2H6YA

Crystal structure of thioredoxin mutant e48d in hexagonal (p61) space group
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
107
structure length
107
Chain Sequence
DKIIHLTDDSFDTDVLKADGAILVDFWAEWCGPCKMIAPILDEIADDYQGKLTVAKLNIDQNPGTAPKYGIRGIPTLLLFKNGEVAATKVGALSKGQLKEFLDANLA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Thioredoxin
publication title Crystal Structure of Thioredoxin Mutant E48D in Hexagonal (p61) Space Group
rcsb
source organism Escherichia coli
molecule tags Electron transport
total genus 30
structure length 107
sequence length 107
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-06-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00085 Thioredoxin Thioredoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 2h6yA00
2EIOA 3EVIA 11GSA 1SYXA 4MK3A 1XW5A 1TU8A 5ECRB 2JADA 4TW5A 3IAM2 4GXZA 2GZYA 3F8UA 3F4TA 3H79A 3KZQA 2IMIA 4FIWA 1SD8A 5ELAA 3GKNA 3A2XA 5LCZA 4HZ4A 1U88A 1KTEA 5B7CA 3ZRDA 3TRQA 4HS1A 2AUVA 3FR9A 2CQ9A 3L4NA 2OE1A 4RUVA 1YDKA 1FW1A 3UJ1A 1U6TA 3UAPA 4WBJA 4XS1A 1N8JA 5ECLB 3FZAA 4JR4A 5IM9A 4TR1B 4IQ1A 5HFKA 3F4SA 2FNOA 4GSTA 1I9DA 3Q18A 3UVHA 1SYRA 3DIEA 3F9UA 5IO2A 4KH7A 2XBIA 4TVEA 1KBNA 4NAXA 1LBKA 1M7TA 2DIZA 1I5GA 2LQOA 3HXSA 3M9JA 1A23A 2H74A 1IYIA 1OVNA 1FB6A 2R37A 3DVXA 4WF5A 1TI3A 3VPQA 1AUCA 3RHBA 4IHUA 3LWAA 5ECOB 1G7EA 4HU7A 1WE0A 4BPYA 4F0BA 3FK8A 2EC4A 1YKCA 4GF0A 1CQGA 4IBPA 1K0BA 1YQ1A 2IMDA 1F9MA 3ME8A 1GP1A 4ID0A 5D9XA 1V2AA 4ZBBA 1BQ7A 1N2AA 3C73A 2WCIA 2FWGA 2WRTA 3IPZA 2AB6A 4MCUA 4JRRA 2HSYA 3RDWA 2LKUA 3Q6OA 2B1KA 3HCZA 1V57A 4ZL8A 2L5OA 2H1GA 1J9BA 5B6MA 4K7IA 3TDGA 1K3YA 6GSUA 1TI1A 2RM5A 2HYXA 3VWXA 1F3BA 2I1UA 1U3AA 4ECIA 2JSYA 1UC7A 4I8BA 3H93A 3GHAA 5ECKB 1RQMA 4K9ZA 4WEYA 2CZ2A 2GQLA 2PPTA 4KSOA 1JZOA 1BAYA 3FW2A 3E9JB 1Z5YE 5J5NA 5H5SA 1B48A 2VCVA 2V2GA 2OKAA 1A24A 1O6JA 3JCML 2R3XA 2RIIA 4O5RA 2KP2A 2MBSA 1YF1A 2P31A 2B7JA 3GYKA 4FYUA 2B3SA 4KNDA 4DSRA 2B7KA 10GSA 4PUFC 1K3LA 2DBCA 4G9HA 4XRDA 1EV9A 1TRUA 2X64A 4JE1A 4GRFA 2FLSA 3EMXA 3QPMA 2L5LA 2C0FA 3RBTA 3ZIJA 1EEJA 3GN3A 3G7JA 5F0GA 1TRSA 5CRGA 3A3TA 4ZL7A 3VPTA 2VOCA 3O76A 5G1KA 4X43A 4ML6A 2B5YA 3TUEA 3TKQA 3ZL5A 1SJIA 1PX6A 2LQQA 2GDRA 3WT2A 3SWLA 1TRVA 5E59A 5HFGA 3I6AA 1ZZYA 2L59A 2F8FA 3RPNA 4RQXA 2VCTA 1YF0A 3TKSC 1JFUA 1R26A 1FVKA 2FWFA 2HNLA 1XWBA 2VM1A 3KCMA 1AXDA 2C0GA 3VI5A 3IK7A 4ISDA 1GH2A 5J9BA 4LMVA 1IYHA 1JHBA 1A8LA 2LUSA 1HQOA 2X8GA 2LEGA 3L78A 4DSSA 2GT5A 2DLXA 1XVWA 1TP9A 3ERFA 5F8BA 4MPFA 4L8EA 4KUNA 4ZL9A 4PGTA 3QAVA 3TRXA 5KEJA 3N9JA 1F2EA 1ERUA 1EP7A 4MLYA 3EC3A 1AAZA 1M2AA 2LNSA 5H5RA 3UL3A 2I9HA 9GSSA 5D9TA 2YWMA 3GKKA 2X8HA 4NXIA 2ZUPA 1S3CA 1XBSA 3HYPA 5A4WA 1ZL9A 5J3RA 4WBRD 4OMVA 2V6OA 1FB0A 3LYPA 1YY7A 2BJXA 4WKWA 4YQVA 2PVOC 2P0GA 5EPFA 1QK8A 1VF3A 3WGDA 2M80A 2TRXA 4HQZA 1X5CA 2M46A 3SBCA 4ECBA 4WF4A 2PERA 1BX9A 5DALA 4POLA 5GAND 4NHZA 1GSDA 1FAAA 4GSSA 1XWGA 4CHSA 1DSBA 2FGXA 1GTBA 1B9XC 5ECIB 3PINA 4ECJA 1KNGA 4Q5QA 1GSUA 1NHOA 2IN3A 5J9CA 2GSQA 3MNGA 1MEKA 4MP4A 4XTSA 5D93A 4K7NA 4K0GA 2DIYA 4ZBDA 1X5EA 1X0RA 3GFKA 4EE0A 5B8BA 1ON4A 5B8AA 3KEBA 1YKAA 5AISA 1R5AA 4V1Ag 3VK9A 1PX7A 1A2MA 3PH9A 3ZVJD 4V2LA 4KDXA 2G2QA 4ZB9A 4HI7A 3GX8A 1URMA 1UVZA 12GSA 1WIKA 5CREA 2OE0A 3N5OA 2L6CA 4I6XA 2YOIA 3MWHA 4YQUA 3ZLPA 1SJZA 3MDKA 4I2UA 3IXRA 1MDJA 3QAGA 4EC0A 3IHQA 3KH7A 3NIVA 2KUCA 5AIVA 4KCAA 2VL2A 3TOTA 3M1GA 1VGLA 1Z9HA 4XS6A 3KP9A 5ENUA 4KAEA 1NW2A 3M0FA 4IKHA 1WRYA 3APSA 2GQKA 4F82A 2NVLA 3J7Yk 5ECMB 1WPIA 1O81A 2EIQA 2TRCP 2NDOA 3CMIA 2GSSA 3QCPA 5DAKA 3IR4A 4POKA 5EVOA 2FHEA 6GSWA 2H6XA 4IELA 2MMZA 3W8SA 5HQPA 3TKRA 3P2AA 4OFTA 3VI7A 1GSSA 5EL8A 1UA5A 3NZNA 5DAKB 5HR0A 5ID2A 4MZBA 1ST9A 1FO5A 5JWQB 2H1DA 2QC7A 1BYEA 3EINA 4ULXA 1O73A 1TJDA 2PWJA 2H66A 1AC1A 3H1NA 1QUWA 4Q5FA 5ECPB 2VL9A 3TJFA 1E2YA 3ERWA 3VURA 5DCHA 4XS4B 2MYGA 3MAKA 2KLXA 2VO4A 3WT1A 4LLRA 1VF1A 2Z9SA 4F0CA 5DJMA 3CSIA 1GTIA 2B5EA 1WJKA 3ED3A 4H86A 2EIRA 4MF5A 2OJLA 2IWTA 4HJ2A 2L4CA 4QL7A 5IPGA 4XIHA 3C8EA 4TXOA 4G10A 2JL4A 1WMJA 2BMXA 3FRCA 3MSZA 3P90A 1O8XA 2O7KA 2GT6A 3GIXA 2OBKA 1Z7PA 4TR1A 4X0XA 4TXVA 1SJ6A 2FY6A 4TXOB 2A2SA 5DQSA 2HZEA 2VUPA 3GV1A 2VCQA 3ERGA 3TKSE 2XPEA 3IV4A 1M2BA 1XWAA 4BVXA 4K6XA 2PU9C 2V6KA 2HZEB 5C04A 22GSA 1M9BA 1QFNA 3TJJA 4GQFA 3IE3A 5KN1A 3M9KA 4HOJA 4MABA 1KEBA 3LGCA 2CT6A 1TXXA 2P5QA 1EGRA 4PNFA 5F05A 2YZUA 2NPBA 3ZZXA 4NV2A 4MJEA 3GRXA 4GTUA 4ML1A 1PSQA 5G5FA 4EKZA 1XCCA 2H72A 1XWKA 1DE2A 4E8EA 5IMZA 2FA8A 1HNBA 4LL1B 2V41A 3US3A 1EZKA 4ZB6A 2OADA 5D73A 1PRXA 4KDUA 4MF6A 1Q98A 4ZXGA 4MF7A 1S3AA 1ZMAA 5FWGA 3ZIVA 1VRSD 1YJ6A 3CSJA 1TOFA 3F3RA 1OE8A 2YANA 3KIJA 1EOGA 1WOUA 3D4TA 5IQYA 2M72A 4YAVA 3ZYWA 2DJ0A 3I43A 1OC3A 2YPMA 3UBKA 1TDIA 3BBYA 4PQ1A 1DE1A 2B1LA 2H8LA 2O87A 3HZ4A 1FOVA 5DJLA 2GVPA 2F9SA 1S3DA 4GLTA 2VAFA 1Z7RA 5AGYA 2R5GA 1MTCA 2GZPA 1K0NA 3L9VA 1SKSB 2QKEA 1BJXA 1PA3A 1TRWA 4XHMA 3ZMKA 2MZCA 1GUKA 4V2NA 2CZ3A 1NSWA 6GSVA 2OBIA 2GTUA 4V2MA 3I9V2 2H6YA 3CXGA 4EUYA 5ECNB 4Q5RA 4HDEA 2L57A 1F6MC 2N5FA 4IVFA 4TR0A 5FT3A 3GH9A 1OKDA 4BVYA 2LV3A 4MPGA 2CV4A 4K8MA 4N11A 3C71A 4GCIA 4Q5NA 3QR6A 3W8JA 1K0DA 3ME7A 3DRNA 5A5KA 2WZ9A 2LRNA 1WP0A 1A8YA 3P7XA 4KX4A 5HR1A 2P5RA 1T4YA 2H1AA 2XBQA 4IP1A 1VF4A 1ACVA 1MDKA 1V9WA 1EGOA 1T1VA 1OKTA 2PMTA 1QMVA 3CBUA 4L0WA 3FKFA 4MJBA 4G2EA 3OR5A 2LNTA 3RAZA 3M8NA 3DWVA 1GNEA 3HA9A 3HY2A 2WFCA 5B6NA 4PUAA 2FCHA 5GZZB 2C0EA 4BL7A 14GSA 3CRTA 3KD0A 4OFNA 2KP1A 1O85A 5KN2A 2ZCTA 2K18A 4X1UA 2HFDA 4TN8A 4L5OA 2WDUA 2GSRA 2B6MA 1PQNA 2F3MA 2R4VA 3UVTA 3QOUA 2RM6A 4IS0A 5CRWA 2WJUA 3DVWA 1TU7A 3GKXA 2ON7A 1USBA 1Y25A 2XHFA 2V1MA 3F0IA 1PKWA 1GUMA 4OFMA 1ML6A 5CAXA 2I4AA 5CRHA 2VL3A 6GSXA 1XZOA 1AQWA 1XXUA 1JZDA 2C0DA 1PKZA 3F63A 4L5LA 1OC8A 2CAIA 4TOPA 4MH3A 5D9VA 3TCOA 3IA1A 1JLWA 3C1RA 1XW6A 5D9WA 5G2ZA 4KDYA 5HR3A 4EDYA 3M3MA 2JU5A 3H4KA 1HNAA 2REMA 3HD5A 4JBBA 1GUHA 2FWEA 1ZCPA 5ABRA 3GTUA 3WGEA 3EWLA 2H0GA 8GSSA 1X9SB 5DQYA 3QAWA 1DBYA 1XOAA 2OACA 3TGZA 3DXBA 2AJQB 4IP6A 4BWSA 3ZITA 1MD4A 4OO5A 4IGJA 2DMLA 3GTUB 1TW9A 4ZIJA 1B8XA 5CP1A 3VWVA 3HVVA 4KW6A 3D4MA 3APOA 4EDZA 4MDCA 4NMUA 4EF0A 2H70A 2H71A 2NBSA 4PURA 4WXTA 4LMWA 3KH9A 3C7MA 4TR3A 3Q19A 3QFAC 2XC2A 2YZHA 2AYTA 13GSA 2VL2C 1T8EB 3IBHA 4K7OA 4OD7A 3VWUA 3KP8A 4AJ6A 1GLQA 2MBTA 1X9MB 4N0ZA 4HQSA 4AJ8A 2DSAA 2IJYA 3IRAA 4J57E 4POBA 4EXJA 2QGVA 1PN9A 4YQMA 4KE3A 2K6VA 4PQHA 2K8VA 5CRDA 2DMMA 1W4VA 1OYJA 3APQA 6GSTA 1E6BA 3R2QA 2CA8A 2LRCA 4KSMA 2E2GA 3LSZA 3UARA 1NM3A 1H4OA 5E4WA 4ACSA 2H01A 3ZVJA 1JZWA 2HI7A 4PNGA 3I69A 3HVSA 3PGTA 3QDNA 3UIWA 2OA7A 4IQAA 2CX3A 2IPAA 1AQVA 1T7PB 3GKMA 2GQMA 2ON5A 1K0CA 2R6KA 2AV4A 3F6DA 1XVQA 1X9WB 4GWRA 4O32A 2H19A 1M0UA 5JCUA 5ECHB 1PGTA 2YJHA 1MD3A 3DMLA 5DDLA 1ERVA 5J4UA 5G31A 5JCWA 4IW9A 2VLVA 3BJ5A 1XIYA 5F07A 4PXOA 1Z6NA 2HZFA 3ZTLA 2YP6A 4LL4B 2H75A 3G9BA 4OCEA 4XS4A 1CQHA 4WR5A 3D0ZA 2DJ2A 1Z3EA 2CVBA 4XCSA 4RI6A 1QQ2A 2GSTA 3GMFA 3UEMA 3KTBA 1TK8B 1V98A 3C1SA 1PL2A 2DJ3A 2WULA 5G5EA 1B4PA 3ZFBA 4WETA 1LU4A 4BA7A 4POMA 1OE7A 4DSQA 1A2LA 3FZ9A 3GUSA 1GSYA 4N30A 4O92A 1R4WA 2VD0A 1XWCA 2HSHA 5KN0A 1FVJA 3IC4A 2VIMA 1H75A 3H8QA 4JEDA 3DYRA 3KJYA 2A4VA 2A2RA 3L9UA 2K8SA 1V40A 4NPBA 1ZYQB 4FH8A 4CW9A 1VF2A 3DEXA 2YN1A 3NOFA 1SL0B 2FD3A 1THXA 3TKPA 2JZRA 3U5RE 3FR3A 1BG5A 2I3YA 1ZOFA 3BCKA 3O3TA 3RPPA 4XRAA 4YAPA 2YNXA 3WYWA 4QL9A 4N10A 1HNCA 2HE3A 3WGXA 2GLRA 2FUG2 2LTKA 2HRFA 2LRTA 1GSQA 4MH2A 1B9YC 5JCGA 2OE3A 3TJBA 1FHEA 5GAPD 5D8IA 1G0TA 2VLTA 1B4QA 3QFBC 4FYBA 2JSZA 1XPVA 3D6IA 3FY7A 3KMNA 4FO5A 1SENA 2F51A 1M99A 4G19A 2LJRA 3EURA 4AF2A 5G30A 2GS3A 2ES7A 4HUAA 5KN3A 3GL3A 1ERTA 1GWCA 6GSYA 4L0UA 1GNWA 4P3YB 4PQIA 3E0UA 4HJMA 3KGKA 4K2DA 3KM6A 4AJ7A 1F37A 1NHYA 1RW1A 4MZWA 3GX0A 2C3QA 1W89A 3VWWA 2C8UA 3KXOA 3ZMLA 3ZFLA 2VCWA 2I81A 4WR4A 3A2WA 4GQCA 2DJKA 1X5DA 3IOSA 2DC5A 2MMAA 1SK2A 3F4RA 4EL1A 3FEUA 1SU9A 2QSIA 2O89A 1U3IA 3ZREA 5CNWA 1LJRA 1PMTA 2PUKC 2R2JA 4I2TA 3TOUA 3TRPA 4ZILA 2L6DA 1U87A 3LJRA 3LORA 1ZYEA 1J0FA 3UBLA 2VM2A 1SD9A 1EOHA 3FZ5A 2DJ1A 1XW9A 2AAWA 2D2ZA 2H6ZA 3BCIA 1K0OA 4TKYA 2IL3A 4EO3A 2YJ7A 5C00A 2KOKA 3EU4A 3G7YA 5L71A 2LS5A 1SL2B 2YV9A 3LXTA 2C3NA 1XOBA 16GSA 3EE2A 4I97A 1ILOA 2H1BA 1TK5B 2H0HA 3GNJA 5AIXA 3J7Yb 1YEXA 3HJOA 3GURA 4K0NA 4I5QA 1HYUA 4RQRA 4F2IA 5AN1A 1SK0A 5G1LA 2YWIA 3EU3A 4ILFA 2H73A 5COHA 1BEDA 1F3AA 2YV7A 3QMXA 1C72A 2NTOA 3F6FA 3VFIA 1TKDB 1AQXA 5LD0A 5IMFA 1ERWA 3GSTA 4CDOA 4J56E 3HJMA 3L9SA 3FR6A 2O85A 1AIUA 4IN0A 3IAS2 4JU5A 2HLSA 2HRNA 3P8WA 3F3QA 1R7HA 2CAQA 4ECCA 5IOWA 1EEMA 1A2JA 5F06A 5IMCA 3FHKA 1M2DA 4YH2A 1TK0B 2LSTA 2L4QA 2MMOA 2FWHA 3A2VA 5HFIA 2HXKA 4GSNA 1EV4A 3TB2A 4DEJA 1Y6EA 5LNKe 3E3EA 2AHEA 2H30A 2C1YA 4KB3A 1OC9A 3L0HA 19GSA 1GRXA 1GULA 4HU9A 5D96A 3DD3A 3TJKA 4E8HA 5IMVA 5HR2A 3ISOA 5J41A 3CTFA 2BTOT 4NWYA 17GSA 3D5JA 3BD2A 2RLIA 1OC9B 3AY8A 4EVMA 1M9AA 3GL5A 1ZGNA 2B5XA 3LEFA 1THOA 2VD1A 2IMKA 3HHVA 4N0VA 2E0QA 1FG4A 5JWOB 1WWJA 3LFLA 4KCEA 1OAZA 3DKSA 3D22A 20GSA 2CX4A 2GZZA 3UMAA 5GSSA 1GL8A 1T00A 3CRUA 2O8VB 2FA4A 4MMMA 2H0IA 3TKSA 1YEPA 4AGSA 4DSSB 1K0MA 5A4VA 5A4UA 5GSTA 2VLUA 2TIRA 1PD21 3GA4A 2IMFA 4ZB8A 4MJCA 5ECSA 5CYYA 1GTUA 5H5QA 2ALBA 1O8WA 1V58A 2DJJA 4F9ZA 2MMNA 3FYGA 2J23A 3BOAA 2E2MA 2C3TA 4O7HA 2JZTA 4J2FA 1RK4A 5ELGA 5CO3A 3S9FA 4JZQA 1Z6MA 1UN2A 4PX1A 2X99A 3DGQA 1QXHA 3LXZA 5IPHA 4OO4A 2IFQA 2PBJA 4MA9A 3RHCA 2C4JA 2C80A 3EYTA 2G0FA 1MDIA 3CSHA 2XPDA 2RUEA 5DBQA 5DALB 3KTLA 1XFLA 3LG6A 3W6GA 2YWOA 2IFQB 1GLPA 2E7PA 2VCZA 5EY6A 3CYNA 5INYA 2LJAA 4KA0A 5IOXA 3TJGA 1TTZA 2CVKA 3IK9A 4F03A 4IJIA 2WGRA 3KMOA 2K9FA 3PR8A 4OCFA 2IIYA 3K8NA 3HJPA 2JZSA 3LYKA 2WS2A 5IMAA 3QD9A 2N5AA 4MZCA 1GSFA 3CTGA 4ZBAA 1SL1B 3HKRA 4Z7XA 7GSSA 2KHPA 2V32A 1GTAA 2VCXA 3HZ8A 4RI7A 3A5WA 4HEA2 1YZXA 3HDCA 1R5PA 1EWXA 2RUFA 1T3BA 3UOMA 3V1WA 1ABAA 1T4ZA 2J9HA 4LA1A 3LQ7A 3G7IA 2PVQA 4MJAA 1PL1A 2PGTA 1SKRB 3O6TA 5DVBA 5IMDA 5IIZA 1Q4JA 4K1FA 3WD6A 2X8CA 1JZRA 5JWRB 2H76A 2IMEA 5IO0A 2ZNMA 4V1Ap 4NV5A 1GSEA 4IJ3A 3D21A 4OWYA 4JR6A 1DUGA 1J08A 1SK1A 1SKWB 1JLVA 1G7OA 1K3OA 2HT9A 3FZ4A 2YCDA 1A0FA 5ECQB 1A0RP 2JACA 2LJKA 4TR4A 1EP8A 4D73A 1O7UA 3IDVA 2GGTA 3HVXA 3U6VA 3VLNA 3Q74A 3GSSA 5ID2B 5DCGA 4HZ2A 5FHIA 4TRXA 4DVCA 2WB9A 4FYCA 2F8AA 2YWNA 3EMPA 4D73B 2N5BA 4NHWA 4QQ7A 2PN8A 1G6YA 1G6WA 3GH6A 6GSSA 1QGVA 18GSA 4BWQA 2CVDA 1K0AA 1AW9A 4KGIA 1HD2A
chains in the Genus database with same CATH superfamily
2EIOA 3EVIA 11GSA 1SYXA 1ZYNA 4MK3A 1XW5A 2X4AA 1TU8A 5ECRB 2JADA 4TW5A 3IAM2 4GXZA 1S3RA 2GZYA 3F8UA 3F4TA 3H79A 3KZQA 2IMIA 4FIWA 1SD8A 5ELAA 3GKNA 3A2XA 5LCZA 4HZ4A 1U88A 1KTEA 5B7CA 3ZRDA 3TRQA 4HS1A 2AUVA 3FR9A 2CQ9A 3L4NA 2OE1A 4RUVA 1YDKA 1FW1A 3UJ1A 1U6TA 3UAPA 4WBJA 4XS1A 1N8JA 2QA2A 5ECLB 3FZAA 4JR4A 5IM9A 4TR1B 2X49A 4IQ1A 5HFKA 3F4SA 2FNOA 4GSTA 1I9DA 3Q18A 3UVHA 1SYRA 3DIEA 3F9UA 5IO2A 4KH7A 2XBIA 4TVEA 1KBNA 4NAXA 1LBKA 1M7TA 2DIZA 2DKIA 1I5GA 2LQOA 3HXSA 4CY6A 3M9JA 2HRAA 1A23A 2H74A 1IYIA 1OVNA 4G0IA 1M3IA 1FB6A 2R37A 3DVXA 4WF5A 1TI3A 4BVXB 3VPQA 1AUCA 3RHBA 4IHUA 3LWAA 5ECOB 1G7EA 4HU7A 1WE0A 4BPYA 4F0BA 3FK8A 2EC4A 1YKCA 4GF0A 1CQGA 4IBPA 2HRKA 1K0BA 1YQ1A 2IMDA 1F9MA 3ME8A 1GP1A 4ID0A 5D9XA 1V2AA 4ZBBA 1BQ7A 1N2AA 3C73A 2WCIA 2FWGA 2WRTA 3IPZA 2AB6A 4MCUA 4JRRA 2HSYA 3RDWA 2LKUA 3Q6OA 3R3EA 2B1KA 3HCZA 1V57A 4ZL8A 2L5OA 2H1GA 1J9BA 3MIXA 5B6MA 4YKFA 4K7IA 3TDGA 1K3YA 6GSUA 1TI1A 2RM5A 2HYXA 3VWXA 1F3BA 2I1UA 1U3AA 4ECIA 2JSYA 1UC7A 4I8BA 3H93A 3GHAA 5ECKB 1RQMA 4K9ZA 4WEYA 2CZ2A 2GQLA 2PPTA 4KSOA 1JZOA 1BAYA 3FW2A 3E9JB 1Z5YE 5J5NA 5H5SA 1B48A 2VCVA 2V2GA 2OKAA 1A24A 1O6JA 3JCML 2R3XA 2RIIA 4O5RA 2KP2A 2MBSA 1YF1A 1ZYPA 2P31A 2B7JA 3GYKA 4FYUA 2B3SA 4KNDA 4DSRA 2B7KA 2A4HA 10GSA 4PUFC 1K3LA 2DBCA 4G9HA 4XRDA 1EV9A 1TRUA 2X64A 4JE1A 4GRFA 2FLSA 3EMXA 3QPMA 2L5LA 2C0FA 3IC8A 3RBTA 3ZIJA 1EEJA 3GN3A 3G7JA 2UZ8A 5F0GA 1TRSA 5CRGA 3A3TA 4ZL7A 3VPTA 2VOCA 3O76A 5G1KA 4X43A 4ML6A 2B5YA 3TUEA 3TKQA 3ZL5A 1SJIA 1PX6A 2LQQA 2GDRA 3WT2A 3SWLA 1TRVA 5E59A 5HFGA 3I6AA 1ZZYA 2L59A 2F8FA 3RPNA 4RQXA 2VCTA 1YF0A 3TKSC 1JFUA 1R26A 1FVKA 2FWFA 2HNLA 1XWBA 2VM1A 3KCMA 1AXDA 2C0GA 4BL7B 3VI5A 3IK7A 4ISDA 1GH2A 5J9BA 4LMVA 1IYHA 1JHBA 1A8LA 2LUSA 1HQOA 2X8GA 2LEGA 3L78A 4DSSA 2GT5A 2DLXA 2QA1A 1XVWA 1TP9A 3ERFA 5F8BA 4MPFA 4L8EA 4KUNA 4X4JA 4ZL9A 4PGTA 3QAVA 3TRXA 5KEJA 3N9JA 4G0LA 1F2EA 1ERUA 1EP7A 4EIQA 2DKHA 4MLYA 3EC3A 1AAZA 1M2AA 2LNSA 5H5RA 3UL3A 2I9HA 9GSSA 5D9TA 2YWMA 3GKKA 2X8HA 4NXIA 2ZUPA 1S3CA 1XBSA 3HYPA 5A4WA 1ZL9A 5J3RA 4WBRD 4OMVA 2V6OA 1FB0A 3LYPA 1YY7A 2BJXA 4WKWA 4YQVA 2PVOC 2P0GA 5EPFA 1QK8A 1VF3A 3WGDA 2M80A 2TRXA 4HQZA 1X5CA 2M46A 3SBCA 4ECBA 4WF4A 2PERA 1BX9A 5DALA 4POLA 5GAND 4NHZA 1GSDA 1FAAA 4GSSA 1XWGA 4CHSA 1DSBA 2FGXA 1GTBA 1B9XC 5ECIB 3PINA 4ECJA 1KNGA 4Q5QA 1GSUA 1NHOA 2IN3A 5J9CA 2GSQA 3MNGA 1MEKA 4MP4A 4XTSA 5D93A 4K7NA 4K0GA 2DIYA 4ZBDA 1X5EA 1X0RA 3GFKA 4EE0A 5B8BA 1ON4A 3MYDA 5B8AA 3KEBA 1YKAA 5AISA 1R5AA 4V1Ag 3VK9A 1PX7A 1A2MA 3PH9A 3ZVJD 4V2LA 4KDXA 2G2QA 4KF9A 4ZB9A 4HI7A 3GX8A 1URMA 1UVZA 12GSA 1WIKA 5CREA 2R0GA 2OE0A 3N5OA 2L6CA 4I6XA 2YOIA 3MWHA 4YQUA 3ZLPA 1SJZA 3MDKA 4I2UA 3IXRA 1MDJA 3QAGA 4EC0A 3IHQA 3KH7A 3NIVA 2KUCA 5AIVA 4KCAA 2VL2A 3TOTA 3M1GA 1VGLA 1Z9HA 4XS6A 3KP9A 5ENUA 4KAEA 1NW2A 3M0FA 4IKHA 1WRYA 3APSA 2GQKA 4F82A 2NVLA 3J7Yk 5ECMB 1WPIA 1O81A 2EIQA 2TRCP 2NDOA 3CMIA 2GSSA 3QCPA 5DAKA 3IR4A 4POKA 5EVOA 2FHEA 6GSWA 2H6XA 4IELA 2MMZA 3W8SA 4G0KA 5HQPA 3TKRA 3P2AA 4OFTA 3VI7A 1GSSA 5EL8A 1UA5A 3NZNA 5DAKB 5HR0A 5ID2A 4MZBA 1ST9A 1FO5A 5JWQB 2H1DA 2QC7A 1BYEA 3EINA 4ULXA 1O73A 1TJDA 4O5UA 2PWJA 2H66A 1AC1A 3H1NA 1QUWA 4Q5FA 5ECPB 2VL9A 3TJFA 1E2YA 4MNNA 3ERWA 3VURA 5DCHA 4XS4B 2MYGA 3MAKA 2KLXA 2VO4A 3WT1A 4LLRA 1VF1A 2Z9SA 4F0CA 5DJMA 3CSIA 1GTIA 2B5EA 1WJKA 3ED3A 4H86A 2EIRA 1FOHA 4MF5A 2OJLA 2IWTA 4HJ2A 2L4CA 4QL7A 5IPGA 4XIHA 3C8EA 4TXOA 4G10A 2JL4A 1WMJA 2BMXA 3FRCA 3MSZA 3P90A 1O8XA 2O7KA 2GT6A 3GIXA 4Z2TA 2OBKA 1Z7PA 4TR1A 4X0XA 4TXVA 1SJ6A 2FY6A 4TXOB 2A2SA 5DQSA 2HZEA 2VUPA 3GV1A 2VCQA 3ERGA 3TKSE 2XPEA 3IV4A 1M2BA 1XWAA 4BVXA 4K6XA 2PU9C 2V6KA 2HZEB 5C04A 22GSA 1M9BA 1QFNA 3TJJA 4GQFA 3IE3A 5KN1A 3M9KA 4HOJA 4MABA 1KEBA 3LGCA 4YKGA 2CT6A 1TXXA 2P5QA 1EGRA 4PNFA 5F05A 2YZUA 2NPBA 3ZZXA 4NV2A 4MJEA 3GRXA 4GTUA 4ML1A 1PSQA 5G5FA 4EKZA 1XCCA 2H72A 1PN0A 1XWKA 1DE2A 4E8EA 5IMZA 2FA8A 1HNBA 4LL1B 2V41A 3US3A 1EZKA 4ZB6A 2OADA 5D73A 1PRXA 4KDUA 3A5IA 4MF6A 1Q98A 4ZXGA 4MF7A 1S3AA 4ICYA 1ZMAA 5FWGA 3ZIVA 1VRSD 1YJ6A 3CSJA 1TOFA 3F3RA 1OE8A 2YANA 3KIJA 1EOGA 1WOUA 3D4TA 5IQYA 2M72A 4YAVA 3ZYWA 2DJ0A 1XG8A 3I43A 1OC3A 2YPMA 3UBKA 1TDIA 3BBYA 4PQ1A 1DE1A 2B1LA 2H8LA 2O87A 4HSCX 3HZ4A 4EIPA 1FOVA 5DJLA 2GVPA 2F9SA 1S3DA 4GLTA 2VAFA 1Z7RA 5AGYA 2R5GA 1MTCA 2GZPA 1K0NA 3L9VA 1SKSB 2QKEA 1BJXA 1PA3A 1TRWA 4XHMA 3ZMKA 2MZCA 1GUKA 4V2NA 2CZ3A 1NSWA 6GSVA 2OBIA 2GTUA 4V2MA 3I9V2 2H6YA 3CXGA 4EUYA 5ECNB 4Q5RA 4HDEA 2L57A 1F6MC 2N5FA 4IVFA 4TR0A 5FT3A 3GH9A 1OKDA 4BVYA 2LV3A 4MPGA 2CV4A 4K8MA 4N11A 3C71A 4GCIA 3CQFA 4Q5NA 2R0PA 3QR6A 3W8JA 1K0DA 3ME7A 3DRNA 5A5KA 2WZ9A 2LRNA 1WP0A 1A8YA 3P7XA 4KX4A 5HR1A 2P5RA 4BVYB 1T4YA 2H1AA 2XBQA 4IP1A 1VF4A 1ACVA 1MDKA 1V9WA 1EGOA 1T1VA 1OKTA 2PMTA 1QMVA 3CBUA 4L0WA 3FKFA 4MJBA 4G2EA 3OR5A 2LNTA 3RAZA 3M8NA 3DWVA 1GNEA 3HA9A 3HY2A 2WFCA 5B6NA 4PUAA 2FCHA 5GZZB 2C0EA 4BL7A 14GSA 3CRTA 3KD0A 4OFNA 2KP1A 1O85A 5KN2A 2ZCTA 2K18A 4X1UA 2HFDA 4TN8A 4L5OA 2WDUA 2GSRA 2B6MA 1PQNA 2F3MA 2R4VA 3UVTA 3QOUA 2RM6A 4IS0A 5CRWA 2WJUA 3DVWA 1TU7A 3GKXA 2ON7A 1USBA 1Y25A 2XHFA 2V1MA 3F0IA 3HVNA 1PKWA 1GUMA 4OFMA 1ML6A 5CAXA 2I4AA 5CRHA 2VL3A 6GSXA 1XZOA 1AQWA 1XXUA 1JZDA 2C0DA 1PKZA 3F63A 4L5LA 1OC8A 2CAIA 4TOPA 4MH3A 5KOWA 5D9VA 3TCOA 3IA1A 1JLWA 3C1RA 1XW6A 5D9WA 5G2ZA 4KDYA 5HR3A 4EDYA 3M3MA 2JU5A 3H4KA 1HNAA 2REMA 3HD5A 4JBBA 1GUHA 2FWEA 1ZCPA 5ABRA 3GTUA 3WGEA 3EWLA 2H0GA 8GSSA 1X9SB 5DQYA 3QAWA 1DBYA 1XOAA 2OACA 3TGZA 3DXBA 2AJQB 4IP6A 4BWSA 3ZITA 1MD4A 4OO5A 4IGJA 2DMLA 3GTUB 1TW9A 4ZIJA 1B8XA 5CP1A 4CY8A 4K2XA 3VWVA 3HVVA 4KW6A 3D4MA 3APOA 4EDZA 4MDCA 4NMUA 4EF0A 2H70A 2H71A 2NBSA 4PURA 4WXTA 4LMWA 3KH9A 3C7MA 4TR3A 3Q19A 3QFAC 2XC2A 2YZHA 2AYTA 13GSA 2VL2C 1T8EB 3IBHA 4K7OA 4OD7A 3VWUA 3KP8A 4AJ6A 1GLQA 2MBTA 1X9MB 4N0ZA 5BRTA 4HQSA 4AJ8A 1M3JA 2DSAA 2IJYA 3IRAA 4J57E 4POBA 4EXJA 2QGVA 1PN9A 4YQMA 4KE3A 2K6VA 4PQHA 2K8VA 5CRDA 2DMMA 1W4VA 1OYJA 3APQA 6GSTA 1E6BA 3R2QA 2CA8A 2LRCA 4KSMA 2E2GA 3LSZA 3UARA 1NM3A 3PPUA 1H4OA 5E4WA 4ACSA 2H01A 3ZVJA 1JZWA 2HI7A 4PNGA 3I69A 3HVSA 3PGTA 3QDNA 3UIWA 2OA7A 4IQAA 5BMUA 2CX3A 2IPAA 1AQVA 2A2PA 1T7PB 3GKMA 2GQMA 2ON5A 1K0CA 2R6KA 2AV4A 3F6DA 1XVQA 1X9WB 4GWRA 4O32A 2H19A 1M0UA 5JCUA 5ECHB 1PGTA 2YJHA 1MD3A 3DMLA 5DDLA 1ERVA 5J4UA 5G31A 5JCWA 4IW9A 2VLVA 3BJ5A 1XIYA 5F07A 4PXOA 1Z6NA 2HZFA 3ZTLA 2YP6A 4LL4B 2H75A 3G9BA 4OCEA 4XS4A 1CQHA 4WR5A 3D0ZA 2DJ2A 1Z3EA 2CVBA 4XCSA 4RI6A 1QQ2A 2GSTA 3GMFA 3UEMA 3KTBA 1TK8B 1V98A 3C1SA 1PL2A 2DJ3A 2WULA 5G5EA 1B4PA 3ZFBA 4WETA 1LU4A 4BA7A 2R0CA 4POMA 1OE7A 4DSQA 1A2LA 3FZ9A 3GUSA 1GSYA 4N30A 4O92A 1R4WA 2VD0A 1XWCA 2HSHA 5KN0A 1FVJA 4K5SA 3IC4A 2VIMA 1H75A 3H8QA 4JEDA 3DYRA 3KJYA 2A4VA 2A2RA 3L9UA 2K8SA 1V40A 4NPBA 1ZYQB 4FH8A 4CW9A 1VF2A 3DEXA 2YN1A 3NOFA 1SL0B 2FD3A 1THXA 3TKPA 2JZRA 3U5RE 3FR3A 1BG5A 2I3YA 1ZOFA 3BCKA 3O3TA 3RPPA 4XRAA 4YAPA 2YNXA 3WYWA 4QL9A 4N10A 1HNCA 2HE3A 3WGXA 2GLRA 2FUG2 2LTKA 2HRFA 2LRTA 1GSQA 4MH2A 1B9YC 5JCGA 2OE3A 3TJBA 1FHEA 5GAPD 5D8IA 1G0TA 2VLTA 1B4QA 3QFBC 4FYBA 2JSZA 1XPVA 3D6IA 3FY7A 3KMNA 4FO5A 1SENA 2F51A 1M99A 4G19A 2LJRA 3EURA 4AF2A 5G30A 2GS3A 4USSA 2ES7A 4HUAA 5KN3A 3GL3A 1ERTA 1GWCA 6GSYA 4L0UA 1GNWA 4P3YB 4PQIA 3E0UA 4HJMA 3KGKA 4K2DA 3KM6A 4AJ7A 1F37A 1NHYA 1RW1A 4MZWA 3GX0A 2C3QA 1W89A 3VWWA 2C8UA 3KXOA 3ZMLA 3ZFLA 2VCWA 2I81A 4WR4A 4K5RA 3A2WA 4GQCA 2DJKA 1X5DA 3IOSA 2DC5A 2MMAA 1SK2A 3F4RA 4EL1A 3FEUA 1SU9A 2QSIA 2O89A 1U3IA 3ZREA 5CNWA 1LJRA 1PMTA 2PUKC 2R2JA 4I2TA 3TOUA 3TRPA 4ZILA 2L6DA 1U87A 3LJRA 3LORA 1ZYEA 1J0FA 3UBLA 2VM2A 1SD9A 1EOHA 3FZ5A 2DJ1A 1XW9A 2AAWA 2D2ZA 2H6ZA 3BCIA 1K0OA 4TKYA 2IL3A 4EO3A 2YJ7A 5C00A 2KOKA 3EU4A 3G7YA 5L71A 2LS5A 3EPTA 1SL2B 2YV9A 3LXTA 2C3NA 1XOBA 4PTSA 16GSA 3EE2A 4I97A 1ILOA 2H1BA 1TK5B 2H0HA 3GNJA 5AIXA 3J7Yb 1YEXA 3HJOA 3GURA 4K0NA 4I5QA 1HYUA 4RQRA 4F2IA 5AN1A 1SK0A 5G1LA 2YWIA 3EU3A 4ILFA 2H73A 5COHA 1BEDA 1F3AA 2YV7A 3QMXA 1C72A 2NTOA 3F6FA 3VFIA 1TKDB 1AQXA 5LD0A 5IMFA 1ERWA 3GSTA 4CDOA 4J56E 3HJMA 3L9SA 3FR6A 2O85A 1AIUA 4IN0A 3IAS2 4JU5A 2HLSA 2HRNA 3P8WA 3F3QA 1R7HA 2CAQA 4ECCA 5IOWA 1EEMA 1A2JA 5F06A 5IMCA 3FHKA 1M2DA 4YH2A 1TK0B 2LSTA 2L4QA 4FQUA 2MMOA 2FWHA 3A2VA 5HFIA 2HXKA 4GSNA 1EV4A 3TB2A 4DEJA 1Y6EA 5LNKe 3E3EA 2AHEA 2H30A 2C1YA 4KB3A 1OC9A 4Z2RA 3L0HA 19GSA 1GRXA 1GULA 4HU9A 5D96A 3DD3A 3TJKA 4E8HA 5IMVA 5HR2A 3ISOA 5J41A 3CTFA 2BTOT 4NWYA 17GSA 3D5JA 3BD2A 2RLIA 1OC9B 3AY8A 4EVMA 1M9AA 3GL5A 1ZGNA 2B5XA 3LEFA 1THOA 2VD1A 2IMKA 3HHVA 4N0VA 2E0QA 1FG4A 2HSMA 5JWOB 1WWJA 3IHGA 3LFLA 4KCEA 1OAZA 3DKSA 3D22A 20GSA 2CX4A 2GZZA 3UMAA 5GSSA 1GL8A 1T00A 3CRUA 2O8VB 2FA4A 4MMMA 2H0IA 3TKSA 1YEPA 4AGSA 4DSSB 1K0MA 5A4VA 5A4UA 5GSTA 2VLUA 2TIRA 1PD21 3GA4A 2IMFA 4ZB8A 4MJCA 5ECSA 5CYYA 1GTUA 5H5QA 2ALBA 1O8WA 1V58A 2DJJA 4F9ZA 2MMNA 3FYGA 2J23A 4BIKA 3BOAA 2E2MA 2C3TA 4O7HA 2JZTA 4J2FA 1RK4A 5ELGA 5CO3A 3S9FA 4JZQA 1Z6MA 1UN2A 4PX1A 2X99A 3DGQA 1QXHA 3LXZA 5IPHA 4OO4A 2IFQA 2PBJA 4MA9A 3RHCA 2C4JA 2C80A 3EYTA 2G0FA 1MDIA 3CSHA 2XPDA 2RUEA 5DBQA 5DALB 3KTLA 1XFLA 3LG6A 3W6GA 2YWOA 2IFQB 1GLPA 2E7PA 2VCZA 5EY6A 3CYNA 5INYA 2LJAA 4KA0A 5IOXA 3TJGA 1TTZA 2CVKA 3IK9A 4F03A 4IJIA 2WGRA 3KMOA 2K9FA 3PR8A 4OCFA 2IIYA 3K8NA 3HJPA 4O5QA 2JZSA 3LYKA 1PFOA 2WS2A 5IMAA 3QD9A 2N5AA 4MZCA 1GSFA 3CTGA 4ZBAA 1SL1B 3HKRA 4Z7XA 7GSSA 2KHPA 2V32A 3LW9A 1GTAA 2VCXA 3HZ8A 4Z2UA 4RI7A 3A5WA 4HEA2 1YZXA 3HDCA 1R5PA 1EWXA 2RUFA 1T3BA 3UOMA 3FMWA 3V1WA 1ABAA 1T4ZA 2J9HA 4LA1A 3LQ7A 3G7IA 2PVQA 4MJAA 1PL1A 2PGTA 1SKRB 3O6TA 5DVBA 5IMDA 5IIZA 1Q4JA 4K1FA 3WD6A 2X8CA 1JZRA 5JWRB 2H76A 2IMEA 5IO0A 2ZNMA 4V1Ap 4NV5A 1GSEA 4IJ3A 4A5PA 3D21A 4OWYA 4JR6A 1DUGA 1J08A 1SK1A 1SKWB 1JLVA 1G7OA 1K3OA 2HT9A 3FZ4A 2YCDA 1A0FA 5ECQB 1A0RP 2JACA 2LJKA 4TR4A 1EP8A 4D73A 1O7UA 3IDVA 2GGTA 3HVXA 3U6VA 3VLNA 3Q74A 3GSSA 5ID2B 5DCGA 4HZ2A 5FHIA 4TRXA 4DVCA 2WB9A 4FYCA 2F8AA 2YWNA 3EMPA 4D73B 2N5BA 4NHWA 4QQ7A 2PN8A 1G6YA 1G6WA 3GH6A 6GSSA 1QGVA 18GSA 4BWQA 2CVDA 1K0AA 1AW9A 4KGIA 5KOXA 1HD2A
chains in the Genus database with same CATH topology
2EIOA 3EVIA 11GSA 1SYXA 1ZYNA 4MK3A 1XW5A 2X4AA 1TU8A 5ECRB 2JADA 4TW5A 3IAM2 4GXZA 2GZYA 3F8UA 3F4TA 3H79A 3KZQA 2IMIA 4FIWA 1SD8A 5ELAA 3GKNA 3A2XA 5LCZA 4HZ4A 1U88A 1KTEA 5B7CA 3ZRDA 3TRQA 4HS1A 2AUVA 3FR9A 2CQ9A 3L4NA 2OE1A 4RUVA 1YDKA 1FW1A 3UJ1A 1U6TA 3UAPA 4WBJA 4XS1A 1N8JA 2QA2A 5ECLB 3FZAA 4JR4A 5IM9A 4TR1B 2X49A 4IQ1A 5HFKA 3F4SA 2FNOA 4GSTA 1I9DA 3Q18A 3UVHA 1SYRA 3DIEA 3F9UA 5IO2A 4KH7A 2XBIA 4TVEA 1KBNA 4NAXA 1LBKA 1M7TA 2DIZA 2DKIA 1I5GA 2LQOA 3HXSA 4CY6A 3M9JA 2HRAA 1A23A 2H74A 1IYIA 1OVNA 4G0IA 1FB6A 2R37A 3DVXA 4WF5A 1TI3A 4BVXB 3VPQA 1AUCA 3RHBA 4IHUA 3LWAA 5ECOB 1G7EA 4HU7A 1WE0A 4BPYA 4F0BA 3FK8A 2EC4A 1YKCA 4GF0A 1CQGA 4IBPA 2HRKA 1K0BA 1YQ1A 2IMDA 1F9MA 3ME8A 1GP1A 4ID0A 5D9XA 1V2AA 4ZBBA 1BQ7A 1N2AA 3C73A 2WCIA 2FWGA 2WRTA 3IPZA 2AB6A 4MCUA 4JRRA 2HSYA 3RDWA 2LKUA 3Q6OA 3R3EA 2B1KA 3HCZA 1V57A 4ZL8A 2L5OA 2H1GA 1J9BA 3MIXA 5B6MA 4YKFA 4K7IA 3TDGA 1K3YA 6GSUA 1TI1A 2RM5A 2HYXA 3VWXA 1F3BA 2I1UA 1U3AA 4ECIA 2JSYA 1UC7A 4I8BA 3H93A 3GHAA 5ECKB 1RQMA 4K9ZA 4WEYA 2CZ2A 2GQLA 2PPTA 4KSOA 1JZOA 1BAYA 3FW2A 3E9JB 1Z5YE 5J5NA 5H5SA 1B48A 2VCVA 2V2GA 2OKAA 1A24A 1O6JA 3JCML 2R3XA 2RIIA 4O5RA 2KP2A 2MBSA 1YF1A 1ZYPA 2P31A 2B7JA 3GYKA 4FYUA 2B3SA 4KNDA 4DSRA 2B7KA 2A4HA 10GSA 4PUFC 1K3LA 2DBCA 4G9HA 4XRDA 1EV9A 1TRUA 2X64A 4JE1A 4GRFA 2FLSA 3EMXA 3QPMA 2L5LA 2C0FA 3IC8A 3RBTA 3ZIJA 1EEJA 3GN3A 3G7JA 2UZ8A 5F0GA 1TRSA 5CRGA 3A3TA 4ZL7A 3VPTA 2VOCA 3O76A 5G1KA 4X43A 4ML6A 2B5YA 3TUEA 3TKQA 3ZL5A 1SJIA 1PX6A 2LQQA 2GDRA 3WT2A 3SWLA 1TRVA 5E59A 5HFGA 3I6AA 1ZZYA 2L59A 2F8FA 3RPNA 4RQXA 2VCTA 1YF0A 3TKSC 1JFUA 1R26A 1FVKA 2FWFA 2HNLA 1XWBA 2VM1A 3KCMA 1AXDA 2C0GA 4BL7B 3VI5A 3IK7A 4ISDA 1GH2A 5J9BA 4LMVA 1IYHA 1JHBA 1A8LA 2LUSA 1HQOA 2X8GA 2LEGA 3L78A 4DSSA 2GT5A 2DLXA 2QA1A 1XVWA 1TP9A 3ERFA 5F8BA 4MPFA 4L8EA 4KUNA 4X4JA 4ZL9A 4PGTA 3QAVA 3TRXA 5KEJA 3N9JA 4G0LA 1F2EA 1ERUA 1EP7A 4EIQA 2DKHA 4MLYA 3EC3A 1AAZA 1M2AA 2LNSA 5H5RA 3UL3A 2I9HA 9GSSA 5D9TA 2YWMA 3GKKA 2X8HA 4NXIA 2ZUPA 1S3CA 1XBSA 3HYPA 5A4WA 1ZL9A 5J3RA 4WBRD 4OMVA 2V6OA 1FB0A 3LYPA 1YY7A 2BJXA 4WKWA 4YQVA 2PVOC 2P0GA 5EPFA 1QK8A 1VF3A 3WGDA 2M80A 2TRXA 4HQZA 1X5CA 2M46A 3SBCA 4ECBA 4WF4A 2PERA 1BX9A 5DALA 4POLA 5GAND 4NHZA 1GSDA 1FAAA 4GSSA 1XWGA 4CHSA 1DSBA 2FGXA 1GTBA 1B9XC 5ECIB 3PINA 4ECJA 1KNGA 4Q5QA 1GSUA 1NHOA 2IN3A 5J9CA 2GSQA 3MNGA 1MEKA 4MP4A 4XTSA 5D93A 4K7NA 4K0GA 2DIYA 4ZBDA 1X5EA 1X0RA 3GFKA 4EE0A 5B8BA 1ON4A 3MYDA 5B8AA 3KEBA 1YKAA 5AISA 1R5AA 4V1Ag 3VK9A 1PX7A 1A2MA 3PH9A 3ZVJD 4V2LA 4KDXA 2G2QA 4KF9A 4ZB9A 4HI7A 3GX8A 1URMA 1UVZA 12GSA 1WIKA 5CREA 2R0GA 2OE0A 3N5OA 2L6CA 4I6XA 2YOIA 3MWHA 4YQUA 3ZLPA 1SJZA 3MDKA 4I2UA 3IXRA 1MDJA 3QAGA 4EC0A 3IHQA 3KH7A 3NIVA 2KUCA 5AIVA 4KCAA 2VL2A 3TOTA 3M1GA 1VGLA 1Z9HA 4XS6A 3KP9A 5ENUA 4KAEA 1NW2A 3M0FA 4IKHA 1WRYA 3APSA 2GQKA 4F82A 2NVLA 3J7Yk 5ECMB 1WPIA 1O81A 2EIQA 2TRCP 2NDOA 3CMIA 2GSSA 3QCPA 5DAKA 3IR4A 4POKA 5EVOA 2FHEA 6GSWA 2H6XA 4IELA 2MMZA 3W8SA 4G0KA 5HQPA 3TKRA 3P2AA 4OFTA 3VI7A 1GSSA 5EL8A 1UA5A 3NZNA 5DAKB 5HR0A 5ID2A 4MZBA 1ST9A 1FO5A 5JWQB 2H1DA 2QC7A 1BYEA 3EINA 4ULXA 1O73A 1TJDA 4O5UA 2PWJA 2H66A 1AC1A 3H1NA 1QUWA 4Q5FA 5ECPB 2VL9A 3TJFA 1E2YA 4MNNA 3ERWA 3VURA 5DCHA 4XS4B 2MYGA 3MAKA 2KLXA 2VO4A 3WT1A 4LLRA 1VF1A 2Z9SA 4F0CA 5DJMA 3CSIA 1GTIA 2B5EA 1WJKA 3ED3A 4H86A 2EIRA 1FOHA 4MF5A 2OJLA 2IWTA 4HJ2A 2L4CA 4QL7A 5IPGA 4XIHA 3C8EA 4TXOA 4G10A 2JL4A 1WMJA 2BMXA 3FRCA 3MSZA 3P90A 1O8XA 2O7KA 2GT6A 3GIXA 4Z2TA 2OBKA 1Z7PA 4TR1A 4X0XA 4TXVA 1SJ6A 2FY6A 4TXOB 2A2SA 5DQSA 2HZEA 2VUPA 3GV1A 2VCQA 3ERGA 3TKSE 2XPEA 3IV4A 1M2BA 1XWAA 4BVXA 4K6XA 2PU9C 2V6KA 2HZEB 5C04A 22GSA 1M9BA 1QFNA 3TJJA 4GQFA 3IE3A 5KN1A 3M9KA 4HOJA 4MABA 1KEBA 3LGCA 4YKGA 2CT6A 1TXXA 2P5QA 1EGRA 4PNFA 5F05A 2YZUA 2NPBA 3ZZXA 4NV2A 4MJEA 3GRXA 4GTUA 4ML1A 1PSQA 5G5FA 4EKZA 1XCCA 2H72A 1PN0A 1XWKA 1DE2A 4E8EA 5IMZA 2FA8A 1HNBA 4LL1B 2V41A 3US3A 1EZKA 4ZB6A 2OADA 5D73A 1PRXA 4KDUA 3A5IA 4MF6A 1Q98A 4ZXGA 4MF7A 1S3AA 4ICYA 1ZMAA 5FWGA 3ZIVA 1VRSD 1YJ6A 3CSJA 1TOFA 3F3RA 1OE8A 2YANA 3KIJA 1EOGA 1WOUA 3D4TA 5IQYA 2M72A 4YAVA 3ZYWA 2DJ0A 3I43A 1OC3A 2YPMA 3UBKA 1TDIA 3BBYA 4PQ1A 1DE1A 2B1LA 2H8LA 2O87A 3HZ4A 4EIPA 1FOVA 5DJLA 2GVPA 2F9SA 1S3DA 4GLTA 2VAFA 1Z7RA 5AGYA 2R5GA 1MTCA 2GZPA 1K0NA 3L9VA 1SKSB 2QKEA 1BJXA 1PA3A 1TRWA 4XHMA 3ZMKA 2MZCA 1GUKA 4V2NA 2CZ3A 1NSWA 6GSVA 2OBIA 2GTUA 4V2MA 3I9V2 2H6YA 3CXGA 4EUYA 5ECNB 4Q5RA 4HDEA 2L57A 1F6MC 2N5FA 4IVFA 4TR0A 5FT3A 3GH9A 1OKDA 4BVYA 2LV3A 4MPGA 2CV4A 4K8MA 4N11A 3C71A 4GCIA 4Q5NA 2R0PA 3QR6A 3W8JA 1K0DA 3ME7A 3DRNA 5A5KA 2WZ9A 2LRNA 1WP0A 1A8YA 3P7XA 4KX4A 5HR1A 2P5RA 4BVYB 1T4YA 2H1AA 2XBQA 4IP1A 1VF4A 1ACVA 1MDKA 1V9WA 1EGOA 1T1VA 1OKTA 2PMTA 1QMVA 3CBUA 4L0WA 3FKFA 4MJBA 4G2EA 3OR5A 2LNTA 3RAZA 3M8NA 3DWVA 1GNEA 3HA9A 3HY2A 2WFCA 5B6NA 4PUAA 2FCHA 5GZZB 2C0EA 4BL7A 14GSA 3CRTA 3KD0A 4OFNA 2KP1A 1O85A 5KN2A 2ZCTA 2K18A 4X1UA 2HFDA 4TN8A 4L5OA 2WDUA 2GSRA 2B6MA 1PQNA 2F3MA 2R4VA 3UVTA 3QOUA 2RM6A 4IS0A 5CRWA 2WJUA 3DVWA 1TU7A 3GKXA 2ON7A 1USBA 1Y25A 2XHFA 2V1MA 3F0IA 1PKWA 1GUMA 4OFMA 1ML6A 5CAXA 2I4AA 5CRHA 2VL3A 6GSXA 1XZOA 1AQWA 1XXUA 1JZDA 2C0DA 1PKZA 3F63A 4L5LA 1OC8A 2CAIA 4TOPA 4MH3A 5KOWA 5D9VA 3TCOA 3IA1A 1JLWA 3C1RA 1XW6A 5D9WA 5G2ZA 4KDYA 5HR3A 4EDYA 3M3MA 2JU5A 3H4KA 1HNAA 2REMA 3HD5A 4JBBA 1GUHA 2FWEA 1ZCPA 5ABRA 3GTUA 3WGEA 3EWLA 2H0GA 8GSSA 1X9SB 5DQYA 3QAWA 1DBYA 1XOAA 2OACA 3TGZA 3DXBA 2AJQB 4IP6A 4BWSA 3ZITA 1MD4A 4OO5A 4IGJA 2DMLA 3GTUB 1TW9A 4ZIJA 1B8XA 5CP1A 4CY8A 4K2XA 3VWVA 3HVVA 4KW6A 3D4MA 3APOA 4EDZA 4MDCA 4NMUA 4EF0A 2H70A 2H71A 2NBSA 4PURA 4WXTA 4LMWA 3KH9A 3C7MA 4TR3A 3Q19A 3QFAC 2XC2A 2YZHA 2AYTA 13GSA 2VL2C 1T8EB 3IBHA 4K7OA 4OD7A 3VWUA 3KP8A 4AJ6A 1GLQA 2MBTA 1X9MB 4N0ZA 5BRTA 4HQSA 4AJ8A 2DSAA 2IJYA 3IRAA 4J57E 4POBA 4EXJA 2QGVA 1PN9A 4YQMA 4KE3A 2K6VA 4PQHA 2K8VA 5CRDA 2DMMA 1W4VA 1OYJA 3APQA 6GSTA 1E6BA 3R2QA 2CA8A 2LRCA 4KSMA 2E2GA 3LSZA 3UARA 1NM3A 3PPUA 1H4OA 5E4WA 4ACSA 2H01A 3ZVJA 1JZWA 2HI7A 4PNGA 3I69A 3HVSA 3PGTA 3QDNA 3UIWA 2OA7A 4IQAA 5BMUA 2CX3A 2IPAA 1AQVA 2A2PA 1T7PB 3GKMA 2GQMA 2ON5A 1K0CA 2R6KA 2AV4A 3F6DA 1XVQA 1X9WB 4GWRA 4O32A 2H19A 1M0UA 5JCUA 5ECHB 1PGTA 2YJHA 1MD3A 3DMLA 5DDLA 1ERVA 5J4UA 5G31A 5JCWA 4IW9A 2VLVA 3BJ5A 1XIYA 5F07A 4PXOA 1Z6NA 2HZFA 3ZTLA 2YP6A 4LL4B 2H75A 3G9BA 4OCEA 4XS4A 1CQHA 4WR5A 3D0ZA 2DJ2A 1Z3EA 2CVBA 4XCSA 4RI6A 1QQ2A 2GSTA 3GMFA 3UEMA 3KTBA 1TK8B 1V98A 3C1SA 1PL2A 2DJ3A 2WULA 5G5EA 1B4PA 3ZFBA 4WETA 1LU4A 4BA7A 2R0CA 4POMA 1OE7A 4DSQA 1A2LA 3FZ9A 3GUSA 1GSYA 4N30A 4O92A 1R4WA 2VD0A 1XWCA 2HSHA 5KN0A 1FVJA 4K5SA 3IC4A 2VIMA 1H75A 3H8QA 4JEDA 3DYRA 3KJYA 2A4VA 2A2RA 3L9UA 2K8SA 1V40A 4NPBA 1ZYQB 4FH8A 4CW9A 1VF2A 3DEXA 2YN1A 3NOFA 1SL0B 2FD3A 1THXA 3TKPA 2JZRA 3U5RE 3FR3A 1BG5A 2I3YA 1ZOFA 3BCKA 3O3TA 3RPPA 4XRAA 4YAPA 2YNXA 3WYWA 4QL9A 4N10A 1HNCA 2HE3A 3WGXA 2GLRA 2FUG2 2LTKA 2HRFA 2LRTA 1GSQA 4MH2A 1B9YC 5JCGA 2OE3A 3TJBA 1FHEA 5GAPD 5D8IA 1G0TA 2VLTA 1B4QA 3QFBC 4FYBA 2JSZA 1XPVA 3D6IA 3FY7A 3KMNA 4FO5A 1SENA 2F51A 1M99A 4G19A 2LJRA 3EURA 4AF2A 5G30A 2GS3A 4USSA 2ES7A 4HUAA 5KN3A 3GL3A 1ERTA 1GWCA 6GSYA 4L0UA 1GNWA 4P3YB 4PQIA 3E0UA 4HJMA 3KGKA 4K2DA 3KM6A 4AJ7A 1F37A 1NHYA 1RW1A 4MZWA 3GX0A 2C3QA 1W89A 3VWWA 2C8UA 3KXOA 3ZMLA 3ZFLA 2VCWA 2I81A 4WR4A 4K5RA 3A2WA 4GQCA 2DJKA 1X5DA 3IOSA 2DC5A 2MMAA 1SK2A 3F4RA 4EL1A 3FEUA 1SU9A 2QSIA 2O89A 1U3IA 3ZREA 5CNWA 1LJRA 1PMTA 2PUKC 2R2JA 4I2TA 3TOUA 3TRPA 4ZILA 2L6DA 1U87A 3LJRA 3LORA 1ZYEA 1J0FA 3UBLA 2VM2A 1SD9A 1EOHA 3FZ5A 2DJ1A 1XW9A 2AAWA 2D2ZA 2H6ZA 3BCIA 1K0OA 4TKYA 2IL3A 4EO3A 2YJ7A 5C00A 2KOKA 3EU4A 3G7YA 5L71A 2LS5A 3EPTA 1SL2B 2YV9A 3LXTA 2C3NA 1XOBA 4PTSA 16GSA 3EE2A 4I97A 1ILOA 2H1BA 1TK5B 2H0HA 3GNJA 5AIXA 3J7Yb 1YEXA 3HJOA 3GURA 4K0NA 4I5QA 1HYUA 4RQRA 4F2IA 5AN1A 1SK0A 5G1LA 2YWIA 3EU3A 4ILFA 2H73A 5COHA 1BEDA 1F3AA 2YV7A 3QMXA 1C72A 2NTOA 3F6FA 3VFIA 1TKDB 1AQXA 5LD0A 5IMFA 1ERWA 3GSTA 4CDOA 4J56E 3HJMA 3L9SA 3FR6A 2O85A 1AIUA 4IN0A 3IAS2 4JU5A 2HLSA 2HRNA 3P8WA 3F3QA 1R7HA 2CAQA 4ECCA 5IOWA 1EEMA 1A2JA 5F06A 5IMCA 3FHKA 1M2DA 4YH2A 1TK0B 2LSTA 2L4QA 4FQUA 2MMOA 2FWHA 3A2VA 5HFIA 2HXKA 4GSNA 1EV4A 3TB2A 4DEJA 1Y6EA 5LNKe 3E3EA 2AHEA 2H30A 2C1YA 4KB3A 1OC9A 4Z2RA 3L0HA 19GSA 1GRXA 1GULA 4HU9A 5D96A 3DD3A 3TJKA 4E8HA 5IMVA 5HR2A 3ISOA 5J41A 3CTFA 2BTOT 4NWYA 17GSA 3D5JA 3BD2A 2RLIA 1OC9B 3AY8A 4EVMA 1M9AA 3GL5A 1ZGNA 2B5XA 3LEFA 1THOA 2VD1A 2IMKA 3HHVA 4N0VA 2E0QA 1FG4A 2HSMA 5JWOB 1WWJA 3IHGA 3LFLA 4KCEA 1OAZA 3DKSA 3D22A 20GSA 2CX4A 2GZZA 3UMAA 5GSSA 1GL8A 1T00A 3CRUA 2O8VB 2FA4A 4MMMA 2H0IA 3TKSA 1YEPA 4AGSA 4DSSB 1K0MA 5A4VA 5A4UA 5GSTA 2VLUA 2TIRA 1PD21 3GA4A 2IMFA 4ZB8A 4MJCA 5ECSA 5CYYA 1GTUA 5H5QA 2ALBA 1O8WA 1V58A 2DJJA 4F9ZA 2MMNA 3FYGA 2J23A 3BOAA 2E2MA 2C3TA 4O7HA 2JZTA 4J2FA 1RK4A 5ELGA 5CO3A 3S9FA 4JZQA 1Z6MA 1UN2A 4PX1A 2X99A 3DGQA 1QXHA 3LXZA 5IPHA 4OO4A 2IFQA 2PBJA 4MA9A 3RHCA 2C4JA 2C80A 3EYTA 2G0FA 1MDIA 3CSHA 2XPDA 2RUEA 5DBQA 5DALB 3KTLA 1XFLA 3LG6A 3W6GA 2YWOA 2IFQB 1GLPA 2E7PA 2VCZA 5EY6A 3CYNA 5INYA 2LJAA 4KA0A 5IOXA 3TJGA 1TTZA 2CVKA 3IK9A 4F03A 4IJIA 2WGRA 3KMOA 2K9FA 3PR8A 4OCFA 2IIYA 3K8NA 3HJPA 4O5QA 2JZSA 3LYKA 2WS2A 5IMAA 3QD9A 2N5AA 4MZCA 1GSFA 3CTGA 4ZBAA 1SL1B 3HKRA 4Z7XA 7GSSA 2KHPA 2V32A 3LW9A 1GTAA 2VCXA 3HZ8A 4Z2UA 4RI7A 3A5WA 4HEA2 1YZXA 3HDCA 1R5PA 1EWXA 2RUFA 1T3BA 3UOMA 3FMWA 3V1WA 1ABAA 1T4ZA 2J9HA 4LA1A 3LQ7A 3G7IA 2PVQA 4MJAA 1PL1A 2PGTA 1SKRB 3O6TA 5DVBA 5IMDA 5IIZA 1Q4JA 4K1FA 3WD6A 2X8CA 1JZRA 5JWRB 2H76A 2IMEA 5IO0A 2ZNMA 4V1Ap 4NV5A 1GSEA 4IJ3A 4A5PA 3D21A 4OWYA 4JR6A 1DUGA 1J08A 1SK1A 1SKWB 1JLVA 1G7OA 1K3OA 2HT9A 3FZ4A 2YCDA 1A0FA 5ECQB 1A0RP 2JACA 2LJKA 4TR4A 1EP8A 4D73A 1O7UA 3IDVA 2GGTA 3HVXA 3U6VA 3VLNA 3Q74A 3GSSA 5ID2B 5DCGA 4HZ2A 5FHIA 4TRXA 4DVCA 2WB9A 4FYCA 2F8AA 2YWNA 3EMPA 4D73B 2N5BA 4NHWA 4QQ7A 2PN8A 1G6YA 1G6WA 3GH6A 6GSSA 1QGVA 18GSA 4BWQA 2CVDA 1K0AA 1AW9A 4KGIA 5KOXA 1HD2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EIO A;  3EVI A;  11GS A;  1SYX A;  4MK3 A;  1XW5 A;  1TU8 A;  5ECR B;  2JAD A;  4TW5 A;  3IAM 2;  4GXZ A;  2GZY A;  3F8U A;  3F4T A;  3H79 A;  3KZQ A;  2IMI A;  4FIW A;  1SD8 A;  5ELA A;  3GKN A;  3A2X A;  5LCZ A;  4HZ4 A;  1U88 A;  1KTE A;  5B7C A;  3ZRD A;  3TRQ A;  4HS1 A;  2AUV A;  3FR9 A;  2CQ9 A;  3L4N A;  2OE1 A;  4RUV A;  1YDK A;  1FW1 A;  3UJ1 A;  1U6T A;  3UAP A;  4WBJ A;  4XS1 A;  1N8J A;  5ECL B;  3FZA A;  4JR4 A;  5IM9 A;  4TR1 B;  4IQ1 A;  5HFK A;  3F4S A;  2FNO A;  4GST A;  1I9D A;  3Q18 A;  3UVH A;  1SYR A;  3DIE A;  3F9U A;  5IO2 A;  4KH7 A;  2XBI A;  4TVE A;  1KBN A;  4NAX A;  1LBK A;  1M7T A;  2DIZ A;  1I5G A;  2LQO A;  3HXS A;  3M9J A;  1A23 A;  2H74 A;  1IYI A;  1OVN A;  1FB6 A;  2R37 A;  3DVX A;  4WF5 A;  1TI3 A;  3VPQ A;  1AUC A;  3RHB A;  4IHU A;  3LWA A;  5ECO B;  1G7E A;  4HU7 A;  1WE0 A;  4BPY A;  4F0B A;  3FK8 A;  2EC4 A;  1YKC A;  4GF0 A;  1CQG A;  4IBP A;  1K0B A;  1YQ1 A;  2IMD A;  1F9M A;  3ME8 A;  1GP1 A;  4ID0 A;  5D9X A;  1V2A A;  4ZBB A;  1BQ7 A;  1N2A A;  3C73 A;  2WCI A;  2FWG A;  2WRT A;  3IPZ A;  2AB6 A;  4MCU A;  4JRR A;  2HSY A;  3RDW A;  2LKU A;  3Q6O A;  2B1K A;  3HCZ A;  1V57 A;  4ZL8 A;  2L5O A;  2H1G A;  1J9B A;  5B6M A;  4K7I A;  3TDG A;  1K3Y A;  6GSU A;  1TI1 A;  2RM5 A;  2HYX A;  3VWX A;  1F3B A;  2I1U A;  1U3A A;  4ECI A;  2JSY A;  1UC7 A;  4I8B A;  3H93 A;  3GHA A;  5ECK B;  1RQM A;  4K9Z A;  4WEY A;  2CZ2 A;  2GQL A;  2PPT A;  4KSO A;  1JZO A;  1BAY A;  3FW2 A;  3E9J B;  1Z5Y E;  5J5N A;  5H5S A;  1B48 A;  2VCV A;  2V2G A;  2OKA A;  1A24 A;  1O6J A;  3JCM L;  2R3X A;  2RII A;  4O5R A;  2KP2 A;  2MBS A;  1YF1 A;  2P31 A;  2B7J A;  3GYK A;  4FYU A;  2B3S A;  4KND A;  4DSR A;  2B7K A;  10GS A;  4PUF C;  1K3L A;  2DBC A;  4G9H A;  4XRD A;  1EV9 A;  1TRU A;  2X64 A;  4JE1 A;  4GRF A;  2FLS A;  3EMX A;  3QPM A;  2L5L A;  2C0F A;  3RBT A;  3ZIJ A;  1EEJ A;  3GN3 A;  3G7J A;  5F0G A;  1TRS A;  5CRG A;  3A3T A;  4ZL7 A;  3VPT A;  2VOC A;  3O76 A;  5G1K A;  4X43 A;  4ML6 A;  2B5Y A;  3TUE A;  3TKQ A;  3ZL5 A;  1SJI A;  1PX6 A;  2LQQ A;  2GDR A;  3WT2 A;  3SWL A;  1TRV A;  5E59 A;  5HFG A;  3I6A A;  1ZZY A;  2L59 A;  2F8F A;  3RPN A;  4RQX A;  2VCT A;  1YF0 A;  3TKS C;  1JFU A;  1R26 A;  1FVK A;  2FWF A;  2HNL A;  1XWB A;  2VM1 A;  3KCM A;  1AXD A;  2C0G A;  3VI5 A;  3IK7 A;  4ISD A;  1GH2 A;  5J9B A;  4LMV A;  1IYH A;  1JHB A;  1A8L A;  2LUS A;  1HQO A;  2X8G A;  2LEG A;  3L78 A;  4DSS A;  2GT5 A;  2DLX A;  1XVW A;  1TP9 A;  3ERF A;  5F8B A;  4MPF A;  4L8E A;  4KUN A;  4ZL9 A;  4PGT A;  3QAV A;  3TRX A;  5KEJ A;  3N9J A;  1F2E A;  1ERU A;  1EP7 A;  4MLY A;  3EC3 A;  1AAZ A;  1M2A A;  2LNS A;  5H5R A;  3UL3 A;  2I9H A;  9GSS A;  5D9T A;  2YWM A;  3GKK A;  2X8H A;  4NXI A;  2ZUP A;  1S3C A;  1XBS A;  3HYP A;  5A4W A;  1ZL9 A;  5J3R A;  4WBR D;  4OMV A;  2V6O A;  1FB0 A;  3LYP A;  1YY7 A;  2BJX A;  4WKW A;  4YQV A;  2PVO C;  2P0G A;  5EPF A;  1QK8 A;  1VF3 A;  3WGD A;  2M80 A;  2TRX A;  4HQZ A;  1X5C A;  2M46 A;  3SBC A;  4ECB A;  4WF4 A;  2PER A;  1BX9 A;  5DAL A;  4POL A;  5GAN D;  4NHZ A;  1GSD A;  1FAA A;  4GSS A;  1XWG A;  4CHS A;  1DSB A;  2FGX A;  1GTB A;  1B9X C;  5ECI B;  3PIN A;  4ECJ A;  1KNG A;  4Q5Q A;  1GSU A;  1NHO A;  2IN3 A;  5J9C A;  2GSQ A;  3MNG A;  1MEK A;  4MP4 A;  4XTS A;  5D93 A;  4K7N A;  4K0G A;  2DIY A;  4ZBD A;  1X5E A;  1X0R A;  3GFK A;  4EE0 A;  5B8B A;  1ON4 A;  5B8A A;  3KEB A;  1YKA A;  5AIS A;  1R5A A;  4V1A g;  3VK9 A;  1PX7 A;  1A2M A;  3PH9 A;  3ZVJ D;  4V2L A;  4KDX A;  2G2Q A;  4ZB9 A;  4HI7 A;  3GX8 A;  1URM A;  1UVZ A;  12GS A;  1WIK A;  5CRE A;  2OE0 A;  3N5O A;  2L6C A;  4I6X A;  2YOI A;  3MWH A;  4YQU A;  3ZLP A;  1SJZ A;  3MDK A;  4I2U A;  3IXR A;  1MDJ A;  3QAG A;  4EC0 A;  3IHQ A;  3KH7 A;  3NIV A;  2KUC A;  5AIV A;  4KCA A;  2VL2 A;  3TOT A;  3M1G A;  1VGL A;  1Z9H A;  4XS6 A;  3KP9 A;  5ENU A;  4KAE A;  1NW2 A;  3M0F A;  4IKH A;  1WRY A;  3APS A;  2GQK A;  4F82 A;  2NVL A;  3J7Y k;  5ECM B;  1WPI A;  1O81 A;  2EIQ A;  2TRC P;  2NDO A;  3CMI A;  2GSS A;  3QCP A;  5DAK A;  3IR4 A;  4POK A;  5EVO A;  2FHE A;  6GSW A;  2H6X A;  4IEL A;  2MMZ A;  3W8S A;  5HQP A;  3TKR A;  3P2A A;  4OFT A;  3VI7 A;  1GSS A;  5EL8 A;  1UA5 A;  3NZN A;  5DAK B;  5HR0 A;  5ID2 A;  4MZB A;  1ST9 A;  1FO5 A;  5JWQ B;  2H1D A;  2QC7 A;  1BYE A;  3EIN A;  4ULX A;  1O73 A;  1TJD A;  2PWJ A;  2H66 A;  1AC1 A;  3H1N A;  1QUW A;  4Q5F A;  5ECP B;  2VL9 A;  3TJF A;  1E2Y A;  3ERW A;  3VUR A;  5DCH A;  4XS4 B;  2MYG A;  3MAK A;  2KLX A;  2VO4 A;  3WT1 A;  4LLR A;  1VF1 A;  2Z9S A;  4F0C A;  5DJM A;  3CSI A;  1GTI A;  2B5E A;  1WJK A;  3ED3 A;  4H86 A;  2EIR A;  4MF5 A;  2OJL A;  2IWT A;  4HJ2 A;  2L4C A;  4QL7 A;  5IPG A;  4XIH A;  3C8E A;  4TXO A;  4G10 A;  2JL4 A;  1WMJ A;  2BMX A;  3FRC A;  3MSZ A;  3P90 A;  1O8X A;  2O7K A;  2GT6 A;  3GIX A;  2OBK A;  1Z7P A;  4TR1 A;  4X0X A;  4TXV A;  1SJ6 A;  2FY6 A;  4TXO B;  2A2S A;  5DQS A;  2HZE A;  2VUP A;  3GV1 A;  2VCQ A;  3ERG A;  3TKS E;  2XPE A;  3IV4 A;  1M2B A;  1XWA A;  4BVX A;  4K6X A;  2PU9 C;  2V6K A;  2HZE B;  5C04 A;  22GS A;  1M9B A;  1QFN A;  3TJJ A;  4GQF A;  3IE3 A;  5KN1 A;  3M9K A;  4HOJ A;  4MAB A;  1KEB A;  3LGC A;  2CT6 A;  1TXX A;  2P5Q A;  1EGR A;  4PNF A;  5F05 A;  2YZU A;  2NPB A;  3ZZX A;  4NV2 A;  4MJE A;  3GRX A;  4GTU A;  4ML1 A;  1PSQ A;  5G5F A;  4EKZ A;  1XCC A;  2H72 A;  1XWK A;  1DE2 A;  4E8E A;  5IMZ A;  2FA8 A;  1HNB A;  4LL1 B;  2V41 A;  3US3 A;  1EZK A;  4ZB6 A;  2OAD A;  5D73 A;  1PRX A;  4KDU A;  4MF6 A;  1Q98 A;  4ZXG A;  4MF7 A;  1S3A A;  1ZMA A;  5FWG A;  3ZIV A;  1VRS D;  1YJ6 A;  3CSJ A;  1TOF A;  3F3R A;  1OE8 A;  2YAN A;  3KIJ A;  1EOG A;  1WOU A;  3D4T A;  5IQY A;  2M72 A;  4YAV A;  3ZYW A;  2DJ0 A;  3I43 A;  1OC3 A;  2YPM A;  3UBK A;  1TDI A;  3BBY A;  4PQ1 A;  1DE1 A;  2B1L A;  2H8L A;  2O87 A;  3HZ4 A;  1FOV A;  5DJL A;  2GVP A;  2F9S A;  1S3D A;  4GLT A;  2VAF A;  1Z7R A;  5AGY A;  2R5G A;  1MTC A;  2GZP A;  1K0N A;  3L9V A;  1SKS B;  2QKE A;  1BJX A;  1PA3 A;  1TRW A;  4XHM A;  3ZMK A;  2MZC A;  1GUK A;  4V2N A;  2CZ3 A;  1NSW A;  6GSV A;  2OBI A;  2GTU A;  4V2M A;  3I9V 2;  2H6Y A;  3CXG A;  4EUY A;  5ECN B;  4Q5R A;  4HDE A;  2L57 A;  1F6M C;  2N5F A;  4IVF A;  4TR0 A;  5FT3 A;  3GH9 A;  1OKD A;  4BVY A;  2LV3 A;  4MPG A;  2CV4 A;  4K8M A;  4N11 A;  3C71 A;  4GCI A;  4Q5N A;  3QR6 A;  3W8J A;  1K0D A;  3ME7 A;  3DRN A;  5A5K A;  2WZ9 A;  2LRN A;  1WP0 A;  1A8Y A;  3P7X A;  4KX4 A;  5HR1 A;  2P5R A;  1T4Y A;  2H1A A;  2XBQ A;  4IP1 A;  1VF4 A;  1ACV A;  1MDK A;  1V9W A;  1EGO A;  1T1V A;  1OKT A;  2PMT A;  1QMV A;  3CBU A;  4L0W A;  3FKF A;  4MJB A;  4G2E A;  3OR5 A;  2LNT A;  3RAZ A;  3M8N A;  3DWV A;  1GNE A;  3HA9 A;  3HY2 A;  2WFC A;  5B6N A;  4PUA A;  2FCH A;  5GZZ B;  2C0E A;  4BL7 A;  14GS A;  3CRT A;  3KD0 A;  4OFN A;  2KP1 A;  1O85 A;  5KN2 A;  2ZCT A;  2K18 A;  4X1U A;  2HFD A;  4TN8 A;  4L5O A;  2WDU A;  2GSR A;  2B6M A;  1PQN A;  2F3M A;  2R4V A;  3UVT A;  3QOU A;  2RM6 A;  4IS0 A;  5CRW A;  2WJU A;  3DVW A;  1TU7 A;  3GKX A;  2ON7 A;  1USB A;  1Y25 A;  2XHF A;  2V1M A;  3F0I A;  1PKW A;  1GUM A;  4OFM A;  1ML6 A;  5CAX A;  2I4A A;  5CRH A;  2VL3 A;  6GSX A;  1XZO A;  1AQW A;  1XXU A;  1JZD A;  2C0D A;  1PKZ A;  3F63 A;  4L5L A;  1OC8 A;  2CAI A;  4TOP A;  4MH3 A;  5D9V A;  3TCO A;  3IA1 A;  1JLW A;  3C1R A;  1XW6 A;  5D9W A;  5G2Z A;  4KDY A;  5HR3 A;  4EDY A;  3M3M A;  2JU5 A;  3H4K A;  1HNA A;  2REM A;  3HD5 A;  4JBB A;  1GUH A;  2FWE A;  1ZCP A;  5ABR A;  3GTU A;  3WGE A;  3EWL A;  2H0G A;  8GSS A;  1X9S B;  5DQY A;  3QAW A;  1DBY A;  1XOA A;  2OAC A;  3TGZ A;  3DXB A;  2AJQ B;  4IP6 A;  4BWS A;  3ZIT A;  1MD4 A;  4OO5 A;  4IGJ A;  2DML A;  3GTU B;  1TW9 A;  4ZIJ A;  1B8X A;  5CP1 A;  3VWV A;  3HVV A;  4KW6 A;  3D4M A;  3APO A;  4EDZ A;  4MDC A;  4NMU A;  4EF0 A;  2H70 A;  2H71 A;  2NBS A;  4PUR A;  4WXT A;  4LMW A;  3KH9 A;  3C7M A;  4TR3 A;  3Q19 A;  3QFA C;  2XC2 A;  2YZH A;  2AYT A;  13GS A;  2VL2 C;  1T8E B;  3IBH A;  4K7O A;  4OD7 A;  3VWU A;  3KP8 A;  4AJ6 A;  1GLQ A;  2MBT A;  1X9M B;  4N0Z A;  4HQS A;  4AJ8 A;  2DSA A;  2IJY A;  3IRA A;  4J57 E;  4POB A;  4EXJ A;  2QGV A;  1PN9 A;  4YQM A;  4KE3 A;  2K6V A;  4PQH A;  2K8V A;  5CRD A;  2DMM A;  1W4V A;  1OYJ A;  3APQ A;  6GST A;  1E6B A;  3R2Q A;  2CA8 A;  2LRC A;  4KSM A;  2E2G A;  3LSZ A;  3UAR A;  1NM3 A;  1H4O A;  5E4W A;  4ACS A;  2H01 A;  3ZVJ A;  1JZW A;  2HI7 A;  4PNG A;  3I69 A;  3HVS A;  3PGT A;  3QDN A;  3UIW A;  2OA7 A;  4IQA A;  2CX3 A;  2IPA A;  1AQV A;  1T7P B;  3GKM A;  2GQM A;  2ON5 A;  1K0C A;  2R6K A;  2AV4 A;  3F6D A;  1XVQ A;  1X9W B;  4GWR A;  4O32 A;  2H19 A;  1M0U A;  5JCU A;  5ECH B;  1PGT A;  2YJH A;  1MD3 A;  3DML A;  5DDL A;  1ERV A;  5J4U A;  5G31 A;  5JCW A;  4IW9 A;  2VLV A;  3BJ5 A;  1XIY A;  5F07 A;  4PXO A;  1Z6N A;  2HZF A;  3ZTL A;  2YP6 A;  4LL4 B;  2H75 A;  3G9B A;  4OCE A;  4XS4 A;  1CQH A;  4WR5 A;  3D0Z A;  2DJ2 A;  1Z3E A;  2CVB A;  4XCS A;  4RI6 A;  1QQ2 A;  2GST A;  3GMF A;  3UEM A;  3KTB A;  1TK8 B;  1V98 A;  3C1S A;  1PL2 A;  2DJ3 A;  2WUL A;  5G5E A;  1B4P A;  3ZFB A;  4WET A;  1LU4 A;  4BA7 A;  4POM A;  1OE7 A;  4DSQ A;  1A2L A;  3FZ9 A;  3GUS A;  1GSY A;  4N30 A;  4O92 A;  1R4W A;  2VD0 A;  1XWC A;  2HSH A;  5KN0 A;  1FVJ A;  3IC4 A;  2VIM A;  1H75 A;  3H8Q A;  4JED A;  3DYR A;  3KJY A;  2A4V A;  2A2R A;  3L9U A;  2K8S A;  1V40 A;  4NPB A;  1ZYQ B;  4FH8 A;  4CW9 A;  1VF2 A;  3DEX A;  2YN1 A;  3NOF A;  1SL0 B;  2FD3 A;  1THX A;  3TKP A;  2JZR A;  3U5R E;  3FR3 A;  1BG5 A;  2I3Y A;  1ZOF A;  3BCK A;  3O3T A;  3RPP A;  4XRA A;  4YAP A;  2YNX A;  3WYW A;  4QL9 A;  4N10 A;  1HNC A;  2HE3 A;  3WGX A;  2GLR A;  2FUG 2;  2LTK A;  2HRF A;  2LRT A;  1GSQ A;  4MH2 A;  1B9Y C;  5JCG A;  2OE3 A;  3TJB A;  1FHE A;  5GAP D;  5D8I A;  1G0T A;  2VLT A;  1B4Q A;  3QFB C;  4FYB A;  2JSZ A;  1XPV A;  3D6I A;  3FY7 A;  3KMN A;  4FO5 A;  1SEN A;  2F51 A;  1M99 A;  4G19 A;  2LJR A;  3EUR A;  4AF2 A;  5G30 A;  2GS3 A;  2ES7 A;  4HUA A;  5KN3 A;  3GL3 A;  1ERT A;  1GWC A;  6GSY A;  4L0U A;  1GNW A;  4P3Y B;  4PQI A;  3E0U A;  4HJM A;  3KGK A;  4K2D A;  3KM6 A;  4AJ7 A;  1F37 A;  1NHY A;  1RW1 A;  4MZW A;  3GX0 A;  2C3Q A;  1W89 A;  3VWW A;  2C8U A;  3KXO A;  3ZML A;  3ZFL A;  2VCW A;  2I81 A;  4WR4 A;  3A2W A;  4GQC A;  2DJK A;  1X5D A;  3IOS A;  2DC5 A;  2MMA A;  1SK2 A;  3F4R A;  4EL1 A;  3FEU A;  1SU9 A;  2QSI A;  2O89 A;  1U3I A;  3ZRE A;  5CNW A;  1LJR A;  1PMT A;  2PUK C;  2R2J A;  4I2T A;  3TOU A;  3TRP A;  4ZIL A;  2L6D A;  1U87 A;  3LJR A;  3LOR A;  1ZYE A;  1J0F A;  3UBL A;  2VM2 A;  1SD9 A;  1EOH A;  3FZ5 A;  2DJ1 A;  1XW9 A;  2AAW A;  2D2Z A;  2H6Z A;  3BCI A;  1K0O A;  4TKY A;  2IL3 A;  4EO3 A;  2YJ7 A;  5C00 A;  2KOK A;  3EU4 A;  3G7Y A;  5L71 A;  2LS5 A;  1SL2 B;  2YV9 A;  3LXT A;  2C3N A;  1XOB A;  16GS A;  3EE2 A;  4I97 A;  1ILO A;  2H1B A;  1TK5 B;  2H0H A;  3GNJ A;  5AIX A;  3J7Y b;  1YEX A;  3HJO A;  3GUR A;  4K0N A;  4I5Q A;  1HYU A;  4RQR A;  4F2I A;  5AN1 A;  1SK0 A;  5G1L A;  2YWI A;  3EU3 A;  4ILF A;  2H73 A;  5COH A;  1BED A;  1F3A A;  2YV7 A;  3QMX A;  1C72 A;  2NTO A;  3F6F A;  3VFI A;  1TKD B;  1AQX A;  5LD0 A;  5IMF A;  1ERW A;  3GST A;  4CDO A;  4J56 E;  3HJM A;  3L9S A;  3FR6 A;  2O85 A;  1AIU A;  4IN0 A;  3IAS 2;  4JU5 A;  2HLS A;  2HRN A;  3P8W A;  3F3Q A;  1R7H A;  2CAQ A;  4ECC A;  5IOW A;  1EEM A;  1A2J A;  5F06 A;  5IMC A;  3FHK A;  1M2D A;  4YH2 A;  1TK0 B;  2LST A;  2L4Q A;  2MMO A;  2FWH A;  3A2V A;  5HFI A;  2HXK A;  4GSN A;  1EV4 A;  3TB2 A;  4DEJ A;  1Y6E A;  5LNK e;  3E3E A;  2AHE A;  2H30 A;  2C1Y A;  4KB3 A;  1OC9 A;  3L0H A;  19GS A;  1GRX A;  1GUL A;  4HU9 A;  5D96 A;  3DD3 A;  3TJK A;  4E8H A;  5IMV A;  5HR2 A;  3ISO A;  5J41 A;  3CTF A;  2BTO T;  4NWY A;  17GS A;  3D5J A;  3BD2 A;  2RLI A;  1OC9 B;  3AY8 A;  4EVM A;  1M9A A;  3GL5 A;  1ZGN A;  2B5X A;  3LEF A;  1THO A;  2VD1 A;  2IMK A;  3HHV A;  4N0V A;  2E0Q A;  1FG4 A;  5JWO B;  1WWJ A;  3LFL A;  4KCE A;  1OAZ A;  3DKS A;  3D22 A;  20GS A;  2CX4 A;  2GZZ A;  3UMA A;  5GSS A;  1GL8 A;  1T00 A;  3CRU A;  2O8V B;  2FA4 A;  4MMM A;  2H0I A;  3TKS A;  1YEP A;  4AGS A;  4DSS B;  1K0M A;  5A4V A;  5A4U A;  5GST A;  2VLU A;  2TIR A;  1PD2 1;  3GA4 A;  2IMF A;  4ZB8 A;  4MJC A;  5ECS A;  5CYY A;  1GTU A;  5H5Q A;  2ALB A;  1O8W A;  1V58 A;  2DJJ A;  4F9Z A;  2MMN A;  3FYG A;  2J23 A;  3BOA A;  2E2M A;  2C3T A;  4O7H A;  2JZT A;  4J2F A;  1RK4 A;  5ELG A;  5CO3 A;  3S9F A;  4JZQ A;  1Z6M A;  1UN2 A;  4PX1 A;  2X99 A;  3DGQ A;  1QXH A;  3LXZ A;  5IPH A;  4OO4 A;  2IFQ A;  2PBJ A;  4MA9 A;  3RHC A;  2C4J A;  2C80 A;  3EYT A;  2G0F A;  1MDI A;  3CSH A;  2XPD A;  2RUE A;  5DBQ A;  5DAL B;  3KTL A;  1XFL A;  3LG6 A;  3W6G A;  2YWO A;  2IFQ B;  1GLP A;  2E7P A;  2VCZ A;  5EY6 A;  3CYN A;  5INY A;  2LJA A;  4KA0 A;  5IOX A;  3TJG A;  1TTZ A;  2CVK A;  3IK9 A;  4F03 A;  4IJI A;  2WGR A;  3KMO A;  2K9F A;  3PR8 A;  4OCF A;  2IIY A;  3K8N A;  3HJP A;  2JZS A;  3LYK A;  2WS2 A;  5IMA A;  3QD9 A;  2N5A A;  4MZC A;  1GSF A;  3CTG A;  4ZBA A;  1SL1 B;  3HKR A;  4Z7X A;  7GSS A;  2KHP A;  2V32 A;  1GTA A;  2VCX A;  3HZ8 A;  4RI7 A;  3A5W A;  4HEA 2;  1YZX A;  3HDC A;  1R5P A;  1EWX A;  2RUF A;  1T3B A;  3UOM A;  3V1W A;  1ABA A;  1T4Z A;  2J9H A;  4LA1 A;  3LQ7 A;  3G7I A;  2PVQ A;  4MJA A;  1PL1 A;  2PGT A;  1SKR B;  3O6T A;  5DVB A;  5IMD A;  5IIZ A;  1Q4J A;  4K1F A;  3WD6 A;  2X8C A;  1JZR A;  5JWR B;  2H76 A;  2IME A;  5IO0 A;  2ZNM A;  4V1A p;  4NV5 A;  1GSE A;  4IJ3 A;  3D21 A;  4OWY A;  4JR6 A;  1DUG A;  1J08 A;  1SK1 A;  1SKW B;  1JLV A;  1G7O A;  1K3O A;  2HT9 A;  3FZ4 A;  2YCD A;  1A0F A;  5ECQ B;  1A0R P;  2JAC A;  2LJK A;  4TR4 A;  1EP8 A;  4D73 A;  1O7U A;  3IDV A;  2GGT A;  3HVX A;  3U6V A;  3VLN A;  3Q74 A;  3GSS A;  5ID2 B;  5DCG A;  4HZ2 A;  5FHI A;  4TRX A;  4DVC A;  2WB9 A;  4FYC A;  2F8A A;  2YWN A;  3EMP A;  4D73 B;  2N5B A;  4NHW A;  4QQ7 A;  2PN8 A;  1G6Y A;  1G6W A;  3GH6 A;  6GSS A;  1QGV A;  18GS A;  4BWQ A;  2CVD A;  1K0A A;  1AW9 A;  4KGI A;  1HD2 A; 
#chains in the Genus database with same CATH topology
 2EIO A;  3EVI A;  11GS A;  1SYX A;  1ZYN A;  4MK3 A;  1XW5 A;  2X4A A;  1TU8 A;  5ECR B;  2JAD A;  4TW5 A;  3IAM 2;  4GXZ A;  1S3R A;  2GZY A;  3F8U A;  3F4T A;  3H79 A;  3KZQ A;  2IMI A;  4FIW A;  1SD8 A;  5ELA A;  3GKN A;  3A2X A;  5LCZ A;  4HZ4 A;  1U88 A;  1KTE A;  5B7C A;  3ZRD A;  3TRQ A;  4HS1 A;  2AUV A;  3FR9 A;  2CQ9 A;  3L4N A;  2OE1 A;  4RUV A;  1YDK A;  1FW1 A;  3UJ1 A;  1U6T A;  3UAP A;  4WBJ A;  4XS1 A;  1N8J A;  2QA2 A;  5ECL B;  3FZA A;  4JR4 A;  5IM9 A;  4TR1 B;  2X49 A;  4IQ1 A;  5HFK A;  3F4S A;  2FNO A;  4GST A;  1I9D A;  3Q18 A;  3UVH A;  1SYR A;  3DIE A;  3F9U A;  5IO2 A;  4KH7 A;  2XBI A;  4TVE A;  1KBN A;  4NAX A;  1LBK A;  1M7T A;  2DIZ A;  2DKI A;  1I5G A;  2LQO A;  3HXS A;  4CY6 A;  3M9J A;  2HRA A;  1A23 A;  2H74 A;  1IYI A;  1OVN A;  4G0I A;  1M3I A;  1FB6 A;  2R37 A;  3DVX A;  4WF5 A;  1TI3 A;  4BVX B;  3VPQ A;  1AUC A;  3RHB A;  4IHU A;  3LWA A;  5ECO B;  1G7E A;  4HU7 A;  1WE0 A;  4BPY A;  4F0B A;  3FK8 A;  2EC4 A;  1YKC A;  4GF0 A;  1CQG A;  4IBP A;  2HRK A;  1K0B A;  1YQ1 A;  2IMD A;  1F9M A;  3ME8 A;  1GP1 A;  4ID0 A;  5D9X A;  1V2A A;  4ZBB A;  1BQ7 A;  1N2A A;  3C73 A;  2WCI A;  2FWG A;  2WRT A;  3IPZ A;  2AB6 A;  4MCU A;  4JRR A;  2HSY A;  3RDW A;  2LKU A;  3Q6O A;  3R3E A;  2B1K A;  3HCZ A;  1V57 A;  4ZL8 A;  2L5O A;  2H1G A;  1J9B A;  3MIX A;  5B6M A;  4YKF A;  4K7I A;  3TDG A;  1K3Y A;  6GSU A;  1TI1 A;  2RM5 A;  2HYX A;  3VWX A;  1F3B A;  2I1U A;  1U3A A;  4ECI A;  2JSY A;  1UC7 A;  4I8B A;  3H93 A;  3GHA A;  5ECK B;  1RQM A;  4K9Z A;  4WEY A;  2CZ2 A;  2GQL A;  2PPT A;  4KSO A;  1JZO A;  1BAY A;  3FW2 A;  3E9J B;  1Z5Y E;  5J5N A;  5H5S A;  1B48 A;  2VCV A;  2V2G A;  2OKA A;  1A24 A;  1O6J A;  3JCM L;  2R3X A;  2RII A;  4O5R A;  2KP2 A;  2MBS A;  1YF1 A;  1ZYP A;  2P31 A;  2B7J A;  3GYK A;  4FYU A;  2B3S A;  4KND A;  4DSR A;  2B7K A;  2A4H A;  10GS A;  4PUF C;  1K3L A;  2DBC A;  4G9H A;  4XRD A;  1EV9 A;  1TRU A;  2X64 A;  4JE1 A;  4GRF A;  2FLS A;  3EMX A;  3QPM A;  2L5L A;  2C0F A;  3IC8 A;  3RBT A;  3ZIJ A;  1EEJ A;  3GN3 A;  3G7J A;  2UZ8 A;  5F0G A;  1TRS A;  5CRG A;  3A3T A;  4ZL7 A;  3VPT A;  2VOC A;  3O76 A;  5G1K A;  4X43 A;  4ML6 A;  2B5Y A;  3TUE A;  3TKQ A;  3ZL5 A;  1SJI A;  1PX6 A;  2LQQ A;  2GDR A;  3WT2 A;  3SWL A;  1TRV A;  5E59 A;  5HFG A;  3I6A A;  1ZZY A;  2L59 A;  2F8F A;  3RPN A;  4RQX A;  2VCT A;  1YF0 A;  3TKS C;  1JFU A;  1R26 A;  1FVK A;  2FWF A;  2HNL A;  1XWB A;  2VM1 A;  3KCM A;  1AXD A;  2C0G A;  4BL7 B;  3VI5 A;  3IK7 A;  4ISD A;  1GH2 A;  5J9B A;  4LMV A;  1IYH A;  1JHB A;  1A8L A;  2LUS A;  1HQO A;  2X8G A;  2LEG A;  3L78 A;  4DSS A;  2GT5 A;  2DLX A;  2QA1 A;  1XVW A;  1TP9 A;  3ERF A;  5F8B A;  4MPF A;  4L8E A;  4KUN A;  4X4J A;  4ZL9 A;  4PGT A;  3QAV A;  3TRX A;  5KEJ A;  3N9J A;  4G0L A;  1F2E A;  1ERU A;  1EP7 A;  4EIQ A;  2DKH A;  4MLY A;  3EC3 A;  1AAZ A;  1M2A A;  2LNS A;  5H5R A;  3UL3 A;  2I9H A;  9GSS A;  5D9T A;  2YWM A;  3GKK A;  2X8H A;  4NXI A;  2ZUP A;  1S3C A;  1XBS A;  3HYP A;  5A4W A;  1ZL9 A;  5J3R A;  4WBR D;  4OMV A;  2V6O A;  1FB0 A;  3LYP A;  1YY7 A;  2BJX A;  4WKW A;  4YQV A;  2PVO C;  2P0G A;  5EPF A;  1QK8 A;  1VF3 A;  3WGD A;  2M80 A;  2TRX A;  4HQZ A;  1X5C A;  2M46 A;  3SBC A;  4ECB A;  4WF4 A;  2PER A;  1BX9 A;  5DAL A;  4POL A;  5GAN D;  4NHZ A;  1GSD A;  1FAA A;  4GSS A;  1XWG A;  4CHS A;  1DSB A;  2FGX A;  1GTB A;  1B9X C;  5ECI B;  3PIN A;  4ECJ A;  1KNG A;  4Q5Q A;  1GSU A;  1NHO A;  2IN3 A;  5J9C A;  2GSQ A;  3MNG A;  1MEK A;  4MP4 A;  4XTS A;  5D93 A;  4K7N A;  4K0G A;  2DIY A;  4ZBD A;  1X5E A;  1X0R A;  3GFK A;  4EE0 A;  5B8B A;  1ON4 A;  3MYD A;  5B8A A;  3KEB A;  1YKA A;  5AIS A;  1R5A A;  4V1A g;  3VK9 A;  1PX7 A;  1A2M A;  3PH9 A;  3ZVJ D;  4V2L A;  4KDX A;  2G2Q A;  4KF9 A;  4ZB9 A;  4HI7 A;  3GX8 A;  1URM A;  1UVZ A;  12GS A;  1WIK A;  5CRE A;  2R0G A;  2OE0 A;  3N5O A;  2L6C A;  4I6X A;  2YOI A;  3MWH A;  4YQU A;  3ZLP A;  1SJZ A;  3MDK A;  4I2U A;  3IXR A;  1MDJ A;  3QAG A;  4EC0 A;  3IHQ A;  3KH7 A;  3NIV A;  2KUC A;  5AIV A;  4KCA A;  2VL2 A;  3TOT A;  3M1G A;  1VGL A;  1Z9H A;  4XS6 A;  3KP9 A;  5ENU A;  4KAE A;  1NW2 A;  3M0F A;  4IKH A;  1WRY A;  3APS A;  2GQK A;  4F82 A;  2NVL A;  3J7Y k;  5ECM B;  1WPI A;  1O81 A;  2EIQ A;  2TRC P;  2NDO A;  3CMI A;  2GSS A;  3QCP A;  5DAK A;  3IR4 A;  4POK A;  5EVO A;  2FHE A;  6GSW A;  2H6X A;  4IEL A;  2MMZ A;  3W8S A;  4G0K A;  5HQP A;  3TKR A;  3P2A A;  4OFT A;  3VI7 A;  1GSS A;  5EL8 A;  1UA5 A;  3NZN A;  5DAK B;  5HR0 A;  5ID2 A;  4MZB A;  1ST9 A;  1FO5 A;  5JWQ B;  2H1D A;  2QC7 A;  1BYE A;  3EIN A;  4ULX A;  1O73 A;  1TJD A;  4O5U A;  2PWJ A;  2H66 A;  1AC1 A;  3H1N A;  1QUW A;  4Q5F A;  5ECP B;  2VL9 A;  3TJF A;  1E2Y A;  4MNN A;  3ERW A;  3VUR A;  5DCH A;  4XS4 B;  2MYG A;  3MAK A;  2KLX A;  2VO4 A;  3WT1 A;  4LLR A;  1VF1 A;  2Z9S A;  4F0C A;  5DJM A;  3CSI A;  1GTI A;  2B5E A;  1WJK A;  3ED3 A;  4H86 A;  2EIR A;  1FOH A;  4MF5 A;  2OJL A;  2IWT A;  4HJ2 A;  2L4C A;  4QL7 A;  5IPG A;  4XIH A;  3C8E A;  4TXO A;  4G10 A;  2JL4 A;  1WMJ A;  2BMX A;  3FRC A;  3MSZ A;  3P90 A;  1O8X A;  2O7K A;  2GT6 A;  3GIX A;  4Z2T A;  2OBK A;  1Z7P A;  4TR1 A;  4X0X A;  4TXV A;  1SJ6 A;  2FY6 A;  4TXO B;  2A2S A;  5DQS A;  2HZE A;  2VUP A;  3GV1 A;  2VCQ A;  3ERG A;  3TKS E;  2XPE A;  3IV4 A;  1M2B A;  1XWA A;  4BVX A;  4K6X A;  2PU9 C;  2V6K A;  2HZE B;  5C04 A;  22GS A;  1M9B A;  1QFN A;  3TJJ A;  4GQF A;  3IE3 A;  5KN1 A;  3M9K A;  4HOJ A;  4MAB A;  1KEB A;  3LGC A;  4YKG A;  2CT6 A;  1TXX A;  2P5Q A;  1EGR A;  4PNF A;  5F05 A;  2YZU A;  2NPB A;  3ZZX A;  4NV2 A;  4MJE A;  3GRX A;  4GTU A;  4ML1 A;  1PSQ A;  5G5F A;  4EKZ A;  1XCC A;  2H72 A;  1PN0 A;  1XWK A;  1DE2 A;  4E8E A;  5IMZ A;  2FA8 A;  1HNB A;  4LL1 B;  2V41 A;  3US3 A;  1EZK A;  4ZB6 A;  2OAD A;  5D73 A;  1PRX A;  4KDU A;  3A5I A;  4MF6 A;  1Q98 A;  4ZXG A;  4MF7 A;  1S3A A;  4ICY A;  1ZMA A;  5FWG A;  3ZIV A;  1VRS D;  1YJ6 A;  3CSJ A;  1TOF A;  3F3R A;  1OE8 A;  2YAN A;  3KIJ A;  1EOG A;  1WOU A;  3D4T A;  5IQY A;  2M72 A;  4YAV A;  3ZYW A;  2DJ0 A;  1XG8 A;  3I43 A;  1OC3 A;  2YPM A;  3UBK A;  1TDI A;  3BBY A;  4PQ1 A;  1DE1 A;  2B1L A;  2H8L A;  2O87 A;  4HSC X;  3HZ4 A;  4EIP A;  1FOV A;  5DJL A;  2GVP A;  2F9S A;  1S3D A;  4GLT A;  2VAF A;  1Z7R A;  5AGY A;  2R5G A;  1MTC A;  2GZP A;  1K0N A;  3L9V A;  1SKS B;  2QKE A;  1BJX A;  1PA3 A;  1TRW A;  4XHM A;  3ZMK A;  2MZC A;  1GUK A;  4V2N A;  2CZ3 A;  1NSW A;  6GSV A;  2OBI A;  2GTU A;  4V2M A;  3I9V 2;  2H6Y A;  3CXG A;  4EUY A;  5ECN B;  4Q5R A;  4HDE A;  2L57 A;  1F6M C;  2N5F A;  4IVF A;  4TR0 A;  5FT3 A;  3GH9 A;  1OKD A;  4BVY A;  2LV3 A;  4MPG A;  2CV4 A;  4K8M A;  4N11 A;  3C71 A;  4GCI A;  3CQF A;  4Q5N A;  2R0P A;  3QR6 A;  3W8J A;  1K0D A;  3ME7 A;  3DRN A;  5A5K A;  2WZ9 A;  2LRN A;  1WP0 A;  1A8Y A;  3P7X A;  4KX4 A;  5HR1 A;  2P5R A;  4BVY B;  1T4Y A;  2H1A A;  2XBQ A;  4IP1 A;  1VF4 A;  1ACV A;  1MDK A;  1V9W A;  1EGO A;  1T1V A;  1OKT A;  2PMT A;  1QMV A;  3CBU A;  4L0W A;  3FKF A;  4MJB A;  4G2E A;  3OR5 A;  2LNT A;  3RAZ A;  3M8N A;  3DWV A;  1GNE A;  3HA9 A;  3HY2 A;  2WFC A;  5B6N A;  4PUA A;  2FCH A;  5GZZ B;  2C0E A;  4BL7 A;  14GS A;  3CRT A;  3KD0 A;  4OFN A;  2KP1 A;  1O85 A;  5KN2 A;  2ZCT A;  2K18 A;  4X1U A;  2HFD A;  4TN8 A;  4L5O A;  2WDU A;  2GSR A;  2B6M A;  1PQN A;  2F3M A;  2R4V A;  3UVT A;  3QOU A;  2RM6 A;  4IS0 A;  5CRW A;  2WJU A;  3DVW A;  1TU7 A;  3GKX A;  2ON7 A;  1USB A;  1Y25 A;  2XHF A;  2V1M A;  3F0I A;  3HVN A;  1PKW A;  1GUM A;  4OFM A;  1ML6 A;  5CAX A;  2I4A A;  5CRH A;  2VL3 A;  6GSX A;  1XZO A;  1AQW A;  1XXU A;  1JZD A;  2C0D A;  1PKZ A;  3F63 A;  4L5L A;  1OC8 A;  2CAI A;  4TOP A;  4MH3 A;  5KOW A;  5D9V A;  3TCO A;  3IA1 A;  1JLW A;  3C1R A;  1XW6 A;  5D9W A;  5G2Z A;  4KDY A;  5HR3 A;  4EDY A;  3M3M A;  2JU5 A;  3H4K A;  1HNA A;  2REM A;  3HD5 A;  4JBB A;  1GUH A;  2FWE A;  1ZCP A;  5ABR A;  3GTU A;  3WGE A;  3EWL A;  2H0G A;  8GSS A;  1X9S B;  5DQY A;  3QAW A;  1DBY A;  1XOA A;  2OAC A;  3TGZ A;  3DXB A;  2AJQ B;  4IP6 A;  4BWS A;  3ZIT A;  1MD4 A;  4OO5 A;  4IGJ A;  2DML A;  3GTU B;  1TW9 A;  4ZIJ A;  1B8X A;  5CP1 A;  4CY8 A;  4K2X A;  3VWV A;  3HVV A;  4KW6 A;  3D4M A;  3APO A;  4EDZ A;  4MDC A;  4NMU A;  4EF0 A;  2H70 A;  2H71 A;  2NBS A;  4PUR A;  4WXT A;  4LMW A;  3KH9 A;  3C7M A;  4TR3 A;  3Q19 A;  3QFA C;  2XC2 A;  2YZH A;  2AYT A;  13GS A;  2VL2 C;  1T8E B;  3IBH A;  4K7O A;  4OD7 A;  3VWU A;  3KP8 A;  4AJ6 A;  1GLQ A;  2MBT A;  1X9M B;  4N0Z A;  5BRT A;  4HQS A;  4AJ8 A;  1M3J A;  2DSA A;  2IJY A;  3IRA A;  4J57 E;  4POB A;  4EXJ A;  2QGV A;  1PN9 A;  4YQM A;  4KE3 A;  2K6V A;  4PQH A;  2K8V A;  5CRD A;  2DMM A;  1W4V A;  1OYJ A;  3APQ A;  6GST A;  1E6B A;  3R2Q A;  2CA8 A;  2LRC A;  4KSM A;  2E2G A;  3LSZ A;  3UAR A;  1NM3 A;  3PPU A;  1H4O A;  5E4W A;  4ACS A;  2H01 A;  3ZVJ A;  1JZW A;  2HI7 A;  4PNG A;  3I69 A;  3HVS A;  3PGT A;  3QDN A;  3UIW A;  2OA7 A;  4IQA A;  5BMU A;  2CX3 A;  2IPA A;  1AQV A;  2A2P A;  1T7P B;  3GKM A;  2GQM A;  2ON5 A;  1K0C A;  2R6K A;  2AV4 A;  3F6D A;  1XVQ A;  1X9W B;  4GWR A;  4O32 A;  2H19 A;  1M0U A;  5JCU A;  5ECH B;  1PGT A;  2YJH A;  1MD3 A;  3DML A;  5DDL A;  1ERV A;  5J4U A;  5G31 A;  5JCW A;  4IW9 A;  2VLV A;  3BJ5 A;  1XIY A;  5F07 A;  4PXO A;  1Z6N A;  2HZF A;  3ZTL A;  2YP6 A;  4LL4 B;  2H75 A;  3G9B A;  4OCE A;  4XS4 A;  1CQH A;  4WR5 A;  3D0Z A;  2DJ2 A;  1Z3E A;  2CVB A;  4XCS A;  4RI6 A;  1QQ2 A;  2GST A;  3GMF A;  3UEM A;  3KTB A;  1TK8 B;  1V98 A;  3C1S A;  1PL2 A;  2DJ3 A;  2WUL A;  5G5E A;  1B4P A;  3ZFB A;  4WET A;  1LU4 A;  4BA7 A;  2R0C A;  4POM A;  1OE7 A;  4DSQ A;  1A2L A;  3FZ9 A;  3GUS A;  1GSY A;  4N30 A;  4O92 A;  1R4W A;  2VD0 A;  1XWC A;  2HSH A;  5KN0 A;  1FVJ A;  4K5S A;  3IC4 A;  2VIM A;  1H75 A;  3H8Q A;  4JED A;  3DYR A;  3KJY A;  2A4V A;  2A2R A;  3L9U A;  2K8S A;  1V40 A;  4NPB A;  1ZYQ B;  4FH8 A;  4CW9 A;  1VF2 A;  3DEX A;  2YN1 A;  3NOF A;  1SL0 B;  2FD3 A;  1THX A;  3TKP A;  2JZR A;  3U5R E;  3FR3 A;  1BG5 A;  2I3Y A;  1ZOF A;  3BCK A;  3O3T A;  3RPP A;  4XRA A;  4YAP A;  2YNX A;  3WYW A;  4QL9 A;  4N10 A;  1HNC A;  2HE3 A;  3WGX A;  2GLR A;  2FUG 2;  2LTK A;  2HRF A;  2LRT A;  1GSQ A;  4MH2 A;  1B9Y C;  5JCG A;  2OE3 A;  3TJB A;  1FHE A;  5GAP D;  5D8I A;  1G0T A;  2VLT A;  1B4Q A;  3QFB C;  4FYB A;  2JSZ A;  1XPV A;  3D6I A;  3FY7 A;  3KMN A;  4FO5 A;  1SEN A;  2F51 A;  1M99 A;  4G19 A;  2LJR A;  3EUR A;  4AF2 A;  5G30 A;  2GS3 A;  4USS A;  2ES7 A;  4HUA A;  5KN3 A;  3GL3 A;  1ERT A;  1GWC A;  6GSY A;  4L0U A;  1GNW A;  4P3Y B;  4PQI A;  3E0U A;  4HJM A;  3KGK A;  4K2D A;  3KM6 A;  4AJ7 A;  1F37 A;  1NHY A;  1RW1 A;  4MZW A;  3GX0 A;  2C3Q A;  1W89 A;  3VWW A;  2C8U A;  3KXO A;  3ZML A;  3ZFL A;  2VCW A;  2I81 A;  4WR4 A;  4K5R A;  3A2W A;  4GQC A;  2DJK A;  1X5D A;  3IOS A;  2DC5 A;  2MMA A;  1SK2 A;  3F4R A;  4EL1 A;  3FEU A;  1SU9 A;  2QSI A;  2O89 A;  1U3I A;  3ZRE A;  5CNW A;  1LJR A;  1PMT A;  2PUK C;  2R2J A;  4I2T A;  3TOU A;  3TRP A;  4ZIL A;  2L6D A;  1U87 A;  3LJR A;  3LOR A;  1ZYE A;  1J0F A;  3UBL A;  2VM2 A;  1SD9 A;  1EOH A;  3FZ5 A;  2DJ1 A;  1XW9 A;  2AAW A;  2D2Z A;  2H6Z A;  3BCI A;  1K0O A;  4TKY A;  2IL3 A;  4EO3 A;  2YJ7 A;  5C00 A;  2KOK A;  3EU4 A;  3G7Y A;  5L71 A;  2LS5 A;  3EPT A;  1SL2 B;  2YV9 A;  3LXT A;  2C3N A;  1XOB A;  4PTS A;  16GS A;  3EE2 A;  4I97 A;  1ILO A;  2H1B A;  1TK5 B;  2H0H A;  3GNJ A;  5AIX A;  3J7Y b;  1YEX A;  3HJO A;  3GUR A;  4K0N A;  4I5Q A;  1HYU A;  4RQR A;  4F2I A;  5AN1 A;  1SK0 A;  5G1L A;  2YWI A;  3EU3 A;  4ILF A;  2H73 A;  5COH A;  1BED A;  1F3A A;  2YV7 A;  3QMX A;  1C72 A;  2NTO A;  3F6F A;  3VFI A;  1TKD B;  1AQX A;  5LD0 A;  5IMF A;  1ERW A;  3GST A;  4CDO A;  4J56 E;  3HJM A;  3L9S A;  3FR6 A;  2O85 A;  1AIU A;  4IN0 A;  3IAS 2;  4JU5 A;  2HLS A;  2HRN A;  3P8W A;  3F3Q A;  1R7H A;  2CAQ A;  4ECC A;  5IOW A;  1EEM A;  1A2J A;  5F06 A;  5IMC A;  3FHK A;  1M2D A;  4YH2 A;  1TK0 B;  2LST A;  2L4Q A;  4FQU A;  2MMO A;  2FWH A;  3A2V A;  5HFI A;  2HXK A;  4GSN A;  1EV4 A;  3TB2 A;  4DEJ A;  1Y6E A;  5LNK e;  3E3E A;  2AHE A;  2H30 A;  2C1Y A;  4KB3 A;  1OC9 A;  4Z2R A;  3L0H A;  19GS A;  1GRX A;  1GUL A;  4HU9 A;  5D96 A;  3DD3 A;  3TJK A;  4E8H A;  5IMV A;  5HR2 A;  3ISO A;  5J41 A;  3CTF A;  2BTO T;  4NWY A;  17GS A;  3D5J A;  3BD2 A;  2RLI A;  1OC9 B;  3AY8 A;  4EVM A;  1M9A A;  3GL5 A;  1ZGN A;  2B5X A;  3LEF A;  1THO A;  2VD1 A;  2IMK A;  3HHV A;  4N0V A;  2E0Q A;  1FG4 A;  2HSM A;  5JWO B;  1WWJ A;  3IHG A;  3LFL A;  4KCE A;  1OAZ A;  3DKS A;  3D22 A;  20GS A;  2CX4 A;  2GZZ A;  3UMA A;  5GSS A;  1GL8 A;  1T00 A;  3CRU A;  2O8V B;  2FA4 A;  4MMM A;  2H0I A;  3TKS A;  1YEP A;  4AGS A;  4DSS B;  1K0M A;  5A4V A;  5A4U A;  5GST A;  2VLU A;  2TIR A;  1PD2 1;  3GA4 A;  2IMF A;  4ZB8 A;  4MJC A;  5ECS A;  5CYY A;  1GTU A;  5H5Q A;  2ALB A;  1O8W A;  1V58 A;  2DJJ A;  4F9Z A;  2MMN A;  3FYG A;  2J23 A;  4BIK A;  3BOA A;  2E2M A;  2C3T A;  4O7H A;  2JZT A;  4J2F A;  1RK4 A;  5ELG A;  5CO3 A;  3S9F A;  4JZQ A;  1Z6M A;  1UN2 A;  4PX1 A;  2X99 A;  3DGQ A;  1QXH A;  3LXZ A;  5IPH A;  4OO4 A;  2IFQ A;  2PBJ A;  4MA9 A;  3RHC A;  2C4J A;  2C80 A;  3EYT A;  2G0F A;  1MDI A;  3CSH A;  2XPD A;  2RUE A;  5DBQ A;  5DAL B;  3KTL A;  1XFL A;  3LG6 A;  3W6G A;  2YWO A;  2IFQ B;  1GLP A;  2E7P A;  2VCZ A;  5EY6 A;  3CYN A;  5INY A;  2LJA A;  4KA0 A;  5IOX A;  3TJG A;  1TTZ A;  2CVK A;  3IK9 A;  4F03 A;  4IJI A;  2WGR A;  3KMO A;  2K9F A;  3PR8 A;  4OCF A;  2IIY A;  3K8N A;  3HJP A;  4O5Q A;  2JZS A;  3LYK A;  1PFO A;  2WS2 A;  5IMA A;  3QD9 A;  2N5A A;  4MZC A;  1GSF A;  3CTG A;  4ZBA A;  1SL1 B;  3HKR A;  4Z7X A;  7GSS A;  2KHP A;  2V32 A;  3LW9 A;  1GTA A;  2VCX A;  3HZ8 A;  4Z2U A;  4RI7 A;  3A5W A;  4HEA 2;  1YZX A;  3HDC A;  1R5P A;  1EWX A;  2RUF A;  1T3B A;  3UOM A;  3FMW A;  3V1W A;  1ABA A;  1T4Z A;  2J9H A;  4LA1 A;  3LQ7 A;  3G7I A;  2PVQ A;  4MJA A;  1PL1 A;  2PGT A;  1SKR B;  3O6T A;  5DVB A;  5IMD A;  5IIZ A;  1Q4J A;  4K1F A;  3WD6 A;  2X8C A;  1JZR A;  5JWR B;  2H76 A;  2IME A;  5IO0 A;  2ZNM A;  4V1A p;  4NV5 A;  1GSE A;  4IJ3 A;  4A5P A;  3D21 A;  4OWY A;  4JR6 A;  1DUG A;  1J08 A;  1SK1 A;  1SKW B;  1JLV A;  1G7O A;  1K3O A;  2HT9 A;  3FZ4 A;  2YCD A;  1A0F A;  5ECQ B;  1A0R P;  2JAC A;  2LJK A;  4TR4 A;  1EP8 A;  4D73 A;  1O7U A;  3IDV A;  2GGT A;  3HVX A;  3U6V A;  3VLN A;  3Q74 A;  3GSS A;  5ID2 B;  5DCG A;  4HZ2 A;  5FHI A;  4TRX A;  4DVC A;  2WB9 A;  4FYC A;  2F8A A;  2YWN A;  3EMP A;  4D73 B;  2N5B A;  4NHW A;  4QQ7 A;  2PN8 A;  1G6Y A;  1G6W A;  3GH6 A;  6GSS A;  1QGV A;  18GS A;  4BWQ A;  2CVD A;  1K0A A;  1AW9 A;  4KGI A;  5KOX A;  1HD2 A; 
#chains in the Genus database with same CATH homology
 2EIO A;  3EVI A;  11GS A;  1SYX A;  1ZYN A;  4MK3 A;  1XW5 A;  2X4A A;  1TU8 A;  5ECR B;  2JAD A;  4TW5 A;  3IAM 2;  4GXZ A;  2GZY A;  3F8U A;  3F4T A;  3H79 A;  3KZQ A;  2IMI A;  4FIW A;  1SD8 A;  5ELA A;  3GKN A;  3A2X A;  5LCZ A;  4HZ4 A;  1U88 A;  1KTE A;  5B7C A;  3ZRD A;  3TRQ A;  4HS1 A;  2AUV A;  3FR9 A;  2CQ9 A;  3L4N A;  2OE1 A;  4RUV A;  1YDK A;  1FW1 A;  3UJ1 A;  1U6T A;  3UAP A;  4WBJ A;  4XS1 A;  1N8J A;  2QA2 A;  5ECL B;  3FZA A;  4JR4 A;  5IM9 A;  4TR1 B;  2X49 A;  4IQ1 A;  5HFK A;  3F4S A;  2FNO A;  4GST A;  1I9D A;  3Q18 A;  3UVH A;  1SYR A;  3DIE A;  3F9U A;  5IO2 A;  4KH7 A;  2XBI A;  4TVE A;  1KBN A;  4NAX A;  1LBK A;  1M7T A;  2DIZ A;  2DKI A;  1I5G A;  2LQO A;  3HXS A;  4CY6 A;  3M9J A;  2HRA A;  1A23 A;  2H74 A;  1IYI A;  1OVN A;  4G0I A;  1FB6 A;  2R37 A;  3DVX A;  4WF5 A;  1TI3 A;  4BVX B;  3VPQ A;  1AUC A;  3RHB A;  4IHU A;  3LWA A;  5ECO B;  1G7E A;  4HU7 A;  1WE0 A;  4BPY A;  4F0B A;  3FK8 A;  2EC4 A;  1YKC A;  4GF0 A;  1CQG A;  4IBP A;  2HRK A;  1K0B A;  1YQ1 A;  2IMD A;  1F9M A;  3ME8 A;  1GP1 A;  4ID0 A;  5D9X A;  1V2A A;  4ZBB A;  1BQ7 A;  1N2A A;  3C73 A;  2WCI A;  2FWG A;  2WRT A;  3IPZ A;  2AB6 A;  4MCU A;  4JRR A;  2HSY A;  3RDW A;  2LKU A;  3Q6O A;  3R3E A;  2B1K A;  3HCZ A;  1V57 A;  4ZL8 A;  2L5O A;  2H1G A;  1J9B A;  3MIX A;  5B6M A;  4YKF A;  4K7I A;  3TDG A;  1K3Y A;  6GSU A;  1TI1 A;  2RM5 A;  2HYX A;  3VWX A;  1F3B A;  2I1U A;  1U3A A;  4ECI A;  2JSY A;  1UC7 A;  4I8B A;  3H93 A;  3GHA A;  5ECK B;  1RQM A;  4K9Z A;  4WEY A;  2CZ2 A;  2GQL A;  2PPT A;  4KSO A;  1JZO A;  1BAY A;  3FW2 A;  3E9J B;  1Z5Y E;  5J5N A;  5H5S A;  1B48 A;  2VCV A;  2V2G A;  2OKA A;  1A24 A;  1O6J A;  3JCM L;  2R3X A;  2RII A;  4O5R A;  2KP2 A;  2MBS A;  1YF1 A;  1ZYP A;  2P31 A;  2B7J A;  3GYK A;  4FYU A;  2B3S A;  4KND A;  4DSR A;  2B7K A;  2A4H A;  10GS A;  4PUF C;  1K3L A;  2DBC A;  4G9H A;  4XRD A;  1EV9 A;  1TRU A;  2X64 A;  4JE1 A;  4GRF A;  2FLS A;  3EMX A;  3QPM A;  2L5L A;  2C0F A;  3IC8 A;  3RBT A;  3ZIJ A;  1EEJ A;  3GN3 A;  3G7J A;  2UZ8 A;  5F0G A;  1TRS A;  5CRG A;  3A3T A;  4ZL7 A;  3VPT A;  2VOC A;  3O76 A;  5G1K A;  4X43 A;  4ML6 A;  2B5Y A;  3TUE A;  3TKQ A;  3ZL5 A;  1SJI A;  1PX6 A;  2LQQ A;  2GDR A;  3WT2 A;  3SWL A;  1TRV A;  5E59 A;  5HFG A;  3I6A A;  1ZZY A;  2L59 A;  2F8F A;  3RPN A;  4RQX A;  2VCT A;  1YF0 A;  3TKS C;  1JFU A;  1R26 A;  1FVK A;  2FWF A;  2HNL A;  1XWB A;  2VM1 A;  3KCM A;  1AXD A;  2C0G A;  4BL7 B;  3VI5 A;  3IK7 A;  4ISD A;  1GH2 A;  5J9B A;  4LMV A;  1IYH A;  1JHB A;  1A8L A;  2LUS A;  1HQO A;  2X8G A;  2LEG A;  3L78 A;  4DSS A;  2GT5 A;  2DLX A;  2QA1 A;  1XVW A;  1TP9 A;  3ERF A;  5F8B A;  4MPF A;  4L8E A;  4KUN A;  4X4J A;  4ZL9 A;  4PGT A;  3QAV A;  3TRX A;  5KEJ A;  3N9J A;  4G0L A;  1F2E A;  1ERU A;  1EP7 A;  4EIQ A;  2DKH A;  4MLY A;  3EC3 A;  1AAZ A;  1M2A A;  2LNS A;  5H5R A;  3UL3 A;  2I9H A;  9GSS A;  5D9T A;  2YWM A;  3GKK A;  2X8H A;  4NXI A;  2ZUP A;  1S3C A;  1XBS A;  3HYP A;  5A4W A;  1ZL9 A;  5J3R A;  4WBR D;  4OMV A;  2V6O A;  1FB0 A;  3LYP A;  1YY7 A;  2BJX A;  4WKW A;  4YQV A;  2PVO C;  2P0G A;  5EPF A;  1QK8 A;  1VF3 A;  3WGD A;  2M80 A;  2TRX A;  4HQZ A;  1X5C A;  2M46 A;  3SBC A;  4ECB A;  4WF4 A;  2PER A;  1BX9 A;  5DAL A;  4POL A;  5GAN D;  4NHZ A;  1GSD A;  1FAA A;  4GSS A;  1XWG A;  4CHS A;  1DSB A;  2FGX A;  1GTB A;  1B9X C;  5ECI B;  3PIN A;  4ECJ A;  1KNG A;  4Q5Q A;  1GSU A;  1NHO A;  2IN3 A;  5J9C A;  2GSQ A;  3MNG A;  1MEK A;  4MP4 A;  4XTS A;  5D93 A;  4K7N A;  4K0G A;  2DIY A;  4ZBD A;  1X5E A;  1X0R A;  3GFK A;  4EE0 A;  5B8B A;  1ON4 A;  3MYD A;  5B8A A;  3KEB A;  1YKA A;  5AIS A;  1R5A A;  4V1A g;  3VK9 A;  1PX7 A;  1A2M A;  3PH9 A;  3ZVJ D;  4V2L A;  4KDX A;  2G2Q A;  4KF9 A;  4ZB9 A;  4HI7 A;  3GX8 A;  1URM A;  1UVZ A;  12GS A;  1WIK A;  5CRE A;  2R0G A;  2OE0 A;  3N5O A;  2L6C A;  4I6X A;  2YOI A;  3MWH A;  4YQU A;  3ZLP A;  1SJZ A;  3MDK A;  4I2U A;  3IXR A;  1MDJ A;  3QAG A;  4EC0 A;  3IHQ A;  3KH7 A;  3NIV A;  2KUC A;  5AIV A;  4KCA A;  2VL2 A;  3TOT A;  3M1G A;  1VGL A;  1Z9H A;  4XS6 A;  3KP9 A;  5ENU A;  4KAE A;  1NW2 A;  3M0F A;  4IKH A;  1WRY A;  3APS A;  2GQK A;  4F82 A;  2NVL A;  3J7Y k;  5ECM B;  1WPI A;  1O81 A;  2EIQ A;  2TRC P;  2NDO A;  3CMI A;  2GSS A;  3QCP A;  5DAK A;  3IR4 A;  4POK A;  5EVO A;  2FHE A;  6GSW A;  2H6X A;  4IEL A;  2MMZ A;  3W8S A;  4G0K A;  5HQP A;  3TKR A;  3P2A A;  4OFT A;  3VI7 A;  1GSS A;  5EL8 A;  1UA5 A;  3NZN A;  5DAK B;  5HR0 A;  5ID2 A;  4MZB A;  1ST9 A;  1FO5 A;  5JWQ B;  2H1D A;  2QC7 A;  1BYE A;  3EIN A;  4ULX A;  1O73 A;  1TJD A;  4O5U A;  2PWJ A;  2H66 A;  1AC1 A;  3H1N A;  1QUW A;  4Q5F A;  5ECP B;  2VL9 A;  3TJF A;  1E2Y A;  4MNN A;  3ERW A;  3VUR A;  5DCH A;  4XS4 B;  2MYG A;  3MAK A;  2KLX A;  2VO4 A;  3WT1 A;  4LLR A;  1VF1 A;  2Z9S A;  4F0C A;  5DJM A;  3CSI A;  1GTI A;  2B5E A;  1WJK A;  3ED3 A;  4H86 A;  2EIR A;  1FOH A;  4MF5 A;  2OJL A;  2IWT A;  4HJ2 A;  2L4C A;  4QL7 A;  5IPG A;  4XIH A;  3C8E A;  4TXO A;  4G10 A;  2JL4 A;  1WMJ A;  2BMX A;  3FRC A;  3MSZ A;  3P90 A;  1O8X A;  2O7K A;  2GT6 A;  3GIX A;  4Z2T A;  2OBK A;  1Z7P A;  4TR1 A;  4X0X A;  4TXV A;  1SJ6 A;  2FY6 A;  4TXO B;  2A2S A;  5DQS A;  2HZE A;  2VUP A;  3GV1 A;  2VCQ A;  3ERG A;  3TKS E;  2XPE A;  3IV4 A;  1M2B A;  1XWA A;  4BVX A;  4K6X A;  2PU9 C;  2V6K A;  2HZE B;  5C04 A;  22GS A;  1M9B A;  1QFN A;  3TJJ A;  4GQF A;  3IE3 A;  5KN1 A;  3M9K A;  4HOJ A;  4MAB A;  1KEB A;  3LGC A;  4YKG A;  2CT6 A;  1TXX A;  2P5Q A;  1EGR A;  4PNF A;  5F05 A;  2YZU A;  2NPB A;  3ZZX A;  4NV2 A;  4MJE A;  3GRX A;  4GTU A;  4ML1 A;  1PSQ A;  5G5F A;  4EKZ A;  1XCC A;  2H72 A;  1PN0 A;  1XWK A;  1DE2 A;  4E8E A;  5IMZ A;  2FA8 A;  1HNB A;  4LL1 B;  2V41 A;  3US3 A;  1EZK A;  4ZB6 A;  2OAD A;  5D73 A;  1PRX A;  4KDU A;  3A5I A;  4MF6 A;  1Q98 A;  4ZXG A;  4MF7 A;  1S3A A;  4ICY A;  1ZMA A;  5FWG A;  3ZIV A;  1VRS D;  1YJ6 A;  3CSJ A;  1TOF A;  3F3R A;  1OE8 A;  2YAN A;  3KIJ A;  1EOG A;  1WOU A;  3D4T A;  5IQY A;  2M72 A;  4YAV A;  3ZYW A;  2DJ0 A;  3I43 A;  1OC3 A;  2YPM A;  3UBK A;  1TDI A;  3BBY A;  4PQ1 A;  1DE1 A;  2B1L A;  2H8L A;  2O87 A;  3HZ4 A;  4EIP A;  1FOV A;  5DJL A;  2GVP A;  2F9S A;  1S3D A;  4GLT A;  2VAF A;  1Z7R A;  5AGY A;  2R5G A;  1MTC A;  2GZP A;  1K0N A;  3L9V A;  1SKS B;  2QKE A;  1BJX A;  1PA3 A;  1TRW A;  4XHM A;  3ZMK A;  2MZC A;  1GUK A;  4V2N A;  2CZ3 A;  1NSW A;  6GSV A;  2OBI A;  2GTU A;  4V2M A;  3I9V 2;  2H6Y A;  3CXG A;  4EUY A;  5ECN B;  4Q5R A;  4HDE A;  2L57 A;  1F6M C;  2N5F A;  4IVF A;  4TR0 A;  5FT3 A;  3GH9 A;  1OKD A;  4BVY A;  2LV3 A;  4MPG A;  2CV4 A;  4K8M A;  4N11 A;  3C71 A;  4GCI A;  4Q5N A;  2R0P A;  3QR6 A;  3W8J A;  1K0D A;  3ME7 A;  3DRN A;  5A5K A;  2WZ9 A;  2LRN A;  1WP0 A;  1A8Y A;  3P7X A;  4KX4 A;  5HR1 A;  2P5R A;  4BVY B;  1T4Y A;  2H1A A;  2XBQ A;  4IP1 A;  1VF4 A;  1ACV A;  1MDK A;  1V9W A;  1EGO A;  1T1V A;  1OKT A;  2PMT A;  1QMV A;  3CBU A;  4L0W A;  3FKF A;  4MJB A;  4G2E A;  3OR5 A;  2LNT A;  3RAZ A;  3M8N A;  3DWV A;  1GNE A;  3HA9 A;  3HY2 A;  2WFC A;  5B6N A;  4PUA A;  2FCH A;  5GZZ B;  2C0E A;  4BL7 A;  14GS A;  3CRT A;  3KD0 A;  4OFN A;  2KP1 A;  1O85 A;  5KN2 A;  2ZCT A;  2K18 A;  4X1U A;  2HFD A;  4TN8 A;  4L5O A;  2WDU A;  2GSR A;  2B6M A;  1PQN A;  2F3M A;  2R4V A;  3UVT A;  3QOU A;  2RM6 A;  4IS0 A;  5CRW A;  2WJU A;  3DVW A;  1TU7 A;  3GKX A;  2ON7 A;  1USB A;  1Y25 A;  2XHF A;  2V1M A;  3F0I A;  1PKW A;  1GUM A;  4OFM A;  1ML6 A;  5CAX A;  2I4A A;  5CRH A;  2VL3 A;  6GSX A;  1XZO A;  1AQW A;  1XXU A;  1JZD A;  2C0D A;  1PKZ A;  3F63 A;  4L5L A;  1OC8 A;  2CAI A;  4TOP A;  4MH3 A;  5KOW A;  5D9V A;  3TCO A;  3IA1 A;  1JLW A;  3C1R A;  1XW6 A;  5D9W A;  5G2Z A;  4KDY A;  5HR3 A;  4EDY A;  3M3M A;  2JU5 A;  3H4K A;  1HNA A;  2REM A;  3HD5 A;  4JBB A;  1GUH A;  2FWE A;  1ZCP A;  5ABR A;  3GTU A;  3WGE A;  3EWL A;  2H0G A;  8GSS A;  1X9S B;  5DQY A;  3QAW A;  1DBY A;  1XOA A;  2OAC A;  3TGZ A;  3DXB A;  2AJQ B;  4IP6 A;  4BWS A;  3ZIT A;  1MD4 A;  4OO5 A;  4IGJ A;  2DML A;  3GTU B;  1TW9 A;  4ZIJ A;  1B8X A;  5CP1 A;  4CY8 A;  4K2X A;  3VWV A;  3HVV A;  4KW6 A;  3D4M A;  3APO A;  4EDZ A;  4MDC A;  4NMU A;  4EF0 A;  2H70 A;  2H71 A;  2NBS A;  4PUR A;  4WXT A;  4LMW A;  3KH9 A;  3C7M A;  4TR3 A;  3Q19 A;  3QFA C;  2XC2 A;  2YZH A;  2AYT A;  13GS A;  2VL2 C;  1T8E B;  3IBH A;  4K7O A;  4OD7 A;  3VWU A;  3KP8 A;  4AJ6 A;  1GLQ A;  2MBT A;  1X9M B;  4N0Z A;  5BRT A;  4HQS A;  4AJ8 A;  2DSA A;  2IJY A;  3IRA A;  4J57 E;  4POB A;  4EXJ A;  2QGV A;  1PN9 A;  4YQM A;  4KE3 A;  2K6V A;  4PQH A;  2K8V A;  5CRD A;  2DMM A;  1W4V A;  1OYJ A;  3APQ A;  6GST A;  1E6B A;  3R2Q A;  2CA8 A;  2LRC A;  4KSM A;  2E2G A;  3LSZ A;  3UAR A;  1NM3 A;  3PPU A;  1H4O A;  5E4W A;  4ACS A;  2H01 A;  3ZVJ A;  1JZW A;  2HI7 A;  4PNG A;  3I69 A;  3HVS A;  3PGT A;  3QDN A;  3UIW A;  2OA7 A;  4IQA A;  5BMU A;  2CX3 A;  2IPA A;  1AQV A;  2A2P A;  1T7P B;  3GKM A;  2GQM A;  2ON5 A;  1K0C A;  2R6K A;  2AV4 A;  3F6D A;  1XVQ A;  1X9W B;  4GWR A;  4O32 A;  2H19 A;  1M0U A;  5JCU A;  5ECH B;  1PGT A;  2YJH A;  1MD3 A;  3DML A;  5DDL A;  1ERV A;  5J4U A;  5G31 A;  5JCW A;  4IW9 A;  2VLV A;  3BJ5 A;  1XIY A;  5F07 A;  4PXO A;  1Z6N A;  2HZF A;  3ZTL A;  2YP6 A;  4LL4 B;  2H75 A;  3G9B A;  4OCE A;  4XS4 A;  1CQH A;  4WR5 A;  3D0Z A;  2DJ2 A;  1Z3E A;  2CVB A;  4XCS A;  4RI6 A;  1QQ2 A;  2GST A;  3GMF A;  3UEM A;  3KTB A;  1TK8 B;  1V98 A;  3C1S A;  1PL2 A;  2DJ3 A;  2WUL A;  5G5E A;  1B4P A;  3ZFB A;  4WET A;  1LU4 A;  4BA7 A;  2R0C A;  4POM A;  1OE7 A;  4DSQ A;  1A2L A;  3FZ9 A;  3GUS A;  1GSY A;  4N30 A;  4O92 A;  1R4W A;  2VD0 A;  1XWC A;  2HSH A;  5KN0 A;  1FVJ A;  4K5S A;  3IC4 A;  2VIM A;  1H75 A;  3H8Q A;  4JED A;  3DYR A;  3KJY A;  2A4V A;  2A2R A;  3L9U A;  2K8S A;  1V40 A;  4NPB A;  1ZYQ B;  4FH8 A;  4CW9 A;  1VF2 A;  3DEX A;  2YN1 A;  3NOF A;  1SL0 B;  2FD3 A;  1THX A;  3TKP A;  2JZR A;  3U5R E;  3FR3 A;  1BG5 A;  2I3Y A;  1ZOF A;  3BCK A;  3O3T A;  3RPP A;  4XRA A;  4YAP A;  2YNX A;  3WYW A;  4QL9 A;  4N10 A;  1HNC A;  2HE3 A;  3WGX A;  2GLR A;  2FUG 2;  2LTK A;  2HRF A;  2LRT A;  1GSQ A;  4MH2 A;  1B9Y C;  5JCG A;  2OE3 A;  3TJB A;  1FHE A;  5GAP D;  5D8I A;  1G0T A;  2VLT A;  1B4Q A;  3QFB C;  4FYB A;  2JSZ A;  1XPV A;  3D6I A;  3FY7 A;  3KMN A;  4FO5 A;  1SEN A;  2F51 A;  1M99 A;  4G19 A;  2LJR A;  3EUR A;  4AF2 A;  5G30 A;  2GS3 A;  4USS A;  2ES7 A;  4HUA A;  5KN3 A;  3GL3 A;  1ERT A;  1GWC A;  6GSY A;  4L0U A;  1GNW A;  4P3Y B;  4PQI A;  3E0U A;  4HJM A;  3KGK A;  4K2D A;  3KM6 A;  4AJ7 A;  1F37 A;  1NHY A;  1RW1 A;  4MZW A;  3GX0 A;  2C3Q A;  1W89 A;  3VWW A;  2C8U A;  3KXO A;  3ZML A;  3ZFL A;  2VCW A;  2I81 A;  4WR4 A;  4K5R A;  3A2W A;  4GQC A;  2DJK A;  1X5D A;  3IOS A;  2DC5 A;  2MMA A;  1SK2 A;  3F4R A;  4EL1 A;  3FEU A;  1SU9 A;  2QSI A;  2O89 A;  1U3I A;  3ZRE A;  5CNW A;  1LJR A;  1PMT A;  2PUK C;  2R2J A;  4I2T A;  3TOU A;  3TRP A;  4ZIL A;  2L6D A;  1U87 A;  3LJR A;  3LOR A;  1ZYE A;  1J0F A;  3UBL A;  2VM2 A;  1SD9 A;  1EOH A;  3FZ5 A;  2DJ1 A;  1XW9 A;  2AAW A;  2D2Z A;  2H6Z A;  3BCI A;  1K0O A;  4TKY A;  2IL3 A;  4EO3 A;  2YJ7 A;  5C00 A;  2KOK A;  3EU4 A;  3G7Y A;  5L71 A;  2LS5 A;  3EPT A;  1SL2 B;  2YV9 A;  3LXT A;  2C3N A;  1XOB A;  4PTS A;  16GS A;  3EE2 A;  4I97 A;  1ILO A;  2H1B A;  1TK5 B;  2H0H A;  3GNJ A;  5AIX A;  3J7Y b;  1YEX A;  3HJO A;  3GUR A;  4K0N A;  4I5Q A;  1HYU A;  4RQR A;  4F2I A;  5AN1 A;  1SK0 A;  5G1L A;  2YWI A;  3EU3 A;  4ILF A;  2H73 A;  5COH A;  1BED A;  1F3A A;  2YV7 A;  3QMX A;  1C72 A;  2NTO A;  3F6F A;  3VFI A;  1TKD B;  1AQX A;  5LD0 A;  5IMF A;  1ERW A;  3GST A;  4CDO A;  4J56 E;  3HJM A;  3L9S A;  3FR6 A;  2O85 A;  1AIU A;  4IN0 A;  3IAS 2;  4JU5 A;  2HLS A;  2HRN A;  3P8W A;  3F3Q A;  1R7H A;  2CAQ A;  4ECC A;  5IOW A;  1EEM A;  1A2J A;  5F06 A;  5IMC A;  3FHK A;  1M2D A;  4YH2 A;  1TK0 B;  2LST A;  2L4Q A;  4FQU A;  2MMO A;  2FWH A;  3A2V A;  5HFI A;  2HXK A;  4GSN A;  1EV4 A;  3TB2 A;  4DEJ A;  1Y6E A;  5LNK e;  3E3E A;  2AHE A;  2H30 A;  2C1Y A;  4KB3 A;  1OC9 A;  4Z2R A;  3L0H A;  19GS A;  1GRX A;  1GUL A;  4HU9 A;  5D96 A;  3DD3 A;  3TJK A;  4E8H A;  5IMV A;  5HR2 A;  3ISO A;  5J41 A;  3CTF A;  2BTO T;  4NWY A;  17GS A;  3D5J A;  3BD2 A;  2RLI A;  1OC9 B;  3AY8 A;  4EVM A;  1M9A A;  3GL5 A;  1ZGN A;  2B5X A;  3LEF A;  1THO A;  2VD1 A;  2IMK A;  3HHV A;  4N0V A;  2E0Q A;  1FG4 A;  2HSM A;  5JWO B;  1WWJ A;  3IHG A;  3LFL A;  4KCE A;  1OAZ A;  3DKS A;  3D22 A;  20GS A;  2CX4 A;  2GZZ A;  3UMA A;  5GSS A;  1GL8 A;  1T00 A;  3CRU A;  2O8V B;  2FA4 A;  4MMM A;  2H0I A;  3TKS A;  1YEP A;  4AGS A;  4DSS B;  1K0M A;  5A4V A;  5A4U A;  5GST A;  2VLU A;  2TIR A;  1PD2 1;  3GA4 A;  2IMF A;  4ZB8 A;  4MJC A;  5ECS A;  5CYY A;  1GTU A;  5H5Q A;  2ALB A;  1O8W A;  1V58 A;  2DJJ A;  4F9Z A;  2MMN A;  3FYG A;  2J23 A;  3BOA A;  2E2M A;  2C3T A;  4O7H A;  2JZT A;  4J2F A;  1RK4 A;  5ELG A;  5CO3 A;  3S9F A;  4JZQ A;  1Z6M A;  1UN2 A;  4PX1 A;  2X99 A;  3DGQ A;  1QXH A;  3LXZ A;  5IPH A;  4OO4 A;  2IFQ A;  2PBJ A;  4MA9 A;  3RHC A;  2C4J A;  2C80 A;  3EYT A;  2G0F A;  1MDI A;  3CSH A;  2XPD A;  2RUE A;  5DBQ A;  5DAL B;  3KTL A;  1XFL A;  3LG6 A;  3W6G A;  2YWO A;  2IFQ B;  1GLP A;  2E7P A;  2VCZ A;  5EY6 A;  3CYN A;  5INY A;  2LJA A;  4KA0 A;  5IOX A;  3TJG A;  1TTZ A;  2CVK A;  3IK9 A;  4F03 A;  4IJI A;  2WGR A;  3KMO A;  2K9F A;  3PR8 A;  4OCF A;  2IIY A;  3K8N A;  3HJP A;  4O5Q A;  2JZS A;  3LYK A;  2WS2 A;  5IMA A;  3QD9 A;  2N5A A;  4MZC A;  1GSF A;  3CTG A;  4ZBA A;  1SL1 B;  3HKR A;  4Z7X A;  7GSS A;  2KHP A;  2V32 A;  3LW9 A;  1GTA A;  2VCX A;  3HZ8 A;  4Z2U A;  4RI7 A;  3A5W A;  4HEA 2;  1YZX A;  3HDC A;  1R5P A;  1EWX A;  2RUF A;  1T3B A;  3UOM A;  3FMW A;  3V1W A;  1ABA A;  1T4Z A;  2J9H A;  4LA1 A;  3LQ7 A;  3G7I A;  2PVQ A;  4MJA A;  1PL1 A;  2PGT A;  1SKR B;  3O6T A;  5DVB A;  5IMD A;  5IIZ A;  1Q4J A;  4K1F A;  3WD6 A;  2X8C A;  1JZR A;  5JWR B;  2H76 A;  2IME A;  5IO0 A;  2ZNM A;  4V1A p;  4NV5 A;  1GSE A;  4IJ3 A;  4A5P A;  3D21 A;  4OWY A;  4JR6 A;  1DUG A;  1J08 A;  1SK1 A;  1SKW B;  1JLV A;  1G7O A;  1K3O A;  2HT9 A;  3FZ4 A;  2YCD A;  1A0F A;  5ECQ B;  1A0R P;  2JAC A;  2LJK A;  4TR4 A;  1EP8 A;  4D73 A;  1O7U A;  3IDV A;  2GGT A;  3HVX A;  3U6V A;  3VLN A;  3Q74 A;  3GSS A;  5ID2 B;  5DCG A;  4HZ2 A;  5FHI A;  4TRX A;  4DVC A;  2WB9 A;  4FYC A;  2F8A A;  2YWN A;  3EMP A;  4D73 B;  2N5B A;  4NHW A;  4QQ7 A;  2PN8 A;  1G6Y A;  1G6W A;  3GH6 A;  6GSS A;  1QGV A;  18GS A;  4BWQ A;  2CVD A;  1K0A A;  1AW9 A;  4KGI A;  5KOX A;  1HD2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...