;  4QL7 A;  3LFL A;  3M1G A;  1YY7 A;  3JCM L;  4POK A;  3TOT A;  1TKD B;  2B5Y A;  4DSR A;  3BJ5 A;  3CSI A;  3HVV A;  3C71 A;  2DBC A;  2YV9 A;  4KB3 A;  3ZMK A;  4LLR A;  4BPY A;  1M2B A;  3E3E A;  3TRX A;  3GA4 A;  1SKR B;  4EXJ A;  1FW1 A;  3KP8 A;  1ZYQ B;  2JAD A;  2HSY A;  3FMW A;  2CX3 A;  3CBU A;  4IW9 A;  1PKW A;  1RK4 A;  3I6A A;  9GSS A;  3ME8 A;  3FZA A;  1SK0 A;  1BJX A;  2VLV A;  3A2W A;  3F3R A;  2QA1 A;  3O3T A;  4PNG A;  2VIM A;  1WIK A;  2K8V A;  1WRY A;  4F0B A;  5JCG A;  4OFN A;  2C0D A;  1X9W B;  5IM9 A;  16GS A;  4N11 A;  1BED A;  4ID0 A;  4KDU A;  4LL1 B;  2YZU A;  3WGD A;  3EYT A;  3CSH A;  3F63 A;  4NHZ A;  2CX4 A;  2CAQ A;  2QSI A;  1A24 A;  5G1L A;  1TJD A;  4G0I A;  1MTC A;  2HLS A;  3QFB C;  2JL4 A;  4IN0 A;  1EOG A;  5DAK B;  1SJZ A;  1TRV A;  3KIJ A;  3DRN A;  4MZC A;  2REM A;  5BMU A;  3KXO A;  1M3I A;  5ECS A;  4XS4 B;  3TB2 A;  2YNX A;  5IMZ A;  3IRA A;  5CRH A;  2X4A A;  4Q5R A;  3ZIJ A;  2JAC A;  4DSQ A;  5EVO A;  1HNA A;  1XZO A;  2KP2 A;  2DJK A;  4HOJ A;  1THO A;  3ZVJ A;  1XWC A;  5KN2 A;  2L4C A;  5CNW A;  4GSS A;  4WBJ A;  3TRQ A;  1DBY A;  1OC8 A;  4MF6 A;  3MYD A;  3UBL A;  1ZCP A;  4POM A;  2JZT A;  5A4W A;  3CTF A;  4TXO A;  3SBC A;  1VF1 A;  1ZYP A;  4GLT A;  2YPM A;  4JR6 A;  4O32 A;  1YDK A;  2LQQ A;  2V1M A;  5H5S A;  2BTO T;  1WP0 A;  1EOH A;  1AC1 A;  2IN3 A;  2WGR A;  1T4Y A;  3L9S A;  1ERU A;  3TOU A;  4DSS A;  2F51 A;  2KUC A;  2LNS A;  5LCZ A;  3PGT A;  3FYG A;  3VWV A;  4PQ1 A;  1S3A A;  2J9H A;  3LWA A;  4BWQ A;  2DIY A;  4K6X A;  3GMF A;  1XBS A;  5H5Q A;  2YWM A;  4XRD A;  1S3C A;  2AV4 A;  4K1F A;  2VAF A;  4TR1 A;  1TXX A;  2TRX A;  3VFI A;  3GRX A;  4P3Y B;  4KSM A;  3O6T A;  5ABR A;  3HZ8 A;  3H93 A;  2OJL A;  2KOK A;  2IL3 A;  3CYN A;  2HI7 A;  3GX8 A;  2PMT A;  5INY A;  1GSU A;  2OBK A;  4HQZ A;  5HR2 A;  4EF0 A;  1JLW A;  3NZN A;  2I9H A;  4OCE A;  2HRA A;  1GNE A;  2A2P A;  2H0G A;  1SJI A;  3IDV A;  2X49 A;  2GTU A;  3EMX A;  5CRG A;  4YQV A;  1PSQ A;  2L57 A;  5G5F A;  1FVK A;  4FO5 A;  4HDE A;  4ZXG A;  1Z6M A;  2LRN A;  1O7U A;  1IYI A;  4QQ7 A;  2XHF A;  3ZLP A;  4E8E A;  2H75 A;  2E2M A;  4JZQ A;  1U88 A;  4CY6 A;  1FG4 A;  4ULX A;  3M9J A;  5ECL B;  4MJB A;  6GSW A;  4IKH A;  4LL4 B; 
#chains in the Genus database with same CATH homology
 3DVW A;  1OYJ A;  3WT2 A;  1BX9 A;  2MMA A;  3IOS A;  5GSS A;  1GH2 A;  4L5O A;  2R0P A;  4IQA A;  7GSS A;  5GAP D;  1SYX A;  3TDG A;  1XWA A;  1ZMA A;  2HZF A;  3EUR A;  4O92 A;  1R7H A;  3LYK A;  3VPT A;  4YAP A;  4ML1 A;  1OC9 B;  1TU7 A;  3FR3 A;  2OAC A;  2I1U A;  2VCW A;  3APQ A;  3HCZ A;  4V2N A;  4WF4 A;  1AW9 A;  3TJK A;  2R0G A;  2H0I A;  1JZW A;  4X4J A;  4IVF A;  1KEB A;  2VCX A;  1M7T A;  1O6J A;  3KMN A;  2R5G A;  1B8X A;  3HJP A;  3ZIT A;  4FYC A;  1TU8 A;  1K0C A;  3ZIV A;  3F6D A;  3BCK A;  3UOM A;  1T4Z A;  2LJA A;  1T3B A;  4MK3 A;  6GSX A;  1G0T A;  1SU9 A;  2LRC A;  3U5R E;  4G19 A;  6GSV A;  3UVT A;  1XVQ A;  3DD3 A;  2GZZ A;  4KUN A;  3LJR A;  1G6Y A;  3FK8 A;  3GUS A;  4ZIJ A;  1ON4 A;  1EV4 A;  2FUG 2;  2AUV A;  3DXB A;  3BCI A;  4D73 B;  2I3Y A;  1ST9 A;  5DBQ A;  1UC7 A;  4LA1 A;  1SL2 B;  5IMD A;  3US3 A;  1AXD A;  4GSN A;  3D4T A;  3VI5 A;  1XXU A;  4H86 A;  2B5X A;  2F9S A;  3RHB A;  2H6Z A;  4N10 A;  1ERW A;  5D96 A;  4JRR A;  2C1Y A;  1DUG A;  1GTB A;  3ISO A;  5IPH A;  4ZL7 A;  5J41 A;  2ZNM A;  2QGV A;  4O5R A;  2E0Q A;  2K18 A;  2M46 A;  4MAB A;  2O87 A;  4EO3 A;  1VF3 A;  2VL2 A;  5AIS A;  2QC7 A;  2H1G A;  1AQX A;  1V2A A;  3LXT A;  3GSS A;  1GTU A;  2M72 A;  5GZZ B;  1VGL A;  1Z6N A;  4ZL9 A;  5ECK B;  3GTU B;  1PRX A;  4JED A;  3UIW A;  2IFQ B;  3PPU A;  5KOX A;  2E2G A;  2V6O A;  2LJR A;  3UL3 A;  3TGZ A;  2M80 A;  4WEY A;  1UVZ A;  3DML A;  5EL8 A;  2Z9S A;  2B5E A;  3L9V A;  4ACS A;  3RAZ A;  4KCE A;  3QAW A;  1QQ2 A;  1V9W A;  4F2I A;  2YWN A;  4PTS A;  3HKR A;  1U3I A;  2CA8 A;  2OKA A;  3FHK A;  3GV1 A;  3A2V A;  2P5R A;  1X5E A;  3AY8 A;  2C3N A;  4ECB A;  4IHU A;  4ZL8 A;  4ZB8 A;  1EGO A;  2WB9 A;  2PVO C;  5EPF A;  1GTA A;  4PXO A;  4EKZ A;  2LTK A;  4YH2 A;  5DDL A;  2CQ9 A;  5J9B A;  5ECQ B;  1Z9H A;  4OMV A;  1PA3 A;  3KTB A;  4I2U A;  4TR3 A;  2GZY A;  2DJ1 A;  1Q4J A;  2H71 A;  3IR4 A;  4GF0 A;  2HSM A;  2YZH A;  5D93 A;  1J0F A;  5JCU A;  1SEN A;  18GS A;  3P8W A;  3TUE A;  1WPI A;  5ECH B;  3BD2 A;  3MAK A;  3W8J A;  1WWJ A;  5ECI B;  3ZVJ D;  3TCO A;  2PWJ A;  2QA2 A;  2H30 A;  2P5Q A;  5J4U A;  2H70 A;  1GSQ A;  2HRN A;  1K3O A;  3IA1 A;  4BL7 A;  2TIR A;  3QAG A;  2RUF A;  5FWG A;  1KNG A;  1BYE A;  3FRC A;  3E0U A;  4HU9 A;  3U6V A;  4YAV A;  2WRT A;  1DSB A;  1LU4 A;  6GSY A;  1TDI A;  2WUL A;  2CVD A;  3MIX A;  2OE0 A;  1W89 A;  2OE1 A;  4EIP A;  1QXH A;  1OVN A;  5HR0 A;  3UBK A;  2L6C A;  2C8U A;  3R2Q A;  3W6G A;  3A5W A;  3D21 A;  4N0Z A;  1R5A A;  2FNO A;  2F3M A;  2YV7 A;  2KLX A;  1M9B A;  4K5S A;  1ZYE A;  4MA9 A;  1FAA A;  2PU9 C;  4V2L A;  1OAZ A;  3A3T A;  3ZRD A;  1MD4 A;  2MYG A;  1AIU A;  1ILO A;  2FWH A;  5KN0 A;  5F05 A;  2YN1 A;  2JSY A;  1X0R A;  4TOP A;  2GST A;  4MZB A;  1TI3 A;  4K2X A;  5HFG A;  1I9D A;  17GS A;  5DQS A;  5HR3 A;  5G5E A;  1K0M A;  3OR5 A;  5EY6 A;  3LGC A;  2K6V A;  3ME7 A;  1ML6 A;  2HXK A;  1M9A A;  3EE2 A;  3QR6 A;  2JSZ A;  1ZZY A;  2MMN A;  1F9M A;  2PPT A;  22GS A;  1F6M C;  1PN0 A;  2VCT A;  5KN1 A;  3ERW A;  2HZE B;  3IK9 A;  4DEJ A;  2MMO A;  1GSY A;  1E2Y A;  2OBI A;  3FW2 A;  4ZB6 A;  3HYP A;  2PBJ A;  4FYB A;  5DAK A;  1XW6 A;  4MPF A;  4N0V A;  3IXR A;  3FEU A;  5D9V A;  2JU5 A;  4XS4 A;  2L5O A;  1TRW A;  2V6K A;  3KEB A;  1ABA A;  4FQU A;  1ZOF A;  1SJ6 A;  2JZR A;  2IPA A;  4NHW A;  1SK1 A;  2CZ2 A;  4GTU A;  1S3D A;  3MWH A;  5IO0 A;  1B4P A;  3UVH A;  2BJX A;  4EC0 A;  1F37 A;  3GL3 A;  5A4U A;  1GUH A;  3F9U A;  1Z7R A;  1XWG A;  1TRS A;  2YP6 A;  4BVX B;  2EIR A;  1YF1 A;  1GP1 A;  5DCH A;  2MBS A;  3WYW A;  1TTZ A;  4NV5 A;  4PGT A;  2ON5 A;  3EU3 A;  3EC3 A;  5D9W A;  4TR4 A;  3UMA A;  4KCA A;  2WDU A;  4HU7 A;  4CY8 A;  1CQG A;  2PUK C;  1T1V A;  4DVC A;  4MH2 A;  6GST A;  4OFT A;  3C1R A;  3FZ4 A;  13GS A;  2YCD A;  4OCF A;  3LXZ A;  1GUK A;  2H1B A;  3GH6 A;  2H01 A;  3Q74 A;  2VUP A;  3NIV A;  1JZO A;  1TP9 A;  3WT1 A;  4EIQ A;  2FWG A;  1HYU A;  2FA4 A;  2GT5 A;  2IME A;  4MF7 A;  4O5U A;  1AQV A;  4BVY B;  3HD5 A;  4V1A g;  4TKY A;  5A4V A;  5DAL B;  2FY6 A;  4MPG A;  5KEJ A;  1J08 A;  3TKQ A;  4X0X A;  5DQY A;  5ECP B;  3C7M A;  5DCG A;  6GSU A;  3D0Z A;  2OE3 A;  3F0I A;  4NWY A;  4GST A;  1EZK A;  1TW9 A;  3O76 A;  3GYK A;  4JU5 A;  3TKS C;  3VI7 A;  3P7X A;  1NHY A;  4ECI A;  3EWL A;  4KE3 A;  2FLS A;  20GS A;  1A8Y A;  1X9M B;  4KSO A;  4FH8 A;  2GGT A;  4YQM A;  3VWW A;  5IMV A;  2F8F A;  2WJU A;  4DSS B;  2O85 A;  2IMF A;  1VF4 A;  2IJY A;  1NSW A;  3VK9 A;  3QDN A;  2FGX A;  3HZ4 A;  3KTL A;  2R4V A;  2CAI A;  4XRA A;  5L71 A;  2CVB A;  1Q98 A;  4WXT A;  1X5C A;  2PGT A;  3CTG A;  4GQC A;  5F8B A;  4E8H A;  3CRT A;  3UEM A;  4QL9 A;  4I6X A;  3ZTL A;  2AHE A;  5ID2 B;  2L6D A;  1SYR A;  1K0D A;  5D9X A;  1QFN A;  1TK0 B;  4ZBB A;  4G9H A;  1HQO A;  2DJ2 A;  4MDC A;  2GQL A;  2X99 A;  1R4W A;  3IK7 A;  3TJB A;  3IC8 A;  3G7Y A;  2AB6 A;  2LEG A;  5HFK A;  1C72 A;  4AJ8 A;  2GQM A;  3HXS A;  2C4J A;  2DKH A;  1B9X C;  1OKD A;  2K9F A;  4USS A;  5AIV A;  3VPQ A;  4MP4 A;  5AGY A;  3VLN A;  4NPB A;  3FY7 A;  4WKW A;  3HHV A;  2X8C A;  3ZFL A;  4HUA A;  2C0F A;  5IPG A;  1G6W A;  2L4Q A;  4FIW A;  4O5Q A;  4ML6 A;  4PUF C;  3RHC A;  1VF2 A;  2RM6 A;  4HI7 A;  1OC9 A;  4IP1 A;  2X8H A;  3APS A;  4PQH A;  4TRX A;  1Z7P A;  2LUS A;  5ENU A;  2HRF A;  1GLQ A;  3A5I A;  5G1K A;  4XHM A;  3H1N A;  5CRW A;  11GS A;  4JBB A;  3FKF A;  1GRX A;  4A5P A;  3EMP A;  5IO2 A;  4YKF A;  5FHI A;  5IIZ A;  1HD2 A;  3NOF A;  3F4S A;  3F4T A;  3VWU A;  3R3E A;  1PL1 A;  3P2A A;  4POB A;  2N5B A;  1WOU A;  3J7Y k;  5BRT A;  4IS0 A;  1PL2 A;  2AYT A;  5G30 A;  1TRU A;  3IHQ A;  3I9V 2;  5D8I A;  5C04 A;  3LW9 A;  1B48 A;  2LQO A;  2H1D A;  1YEP A;  4K5R A;  4G0L A;  2LS5 A;  5B8A A;  4TN8 A;  2V2G A;  4F82 A;  1BQ7 A;  4D73 A;  2R6K A;  3ZYW A;  2VCZ A;  4FYU A;  4IEL A;  4KX4 A;  5HR1 A;  2GVP A;  1F2E A;  1URM A;  2JZS A;  3GUR A;  4HEA 2;  4AF2 A;  4GWR A;  4KW6 A;  5CP1 A;  4TXV A;  4WET A;  1V40 A;  1B4Q A;  4XCS A;  3EVI A;  1JHB A;  2B1L A;  2X64 A;  3M3M A;  4HZ2 A;  3PH9 A;  2VOC A;  4KF9 A;  4HS1 A;  4XTS A;  3C1S A;  3P90 A;  3H4K A;  4ILF A;  2XC2 A;  5CRD A;  4TW5 A;  2DJJ A;  2MMZ A;  4OD7 A;  1TK8 B;  1T7P B;  1PN9 A;  4RI7 A;  4GQF A;  4EDY A;  1GSF A;  3G9B A;  3V1W A;  3GTU A;  3EIN A;  1GSD A;  2NDO A;  2IFQ A;  2E7P A;  4K9Z A;  3LOR A;  5JWQ B;  1K0B A;  1H75 A;  2NPB A;  1E6B A;  3EU4 A;  2V32 A;  3APO A;  4F0C A;  1GTI A;  1KBN A;  3HA9 A;  1GLP A;  1QGV A;  5COH A;  4X43 A;  1SKW B;  2AAW A;  5GST A;  3FZ5 A;  3GIX A;  4EDZ A;  2TRC P;  4RQX A;  1FO5 A;  2YJH A;  3KJY A;  3A2X A;  3C73 A;  1F3B A;  2H76 A;  1XWB A;  2WFC A;  2AJQ B;  1MDI A;  1I5G A;  4ICY A;  2C80 A;  3CMI A;  3KD0 A;  1M0U A;  4EVM A;  3IHG A;  2GLR A;  4I97 A;  1XOB A;  4EUY A;  4WR4 A;  1XIY A;  2FWE A;  4JE1 A;  3FZ9 A;  1QK8 A;  2CV4 A;  5AN1 A;  4MH3 A;  4HJ2 A;  4TR0 A;  1XFL A;  1G7E A;  1FHE A;  1Y25 A;  3KGK A;  3CRU A;  4Z2T A;  3D4M A;  2IMK A;  2B6M A;  2C3T A;  2GSS A;  3D22 A;  1MDK A;  4RUV A;  1QMV A;  2DLX A;  2WS2 A;  3D5J A;  4TVE A;  2G0F A;  3F4R A;  5D73 A;  2YWO A;  1CQH A;  4Z2R A;  1EP7 A;  4MCU A;  1GNW A;  2IWT A;  3UAR A;  2YJ7 A;  2H66 A;  2G2Q A;  4AJ7 A;  4EL1 A;  1DE1 A;  1FOH A;  2NTO A;  4K7O A;  2R0C A;  3LEF A;  2FA8 A;  3W8S A;  1JZD A;  3TKS A;  1PD2 1;  4HJM A;  2FCH A;  4Q5F A;  2R37 A;  3KH7 A;  5A5K A;  1T8E B;  2IIY A;  2OA7 A;  2MZC A;  4K0G A;  1ACV A;  1JZR A;  2WCI A;  4O7H A;  5JWR B;  2H6X A;  2LV3 A;  2EIO A;  2DC5 A;  3GL5 A;  2DJ3 A;  2H73 A;  5FT3 A;  4ECC A;  1GWC A;  1MDJ A;  2VL9 A;  2I81 A;  3SWL A;  5LNK e;  2HSH A;  5KOW A;  3ZZX A;  2FHE A;  4I8B A;  5B6M A;  1XCC A;  2WZ9 A;  3TJJ A;  2KP1 A;  1O73 A;  4K2D A;  2C0G A;  2L59 A;  5ECN B;  1OE7 A;  1AAZ A;  5CAX A;  3GX0 A;  3PR8 A;  2HZE A;  3KMO A;  1U87 A;  3HY2 A;  1EGR A;  4G2E A;  3I69 A;  1K3L A;  1PQN A;  2VL2 C;  5ELG A;  2ZUP A;  5DVB A;  1A0R P;  4PUR A;  3TKR A;  1FVJ A;  3HVS A;  2GQK A;  3I43 A;  2LST A;  2VD1 A;  4PNF A;  4NMU A;  3DYR A;  4Z7X A;  3IAS 2;  2CZ3 A;  3LYP A;  2ES7 A;  1AUC A;  1USB A;  2XPD A;  2KHP A;  5G31 A;  4J2F A;  1FB6 A;  4PX1 A;  2O7K A;  3IPZ A;  4V2M A;  3KM6 A;  5CYY A;  2I4A A;  2IMD A;  1F3A A;  4MZW A;  4CW9 A;  4ZBA A;  4MF5 A;  3GH9 A;  1GSS A;  1OE8 A;  1KTE A;  2N5A A;  4IQ1 A;  3MDK A;  4HQS A;  4BVX A;  4V1A p;  4GRF A;  10GS A;  1YZX A;  1V98 A;  5ECO B;  2RM5 A;  3VWX A;  2IMI A;  3KZQ A;  1XOA A;  5ELA A;  2DIZ A;  1EEJ A;  2H1A A;  2MBT A;  3QAV A;  5H5R A;  1YJ6 A;  3IV4 A;  14GS A;  2ZCT A;  1QUW A;  2OAD A;  2O89 A;  3LSZ A;  3TKP A;  4IJI A;  5DJM A;  3M0F A;  3M8N A;  4XS6 A;  1U3A A;  4G0K A;  2H19 A;  1ZL9 A;  1W4V A;  4F9Z A;  3GKN A;  1O8X A;  2RLI A;  4BVY A;  3GNJ A;  5DAL A;  3G7J A;  3CXG A;  1YEX A;  1M99 A;  3TJF A;  2P0G A;  1UA5 A;  2J23 A;  1XWK A;  2C0E A;  1WJK A;  4Q5Q A;  1B9Y C;  4TXO B;  4K7N A;  3DKS A;  1PGT A;  5F06 A;  5J5N A;  2CVK A;  3GHA A;  5IQY A;  4ZB9 A;  4IP6 A;  4L0U A;  2VLT A;  1DE2 A;  4X1U A;  1YQ1 A;  2VLU A;  1N2A A;  1EP8 A;  3ZL5 A;  2CT6 A;  3QPM A;  5HFI A;  2HFD A;  2B7J A;  3ZFB A;  1M2D A;  2YOI A;  4GCI A;  4NXI A;  1UN2 A;  4AJ6 A;  4OO4 A;  1ERT A;  4I2T A;  4KA0 A;  4MJE A;  4N30 A;  4TR1 B;  3VUR A;  3QCP A;  1K3Y A;  1GUM A;  2VL3 A;  2B1K A;  1XW5 A;  3GKK A;  4I5Q A;  5J3R A;  2VD0 A;  3S9F A;  1NW2 A;  2D2Z A;  2A4H A;  5CRE A;  3LQ7 A;  1R26 A;  2V41 A;  1WE0 A;  3RDW A;  5J9C A;  5ID2 A;  3HDC A;  4XIH A;  2NBS A;  5E59 A;  3GKX A;  3BOA A;  5G2Z A;  2P31 A;  4LMV A;  1THX A;  3ZML A;  4ZBD A;  4OWY A;  3KH9 A;  1PKZ A;  5C00 A;  3KP9 A;  1O81 A;  4IGJ A;  3F3Q A;  1HNB A;  2A2S A;  4K8M A;  5B8B A;  1G7O A;  1V57 A;  5B6N A;  4WF5 A;  2GT6 A;  1K0A A;  2LRT A;  5HQP A;  6GSS A;  4OO5 A;  3FR9 A;  1V58 A;  1BG5 A;  1MEK A;  1U6T A;  1A2M A;  3WD6 A;  4BA7 A;  2DJ0 A;  4RQR A;  4LMW A;  2BMX A;  4KDY A;  2LNT A;  4CHS A;  1J9B A;  1SD9 A;  2FWF A;  4L5L A;  3M9K A;  2C3Q A;  3MSZ A;  1TOF A;  2XBQ A;  3ZRE A;  2LKU A;  2PVQ A;  5IMA A;  1NM3 A;  4KAE A;  1ZGN A;  1PX6 A;  2YWI A;  3E9J B;  1X9S B;  2HYX A;  4KH7 A;  5IMF A;  4RI6 A;  4YKG A;  4MLY A;  3PIN A;  4HZ4 A;  1A8L A;  5IOX A;  4K7I A;  5AIX A;  4EE0 A;  2ALB A;  2H8L A;  3RPP A;  3DGQ A;  2L5L A;  2H72 A;  4YQU A;  1N8J A;  2QKE A;  2A2R A;  2DML A;  2O8V B;  5IMC A;  1FOV A;  2VCQ A;  3IC4 A;  3J7Y b;  3L0H A;  2A4V A;  1IYH A;  3HJM A;  3L78 A;  1X5D A;  5F07 A;  4G10 A;  3DEX A;  2F8A A;  1A23 A;  3K8N A;  4KDX A;  3IAM 2;  3ERF A;  2B7K A;  1M2A A;  1A2J A;  1EEM A;  2DKI A;  2PN8 A;  3UAP A;  2HE3 A;  4PUA A;  2YAN A;  1TK5 B;  3IBH A;  1Y6E A;  4IBP A;  4MJC A;  3RBT A;  2DMM A;  1T00 A;  1SK2 A;  3CSJ A;  2EIQ A;  1K0O A;  2HNL A;  5LD0 A;  3WGX A;  1K0N A;  4IJ3 A;  1GUL A;  2X8G A;  2H6Y A;  3GFK A;  1SD8 A;  8GSS A;  4AGS A;  3WGE A;  4Z2U A;  4CDO A;  2RII A;  5JCW A;  4L8E A;  2K8S A;  1JLV A;  4ISD A;  1YKA A;  2LJK A;  2XBI A;  1LBK A;  1SL1 B;  4XS1 A;  1A2L A;  4PQI A;  1ERV A;  2GSQ A;  3FR6 A;  5ECR B;  3QD9 A;  3GN3 A;  1GSE A;  3N9J A;  5DJL A;  5GAN D;  1PX7 A;  1FB0 A;  3H8Q A;  1LJR A;  4NAX A;  4GXZ A;  1Z3E A;  1YF0 A;  3Q19 A;  2XPE A;  5D9T A;  1OC3 A;  3L4N A;  3HJO A;  3TRP A;  1WMJ A;  4JR4 A;  3RPN A;  3Q18 A;  4ZIL A;  3HVX A;  1R5P A;  2GDR A;  4KND A;  2UZ8 A;  2HT9 A;  2GZP A;  5E4W A;  5JWO B;  1VRS D;  1JFU A;  2VM2 A;  1MD3 A;  2ON7 A;  3DWV A;  3F8U A;  5IOW A;  2RUE A;  3ED3 A;  1PMT A;  3L9U A;  4NV2 A;  1GL8 A;  1EWX A;  1ZYN A;  1O8W A;  2B3S A;  5KN3 A;  1BAY A;  2H0H A;  1O85 A;  1RQM A;  1YKC A;  3C8E A;  4POL A;  2NVL A;  1RW1 A;  4MMM A;  4Q5N A;  4BWS A;  3DIE A;  4K0N A;  1XPV A;  4WR5 A;  1OKT A;  2PER A;  2VM1 A;  1A0F A;  2VO4 A;  3H79 A;  3QMX A;  3D6I A;  3Q6O A;  3F6F A;  1NHO A;  3DVX A;  12GS A;  3KCM A;  1AQW A;  3UJ1 A;  4ECJ A;  3QFA C;  3EPT A;  2R3X A;  3QOU A;  4MNN A;  2R2J A;  3ERG A;  3TKS E;  5CO3 A;  3BBY A;  4OFM A;  3GST A;  4WBR D;  4L0W A;  1HNC A;  4J56 E;  3IE3 A;  5F0G A;  2FD3 A;  1SKS B;  2VCV A;  4J57 E;  4KGI A;  4F03 A;  2HRK A;  5ECM B;  3MNG A;  1XVW A;  3GKM A;  1H4O A;  2DSA A;  2EC4 A;  2N5F A;  1TI1 A;  2GS3 A;  1EV9 A;  1XW9 A;  1Z5Y E;  4BL7 B;  3N5O A;  2H74 A;  1SL0 B;  19GS A;  3G7I A;  4MJA A;  5B7C A;  2GSR A;  3TJG A;  3LG6 A;  4QL7 A;  3LFL A;  3M1G A;  1YY7 A;  3JCM L;  4POK A;  3TOT A;  1TKD B;  2B5Y A;  4DSR A;  3BJ5 A;  3CSI A;  3HVV A;  3C71 A;  2DBC A;  2YV9 A;  4KB3 A;  3ZMK A;  4LLR A;  4BPY A;  1M2B A;  3E3E A;  3TRX A;  3GA4 A;  1SKR B;  4EXJ A;  1FW1 A;  3KP8 A;  1ZYQ B;  2JAD A;  2HSY A;  3FMW A;  2CX3 A;  3CBU A;  4IW9 A;  1PKW A;  1RK4 A;  3I6A A;  9GSS A;  3ME8 A;  3FZA A;  1SK0 A;  1BJX A;  2VLV A;  3A2W A;  3F3R A;  2QA1 A;  3O3T A;  4PNG A;  2VIM A;  1WIK A;  2K8V A;  1WRY A;  4F0B A;  5JCG A;  4OFN A;  2C0D A;  1X9W B;  5IM9 A;  16GS A;  4N11 A;  1BED A;  4ID0 A;  4KDU A;  4LL1 B;  2YZU A;  3WGD A;  3EYT A;  3CSH A;  3F63 A;  4NHZ A;  2CX4 A;  2CAQ A;  2QSI A;  1A24 A;  5G1L A;  1TJD A;  4G0I A;  1MTC A;  2HLS A;  3QFB C;  2JL4 A;  4IN0 A;  1EOG A;  5DAK B;  1SJZ A;  1TRV A;  3KIJ A;  3DRN A;  4MZC A;  2REM A;  5BMU A;  3KXO A;  5ECS A;  4XS4 B;  3TB2 A;  2YNX A;  5IMZ A;  3IRA A;  5CRH A;  2X4A A;  4Q5R A;  3ZIJ A;  2JAC A;  4DSQ A;  5EVO A;  1HNA A;  1XZO A;  2KP2 A;  2DJK A;  4HOJ A;  1THO A;  3ZVJ A;  1XWC A;  5KN2 A;  2L4C A;  5CNW A;  4GSS A;  4WBJ A;  3TRQ A;  1DBY A;  1OC8 A;  4MF6 A;  3MYD A;  3UBL A;  1ZCP A;  4POM A;  2JZT A;  5A4W A;  3CTF A;  4TXO A;  3SBC A;  1VF1 A;  1ZYP A;  4GLT A;  2YPM A;  4JR6 A;  4O32 A;  1YDK A;  2LQQ A;  2V1M A;  5H5S A;  2BTO T;  1WP0 A;  1EOH A;  1AC1 A;  2IN3 A;  2WGR A;  1T4Y A;  3L9S A;  1ERU A;  3TOU A;  4DSS A;  2F51 A;  2KUC A;  2LNS A;  5LCZ A;  3PGT A;  3FYG A;  3VWV A;  4PQ1 A;  1S3A A;  2J9H A;  3LWA A;  4BWQ A;  2DIY A;  4K6X A;  3GMF A;  1XBS A;  5H5Q A;  2YWM A;  4XRD A;  1S3C A;  2AV4 A;  4K1F A;  2VAF A;  4TR1 A;  1TXX A;  2TRX A;  3VFI A;  3GRX A;  4P3Y B;  4KSM A;  3O6T A;  5ABR A;  3HZ8 A;  3H93 A;  2OJL A;  2KOK A;  2IL3 A;  3CYN A;  2HI7 A;  3GX8 A;  2PMT A;  5INY A;  1GSU A;  2OBK A;  4HQZ A;  5HR2 A;  4EF0 A;  1JLW A;  3NZN A;  2I9H A;  4OCE A;  2HRA A;  1GNE A;  2A2P A;  2H0G A;  1SJI A;  3IDV A;  2X49 A;  2GTU A;  3EMX A;  5CRG A;  4YQV A;  1PSQ A;  2L57 A;  5G5F A;  1FVK A;  4FO5 A;  4HDE A;  4ZXG A;  1Z6M A;  2LRN A;  1O7U A;  1IYI A;  4QQ7 A;  2XHF A;  3ZLP A;  4E8E A;  2H75 A;  2E2M A;  4JZQ A;  1U88 A;  4CY6 A;  1FG4 A;  4ULX A;  3M9J A;  5ECL B;  4MJB A;  6GSW A;  4IKH A;  4LL4 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...