2H70A

Crystal structure of thioredoxin mutant d9e in hexagonal (p61) space group
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
107
structure length
107
Chain Sequence
b'DKIIHLTEDSFDTDVLKADGAILVDFWAEWCGPCKMIAPILDEIADEYQGKLTVAKLNIDQNPGTAPKYGIRGIPTLLLFKNGEVAATKVGALSKGQLKEFLDANLA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Thioredoxin
publication title A stability pattern of protein hydrophobic mutations that reflects evolutionary structural optimization.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Electron transport
total genus 30
structure length 107
sequence length 107
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-06-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00085 Thioredoxin Thioredoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 2h70A00
4HZ2A 3R2QA 4V2LA 1E2YA 2XPEA 3GKMA 4QL7A 1JHBA 3C1SA 6GSSA 3KMOA 3TKQA 4MF7A 1XWCA 2A2RA 3HDCA 2FY6A 2VD1A 3APQA 4WR5A 3TGZA 4HS1A 1XW9A 4FYBA 1UVZA 1T3BA 4GF0A 2FD3A 2C3QA 1N2AA 1V2AA 4FIWA 4HEA2 5D9XA 3K8NA 4NV5A 4PGTA 1Z6MA 4KDYA 5G2ZA 3HVSA 3GH9A 4N0ZA 1TU8A 1TDIA 2BTOT 4GSNA 1HQOA 1EZKA 5D9VA 1YF0A 1YJ6A 4K1FA 2NPBA 5E59A 4F0BA 1GTIA 1NHYA 4MMMA 1AAZA 3GTUA 2PPTA 1Z7RA 3QMXA 1R26A 2FNOA 2GSQA 2PVQA 4TXVA 2DJJA 2HI7A 5CRHA 2IL3A 3Q6OA 2H70A 4IP6A 3RDWA 2NTOA 2VIMA 1KNGA 8GSSA 4Q5FA 2OADA 2F8AA 4IHUA 2LRNA 3I6AA 13GSA 4K7OA 4RI7A 5J9BA 5KN3A 1U87A 4ML6A 2WB9A 3ZL5A 2JZSA 4IBPA 1T4YA 4XTSA 2IJYA 3F4TA 1FB6A 3JCML 1OC3A 5JCGA 2KOKA 1FO5A 2MMOA 1TRWA 2DJ1A 3BJ5A 1TK8B 4JR6A 5GZZB 3GX8A 5KN1A 1K0CA 2H66A 4BWQA 1Z5YE 1MDKA 4J2FA 3F4SA 2ES7A 3UAPA 2M72A 2VL2A 3L4NA 3NZNA 3RHBA 1V9WA 4IN0A 5J3RA 4KUNA 1SJ6A 3GMFA 1BX9A 2C3TA 1PA3A 17GSA 4PUAA 3KP9A 5A4VA 2VCZA 2C3NA 3EU3A 2YOIA 2YWNA 3TCOA 5GAPD 4ZBBA 3GRXA 2F3MA 3G7JA 3ZMLA 3UVHA 6GSYA 5IQYA 1TTZA 2HSHA 2OACA 2OA7A 12GSA 4XRAA 2DJ2A 4MP4A 6GSWA 2YWIA 5JCUA 4BVYA 5HR3A 3TKSE 3IDVA 3GHAA 10GSA 2YN1A 4IVFA 4WBRD 1E6BA 1SD8A 3KP8A 3GURA 1EWXA 4N30A 1NW2A 4L0UA 1OE7A 2H74A 2GS3A 1M2AA 1XWAA 1ST9A 4HU9A 3DD3A 3CXGA 2RM5A 4TVEA 4V1Ag 1SKWB 4GTUA 5B6NA 1HYUA 1W4VA 3LWAA 3TJKA 4KCAA 1QFNA 3VWUA 2YNXA 2C4JA 1HNCA 2FCHA 4IJIA 2LV3A 2FWFA 2PU9C 4MZCA 1QMVA 9GSSA 3GSTA 2WDUA 4K7NA 2LKUA 11GSA 2AYTA 3DEXA 3DVXA 4K6XA 2O87A 2DJKA 2I81A 5H5RA 3F9UA 3EMPA 4IELA 2L5LA 2NBSA 4XRDA 3WYWA 2MMNA 2LNTA 3WT2A 3CSIA 2CVKA 1GP1A 3L9SA 2JSYA 3E9JB 4PNFA 3KIJA 1O81A 3TJFA 1WWJA 3D4TA 3F3RA 2JACA 5HFKA 1JZDA 1YZXA 3ZIJA 2FGXA 1FOVA 1PD21 2B5XA 1KBNA 3GKKA 4NAXA 4J57E 5ECOB 2DMMA 1AXDA 3C1RA 5CYYA 4DVCA 4CW9A 3GFKA 2R5GA 2CVDA 3M1GA 5JWRB 1A0FA 1GUHA 3HJOA 2VLTA 3TKRA 1XCCA 1SYXA 4HJMA 3VWWA 3TUEA 3DRNA 4MABA 1QQ2A 3D0ZA 4IKHA 3RAZA 4BVXA 4K7IA 6GSXA 3KEBA 4OMVA 4POBA 4DSSA 4MLYA 5CO3A 3VWXA 3HZ4A 5IO2A 2RIIA 3QFBC 1NM3A 3PR8A 3TDGA 4I97A 1QXHA 2H75A 1XFLA 3LEFA 1GULA 5JWOB 1XVWA 4NMUA 4F2IA 1FVJA 2F51A 6GSTA 1ON4A 1WPIA 3GNJA 1MEKA 2V1MA 1MDIA 1O73A 2YWOA 2GQLA 3F6DA 4L5LA 4AGSA 2GSSA 4TR3A 2Z9SA 4MDCA 1JZWA 2N5BA 3W8JA 3CBUA 1YDKA 2FLSA 4KGIA 5ECLB 5C04A 4N10A 2H01A 3FZ4A 1AQWA 3ERGA 1EOHA 3QAVA 2HZEA 4LA1A 2CV4A 1PMTA 4XCSA 5DQSA 4DSQA 2AB6A 1QK8A 3KZQA 5D93A 3ZIVA 4YAVA 2GT6A 5AGYA 2H71A 3HYPA 2OJLA 1B8XA 3SBCA 4ILFA 2WS2A 1THOA 2VCQA 4IQAA 2ON5A 1WMJA 5F8BA 1TK0B 5J41A 1ILOA 3VFIA 2P31A 5ECNB 3EINA 1GH2A 3EWLA 2CAQA 3QAGA 3LQ7A 1AIUA 2HRFA 2H72A 5CP1A 4QQ7A 4TN8A 4P3YB 4O7HA 2YZUA 2VCVA 4HUAA 5CAXA 2HZFA 3CTFA 3LFLA 4EUYA 3HKRA 1XWGA 1A23A 2QKEA 4EO3A 1SJZA 5IOWA 5KN2A 2JL4A 5EVOA 3F0IA 1K0MA 4EE0A 5D8IA 4EKZA 4EVMA 1K3YA 5C00A 2KP1A 1YKCA 18GSA 2VOCA 4I2UA 5ENUA 1VRSD 3LXZA 1A8LA 3MWHA 5KN0A 1FVKA 2EC4A 4H86A 1OAZA 3DWVA 1SK2A 3IAS2 2V6KA 1K0BA 1K3LA 4LMVA 4GXZA 5IM9A 5IO0A 3F3QA 1A2LA 4KE3A 1URMA 4ID0A 2HE3A 2C0FA 4IJ3A 3HA9A 2PGTA 2IMKA 1KTEA 3P7XA 1F3BA 2HZEB 4NV2A 4ZL7A 1I9DA 5AN1A 4TR4A 4ECJA 4Z7XA 4Q5NA 2H6XA 3ZITA 4LMWA 3DKSA 2O8VB 4JBBA 3IK9A 1EV4A 1H75A 2TIRA 2DJ3A 3APOA 1TI1A 4HI7A 2HLSA 4DEJA 4K2DA 3EU4A 1YEXA 1C72A 2X8CA 1JFUA 2MBTA 1OKDA 3GL5A 4KDUA 1V57A 1M99A 2L5OA 2CAIA 3M9KA 1PQNA 1GNEA 4G10A 2OE1A 4OFTA 1FB0A 2KUCA 2YP6A 3WGDA 1VF1A 2L57A 1G0TA 1ZCPA 3NIVA 5AIVA 1RK4A 1ML6A 3L0HA 3MDKA 4WR4A 2BJXA 5CNWA 1GTAA 2LTKA 3N9JA 5AIXA 2X99A 4WBJA 4EDZA 3F4RA 4EC0A 4TR1A 4OO5A 3BBYA 5IMDA 1WIKA 2XBQA 1PL1A 2R6KA 3ZLPA 1OC8A 2VM2A 5J9CA 5DALB 3H93A 1PGTA 2B7KA 2E2MA 4IGJA 14GSA 3J7Yk 2YCDA 1M2BA 4JE1A 2HSYA 4MK3A 5DJLA 1AQVA 3Q19A 1ZL9A 2H1BA 2CX3A 1GWCA 2IN3A 4F0CA 1T8EB 1FAAA 5G31A 4I2TA 2P0GA 3HY2A 1ACVA 4X43A 3IV4A 2MYGA 1TU7A 3D22A 5F07A 3D6IA 5G30A 3A2XA 5DAKA 1U3AA 1R7HA 4LLRA 1PKWA 4O32A 3FZAA 1HNBA 1G7EA 4FYUA 5CRGA 2C80A 6GSUA 1WP0A 5DVBA 1Q4JA 4EF0A 4ACSA 2B5YA 3TJGA 3CMIA 4ZBDA 5D96A 1JZOA 4D73A 2E2GA 3W6GA 3ZVJA 3FR3A 3C8EA 2V2GA 5EY6A 4GLTA 2CVBA 1SKRB 3QOUA 3UEMA 4Q5QA 3EC3A 3UVTA 2FWGA 3QAWA 2I1UA 4ECBA 4G2EA 3ED3A 2ON7A 3UBLA 3SWLA 4YQVA 4E8EA 2B6MA 2H6YA 1BEDA 2GZYA 2CT6A 2O89A 2H30A 1OE8A 1LBKA 3KH7A 3UIWA 1XWKA 2A2SA 5IMVA 2H0IA 1DBYA 1ZGNA 2PMTA 3WD6A 4IS0A 1W89A 5E4WA 1MD3A 5JCWA 4MF5A 2K8SA 1MDJA 2GT5A 2K8VA 4NHZA 4TR1B 3FKFA 4MJEA 2XBIA 1TOFA 3O3TA 2LQQA 4V2NA 2L6CA 3ZVJD 2YV9A 3GTUB 5G5FA 4ZB8A 2YJ7A 1GSSA 4AJ8A 2DJ0A 5FT3A 5A5KA 1IYHA 2X8HA 3GSSA 1T00A 3IXRA 3I69A 4XS1A 3P90A 4ZXGA 3M3MA 4BPYA 2A4VA 5H5QA 3VI5A 2I3YA 7GSSA 1GUKA 1ZYEA 3UMAA 1F3AA 2KP2A 1T1VA 5D73A 5IOXA 1ZMAA 3QFAC 5DJMA 2JSZA 5DAKB 3J7Yb 2C8UA 1WOUA 4ZILA 2YANA 1TP9A 3G9BA 2VCTA 5CREA 3QDNA 2P5QA 2MMAA 2VAFA 4ZL8A 4GQFA 3P2AA 1GLQA 5ELAA 3H8QA 2VLUA 2HT9A 2PVOC 4POLA 1CQHA 3L78A 4ML1A 1T4ZA 5ID2A 4JRRA 2I4AA 5D9WA 2KHPA 3VI7A 2V41A 5G5EA 4XIHA 5J5NA 2WULA 1MD4A 3IA1A 5ABRA 2GZZA 2LRCA 4GQCA 4NXIA 2GVPA 2OBKA 1GRXA 1J9BA 4ZIJA 1O6JA 3TJBA 1YY7A 2B5EA 1XBSA 2GGTA 3UARA 5ECQB 4KB3A 3EURA 2IPAA 4KNDA 2QSIA 1PSQA 1XXUA 5IMFA 3PINA 1PN9A 2B1KA 5DDLA 2JZRA 1ERUA 4HQZA 3GV1A 4RUVA 1WRYA 4XHMA 1USBA 1J0FA 2WFCA 4V2MA 3D4MA 1U6TA 1EEMA 1X5EA 4KCEA 1N8JA 3D21A 1OC9A 3FR6A 3U5RE 4PQHA 1X9WB 3GKXA 1AUCA 2N5AA 1DSBA 3GX0A 5D9TA 3C71A 1F9MA 3IPZA 1UA5A 3M9JA 5HR0A 4MH2A 3I43A 3FZ5A 2H8LA 1PKZA 5ECMB 3NOFA 5IMZA 5DCGA 5AISA 1XOBA 2GTUA 5J4UA 2VUPA 1GSUA 3ISOA 4MCUA 4KH7A 1SENA 3RBTA 2PN8A 1S3AA 2N5FA 1JLWA 4JR4A 4ISDA 4OO4A 1X5DA 3EVIA 1TKDB 1Z9HA 3IK7A 1TW9A 3KJYA 4MH3A 4MF6A 2J23A 3RHCA 5ID2B 1XIYA 4IW9A 4K0NA 4XS4A 3AY8A 2LQOA 1K0DA 5IPGA 4PX1A 3ZRDA 5IIZA 1M9AA 3LSZA 1XOAA 2CQ9A 1BJXA 3PH9A 5ECIB 4MZWA 1Y6EA 3IE3A 2LEGA 3HJPA 3HVXA 5B8BA 4RQRA 2REMA 3BOAA 2AHEA 1EGRA 3CRTA 3L9UA 1FW1A 1LU4A 2ZUPA 3O76A 2WCIA 4DSSB 2RUFA 4KX4A 2FWHA 4RI6A 3CTGA 1K3OA 2F9SA 3D5JA 1BQ7A 1YF1A 4BWSA 5G1KA 1OC9B 4GCIA 5KEJA 2H76A 1IYIA 6GSVA 2MBSA 2XHFA 2FA8A 4LL1B 4KDXA 2OE0A 2BMXA 5HQPA 3H4KA 4GRFA 3V1WA 1A24A 3ME7A 2PUKC 1K0NA 2E0QA 4I8BA 3GL3A 1PX6A 1G6WA 1GSEA 5CRWA 2GLRA 2XC2A 1NHOA 4F03A 2JZTA 4HDEA 4JU5A 3A3TA 4POKA 1OYJA 3KTLA 1M0UA 3CYNA 3G7IA 1B4QA 4TRXA 1TRVA 2QGVA 3BD2A 3HXSA 1T7PB 3TOTA 4V1Ap 4G9HA 4GSSA 5A4UA 1OVNA 4L0WA 4YQMA 4N11A 4FO5A 2DBCA 2H6ZA 2ZNMA 1G7OA 4XS4B 2KLXA 5ECKB 1XVQA 1X9MB 1GSDA 2HNLA 3IAM2 1SKSB 3FK8A 5JWQB 2HRNA 1LJRA 4ZB9A 1DE1A 3US3A 2PBJA 19GSA 3CRUA 4L5OA 2LSTA 2IMEA 4ECCA 4IP1A 3LGCA 3RPNA 3VPQA 4TXOA 3TJJA 1THXA 4O92A 3TB2A 4F9ZA 2DC5A 1V40A 1JZRA 1TXXA 1Y25A 5H5SA 1X9SB 3E0UA 1M7TA 4X0XA 5ECHB 3KMNA 1GSQA 1F37A 5LCZA 1SD9A 2IFQA 3RPPA 4ECIA 4DSRA 3GN3A 1R4WA 3KCMA 2K18A 1SJIA 5LD0A 1EOGA 3WGXA 3TRPA 2LNSA 5A4WA 1S3DA 2RLIA 1J08A 3ERWA 4WXTA 4O5RA 1GTBA 2R4VA 5ECRB 3A2VA 1R5AA 2TRCP 5FHIA 1TRUA 5INYA 4BL7A 1BAYA 1H4OA 3LJRA 5ELGA 4HJ2A 1EP8A 4POMA 3VK9A 3KM6A 3TKPA 3DIEA 2R37A 3LYKA 3VURA 2IWTA 2VM1A 1SU9A 2H1GA 4WF4A 2B7JA 3LG6A 2NDOA 1A8YA 3I9V2 2MZCA 4WF5A 3PGTA 2EIRA 2OKAA 1SK0A 4PURA 2DIYA 5FWGA 2WZ9A 5G1LA 5GSTA 3WT1A 3IOSA 3DYRA 3ZFLA 2H73A 1Z3EA 1I5GA 1F6MC 3HZ8A 1EP7A 1SL1B 4AJ7A 5L71A 2EIQA 2M46A 5GAND 4MJAA 2O85A 3GUSA 3LYPA 4PXOA 3ZTLA 4MPFA 3IC4A 2AV4A 2LRTA 1YKAA 4RQXA 2IMDA 1EV9A 1OKTA 3DGQA 2NVLA 2XPDA 2D2ZA 4EL1A 5DQYA 4PNGA 4G19A 1VF2A 2H19A 2WGRA 4TXOB 2AAWA 2IIYA 3FW2A 4K8MA 2K9FA 2C0GA 2YPMA 3KTBA 1O8WA 3W8SA 2C0DA 2L4CA 3E3EA 2IFQB 2VL2C 5IMCA 1PX7A 1ABAA 3LXTA 4YH2A 4OFMA 4KA0A 4WKWA 2IMIA 3ERFA 1A2JA 2LJAA 4PUFC 1AQXA 1V58A 5ECSA 5EL8A 1XW5A 1G6YA 3HCZA 5F0GA 2GSRA 2R3XA 2JU5A 4ZB6A 4OD7A 2HYXA 5COHA 1K0AA 2FA4A 1GLPA 2YZHA 5EPFA 3UOMA 3QR6A 3F8UA 2GZPA 4PQIA 3APSA 4MJCA 3CSHA 3QPMA 5B8AA 4K9ZA 2VD0A 5GSSA 2X8GA 1M2DA 3M0FA 4ULXA 1RW1A 2QC7A 4EXJA 4WEYA 3P8WA 4KSOA 3TRXA 4I6XA 3C73A 4L8EA 1TJDA 1GSYA 4D73B 5DCHA 4MA9A 1WE0A 3HD5A 1Q98A 4X1UA 1CQGA 1GSFA 3IR4A 2HFDA 2JADA 1V98A 2MMZA 3BCKA 2RUEA 3EMXA 1DE2A 3HVVA 2YJHA 4HQSA 2LUSA 3C7MA 5HR1A 1R5PA 1O85A 3FZ9A 3CSJA 4YQUA 3GYKA 3LORA 3G7YA 2G0FA 3HJMA 2L6DA 1B48A 1RQMA 2V6OA 3ZZXA 2CZ3A 2RM6A 1SL2B 1XW6A 1UN2A 2L59A 4EDYA 1ERWA 3O6TA 5F05A 4TR0A 1YQ1A 3ZREA 4CDOA 1U88A 4AF2A 1AW9A 3EE2A 3FY7A 3DXBA 4F82A 3FRCA 2WRTA 3N5OA 5HFGA 4FYCA 4KSMA 4K0GA 3TOUA 3FHKA 1FHEA 3WGEA 3GKNA 4MZBA 3GIXA 2PWJA 3KXOA 1B4PA 5DBQA 4QL9A 1GUMA 1EEJA 2LJRA 2GQMA 3MSZA 3KH9A 20GSA 3IRAA 1NSWA 2WJUA 1GL8A 2LS5A 1JLVA 1XWBA 4JZQA 2IMFA 2P5RA 1YEPA 1EGOA 1TI3A 2V32A 2G2QA 2DMLA 4NHWA 3KD0A 2VCWA 1ZOFA 1B9YC 2FWEA 1DUGA 1VF3A 1SYRA 2LJKA 4WETA 1SK1A 3M8NA 2C0EA 3UJ1A 3IHQA 1TK5B 4MPGA 2GDRA 2HXKA 1ERVA 2R2JA 2VO4A 2ZCTA 2L4QA 1B9XC 3ZYWA 3H79A 3HHVA 3S9FA 4NWYA 1SL0B 2M80A 2E7PA 5ECPB 3QD9A 1A2MA 1XZOA 3KGKA 4XS6A 3ZMKA 4GSTA 1ERTA 22GSA 4NPBA 1VF4A 3TKSA 2C1YA 4LL4B 4HZ4A 4E8HA 4PQ1A 2OBIA 2VL9A 3H1NA 1VGLA 1Z7PA 3QCPA 2J9HA 1ZYQB 4ZL9A 1A0RP 4HOJA 4KW6A 2DSAA 2AJQB 2VL3A 5F06A 1M9BA 3ME8A 1AC1A 3GA4A 2H0GA 2GQKA 4FH8A 1KEBA 2YWMA 3Q74A 2H1DA 3A2WA 4Q5RA 4OCFA 3TKSC 3EYTA 5B6MA 5LNKe 1PL2A 2EIOA 1UC7A 2FUG2 3U6VA 5B7CA 1U3IA 1HNAA 2FHEA 1Z6NA 5IPHA 2GSTA 4KAEA 1QUWA 4J56E 3ZFBA 4OFNA 3A5WA 2B1LA 2B3SA 3VWVA 2PERA 3FR9A 4BA7A 3FEUA 1MTCA 3Q18A 1WJKA 2H0HA 4OCEA 2F8FA 3IBHA 5HR2A 5DALA 5HFIA 3MAKA 1O8XA 4MJBA 2OE3A 1F2EA 3F6FA 1GNWA 5IMAA 1HD2A 2X64A 2TRXA 3DMLA 4YAPA 4CHSA 1K0OA 3VLNA 3TRQA 2VLVA 1FG4A 3F63A 1X5CA 4ZBAA 5CRDA 1O7UA 3VPTA 2O7KA 4IQ1A 3UBKA 1S3CA 4AJ6A 2ALBA 3L9VA 3DVWA 3UL3A 1GTUA 2DIZA 2H1AA 4HU7A 4TW5A 1BG5A 1PRXA 2K6VA 4GWRA 3OR5A 3BCIA 3MNGA 4TOPA 4I5QA 2CA8A 3GH6A 2I9HA 2CZ2A 1TRSA 2AUVA 2VCXA 3FYGA 2YV7A 4OWYA 4TKYA 1BYEA 1ZZYA 16GSA 2DLXA 4N0VA 1QGVA 2CX4A 1XPVA 1X0RA 4JEDA
chains in the Genus database with same CATH superfamily
4HZ2A 3R2QA 4V2LA 1E2YA 2XPEA 3GKMA 4QL7A 1JHBA 3C1SA 6GSSA 3KMOA 3TKQA 4MF7A 1XWCA 2A2RA 3HDCA 2FY6A 2VD1A 3APQA 4WR5A 3TGZA 4HS1A 1XW9A 4FYBA 1UVZA 1T3BA 4GF0A 2FD3A 2C3QA 1N2AA 1V2AA 4FIWA 4HEA2 5D9XA 3K8NA 4NV5A 4PGTA 1Z6MA 4KDYA 5G2ZA 3HVSA 3GH9A 4N0ZA 4G0LA 1TU8A 1TDIA 2BTOT 4GSNA 1HQOA 1EZKA 5D9VA 1YF0A 1YJ6A 4K1FA 2NPBA 5E59A 4F0BA 1GTIA 1NHYA 4MMMA 1AAZA 3GTUA 2PPTA 1Z7RA 3QMXA 1R26A 2FNOA 2GSQA 3FMWA 2PVQA 4TXVA 2DJJA 2HI7A 5CRHA 3CQFA 2IL3A 3Q6OA 2H70A 4IP6A 3RDWA 2NTOA 2VIMA 1KNGA 8GSSA 4Q5FA 2OADA 2F8AA 4IHUA 2LRNA 3I6AA 13GSA 4K7OA 4RI7A 5J9BA 5KN3A 1U87A 4ML6A 2WB9A 3ZL5A 2JZSA 4IBPA 1T4YA 4XTSA 2IJYA 3F4TA 1FB6A 3JCML 1OC3A 5JCGA 2KOKA 1FO5A 2MMOA 1TRWA 2DJ1A 3BJ5A 1TK8B 4JR6A 5GZZB 3MIXA 3GX8A 1XG8A 5KN1A 1K0CA 2H66A 4BWQA 1Z5YE 2QA1A 1MDKA 4J2FA 3F4SA 2ES7A 3UAPA 2M72A 2VL2A 3L4NA 3NZNA 3RHBA 1V9WA 4IN0A 5J3RA 4KUNA 1SJ6A 3GMFA 1BX9A 2C3TA 1PA3A 17GSA 4PUAA 3KP9A 5A4VA 2VCZA 2C3NA 3EU3A 2YOIA 2YWNA 3TCOA 5GAPD 4ZBBA 3GRXA 2F3MA 3G7JA 3ZMLA 3UVHA 6GSYA 5IQYA 1TTZA 2R0GA 2HSHA 2OACA 2OA7A 12GSA 4XRAA 2DJ2A 4MP4A 6GSWA 2YWIA 5JCUA 4BVYA 5HR3A 3TKSE 3IDVA 3GHAA 10GSA 2YN1A 4X4JA 4IVFA 4WBRD 1E6BA 1SD8A 3KP8A 3GURA 4K5SA 2R0CA 1EWXA 4N30A 1NW2A 4L0UA 1OE7A 2H74A 2GS3A 1M2AA 1XWAA 1ST9A 4HU9A 3DD3A 3CXGA 2RM5A 4TVEA 4V1Ag 1SKWB 4GTUA 5B6NA 1HYUA 1W4VA 3LWAA 3TJKA 4KCAA 1QFNA 3VWUA 2YNXA 2C4JA 1HNCA 2FCHA 4IJIA 2LV3A 1PN0A 2FWFA 2PU9C 4MZCA 1QMVA 9GSSA 3GSTA 2WDUA 4K7NA 2LKUA 11GSA 2AYTA 3DEXA 3DVXA 4FQUA 4K6XA 2O87A 2DJKA 2I81A 4HSCX 5H5RA 3F9UA 3EMPA 4IELA 2L5LA 2NBSA 4XRDA 3WYWA 2MMNA 2LNTA 3WT2A 3CSIA 5BRTA 2CVKA 1GP1A 3L9SA 2JSYA 2X4AA 3E9JB 4PNFA 3KIJA 1O81A 3TJFA 1WWJA 3D4TA 3F3RA 2JACA 5HFKA 1JZDA 1YZXA 3ZIJA 2FGXA 1FOVA 1PD21 2B5XA 1KBNA 3GKKA 4NAXA 4J57E 5ECOB 2DMMA 1AXDA 3C1RA 5BMUA 5CYYA 4DVCA 4CW9A 4K2XA 3GFKA 2R5GA 2CVDA 3M1GA 5JWRB 1A0FA 1GUHA 3HJOA 2VLTA 3TKRA 1XCCA 1SYXA 4HJMA 3VWWA 3TUEA 3DRNA 4MABA 1QQ2A 3D0ZA 4IKHA 3RAZA 4BVXA 4K7IA 6GSXA 3KEBA 4OMVA 4POBA 4DSSA 4MLYA 5CO3A 3VWXA 3HZ4A 5IO2A 2RIIA 3QFBC 1NM3A 3PR8A 3TDGA 4I97A 1QXHA 2H75A 1XFLA 3LEFA 1GULA 5JWOB 2R0PA 1XVWA 4NMUA 4O5QA 4F2IA 1FVJA 4Z2RA 3IC8A 2F51A 6GSTA 4K5RA 1ON4A 1WPIA 3GNJA 1MEKA 2V1MA 1MDIA 1O73A 2YWOA 2GQLA 3F6DA 4L5LA 4AGSA 2GSSA 4TR3A 2Z9SA 4MDCA 1JZWA 2N5BA 3W8JA 3CBUA 1YDKA 2FLSA 4KGIA 3HVNA 5ECLB 5C04A 4N10A 2H01A 3FZ4A 1AQWA 3ERGA 1EOHA 2A4HA 3QAVA 2HZEA 4LA1A 2CV4A 1PMTA 4XCSA 5DQSA 4DSQA 2AB6A 1QK8A 3KZQA 5D93A 3ZIVA 4YAVA 2GT6A 5AGYA 2H71A 3HYPA 2OJLA 1B8XA 3SBCA 4ILFA 1S3RA 2WS2A 1THOA 2VCQA 4IQAA 2ON5A 1WMJA 5F8BA 1TK0B 5J41A 1ILOA 3VFIA 2P31A 5ECNB 3EINA 1GH2A 3EWLA 2CAQA 3QAGA 3LQ7A 1AIUA 2HRFA 2H72A 5CP1A 4QQ7A 4TN8A 4P3YB 4O7HA 2YZUA 2VCVA 4HUAA 5CAXA 2HZFA 3CTFA 3LFLA 4EUYA 3HKRA 1M3IA 1XWGA 1A23A 2QKEA 4EO3A 1SJZA 5IOWA 5KN2A 2JL4A 5EVOA 3F0IA 1K0MA 4EE0A 5D8IA 4EKZA 4EVMA 1K3YA 5C00A 2KP1A 1YKCA 18GSA 2VOCA 4I2UA 5ENUA 1VRSD 3LXZA 1A8LA 3MWHA 5KN0A 1FVKA 2EC4A 4H86A 1OAZA 3DWVA 1SK2A 3IAS2 4KF9A 2V6KA 1K0BA 1K3LA 4LMVA 4GXZA 5IM9A 5IO0A 3F3QA 1A2LA 4KE3A 1URMA 4ID0A 2HE3A 2C0FA 4IJ3A 3HA9A 2PGTA 2IMKA 1KTEA 3P7XA 1F3BA 2HZEB 4NV2A 4ZL7A 1I9DA 5AN1A 4TR4A 4ECJA 4Z7XA 4Q5NA 2H6XA 3ZITA 4USSA 4LMWA 3DKSA 2O8VB 4JBBA 3IK9A 1EV4A 1H75A 2TIRA 2DJ3A 3APOA 1TI1A 4HI7A 2HLSA 4DEJA 4K2DA 3EU4A 1YEXA 1C72A 2X8CA 1JFUA 2MBTA 1OKDA 3GL5A 4KDUA 1V57A 1M99A 2L5OA 2CAIA 3PPUA 3M9KA 1PQNA 1GNEA 4G10A 2OE1A 4OFTA 1FB0A 2KUCA 2YP6A 3WGDA 1VF1A 2L57A 1G0TA 1ZCPA 1ZYPA 3NIVA 5AIVA 1RK4A 1ML6A 3L0HA 3MDKA 4WR4A 2BJXA 5CNWA 1GTAA 2LTKA 3N9JA 5AIXA 1PFOA 2X99A 4WBJA 4EDZA 3F4RA 4EC0A 4TR1A 4OO5A 3BBYA 5IMDA 1WIKA 2XBQA 1PL1A 2R6KA 3ZLPA 1OC8A 2VM2A 5J9CA 5DALB 3H93A 1PGTA 2B7KA 2E2MA 4IGJA 14GSA 3J7Yk 4YKGA 2YCDA 1M2BA 4JE1A 2HSYA 4MK3A 5DJLA 1AQVA 3Q19A 1ZL9A 2H1BA 4Z2UA 2CX3A 1GWCA 2IN3A 4F0CA 1T8EB 1FAAA 5G31A 4I2TA 2P0GA 3HY2A 1ACVA 4X43A 3IV4A 2MYGA 1TU7A 3D22A 5F07A 3D6IA 5G30A 3A2XA 5DAKA 4CY6A 1U3AA 1R7HA 4LLRA 1PKWA 4O32A 3FZAA 1HNBA 1G7EA 4FYUA 5CRGA 2C80A 6GSUA 1WP0A 5DVBA 1Q4JA 4EF0A 4ACSA 2B5YA 3TJGA 3CMIA 4ZBDA 5D96A 1JZOA 4D73A 2E2GA 3W6GA 3ZVJA 3FR3A 3C8EA 2V2GA 5EY6A 4GLTA 2CVBA 1SKRB 3QOUA 3UEMA 4Q5QA 3EC3A 3UVTA 2FWGA 3QAWA 2I1UA 4ECBA 4G2EA 3ED3A 2ON7A 3UBLA 3SWLA 4YQVA 4E8EA 2B6MA 2H6YA 1BEDA 2GZYA 2CT6A 2O89A 2H30A 1OE8A 1LBKA 4BIKA 3KH7A 3UIWA 1XWKA 2A2SA 5IMVA 2H0IA 1DBYA 1ZGNA 2PMTA 3WD6A 4IS0A 1W89A 5E4WA 1MD3A 5JCWA 4MF5A 2K8SA 1MDJA 2GT5A 2K8VA 4NHZA 4TR1B 3FKFA 4MJEA 2XBIA 1TOFA 3O3TA 2LQQA 4V2NA 2L6CA 3ZVJD 2YV9A 3GTUB 5G5FA 4ZB8A 2YJ7A 1GSSA 4AJ8A 2DJ0A 5FT3A 5A5KA 1IYHA 2X8HA 3GSSA 1T00A 3IXRA 3I69A 4XS1A 3P90A 4ZXGA 3M3MA 4BPYA 2A4VA 5H5QA 3VI5A 2I3YA 7GSSA 1GUKA 1ZYEA 3UMAA 1F3AA 2KP2A 1T1VA 5D73A 5IOXA 1ZMAA 2X49A 3QFAC 5DJMA 2JSZA 5DAKB 3J7Yb 2C8UA 1WOUA 4ZILA 4YKFA 2YANA 2HSMA 1TP9A 3G9BA 2VCTA 5CREA 3QDNA 2P5QA 2MMAA 2VAFA 4ZL8A 4GQFA 3P2AA 1GLQA 5ELAA 3H8QA 2VLUA 2HT9A 2PVOC 4POLA 1CQHA 3L78A 4ML1A 1T4ZA 5ID2A 4JRRA 2I4AA 5D9WA 2KHPA 3VI7A 2V41A 5G5EA 4XIHA 5J5NA 2WULA 1MD4A 3IA1A 5ABRA 2GZZA 2LRCA 4GQCA 4NXIA 2GVPA 2OBKA 1GRXA 1J9BA 4ZIJA 1O6JA 3TJBA 1YY7A 2B5EA 1XBSA 2GGTA 3UARA 5ECQB 4KB3A 3EURA 2IPAA 4KNDA 2QSIA 1PSQA 1XXUA 5IMFA 3PINA 1PN9A 2B1KA 5DDLA 4BVYB 2JZRA 1ERUA 4HQZA 3GV1A 4RUVA 1WRYA 4XHMA 1USBA 1J0FA 2WFCA 4V2MA 2DKIA 3D4MA 4ICYA 1U6TA 1EEMA 1X5EA 4KCEA 1N8JA 3D21A 1OC9A 3FR6A 3U5RE 4PQHA 1X9WB 3GKXA 1AUCA 2N5AA 1DSBA 3GX0A 5D9TA 3C71A 1F9MA 3IPZA 1UA5A 3M9JA 5HR0A 4MH2A 3I43A 3FZ5A 2H8LA 1PKZA 5ECMB 3NOFA 5IMZA 5DCGA 5AISA 1XOBA 2GTUA 5J4UA 2VUPA 1GSUA 3ISOA 3IHGA 4MCUA 4KH7A 1SENA 3RBTA 2PN8A 1S3AA 2N5FA 1JLWA 4JR4A 4ISDA 4OO4A 1X5DA 3EVIA 1TKDB 1Z9HA 3IK7A 1TW9A 3KJYA 4MH3A 4MF6A 2J23A 3RHCA 5ID2B 1XIYA 4IW9A 4K0NA 4XS4A 3AY8A 2LQOA 1K0DA 5IPGA 4PX1A 3ZRDA 5IIZA 1M9AA 3LSZA 1XOAA 2CQ9A 1BJXA 3PH9A 5ECIB 4MZWA 1Y6EA 3IE3A 2LEGA 3HJPA 3HVXA 5B8BA 4RQRA 2REMA 3BOAA 2AHEA 1EGRA 3CRTA 3L9UA 1FW1A 1LU4A 4BVXB 2ZUPA 3O76A 2WCIA 4DSSB 2RUFA 4KX4A 2FWHA 4RI6A 3CTGA 1K3OA 2F9SA 3D5JA 1BQ7A 1YF1A 4BWSA 5G1KA 1OC9B 4GCIA 5KEJA 4PTSA 2H76A 1IYIA 6GSVA 2MBSA 2XHFA 2FA8A 4LL1B 4KDXA 2OE0A 2BMXA 5HQPA 3H4KA 4GRFA 3V1WA 1A24A 3ME7A 2PUKC 1K0NA 2E0QA 4I8BA 3GL3A 1PX6A 1G6WA 1GSEA 2UZ8A 2GLRA 5CRWA 2XC2A 1NHOA 4F03A 2JZTA 4HDEA 4JU5A 3A3TA 4POKA 1OYJA 3KTLA 1M0UA 3CYNA 3G7IA 1B4QA 4TRXA 1TRVA 2QGVA 3BD2A 3HXSA 1T7PB 3TOTA 4V1Ap 4G9HA 4GSSA 5A4UA 1FOHA 1OVNA 4L0WA 4YQMA 4N11A 4FO5A 2DBCA 2H6ZA 2ZNMA 1G7OA 4XS4B 2KLXA 5ECKB 1XVQA 1X9MB 1GSDA 2HNLA 3IAM2 1SKSB 3FK8A 5JWQB 2HRNA 1LJRA 4ZB9A 1DE1A 3US3A 2PBJA 19GSA 2HRKA 3CRUA 4L5OA 2LSTA 2IMEA 4ECCA 1ZYNA 4IP1A 3LGCA 3RPNA 3VPQA 4TXOA 3TJJA 1THXA 4O92A 3TB2A 4F9ZA 2DC5A 1V40A 1JZRA 1TXXA 1Y25A 5H5SA 1X9SB 3E0UA 1M7TA 4X0XA 5ECHB 3KMNA 1GSQA 1F37A 5LCZA 1SD9A 2IFQA 3RPPA 4ECIA 4DSRA 3GN3A 1R4WA 3KCMA 2QA2A 2K18A 1SJIA 5LD0A 1EOGA 3WGXA 3TRPA 2LNSA 5A4WA 1S3DA 2RLIA 1J08A 3ERWA 4WXTA 4O5RA 1GTBA 2R4VA 5ECRB 3A2VA 1R5AA 2TRCP 5FHIA 1TRUA 5INYA 4BL7A 1BAYA 1H4OA 3LJRA 5ELGA 2A2PA 4HJ2A 1EP8A 4POMA 3VK9A 3KM6A 3TKPA 3DIEA 2R37A 3LYKA 3VURA 2IWTA 2VM1A 1SU9A 2H1GA 4WF4A 2B7JA 3LG6A 2NDOA 1A8YA 3I9V2 2MZCA 4WF5A 3PGTA 2EIRA 2OKAA 1SK0A 4PURA 2DIYA 5FWGA 2WZ9A 5G1LA 5GSTA 3WT1A 3IOSA 3DYRA 3ZFLA 4EIQA 2H73A 1Z3EA 1I5GA 1F6MC 3HZ8A 1EP7A 1SL1B 4AJ7A 5L71A 2EIQA 2M46A 5GAND 4MJAA 4G0KA 2O85A 3GUSA 3LYPA 4PXOA 3ZTLA 4MPFA 3IC4A 2AV4A 2LRTA 1YKAA 4RQXA 2IMDA 1EV9A 1OKTA 3DGQA 2NVLA 2XPDA 2D2ZA 4EL1A 3A5IA 5DQYA 4PNGA 4G19A 1VF2A 2H19A 2WGRA 4TXOB 2AAWA 2IIYA 3FW2A 4K8MA 2K9FA 2C0GA 2YPMA 3KTBA 1O8WA 3W8SA 2C0DA 2L4CA 3E3EA 2IFQB 2VL2C 5IMCA 1PX7A 1ABAA 3LXTA 4YH2A 4OFMA 4KA0A 4WKWA 2IMIA 3ERFA 1A2JA 2LJAA 4PUFC 1AQXA 1V58A 5ECSA 5EL8A 1XW5A 1G6YA 2DKHA 3HCZA 5F0GA 2GSRA 2R3XA 2JU5A 4ZB6A 4OD7A 2HYXA 5COHA 1K0AA 2FA4A 1GLPA 2YZHA 3LW9A 5EPFA 3UOMA 3QR6A 3F8UA 2GZPA 4PQIA 3APSA 4MJCA 3CSHA 4BL7B 3QPMA 5B8AA 4K9ZA 2VD0A 5GSSA 2X8GA 1M2DA 3M0FA 4ULXA 1RW1A 2QC7A 4EXJA 4WEYA 3P8WA 4KSOA 3TRXA 4I6XA 4L8EA 3C73A 1TJDA 1GSYA 4D73B 5DCHA 4MA9A 1WE0A 3HD5A 1Q98A 4X1UA 1CQGA 1GSFA 3IR4A 2HFDA 4G0IA 2JADA 1V98A 2MMZA 3BCKA 2RUEA 3EMXA 1DE2A 3HVVA 2YJHA 4HQSA 2LUSA 3C7MA 5HR1A 1R5PA 1O85A 3FZ9A 3CSJA 4YQUA 3GYKA 3LORA 3G7YA 2G0FA 3HJMA 2L6DA 1B48A 1RQMA 2V6OA 3ZZXA 2CZ3A 2RM6A 1SL2B 1XW6A 1UN2A 2L59A 4EDYA 1ERWA 3O6TA 5F05A 4TR0A 1YQ1A 3ZREA 4CDOA 1U88A 4AF2A 1AW9A 3EE2A 3FY7A 3DXBA 4F82A 3FRCA 2WRTA 3N5OA 5HFGA 4FYCA 4KSMA 4K0GA 3TOUA 3FHKA 1FHEA 3WGEA 3GKNA 4MZBA 3GIXA 2PWJA 3KXOA 1B4PA 5DBQA 4QL9A 1GUMA 1EEJA 2LJRA 2GQMA 3MSZA 3KH9A 20GSA 3IRAA 1NSWA 2WJUA 1GL8A 2LS5A 1JLVA 1XWBA 4JZQA 2IMFA 2P5RA 1YEPA 1EGOA 1TI3A 2V32A 2G2QA 2DMLA 4NHWA 3KD0A 2VCWA 1ZOFA 1B9YC 2FWEA 1DUGA 1VF3A 1SYRA 2LJKA 4WETA 1SK1A 3M8NA 4O5UA 2C0EA 3UJ1A 3IHQA 1TK5B 4MPGA 2GDRA 2HXKA 1ERVA 2R2JA 2VO4A 2ZCTA 2L4QA 1B9XC 3ZYWA 3H79A 3HHVA 3S9FA 4NWYA 1SL0B 2M80A 2E7PA 5ECPB 3QD9A 1A2MA 1XZOA 3KGKA 4XS6A 3ZMKA 4GSTA 1ERTA 22GSA 1M3JA 5KOXA 4NPBA 1VF4A 3TKSA 2C1YA 4LL4B 4HZ4A 4E8HA 4PQ1A 2OBIA 2VL9A 3H1NA 1VGLA 1Z7PA 3QCPA 2J9HA 1ZYQB 4ZL9A 1A0RP 4HOJA 4Z2TA 4CY8A 4KW6A 2DSAA 2AJQB 2VL3A 5F06A 1M9BA 3ME8A 1AC1A 3GA4A 2H0GA 2GQKA 4FH8A 3EPTA 1KEBA 2YWMA 4A5PA 3Q74A 2H1DA 3A2WA 4Q5RA 4OCFA 3TKSC 3EYTA 5B6MA 5LNKe 1PL2A 2EIOA 1UC7A 2FUG2 3U6VA 5B7CA 1U3IA 1HNAA 2FHEA 1Z6NA 5IPHA 2GSTA 4KAEA 1QUWA 5KOWA 4J56E 3ZFBA 4OFNA 3A5WA 2B1LA 2B3SA 3VWVA 2PERA 3FR9A 4BA7A 3FEUA 1MTCA 3Q18A 1WJKA 3R3EA 2H0HA 4OCEA 2F8FA 3IBHA 5HR2A 5DALA 5HFIA 3MAKA 1O8XA 4MJBA 2OE3A 1F2EA 3F6FA 1GNWA 5IMAA 1HD2A 2X64A 2TRXA 3DMLA 4YAPA 4EIPA 4CHSA 1K0OA 3VLNA 3TRQA 2VLVA 1FG4A 3F63A 1X5CA 4ZBAA 5CRDA 1O7UA 3VPTA 2O7KA 4IQ1A 3UBKA 1S3CA 4AJ6A 2ALBA 3L9VA 3DVWA 3UL3A 1GTUA 2DIZA 2H1AA 2HRAA 4HU7A 4TW5A 1BG5A 3MYDA 1PRXA 2K6VA 4GWRA 3OR5A 3BCIA 3MNGA 4TOPA 4I5QA 2CA8A 3GH6A 2I9HA 2CZ2A 1TRSA 2AUVA 2VCXA 3FYGA 2YV7A 4OWYA 4TKYA 1BYEA 1ZZYA 16GSA 2DLXA 4N0VA 1QGVA 2CX4A 1XPVA 1X0RA 4MNNA 4JEDA
chains in the Genus database with same CATH topology
4HZ2A 3R2QA 4V2LA 1E2YA 2XPEA 3GKMA 4QL7A 1JHBA 3C1SA 6GSSA 3KMOA 3TKQA 4MF7A 1XWCA 2A2RA 3HDCA 2FY6A 2VD1A 3APQA 4WR5A 3TGZA 4HS1A 1XW9A 4FYBA 1UVZA 1T3BA 4GF0A 2FD3A 2C3QA 1N2AA 1V2AA 4FIWA 4HEA2 5D9XA 3K8NA 4NV5A 4PGTA 1Z6MA 4KDYA 5G2ZA 3HVSA 3GH9A 4N0ZA 4G0LA 1TU8A 1TDIA 2BTOT 4GSNA 1HQOA 1EZKA 5D9VA 1YF0A 1YJ6A 4K1FA 2NPBA 5E59A 4F0BA 1GTIA 1NHYA 4MMMA 1AAZA 3GTUA 2PPTA 1Z7RA 3QMXA 1R26A 2FNOA 2GSQA 3FMWA 2PVQA 4TXVA 2DJJA 2HI7A 5CRHA 2IL3A 3Q6OA 2H70A 4IP6A 3RDWA 2NTOA 2VIMA 1KNGA 8GSSA 4Q5FA 2OADA 2F8AA 4IHUA 2LRNA 3I6AA 13GSA 4K7OA 4RI7A 5J9BA 5KN3A 1U87A 4ML6A 2WB9A 3ZL5A 2JZSA 4IBPA 1T4YA 4XTSA 2IJYA 3F4TA 1FB6A 3JCML 1OC3A 5JCGA 2KOKA 1FO5A 2MMOA 1TRWA 2DJ1A 3BJ5A 1TK8B 4JR6A 5GZZB 3MIXA 3GX8A 5KN1A 1K0CA 2H66A 4BWQA 1Z5YE 2QA1A 1MDKA 4J2FA 3F4SA 2ES7A 3UAPA 2M72A 2VL2A 3L4NA 3NZNA 3RHBA 1V9WA 4IN0A 5J3RA 4KUNA 1SJ6A 3GMFA 1BX9A 2C3TA 1PA3A 17GSA 4PUAA 3KP9A 5A4VA 2VCZA 2C3NA 3EU3A 2YOIA 2YWNA 3TCOA 5GAPD 4ZBBA 3GRXA 2F3MA 3G7JA 3ZMLA 3UVHA 6GSYA 5IQYA 1TTZA 2R0GA 2HSHA 2OACA 2OA7A 12GSA 4XRAA 2DJ2A 4MP4A 6GSWA 2YWIA 5JCUA 4BVYA 5HR3A 3TKSE 3IDVA 3GHAA 10GSA 2YN1A 4X4JA 4IVFA 4WBRD 1E6BA 1SD8A 3KP8A 3GURA 4K5SA 2R0CA 1EWXA 4N30A 1NW2A 4L0UA 1OE7A 2H74A 2GS3A 1M2AA 1XWAA 1ST9A 4HU9A 3DD3A 3CXGA 2RM5A 4TVEA 4V1Ag 1SKWB 4GTUA 5B6NA 1HYUA 1W4VA 3LWAA 3TJKA 4KCAA 1QFNA 3VWUA 2YNXA 2C4JA 1HNCA 2FCHA 4IJIA 2LV3A 1PN0A 2FWFA 2PU9C 4MZCA 1QMVA 9GSSA 3GSTA 2WDUA 4K7NA 2LKUA 11GSA 2AYTA 3DEXA 3DVXA 4FQUA 4K6XA 2O87A 2DJKA 2I81A 5H5RA 3F9UA 3EMPA 4IELA 2L5LA 2NBSA 4XRDA 3WYWA 2MMNA 2LNTA 3WT2A 3CSIA 5BRTA 2CVKA 1GP1A 3L9SA 2JSYA 2X4AA 3E9JB 4PNFA 3KIJA 1O81A 3TJFA 1WWJA 3D4TA 3F3RA 2JACA 5HFKA 1JZDA 1YZXA 3ZIJA 2FGXA 1FOVA 1PD21 2B5XA 1KBNA 3GKKA 4NAXA 4J57E 5ECOB 2DMMA 1AXDA 3C1RA 5BMUA 5CYYA 4DVCA 4CW9A 4K2XA 3GFKA 2R5GA 2CVDA 3M1GA 5JWRB 1A0FA 1GUHA 3HJOA 2VLTA 3TKRA 1XCCA 1SYXA 4HJMA 3VWWA 3TUEA 3DRNA 4MABA 1QQ2A 3D0ZA 4IKHA 3RAZA 4BVXA 4K7IA 6GSXA 3KEBA 4OMVA 4POBA 4DSSA 4MLYA 5CO3A 3VWXA 3HZ4A 5IO2A 2RIIA 3QFBC 1NM3A 3PR8A 3TDGA 4I97A 1QXHA 2H75A 1XFLA 3LEFA 1GULA 5JWOB 2R0PA 1XVWA 4NMUA 4O5QA 4F2IA 1FVJA 4Z2RA 3IC8A 2F51A 6GSTA 4K5RA 1ON4A 1WPIA 3GNJA 1MEKA 2V1MA 1MDIA 1O73A 2YWOA 2GQLA 3F6DA 4L5LA 4AGSA 2GSSA 4TR3A 2Z9SA 4MDCA 1JZWA 2N5BA 3W8JA 3CBUA 1YDKA 2FLSA 4KGIA 5ECLB 5C04A 4N10A 2H01A 3FZ4A 1AQWA 3ERGA 1EOHA 2A4HA 3QAVA 2HZEA 4LA1A 2CV4A 1PMTA 4XCSA 5DQSA 4DSQA 2AB6A 1QK8A 3KZQA 5D93A 3ZIVA 4YAVA 2GT6A 5AGYA 2H71A 3HYPA 2OJLA 1B8XA 3SBCA 4ILFA 2WS2A 1THOA 2VCQA 4IQAA 2ON5A 1WMJA 5F8BA 1TK0B 5J41A 1ILOA 3VFIA 2P31A 5ECNB 3EINA 1GH2A 3EWLA 2CAQA 3QAGA 3LQ7A 1AIUA 2HRFA 2H72A 5CP1A 4QQ7A 4TN8A 4P3YB 4O7HA 2YZUA 2VCVA 4HUAA 5CAXA 2HZFA 3CTFA 3LFLA 4EUYA 3HKRA 1XWGA 1A23A 2QKEA 4EO3A 1SJZA 5IOWA 5KN2A 2JL4A 5EVOA 3F0IA 1K0MA 4EE0A 5D8IA 4EKZA 4EVMA 1K3YA 5C00A 2KP1A 1YKCA 18GSA 2VOCA 4I2UA 5ENUA 1VRSD 3LXZA 1A8LA 3MWHA 5KN0A 1FVKA 2EC4A 4H86A 1OAZA 3DWVA 1SK2A 3IAS2 4KF9A 2V6KA 1K0BA 1K3LA 4LMVA 4GXZA 5IM9A 5IO0A 3F3QA 1A2LA 4KE3A 1URMA 4ID0A 2HE3A 2C0FA 4IJ3A 3HA9A 2PGTA 2IMKA 1KTEA 3P7XA 1F3BA 2HZEB 4NV2A 4ZL7A 1I9DA 5AN1A 4TR4A 4ECJA 4Z7XA 4Q5NA 2H6XA 3ZITA 4USSA 4LMWA 3DKSA 2O8VB 4JBBA 3IK9A 1EV4A 1H75A 2TIRA 2DJ3A 3APOA 1TI1A 4HI7A 2HLSA 4DEJA 4K2DA 3EU4A 1YEXA 1C72A 2X8CA 1JFUA 2MBTA 1OKDA 3GL5A 4KDUA 1V57A 1M99A 2L5OA 2CAIA 3PPUA 3M9KA 1PQNA 1GNEA 4G10A 2OE1A 4OFTA 1FB0A 2KUCA 2YP6A 3WGDA 1VF1A 2L57A 1G0TA 1ZCPA 1ZYPA 3NIVA 5AIVA 1RK4A 1ML6A 3L0HA 3MDKA 4WR4A 2BJXA 5CNWA 1GTAA 2LTKA 3N9JA 5AIXA 2X99A 4WBJA 4EDZA 3F4RA 4EC0A 4TR1A 4OO5A 3BBYA 5IMDA 1WIKA 2XBQA 1PL1A 2R6KA 3ZLPA 1OC8A 2VM2A 5J9CA 5DALB 3H93A 1PGTA 2B7KA 2E2MA 4IGJA 14GSA 3J7Yk 4YKGA 2YCDA 1M2BA 4JE1A 2HSYA 4MK3A 5DJLA 1AQVA 3Q19A 1ZL9A 2H1BA 4Z2UA 2CX3A 1GWCA 2IN3A 4F0CA 1T8EB 1FAAA 5G31A 4I2TA 2P0GA 3HY2A 1ACVA 4X43A 3IV4A 2MYGA 1TU7A 3D22A 5F07A 3D6IA 5G30A 3A2XA 5DAKA 4CY6A 1U3AA 1R7HA 4LLRA 1PKWA 4O32A 3FZAA 1HNBA 1G7EA 4FYUA 5CRGA 2C80A 6GSUA 1WP0A 5DVBA 1Q4JA 4EF0A 4ACSA 2B5YA 3TJGA 3CMIA 4ZBDA 5D96A 1JZOA 4D73A 2E2GA 3W6GA 3ZVJA 3FR3A 3C8EA 2V2GA 5EY6A 4GLTA 2CVBA 1SKRB 3QOUA 3UEMA 4Q5QA 3EC3A 3UVTA 2FWGA 3QAWA 2I1UA 4ECBA 4G2EA 3ED3A 2ON7A 3UBLA 3SWLA 4YQVA 4E8EA 2B6MA 2H6YA 1BEDA 2GZYA 2CT6A 2O89A 2H30A 1OE8A 1LBKA 3KH7A 3UIWA 1XWKA 2A2SA 5IMVA 2H0IA 1DBYA 1ZGNA 2PMTA 3WD6A 4IS0A 1W89A 5E4WA 1MD3A 5JCWA 4MF5A 2K8SA 1MDJA 2GT5A 2K8VA 4NHZA 4TR1B 3FKFA 4MJEA 2XBIA 1TOFA 3O3TA 2LQQA 4V2NA 2L6CA 3ZVJD 2YV9A 3GTUB 5G5FA 4ZB8A 2YJ7A 1GSSA 4AJ8A 2DJ0A 5FT3A 5A5KA 1IYHA 2X8HA 3GSSA 1T00A 3IXRA 3I69A 4XS1A 3P90A 4ZXGA 3M3MA 4BPYA 2A4VA 5H5QA 3VI5A 2I3YA 7GSSA 1GUKA 1ZYEA 3UMAA 1F3AA 2KP2A 1T1VA 5D73A 5IOXA 1ZMAA 2X49A 3QFAC 5DJMA 2JSZA 5DAKB 3J7Yb 2C8UA 1WOUA 4ZILA 4YKFA 2YANA 2HSMA 1TP9A 3G9BA 2VCTA 5CREA 3QDNA 2P5QA 2MMAA 2VAFA 4ZL8A 4GQFA 3P2AA 1GLQA 5ELAA 3H8QA 2VLUA 2HT9A 2PVOC 4POLA 1CQHA 3L78A 4ML1A 1T4ZA 5ID2A 4JRRA 2I4AA 5D9WA 2KHPA 3VI7A 2V41A 5G5EA 4XIHA 5J5NA 2WULA 1MD4A 3IA1A 5ABRA 2GZZA 2LRCA 4GQCA 4NXIA 2GVPA 2OBKA 1GRXA 1J9BA 4ZIJA 1O6JA 3TJBA 1YY7A 2B5EA 1XBSA 2GGTA 3UARA 5ECQB 4KB3A 3EURA 2IPAA 4KNDA 2QSIA 1PSQA 1XXUA 5IMFA 3PINA 1PN9A 2B1KA 5DDLA 4BVYB 2JZRA 1ERUA 4HQZA 3GV1A 4RUVA 1WRYA 4XHMA 1USBA 1J0FA 2WFCA 4V2MA 2DKIA 3D4MA 4ICYA 1U6TA 1EEMA 1X5EA 4KCEA 1N8JA 3D21A 1OC9A 3FR6A 3U5RE 4PQHA 1X9WB 3GKXA 1AUCA 2N5AA 1DSBA 3GX0A 5D9TA 3C71A 1F9MA 3IPZA 1UA5A 3M9JA 5HR0A 4MH2A 3I43A 3FZ5A 2H8LA 1PKZA 5ECMB 3NOFA 5IMZA 5DCGA 5AISA 1XOBA 2GTUA 5J4UA 2VUPA 1GSUA 3ISOA 3IHGA 4MCUA 4KH7A 1SENA 3RBTA 2PN8A 1S3AA 2N5FA 1JLWA 4JR4A 4ISDA 4OO4A 1X5DA 3EVIA 1TKDB 1Z9HA 3IK7A 1TW9A 3KJYA 4MH3A 4MF6A 2J23A 3RHCA 5ID2B 1XIYA 4IW9A 4K0NA 4XS4A 3AY8A 2LQOA 1K0DA 5IPGA 4PX1A 3ZRDA 5IIZA 1M9AA 3LSZA 1XOAA 2CQ9A 1BJXA 3PH9A 5ECIB 4MZWA 1Y6EA 3IE3A 2LEGA 3HJPA 3HVXA 5B8BA 4RQRA 2REMA 3BOAA 2AHEA 1EGRA 3CRTA 3L9UA 1FW1A 1LU4A 4BVXB 2ZUPA 3O76A 2WCIA 4DSSB 2RUFA 4KX4A 2FWHA 4RI6A 3CTGA 1K3OA 2F9SA 3D5JA 1BQ7A 1YF1A 4BWSA 5G1KA 1OC9B 4GCIA 5KEJA 4PTSA 2H76A 1IYIA 6GSVA 2MBSA 2XHFA 2FA8A 4LL1B 4KDXA 2OE0A 2BMXA 5HQPA 3H4KA 4GRFA 3V1WA 1A24A 3ME7A 2PUKC 1K0NA 2E0QA 4I8BA 3GL3A 1PX6A 1G6WA 1GSEA 2UZ8A 2GLRA 5CRWA 2XC2A 1NHOA 4F03A 2JZTA 4HDEA 4JU5A 3A3TA 4POKA 1OYJA 3KTLA 1M0UA 3CYNA 3G7IA 1B4QA 4TRXA 1TRVA 2QGVA 3BD2A 3HXSA 1T7PB 3TOTA 4V1Ap 4G9HA 4GSSA 5A4UA 1FOHA 1OVNA 4L0WA 4YQMA 4N11A 4FO5A 2DBCA 2H6ZA 2ZNMA 1G7OA 4XS4B 2KLXA 5ECKB 1XVQA 1X9MB 1GSDA 2HNLA 3IAM2 1SKSB 3FK8A 5JWQB 2HRNA 1LJRA 4ZB9A 1DE1A 3US3A 2PBJA 19GSA 2HRKA 3CRUA 4L5OA 2LSTA 2IMEA 4ECCA 1ZYNA 4IP1A 3LGCA 3RPNA 3VPQA 4TXOA 3TJJA 1THXA 4O92A 3TB2A 4F9ZA 2DC5A 1V40A 1JZRA 1TXXA 1Y25A 5H5SA 1X9SB 3E0UA 1M7TA 4X0XA 5ECHB 3KMNA 1GSQA 1F37A 5LCZA 1SD9A 2IFQA 3RPPA 4ECIA 4DSRA 3GN3A 1R4WA 3KCMA 2QA2A 2K18A 1SJIA 5LD0A 1EOGA 3WGXA 3TRPA 2LNSA 5A4WA 1S3DA 2RLIA 1J08A 3ERWA 4WXTA 4O5RA 1GTBA 2R4VA 5ECRB 3A2VA 1R5AA 2TRCP 5FHIA 1TRUA 5INYA 4BL7A 1BAYA 1H4OA 3LJRA 5ELGA 2A2PA 4HJ2A 1EP8A 4POMA 3VK9A 3KM6A 3TKPA 3DIEA 2R37A 3LYKA 3VURA 2IWTA 2VM1A 1SU9A 2H1GA 4WF4A 2B7JA 3LG6A 2NDOA 1A8YA 3I9V2 2MZCA 4WF5A 3PGTA 2EIRA 2OKAA 1SK0A 4PURA 2DIYA 5FWGA 2WZ9A 5G1LA 5GSTA 3WT1A 3IOSA 3DYRA 3ZFLA 4EIQA 2H73A 1Z3EA 1I5GA 1F6MC 3HZ8A 1EP7A 1SL1B 4AJ7A 5L71A 2EIQA 2M46A 5GAND 4MJAA 4G0KA 2O85A 3GUSA 3LYPA 4PXOA 3ZTLA 4MPFA 3IC4A 2AV4A 2LRTA 1YKAA 4RQXA 2IMDA 1EV9A 1OKTA 3DGQA 2NVLA 2XPDA 2D2ZA 4EL1A 3A5IA 5DQYA 4PNGA 4G19A 1VF2A 2H19A 2WGRA 4TXOB 2AAWA 2IIYA 3FW2A 4K8MA 2K9FA 2C0GA 2YPMA 3KTBA 1O8WA 3W8SA 2C0DA 2L4CA 3E3EA 2IFQB 2VL2C 5IMCA 1PX7A 1ABAA 3LXTA 4YH2A 4OFMA 4KA0A 4WKWA 2IMIA 3ERFA 1A2JA 2LJAA 4PUFC 1AQXA 1V58A 5ECSA 5EL8A 1XW5A 1G6YA 2DKHA 3HCZA 5F0GA 2GSRA 2R3XA 2JU5A 4ZB6A 4OD7A 2HYXA 5COHA 1K0AA 2FA4A 1GLPA 2YZHA 3LW9A 5EPFA 3UOMA 3QR6A 3F8UA 2GZPA 4PQIA 3APSA 4MJCA 3CSHA 4BL7B 3QPMA 5B8AA 4K9ZA 2VD0A 5GSSA 2X8GA 1M2DA 3M0FA 4ULXA 1RW1A 2QC7A 4EXJA 4WEYA 3P8WA 4KSOA 3TRXA 4I6XA 4L8EA 3C73A 1TJDA 1GSYA 4D73B 5DCHA 4MA9A 1WE0A 3HD5A 1Q98A 4X1UA 1CQGA 1GSFA 3IR4A 2HFDA 4G0IA 2JADA 1V98A 2MMZA 3BCKA 2RUEA 3EMXA 1DE2A 3HVVA 2YJHA 4HQSA 2LUSA 3C7MA 5HR1A 1R5PA 1O85A 3FZ9A 3CSJA 4YQUA 3GYKA 3LORA 3G7YA 2G0FA 3HJMA 2L6DA 1B48A 1RQMA 2V6OA 3ZZXA 2CZ3A 2RM6A 1SL2B 1XW6A 1UN2A 2L59A 4EDYA 1ERWA 3O6TA 5F05A 4TR0A 1YQ1A 3ZREA 4CDOA 1U88A 4AF2A 1AW9A 3EE2A 3FY7A 3DXBA 4F82A 3FRCA 2WRTA 3N5OA 5HFGA 4FYCA 4KSMA 4K0GA 3TOUA 3FHKA 1FHEA 3WGEA 3GKNA 4MZBA 3GIXA 2PWJA 3KXOA 1B4PA 5DBQA 4QL9A 1GUMA 1EEJA 2LJRA 2GQMA 3MSZA 3KH9A 20GSA 3IRAA 1NSWA 2WJUA 1GL8A 2LS5A 1JLVA 1XWBA 4JZQA 2IMFA 2P5RA 1YEPA 1EGOA 1TI3A 2V32A 2G2QA 2DMLA 4NHWA 3KD0A 2VCWA 1ZOFA 1B9YC 2FWEA 1DUGA 1VF3A 1SYRA 2LJKA 4WETA 1SK1A 3M8NA 4O5UA 2C0EA 3UJ1A 3IHQA 1TK5B 4MPGA 2GDRA 2HXKA 1ERVA 2R2JA 2VO4A 2ZCTA 2L4QA 1B9XC 3ZYWA 3H79A 3HHVA 3S9FA 4NWYA 1SL0B 2M80A 2E7PA 5ECPB 3QD9A 1A2MA 1XZOA 3KGKA 4XS6A 3ZMKA 4GSTA 1ERTA 22GSA 5KOXA 4NPBA 1VF4A 3TKSA 2C1YA 4LL4B 4HZ4A 4E8HA 4PQ1A 2OBIA 2VL9A 3H1NA 1VGLA 1Z7PA 3QCPA 2J9HA 1ZYQB 4ZL9A 1A0RP 4HOJA 4Z2TA 4CY8A 4KW6A 2DSAA 2AJQB 2VL3A 5F06A 1M9BA 3ME8A 1AC1A 3GA4A 2H0GA 2GQKA 4FH8A 3EPTA 1KEBA 2YWMA 4A5PA 3Q74A 2H1DA 3A2WA 4Q5RA 4OCFA 3TKSC 3EYTA 5B6MA 5LNKe 1PL2A 2EIOA 1UC7A 2FUG2 3U6VA 5B7CA 1U3IA 1HNAA 2FHEA 1Z6NA 5IPHA 2GSTA 4KAEA 1QUWA 5KOWA 4J56E 3ZFBA 4OFNA 3A5WA 2B1LA 2B3SA 3VWVA 2PERA 3FR9A 4BA7A 3FEUA 1MTCA 3Q18A 1WJKA 3R3EA 2H0HA 4OCEA 2F8FA 3IBHA 5HR2A 5DALA 5HFIA 3MAKA 1O8XA 4MJBA 2OE3A 1F2EA 3F6FA 1GNWA 5IMAA 1HD2A 2X64A 2TRXA 3DMLA 4YAPA 4EIPA 4CHSA 1K0OA 3VLNA 3TRQA 2VLVA 1FG4A 3F63A 1X5CA 4ZBAA 5CRDA 1O7UA 3VPTA 2O7KA 4IQ1A 3UBKA 1S3CA 4AJ6A 2ALBA 3L9VA 3DVWA 3UL3A 1GTUA 2DIZA 2H1AA 2HRAA 4HU7A 4TW5A 1BG5A 3MYDA 1PRXA 2K6VA 4GWRA 3OR5A 3BCIA 3MNGA 4TOPA 4I5QA 2CA8A 3GH6A 2I9HA 2CZ2A 1TRSA 2AUVA 2VCXA 3FYGA 2YV7A 4OWYA 4TKYA 1BYEA 1ZZYA 16GSA 2DLXA 4N0VA 1QGVA 2CX4A 1XPVA 1X0RA 4MNNA 4JEDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4HZ2 A;  3R2Q A;  4V2L A;  1E2Y A;  2XPE A;  3GKM A;  4QL7 A;  1JHB A;  3C1S A;  6GSS A;  3KMO A;  3TKQ A;  4MF7 A;  1XWC A;  2A2R A;  3HDC A;  2FY6 A;  2VD1 A;  3APQ A;  4WR5 A;  3TGZ A;  4HS1 A;  1XW9 A;  4FYB A;  1UVZ A;  1T3B A;  4GF0 A;  2FD3 A;  2C3Q A;  1N2A A;  1V2A A;  4FIW A;  4HEA 2;  5D9X A;  3K8N A;  4NV5 A;  4PGT A;  1Z6M A;  4KDY A;  5G2Z A;  3HVS A;  3GH9 A;  4N0Z A;  1TU8 A;  1TDI A;  2BTO T;  4GSN A;  1HQO A;  1EZK A;  5D9V A;  1YF0 A;  1YJ6 A;  4K1F A;  2NPB A;  5E59 A;  4F0B A;  1GTI A;  1NHY A;  4MMM A;  1AAZ A;  3GTU A;  2PPT A;  1Z7R A;  3QMX A;  1R26 A;  2FNO A;  2GSQ A;  2PVQ A;  4TXV A;  2DJJ A;  2HI7 A;  5CRH A;  2IL3 A;  3Q6O A;  2H70 A;  4IP6 A;  3RDW A;  2NTO A;  2VIM A;  1KNG A;  8GSS A;  4Q5F A;  2OAD A;  2F8A A;  4IHU A;  2LRN A;  3I6A A;  13GS A;  4K7O A;  4RI7 A;  5J9B A;  5KN3 A;  1U87 A;  4ML6 A;  2WB9 A;  3ZL5 A;  2JZS A;  4IBP A;  1T4Y A;  4XTS A;  2IJY A;  3F4T A;  1FB6 A;  3JCM L;  1OC3 A;  5JCG A;  2KOK A;  1FO5 A;  2MMO A;  1TRW A;  2DJ1 A;  3BJ5 A;  1TK8 B;  4JR6 A;  5GZZ B;  3GX8 A;  5KN1 A;  1K0C A;  2H66 A;  4BWQ A;  1Z5Y E;  1MDK A;  4J2F A;  3F4S A;  2ES7 A;  3UAP A;  2M72 A;  2VL2 A;  3L4N A;  3NZN A;  3RHB A;  1V9W A;  4IN0 A;  5J3R A;  4KUN A;  1SJ6 A;  3GMF A;  1BX9 A;  2C3T A;  1PA3 A;  17GS A;  4PUA A;  3KP9 A;  5A4V A;  2VCZ A;  2C3N A;  3EU3 A;  2YOI A;  2YWN A;  3TCO A;  5GAP D;  4ZBB A;  3GRX A;  2F3M A;  3G7J A;  3ZML A;  3UVH A;  6GSY A;  5IQY A;  1TTZ A;  2HSH A;  2OAC A;  2OA7 A;  12GS A;  4XRA A;  2DJ2 A;  4MP4 A;  6GSW A;  2YWI A;  5JCU A;  4BVY A;  5HR3 A;  3TKS E;  3IDV A;  3GHA A;  10GS A;  2YN1 A;  4IVF A;  4WBR D;  1E6B A;  1SD8 A;  3KP8 A;  3GUR A;  1EWX A;  4N30 A;  1NW2 A;  4L0U A;  1OE7 A;  2H74 A;  2GS3 A;  1M2A A;  1XWA A;  1ST9 A;  4HU9 A;  3DD3 A;  3CXG A;  2RM5 A;  4TVE A;  4V1A g;  1SKW B;  4GTU A;  5B6N A;  1HYU A;  1W4V A;  3LWA A;  3TJK A;  4KCA A;  1QFN A;  3VWU A;  2YNX A;  2C4J A;  1HNC A;  2FCH A;  4IJI A;  2LV3 A;  2FWF A;  2PU9 C;  4MZC A;  1QMV A;  9GSS A;  3GST A;  2WDU A;  4K7N A;  2LKU A;  11GS A;  2AYT A;  3DEX A;  3DVX A;  4K6X A;  2O87 A;  2DJK A;  2I81 A;  5H5R A;  3F9U A;  3EMP A;  4IEL A;  2L5L A;  2NBS A;  4XRD A;  3WYW A;  2MMN A;  2LNT A;  3WT2 A;  3CSI A;  2CVK A;  1GP1 A;  3L9S A;  2JSY A;  3E9J B;  4PNF A;  3KIJ A;  1O81 A;  3TJF A;  1WWJ A;  3D4T A;  3F3R A;  2JAC A;  5HFK A;  1JZD A;  1YZX A;  3ZIJ A;  2FGX A;  1FOV A;  1PD2 1;  2B5X A;  1KBN A;  3GKK A;  4NAX A;  4J57 E;  5ECO B;  2DMM A;  1AXD A;  3C1R A;  5CYY A;  4DVC A;  4CW9 A;  3GFK A;  2R5G A;  2CVD A;  3M1G A;  5JWR B;  1A0F A;  1GUH A;  3HJO A;  2VLT A;  3TKR A;  1XCC A;  1SYX A;  4HJM A;  3VWW A;  3TUE A;  3DRN A;  4MAB A;  1QQ2 A;  3D0Z A;  4IKH A;  3RAZ A;  4BVX A;  4K7I A;  6GSX A;  3KEB A;  4OMV A;  4POB A;  4DSS A;  4MLY A;  5CO3 A;  3VWX A;  3HZ4 A;  5IO2 A;  2RII A;  3QFB C;  1NM3 A;  3PR8 A;  3TDG A;  4I97 A;  1QXH A;  2H75 A;  1XFL A;  3LEF A;  1GUL A;  5JWO B;  1XVW A;  4NMU A;  4F2I A;  1FVJ A;  2F51 A;  6GST A;  1ON4 A;  1WPI A;  3GNJ A;  1MEK A;  2V1M A;  1MDI A;  1O73 A;  2YWO A;  2GQL A;  3F6D A;  4L5L A;  4AGS A;  2GSS A;  4TR3 A;  2Z9S A;  4MDC A;  1JZW A;  2N5B A;  3W8J A;  3CBU A;  1YDK A;  2FLS A;  4KGI A;  5ECL B;  5C04 A;  4N10 A;  2H01 A;  3FZ4 A;  1AQW A;  3ERG A;  1EOH A;  3QAV A;  2HZE A;  4LA1 A;  2CV4 A;  1PMT A;  4XCS A;  5DQS A;  4DSQ A;  2AB6 A;  1QK8 A;  3KZQ A;  5D93 A;  3ZIV A;  4YAV A;  2GT6 A;  5AGY A;  2H71 A;  3HYP A;  2OJL A;  1B8X A;  3SBC A;  4ILF A;  2WS2 A;  1THO A;  2VCQ A;  4IQA A;  2ON5 A;  1WMJ A;  5F8B A;  1TK0 B;  5J41 A;  1ILO A;  3VFI A;  2P31 A;  5ECN B;  3EIN A;  1GH2 A;  3EWL A;  2CAQ A;  3QAG A;  3LQ7 A;  1AIU A;  2HRF A;  2H72 A;  5CP1 A;  4QQ7 A;  4TN8 A;  4P3Y B;  4O7H A;  2YZU A;  2VCV A;  4HUA A;  5CAX A;  2HZF A;  3CTF A;  3LFL A;  4EUY A;  3HKR A;  1XWG A;  1A23 A;  2QKE A;  4EO3 A;  1SJZ A;  5IOW A;  5KN2 A;  2JL4 A;  5EVO A;  3F0I A;  1K0M A;  4EE0 A;  5D8I A;  4EKZ A;  4EVM A;  1K3Y A;  5C00 A;  2KP1 A;  1YKC A;  18GS A;  2VOC A;  4I2U A;  5ENU A;  1VRS D;  3LXZ A;  1A8L A;  3MWH A;  5KN0 A;  1FVK A;  2EC4 A;  4H86 A;  1OAZ A;  3DWV A;  1SK2 A;  3IAS 2;  2V6K A;  1K0B A;  1K3L A;  4LMV A;  4GXZ A;  5IM9 A;  5IO0 A;  3F3Q A;  1A2L A;  4KE3 A;  1URM A;  4ID0 A;  2HE3 A;  2C0F A;  4IJ3 A;  3HA9 A;  2PGT A;  2IMK A;  1KTE A;  3P7X A;  1F3B A;  2HZE B;  4NV2 A;  4ZL7 A;  1I9D A;  5AN1 A;  4TR4 A;  4ECJ A;  4Z7X A;  4Q5N A;  2H6X A;  3ZIT A;  4LMW A;  3DKS A;  2O8V B;  4JBB A;  3IK9 A;  1EV4 A;  1H75 A;  2TIR A;  2DJ3 A;  3APO A;  1TI1 A;  4HI7 A;  2HLS A;  4DEJ A;  4K2D A;  3EU4 A;  1YEX A;  1C72 A;  2X8C A;  1JFU A;  2MBT A;  1OKD A;  3GL5 A;  4KDU A;  1V57 A;  1M99 A;  2L5O A;  2CAI A;  3M9K A;  1PQN A;  1GNE A;  4G10 A;  2OE1 A;  4OFT A;  1FB0 A;  2KUC A;  2YP6 A;  3WGD A;  1VF1 A;  2L57 A;  1G0T A;  1ZCP A;  3NIV A;  5AIV A;  1RK4 A;  1ML6 A;  3L0H A;  3MDK A;  4WR4 A;  2BJX A;  5CNW A;  1GTA A;  2LTK A;  3N9J A;  5AIX A;  2X99 A;  4WBJ A;  4EDZ A;  3F4R A;  4EC0 A;  4TR1 A;  4OO5 A;  3BBY A;  5IMD A;  1WIK A;  2XBQ A;  1PL1 A;  2R6K A;  3ZLP A;  1OC8 A;  2VM2 A;  5J9C A;  5DAL B;  3H93 A;  1PGT A;  2B7K A;  2E2M A;  4IGJ A;  14GS A;  3J7Y k;  2YCD A;  1M2B A;  4JE1 A;  2HSY A;  4MK3 A;  5DJL A;  1AQV A;  3Q19 A;  1ZL9 A;  2H1B A;  2CX3 A;  1GWC A;  2IN3 A;  4F0C A;  1T8E B;  1FAA A;  5G31 A;  4I2T A;  2P0G A;  3HY2 A;  1ACV A;  4X43 A;  3IV4 A;  2MYG A;  1TU7 A;  3D22 A;  5F07 A;  3D6I A;  5G30 A;  3A2X A;  5DAK A;  1U3A A;  1R7H A;  4LLR A;  1PKW A;  4O32 A;  3FZA A;  1HNB A;  1G7E A;  4FYU A;  5CRG A;  2C80 A;  6GSU A;  1WP0 A;  5DVB A;  1Q4J A;  4EF0 A;  4ACS A;  2B5Y A;  3TJG A;  3CMI A;  4ZBD A;  5D96 A;  1JZO A;  4D73 A;  2E2G A;  3W6G A;  3ZVJ A;  3FR3 A;  3C8E A;  2V2G A;  5EY6 A;  4GLT A;  2CVB A;  1SKR B;  3QOU A;  3UEM A;  4Q5Q A;  3EC3 A;  3UVT A;  2FWG A;  3QAW A;  2I1U A;  4ECB A;  4G2E A;  3ED3 A;  2ON7 A;  3UBL A;  3SWL A;  4YQV A;  4E8E A;  2B6M A;  2H6Y A;  1BED A;  2GZY A;  2CT6 A;  2O89 A;  2H30 A;  1OE8 A;  1LBK A;  3KH7 A;  3UIW A;  1XWK A;  2A2S A;  5IMV A;  2H0I A;  1DBY A;  1ZGN A;  2PMT A;  3WD6 A;  4IS0 A;  1W89 A;  5E4W A;  1MD3 A;  5JCW A;  4MF5 A;  2K8S A;  1MDJ A;  2GT5 A;  2K8V A;  4NHZ A;  4TR1 B;  3FKF A;  4MJE A;  2XBI A;  1TOF A;  3O3T A;  2LQQ A;  4V2N A;  2L6C A;  3ZVJ D;  2YV9 A;  3GTU B;  5G5F A;  4ZB8 A;  2YJ7 A;  1GSS A;  4AJ8 A;  2DJ0 A;  5FT3 A;  5A5K A;  1IYH A;  2X8H A;  3GSS A;  1T00 A;  3IXR A;  3I69 A;  4XS1 A;  3P90 A;  4ZXG A;  3M3M A;  4BPY A;  2A4V A;  5H5Q A;  3VI5 A;  2I3Y A;  7GSS A;  1GUK A;  1ZYE A;  3UMA A;  1F3A A;  2KP2 A;  1T1V A;  5D73 A;  5IOX A;  1ZMA A;  3QFA C;  5DJM A;  2JSZ A;  5DAK B;  3J7Y b;  2C8U A;  1WOU A;  4ZIL A;  2YAN A;  1TP9 A;  3G9B A;  2VCT A;  5CRE A;  3QDN A;  2P5Q A;  2MMA A;  2VAF A;  4ZL8 A;  4GQF A;  3P2A A;  1GLQ A;  5ELA A;  3H8Q A;  2VLU A;  2HT9 A;  2PVO C;  4POL A;  1CQH A;  3L78 A;  4ML1 A;  1T4Z A;  5ID2 A;  4JRR A;  2I4A A;  5D9W A;  2KHP A;  3VI7 A;  2V41 A;  5G5E A;  4XIH A;  5J5N A;  2WUL A;  1MD4 A;  3IA1 A;  5ABR A;  2GZZ A;  2LRC A;  4GQC A;  4NXI A;  2GVP A;  2OBK A;  1GRX A;  1J9B A;  4ZIJ A;  1O6J A;  3TJB A;  1YY7 A;  2B5E A;  1XBS A;  2GGT A;  3UAR A;  5ECQ B;  4KB3 A;  3EUR A;  2IPA A;  4KND A;  2QSI A;  1PSQ A;  1XXU A;  5IMF A;  3PIN A;  1PN9 A;  2B1K A;  5DDL A;  2JZR A;  1ERU A;  4HQZ A;  3GV1 A;  4RUV A;  1WRY A;  4XHM A;  1USB A;  1J0F A;  2WFC A;  4V2M A;  3D4M A;  1U6T A;  1EEM A;  1X5E A;  4KCE A;  1N8J A;  3D21 A;  1OC9 A;  3FR6 A;  3U5R E;  4PQH A;  1X9W B;  3GKX A;  1AUC A;  2N5A A;  1DSB A;  3GX0 A;  5D9T A;  3C71 A;  1F9M A;  3IPZ A;  1UA5 A;  3M9J A;  5HR0 A;  4MH2 A;  3I43 A;  3FZ5 A;  2H8L A;  1PKZ A;  5ECM B;  3NOF A;  5IMZ A;  5DCG A;  5AIS A;  1XOB A;  2GTU A;  5J4U A;  2VUP A;  1GSU A;  3ISO A;  4MCU A;  4KH7 A;  1SEN A;  3RBT A;  2PN8 A;  1S3A A;  2N5F A;  1JLW A;  4JR4 A;  4ISD A;  4OO4 A;  1X5D A;  3EVI A;  1TKD B;  1Z9H A;  3IK7 A;  1TW9 A;  3KJY A;  4MH3 A;  4MF6 A;  2J23 A;  3RHC A;  5ID2 B;  1XIY A;  4IW9 A;  4K0N A;  4XS4 A;  3AY8 A;  2LQO A;  1K0D A;  5IPG A;  4PX1 A;  3ZRD A;  5IIZ A;  1M9A A;  3LSZ A;  1XOA A;  2CQ9 A;  1BJX A;  3PH9 A;  5ECI B;  4MZW A;  1Y6E A;  3IE3 A;  2LEG A;  3HJP A;  3HVX A;  5B8B A;  4RQR A;  2REM A;  3BOA A;  2AHE A;  1EGR A;  3CRT A;  3L9U A;  1FW1 A;  1LU4 A;  2ZUP A;  3O76 A;  2WCI A;  4DSS B;  2RUF A;  4KX4 A;  2FWH A;  4RI6 A;  3CTG A;  1K3O A;  2F9S A;  3D5J A;  1BQ7 A;  1YF1 A;  4BWS A;  5G1K A;  1OC9 B;  4GCI A;  5KEJ A;  2H76 A;  1IYI A;  6GSV A;  2MBS A;  2XHF A;  2FA8 A;  4LL1 B;  4KDX A;  2OE0 A;  2BMX A;  5HQP A;  3H4K A;  4GRF A;  3V1W A;  1A24 A;  3ME7 A;  2PUK C;  1K0N A;  2E0Q A;  4I8B A;  3GL3 A;  1PX6 A;  1G6W A;  1GSE A;  5CRW A;  2GLR A;  2XC2 A;  1NHO A;  4F03 A;  2JZT A;  4HDE A;  4JU5 A;  3A3T A;  4POK A;  1OYJ A;  3KTL A;  1M0U A;  3CYN A;  3G7I A;  1B4Q A;  4TRX A;  1TRV A;  2QGV A;  3BD2 A;  3HXS A;  1T7P B;  3TOT A;  4V1A p;  4G9H A;  4GSS A;  5A4U A;  1OVN A;  4L0W A;  4YQM A;  4N11 A;  4FO5 A;  2DBC A;  2H6Z A;  2ZNM A;  1G7O A;  4XS4 B;  2KLX A;  5ECK B;  1XVQ A;  1X9M B;  1GSD A;  2HNL A;  3IAM 2;  1SKS B;  3FK8 A;  5JWQ B;  2HRN A;  1LJR A;  4ZB9 A;  1DE1 A;  3US3 A;  2PBJ A;  19GS A;  3CRU A;  4L5O A;  2LST A;  2IME A;  4ECC A;  4IP1 A;  3LGC A;  3RPN A;  3VPQ A;  4TXO A;  3TJJ A;  1THX A;  4O92 A;  3TB2 A;  4F9Z A;  2DC5 A;  1V40 A;  1JZR A;  1TXX A;  1Y25 A;  5H5S A;  1X9S B;  3E0U A;  1M7T A;  4X0X A;  5ECH B;  3KMN A;  1GSQ A;  1F37 A;  5LCZ A;  1SD9 A;  2IFQ A;  3RPP A;  4ECI A;  4DSR A;  3GN3 A;  1R4W A;  3KCM A;  2K18 A;  1SJI A;  5LD0 A;  1EOG A;  3WGX A;  3TRP A;  2LNS A;  5A4W A;  1S3D A;  2RLI A;  1J08 A;  3ERW A;  4WXT A;  4O5R A;  1GTB A;  2R4V A;  5ECR B;  3A2V A;  1R5A A;  2TRC P;  5FHI A;  1TRU A;  5INY A;  4BL7 A;  1BAY A;  1H4O A;  3LJR A;  5ELG A;  4HJ2 A;  1EP8 A;  4POM A;  3VK9 A;  3KM6 A;  3TKP A;  3DIE A;  2R37 A;  3LYK A;  3VUR A;  2IWT A;  2VM1 A;  1SU9 A;  2H1G A;  4WF4 A;  2B7J A;  3LG6 A;  2NDO A;  1A8Y A;  3I9V 2;  2MZC A;  4WF5 A;  3PGT A;  2EIR A;  2OKA A;  1SK0 A;  4PUR A;  2DIY A;  5FWG A;  2WZ9 A;  5G1L A;  5GST A;  3WT1 A;  3IOS A;  3DYR A;  3ZFL A;  2H73 A;  1Z3E A;  1I5G A;  1F6M C;  3HZ8 A;  1EP7 A;  1SL1 B;  4AJ7 A;  5L71 A;  2EIQ A;  2M46 A;  5GAN D;  4MJA A;  2O85 A;  3GUS A;  3LYP A;  4PXO A;  3ZTL A;  4MPF A;  3IC4 A;  2AV4 A;  2LRT A;  1YKA A;  4RQX A;  2IMD A;  1EV9 A;  1OKT A;  3DGQ A;  2NVL A;  2XPD A;  2D2Z A;  4EL1 A;  5DQY A;  4PNG A;  4G19 A;  1VF2 A;  2H19 A;  2WGR A;  4TXO B;  2AAW A;  2IIY A;  3FW2 A;  4K8M A;  2K9F A;  2C0G A;  2YPM A;  3KTB A;  1O8W A;  3W8S A;  2C0D A;  2L4C A;  3E3E A;  2IFQ B;  2VL2 C;  5IMC A;  1PX7 A;  1ABA A;  3LXT A;  4YH2 A;  4OFM A;  4KA0 A;  4WKW A;  2IMI A;  3ERF A;  1A2J A;  2LJA A;  4PUF C;  1AQX A;  1V58 A;  5ECS A;  5EL8 A;  1XW5 A;  1G6Y A;  3HCZ A;  5F0G A;  2GSR A;  2R3X A;  2JU5 A;  4ZB6 A;  4OD7 A;  2HYX A;  5COH A;  1K0A A;  2FA4 A;  1GLP A;  2YZH A;  5EPF A;  3UOM A;  3QR6 A;  3F8U A;  2GZP A;  4PQI A;  3APS A;  4MJC A;  3CSH A;  3QPM A;  5B8A A;  4K9Z A;  2VD0 A;  5GSS A;  2X8G A;  1M2D A;  3M0F A;  4ULX A;  1RW1 A;  2QC7 A;  4EXJ A;  4WEY A;  3P8W A;  4KSO A;  3TRX A;  4I6X A;  3C73 A;  4L8E A;  1TJD A;  1GSY A;  4D73 B;  5DCH A;  4MA9 A;  1WE0 A;  3HD5 A;  1Q98 A;  4X1U A;  1CQG A;  1GSF A;  3IR4 A;  2HFD A;  2JAD A;  1V98 A;  2MMZ A;  3BCK A;  2RUE A;  3EMX A;  1DE2 A;  3HVV A;  2YJH A;  4HQS A;  2LUS A;  3C7M A;  5HR1 A;  1R5P A;  1O85 A;  3FZ9 A;  3CSJ A;  4YQU A;  3GYK A;  3LOR A;  3G7Y A;  2G0F A;  3HJM A;  2L6D A;  1B48 A;  1RQM A;  2V6O A;  3ZZX A;  2CZ3 A;  2RM6 A;  1SL2 B;  1XW6 A;  1UN2 A;  2L59 A;  4EDY A;  1ERW A;  3O6T A;  5F05 A;  4TR0 A;  1YQ1 A;  3ZRE A;  4CDO A;  1U88 A;  4AF2 A;  1AW9 A;  3EE2 A;  3FY7 A;  3DXB A;  4F82 A;  3FRC A;  2WRT A;  3N5O A;  5HFG A;  4FYC A;  4KSM A;  4K0G A;  3TOU A;  3FHK A;  1FHE A;  3WGE A;  3GKN A;  4MZB A;  3GIX A;  2PWJ A;  3KXO A;  1B4P A;  5DBQ A;  4QL9 A;  1GUM A;  1EEJ A;  2LJR A;  2GQM A;  3MSZ A;  3KH9 A;  20GS A;  3IRA A;  1NSW A;  2WJU A;  1GL8 A;  2LS5 A;  1JLV A;  1XWB A;  4JZQ A;  2IMF A;  2P5R A;  1YEP A;  1EGO A;  1TI3 A;  2V32 A;  2G2Q A;  2DML A;  4NHW A;  3KD0 A;  2VCW A;  1ZOF A;  1B9Y C;  2FWE A;  1DUG A;  1VF3 A;  1SYR A;  2LJK A;  4WET A;  1SK1 A;  3M8N A;  2C0E A;  3UJ1 A;  3IHQ A;  1TK5 B;  4MPG A;  2GDR A;  2HXK A;  1ERV A;  2R2J A;  2VO4 A;  2ZCT A;  2L4Q A;  1B9X C;  3ZYW A;  3H79 A;  3HHV A;  3S9F A;  4NWY A;  1SL0 B;  2M80 A;  2E7P A;  5ECP B;  3QD9 A;  1A2M A;  1XZO A;  3KGK A;  4XS6 A;  3ZMK A;  4GST A;  1ERT A;  22GS A;  4NPB A;  1VF4 A;  3TKS A;  2C1Y A;  4LL4 B;  4HZ4 A;  4E8H A;  4PQ1 A;  2OBI A;  2VL9 A;  3H1N A;  1VGL A;  1Z7P A;  3QCP A;  2J9H A;  1ZYQ B;  4ZL9 A;  1A0R P;  4HOJ A;  4KW6 A;  2DSA A;  2AJQ B;  2VL3 A;  5F06 A;  1M9B A;  3ME8 A;  1AC1 A;  3GA4 A;  2H0G A;  2GQK A;  4FH8 A;  1KEB A;  2YWM A;  3Q74 A;  2H1D A;  3A2W A;  4Q5R A;  4OCF A;  3TKS C;  3EYT A;  5B6M A;  5LNK e;  1PL2 A;  2EIO A;  1UC7 A;  2FUG 2;  3U6V A;  5B7C A;  1U3I A;  1HNA A;  2FHE A;  1Z6N A;  5IPH A;  2GST A;  4KAE A;  1QUW A;  4J56 E;  3ZFB A;  4OFN A;  3A5W A;  2B1L A;  2B3S A;  3VWV A;  2PER A;  3FR9 A;  4BA7 A;  3FEU A;  1MTC A;  3Q18 A;  1WJK A;  2H0H A;  4OCE A;  2F8F A;  3IBH A;  5HR2 A;  5DAL A;  5HFI A;  3MAK A;  1O8X A;  4MJB A;  2OE3 A;  1F2E A;  3F6F A;  1GNW A;  5IMA A;  1HD2 A;  2X64 A;  2TRX A;  3DML A;  4YAP A;  4CHS A;  1K0O A;  3VLN A;  3TRQ A;  2VLV A;  1FG4 A;  3F63 A;  1X5C A;  4ZBA A;  5CRD A;  1O7U A;  3VPT A;  2O7K A;  4IQ1 A;  3UBK A;  1S3C A;  4AJ6 A;  2ALB A;  3L9V A;  3DVW A;  3UL3 A;  1GTU A;  2DIZ A;  2H1A A;  4HU7 A;  4TW5 A;  1BG5 A;  1PRX A;  2K6V A;  4GWR A;  3OR5 A;  3BCI A;  3MNG A;  4TOP A;  4I5Q A;  2CA8 A;  3GH6 A;  2I9H A;  2CZ2 A;  1TRS A;  2AUV A;  2VCX A;  3FYG A;  2YV7 A;  4OWY A;  4TKY A;  1BYE A;  1ZZY A;  16GS A;  2DLX A;  4N0V A;  1QGV A;  2CX4 A;  1XPV A;  1X0R A;  4JED A; 
#chains in the Genus database with same CATH topology
 4HZ2 A;  3R2Q A;  4V2L A;  1E2Y A;  2XPE A;  3GKM A;  4QL7 A;  1JHB A;  3C1S A;  6GSS A;  3KMO A;  3TKQ A;  4MF7 A;  1XWC A;  2A2R A;  3HDC A;  2FY6 A;  2VD1 A;  3APQ A;  4WR5 A;  3TGZ A;  4HS1 A;  1XW9 A;  4FYB A;  1UVZ A;  1T3B A;  4GF0 A;  2FD3 A;  2C3Q A;  1N2A A;  1V2A A;  4FIW A;  4HEA 2;  5D9X A;  3K8N A;  4NV5 A;  4PGT A;  1Z6M A;  4KDY A;  5G2Z A;  3HVS A;  3GH9 A;  4N0Z A;  4G0L A;  1TU8 A;  1TDI A;  2BTO T;  4GSN A;  1HQO A;  1EZK A;  5D9V A;  1YF0 A;  1YJ6 A;  4K1F A;  2NPB A;  5E59 A;  4F0B A;  1GTI A;  1NHY A;  4MMM A;  1AAZ A;  3GTU A;  2PPT A;  1Z7R A;  3QMX A;  1R26 A;  2FNO A;  2GSQ A;  3FMW A;  2PVQ A;  4TXV A;  2DJJ A;  2HI7 A;  5CRH A;  3CQF A;  2IL3 A;  3Q6O A;  2H70 A;  4IP6 A;  3RDW A;  2NTO A;  2VIM A;  1KNG A;  8GSS A;  4Q5F A;  2OAD A;  2F8A A;  4IHU A;  2LRN A;  3I6A A;  13GS A;  4K7O A;  4RI7 A;  5J9B A;  5KN3 A;  1U87 A;  4ML6 A;  2WB9 A;  3ZL5 A;  2JZS A;  4IBP A;  1T4Y A;  4XTS A;  2IJY A;  3F4T A;  1FB6 A;  3JCM L;  1OC3 A;  5JCG A;  2KOK A;  1FO5 A;  2MMO A;  1TRW A;  2DJ1 A;  3BJ5 A;  1TK8 B;  4JR6 A;  5GZZ B;  3MIX A;  3GX8 A;  1XG8 A;  5KN1 A;  1K0C A;  2H66 A;  4BWQ A;  1Z5Y E;  2QA1 A;  1MDK A;  4J2F A;  3F4S A;  2ES7 A;  3UAP A;  2M72 A;  2VL2 A;  3L4N A;  3NZN A;  3RHB A;  1V9W A;  4IN0 A;  5J3R A;  4KUN A;  1SJ6 A;  3GMF A;  1BX9 A;  2C3T A;  1PA3 A;  17GS A;  4PUA A;  3KP9 A;  5A4V A;  2VCZ A;  2C3N A;  3EU3 A;  2YOI A;  2YWN A;  3TCO A;  5GAP D;  4ZBB A;  3GRX A;  2F3M A;  3G7J A;  3ZML A;  3UVH A;  6GSY A;  5IQY A;  1TTZ A;  2R0G A;  2HSH A;  2OAC A;  2OA7 A;  12GS A;  4XRA A;  2DJ2 A;  4MP4 A;  6GSW A;  2YWI A;  5JCU A;  4BVY A;  5HR3 A;  3TKS E;  3IDV A;  3GHA A;  10GS A;  2YN1 A;  4X4J A;  4IVF A;  4WBR D;  1E6B A;  1SD8 A;  3KP8 A;  3GUR A;  4K5S A;  2R0C A;  1EWX A;  4N30 A;  1NW2 A;  4L0U A;  1OE7 A;  2H74 A;  2GS3 A;  1M2A A;  1XWA A;  1ST9 A;  4HU9 A;  3DD3 A;  3CXG A;  2RM5 A;  4TVE A;  4V1A g;  1SKW B;  4GTU A;  5B6N A;  1HYU A;  1W4V A;  3LWA A;  3TJK A;  4KCA A;  1QFN A;  3VWU A;  2YNX A;  2C4J A;  1HNC A;  2FCH A;  4IJI A;  2LV3 A;  1PN0 A;  2FWF A;  2PU9 C;  4MZC A;  1QMV A;  9GSS A;  3GST A;  2WDU A;  4K7N A;  2LKU A;  11GS A;  2AYT A;  3DEX A;  3DVX A;  4FQU A;  4K6X A;  2O87 A;  2DJK A;  2I81 A;  4HSC X;  5H5R A;  3F9U A;  3EMP A;  4IEL A;  2L5L A;  2NBS A;  4XRD A;  3WYW A;  2MMN A;  2LNT A;  3WT2 A;  3CSI A;  5BRT A;  2CVK A;  1GP1 A;  3L9S A;  2JSY A;  2X4A A;  3E9J B;  4PNF A;  3KIJ A;  1O81 A;  3TJF A;  1WWJ A;  3D4T A;  3F3R A;  2JAC A;  5HFK A;  1JZD A;  1YZX A;  3ZIJ A;  2FGX A;  1FOV A;  1PD2 1;  2B5X A;  1KBN A;  3GKK A;  4NAX A;  4J57 E;  5ECO B;  2DMM A;  1AXD A;  3C1R A;  5BMU A;  5CYY A;  4DVC A;  4CW9 A;  4K2X A;  3GFK A;  2R5G A;  2CVD A;  3M1G A;  5JWR B;  1A0F A;  1GUH A;  3HJO A;  2VLT A;  3TKR A;  1XCC A;  1SYX A;  4HJM A;  3VWW A;  3TUE A;  3DRN A;  4MAB A;  1QQ2 A;  3D0Z A;  4IKH A;  3RAZ A;  4BVX A;  4K7I A;  6GSX A;  3KEB A;  4OMV A;  4POB A;  4DSS A;  4MLY A;  5CO3 A;  3VWX A;  3HZ4 A;  5IO2 A;  2RII A;  3QFB C;  1NM3 A;  3PR8 A;  3TDG A;  4I97 A;  1QXH A;  2H75 A;  1XFL A;  3LEF A;  1GUL A;  5JWO B;  2R0P A;  1XVW A;  4NMU A;  4O5Q A;  4F2I A;  1FVJ A;  4Z2R A;  3IC8 A;  2F51 A;  6GST A;  4K5R A;  1ON4 A;  1WPI A;  3GNJ A;  1MEK A;  2V1M A;  1MDI A;  1O73 A;  2YWO A;  2GQL A;  3F6D A;  4L5L A;  4AGS A;  2GSS A;  4TR3 A;  2Z9S A;  4MDC A;  1JZW A;  2N5B A;  3W8J A;  3CBU A;  1YDK A;  2FLS A;  4KGI A;  3HVN A;  5ECL B;  5C04 A;  4N10 A;  2H01 A;  3FZ4 A;  1AQW A;  3ERG A;  1EOH A;  2A4H A;  3QAV A;  2HZE A;  4LA1 A;  2CV4 A;  1PMT A;  4XCS A;  5DQS A;  4DSQ A;  2AB6 A;  1QK8 A;  3KZQ A;  5D93 A;  3ZIV A;  4YAV A;  2GT6 A;  5AGY A;  2H71 A;  3HYP A;  2OJL A;  1B8X A;  3SBC A;  4ILF A;  1S3R A;  2WS2 A;  1THO A;  2VCQ A;  4IQA A;  2ON5 A;  1WMJ A;  5F8B A;  1TK0 B;  5J41 A;  1ILO A;  3VFI A;  2P31 A;  5ECN B;  3EIN A;  1GH2 A;  3EWL A;  2CAQ A;  3QAG A;  3LQ7 A;  1AIU A;  2HRF A;  2H72 A;  5CP1 A;  4QQ7 A;  4TN8 A;  4P3Y B;  4O7H A;  2YZU A;  2VCV A;  4HUA A;  5CAX A;  2HZF A;  3CTF A;  3LFL A;  4EUY A;  3HKR A;  1M3I A;  1XWG A;  1A23 A;  2QKE A;  4EO3 A;  1SJZ A;  5IOW A;  5KN2 A;  2JL4 A;  5EVO A;  3F0I A;  1K0M A;  4EE0 A;  5D8I A;  4EKZ A;  4EVM A;  1K3Y A;  5C00 A;  2KP1 A;  1YKC A;  18GS A;  2VOC A;  4I2U A;  5ENU A;  1VRS D;  3LXZ A;  1A8L A;  3MWH A;  5KN0 A;  1FVK A;  2EC4 A;  4H86 A;  1OAZ A;  3DWV A;  1SK2 A;  3IAS 2;  4KF9 A;  2V6K A;  1K0B A;  1K3L A;  4LMV A;  4GXZ A;  5IM9 A;  5IO0 A;  3F3Q A;  1A2L A;  4KE3 A;  1URM A;  4ID0 A;  2HE3 A;  2C0F A;  4IJ3 A;  3HA9 A;  2PGT A;  2IMK A;  1KTE A;  3P7X A;  1F3B A;  2HZE B;  4NV2 A;  4ZL7 A;  1I9D A;  5AN1 A;  4TR4 A;  4ECJ A;  4Z7X A;  4Q5N A;  2H6X A;  3ZIT A;  4USS A;  4LMW A;  3DKS A;  2O8V B;  4JBB A;  3IK9 A;  1EV4 A;  1H75 A;  2TIR A;  2DJ3 A;  3APO A;  1TI1 A;  4HI7 A;  2HLS A;  4DEJ A;  4K2D A;  3EU4 A;  1YEX A;  1C72 A;  2X8C A;  1JFU A;  2MBT A;  1OKD A;  3GL5 A;  4KDU A;  1V57 A;  1M99 A;  2L5O A;  2CAI A;  3PPU A;  3M9K A;  1PQN A;  1GNE A;  4G10 A;  2OE1 A;  4OFT A;  1FB0 A;  2KUC A;  2YP6 A;  3WGD A;  1VF1 A;  2L57 A;  1G0T A;  1ZCP A;  1ZYP A;  3NIV A;  5AIV A;  1RK4 A;  1ML6 A;  3L0H A;  3MDK A;  4WR4 A;  2BJX A;  5CNW A;  1GTA A;  2LTK A;  3N9J A;  5AIX A;  1PFO A;  2X99 A;  4WBJ A;  4EDZ A;  3F4R A;  4EC0 A;  4TR1 A;  4OO5 A;  3BBY A;  5IMD A;  1WIK A;  2XBQ A;  1PL1 A;  2R6K A;  3ZLP A;  1OC8 A;  2VM2 A;  5J9C A;  5DAL B;  3H93 A;  1PGT A;  2B7K A;  2E2M A;  4IGJ A;  14GS A;  3J7Y k;  4YKG A;  2YCD A;  1M2B A;  4JE1 A;  2HSY A;  4MK3 A;  5DJL A;  1AQV A;  3Q19 A;  1ZL9 A;  2H1B A;  4Z2U A;  2CX3 A;  1GWC A;  2IN3 A;  4F0C A;  1T8E B;  1FAA A;  5G31 A;  4I2T A;  2P0G A;  3HY2 A;  1ACV A;  4X43 A;  3IV4 A;  2MYG A;  1TU7 A;  3D22 A;  5F07 A;  3D6I A;  5G30 A;  3A2X A;  5DAK A;  4CY6 A;  1U3A A;  1R7H A;  4LLR A;  1PKW A;  4O32 A;  3FZA A;  1HNB A;  1G7E A;  4FYU A;  5CRG A;  2C80 A;  6GSU A;  1WP0 A;  5DVB A;  1Q4J A;  4EF0 A;  4ACS A;  2B5Y A;  3TJG A;  3CMI A;  4ZBD A;  5D96 A;  1JZO A;  4D73 A;  2E2G A;  3W6G A;  3ZVJ A;  3FR3 A;  3C8E A;  2V2G A;  5EY6 A;  4GLT A;  2CVB A;  1SKR B;  3QOU A;  3UEM A;  4Q5Q A;  3EC3 A;  3UVT A;  2FWG A;  3QAW A;  2I1U A;  4ECB A;  4G2E A;  3ED3 A;  2ON7 A;  3UBL A;  3SWL A;  4YQV A;  4E8E A;  2B6M A;  2H6Y A;  1BED A;  2GZY A;  2CT6 A;  2O89 A;  2H30 A;  1OE8 A;  1LBK A;  4BIK A;  3KH7 A;  3UIW A;  1XWK A;  2A2S A;  5IMV A;  2H0I A;  1DBY A;  1ZGN A;  2PMT A;  3WD6 A;  4IS0 A;  1W89 A;  5E4W A;  1MD3 A;  5JCW A;  4MF5 A;  2K8S A;  1MDJ A;  2GT5 A;  2K8V A;  4NHZ A;  4TR1 B;  3FKF A;  4MJE A;  2XBI A;  1TOF A;  3O3T A;  2LQQ A;  4V2N A;  2L6C A;  3ZVJ D;  2YV9 A;  3GTU B;  5G5F A;  4ZB8 A;  2YJ7 A;  1GSS A;  4AJ8 A;  2DJ0 A;  5FT3 A;  5A5K A;  1IYH A;  2X8H A;  3GSS A;  1T00 A;  3IXR A;  3I69 A;  4XS1 A;  3P90 A;  4ZXG A;  3M3M A;  4BPY A;  2A4V A;  5H5Q A;  3VI5 A;  2I3Y A;  7GSS A;  1GUK A;  1ZYE A;  3UMA A;  1F3A A;  2KP2 A;  1T1V A;  5D73 A;  5IOX A;  1ZMA A;  2X49 A;  3QFA C;  5DJM A;  2JSZ A;  5DAK B;  3J7Y b;  2C8U A;  1WOU A;  4ZIL A;  4YKF A;  2YAN A;  2HSM A;  1TP9 A;  3G9B A;  2VCT A;  5CRE A;  3QDN A;  2P5Q A;  2MMA A;  2VAF A;  4ZL8 A;  4GQF A;  3P2A A;  1GLQ A;  5ELA A;  3H8Q A;  2VLU A;  2HT9 A;  2PVO C;  4POL A;  1CQH A;  3L78 A;  4ML1 A;  1T4Z A;  5ID2 A;  4JRR A;  2I4A A;  5D9W A;  2KHP A;  3VI7 A;  2V41 A;  5G5E A;  4XIH A;  5J5N A;  2WUL A;  1MD4 A;  3IA1 A;  5ABR A;  2GZZ A;  2LRC A;  4GQC A;  4NXI A;  2GVP A;  2OBK A;  1GRX A;  1J9B A;  4ZIJ A;  1O6J A;  3TJB A;  1YY7 A;  2B5E A;  1XBS A;  2GGT A;  3UAR A;  5ECQ B;  4KB3 A;  3EUR A;  2IPA A;  4KND A;  2QSI A;  1PSQ A;  1XXU A;  5IMF A;  3PIN A;  1PN9 A;  2B1K A;  5DDL A;  4BVY B;  2JZR A;  1ERU A;  4HQZ A;  3GV1 A;  4RUV A;  1WRY A;  4XHM A;  1USB A;  1J0F A;  2WFC A;  4V2M A;  2DKI A;  3D4M A;  4ICY A;  1U6T A;  1EEM A;  1X5E A;  4KCE A;  1N8J A;  3D21 A;  1OC9 A;  3FR6 A;  3U5R E;  4PQH A;  1X9W B;  3GKX A;  1AUC A;  2N5A A;  1DSB A;  3GX0 A;  5D9T A;  3C71 A;  1F9M A;  3IPZ A;  1UA5 A;  3M9J A;  5HR0 A;  4MH2 A;  3I43 A;  3FZ5 A;  2H8L A;  1PKZ A;  5ECM B;  3NOF A;  5IMZ A;  5DCG A;  5AIS A;  1XOB A;  2GTU A;  5J4U A;  2VUP A;  1GSU A;  3ISO A;  3IHG A;  4MCU A;  4KH7 A;  1SEN A;  3RBT A;  2PN8 A;  1S3A A;  2N5F A;  1JLW A;  4JR4 A;  4ISD A;  4OO4 A;  1X5D A;  3EVI A;  1TKD B;  1Z9H A;  3IK7 A;  1TW9 A;  3KJY A;  4MH3 A;  4MF6 A;  2J23 A;  3RHC A;  5ID2 B;  1XIY A;  4IW9 A;  4K0N A;  4XS4 A;  3AY8 A;  2LQO A;  1K0D A;  5IPG A;  4PX1 A;  3ZRD A;  5IIZ A;  1M9A A;  3LSZ A;  1XOA A;  2CQ9 A;  1BJX A;  3PH9 A;  5ECI B;  4MZW A;  1Y6E A;  3IE3 A;  2LEG A;  3HJP A;  3HVX A;  5B8B A;  4RQR A;  2REM A;  3BOA A;  2AHE A;  1EGR A;  3CRT A;  3L9U A;  1FW1 A;  1LU4 A;  4BVX B;  2ZUP A;  3O76 A;  2WCI A;  4DSS B;  2RUF A;  4KX4 A;  2FWH A;  4RI6 A;  3CTG A;  1K3O A;  2F9S A;  3D5J A;  1BQ7 A;  1YF1 A;  4BWS A;  5G1K A;  1OC9 B;  4GCI A;  5KEJ A;  4PTS A;  2H76 A;  1IYI A;  6GSV A;  2MBS A;  2XHF A;  2FA8 A;  4LL1 B;  4KDX A;  2OE0 A;  2BMX A;  5HQP A;  3H4K A;  4GRF A;  3V1W A;  1A24 A;  3ME7 A;  2PUK C;  1K0N A;  2E0Q A;  4I8B A;  3GL3 A;  1PX6 A;  1G6W A;  1GSE A;  2UZ8 A;  2GLR A;  5CRW A;  2XC2 A;  1NHO A;  4F03 A;  2JZT A;  4HDE A;  4JU5 A;  3A3T A;  4POK A;  1OYJ A;  3KTL A;  1M0U A;  3CYN A;  3G7I A;  1B4Q A;  4TRX A;  1TRV A;  2QGV A;  3BD2 A;  3HXS A;  1T7P B;  3TOT A;  4V1A p;  4G9H A;  4GSS A;  5A4U A;  1FOH A;  1OVN A;  4L0W A;  4YQM A;  4N11 A;  4FO5 A;  2DBC A;  2H6Z A;  2ZNM A;  1G7O A;  4XS4 B;  2KLX A;  5ECK B;  1XVQ A;  1X9M B;  1GSD A;  2HNL A;  3IAM 2;  1SKS B;  3FK8 A;  5JWQ B;  2HRN A;  1LJR A;  4ZB9 A;  1DE1 A;  3US3 A;  2PBJ A;  19GS A;  2HRK A;  3CRU A;  4L5O A;  2LST A;  2IME A;  4ECC A;  1ZYN A;  4IP1 A;  3LGC A;  3RPN A;  3VPQ A;  4TXO A;  3TJJ A;  1THX A;  4O92 A;  3TB2 A;  4F9Z A;  2DC5 A;  1V40 A;  1JZR A;  1TXX A;  1Y25 A;  5H5S A;  1X9S B;  3E0U A;  1M7T A;  4X0X A;  5ECH B;  3KMN A;  1GSQ A;  1F37 A;  5LCZ A;  1SD9 A;  2IFQ A;  3RPP A;  4ECI A;  4DSR A;  3GN3 A;  1R4W A;  3KCM A;  2QA2 A;  2K18 A;  1SJI A;  5LD0 A;  1EOG A;  3WGX A;  3TRP A;  2LNS A;  5A4W A;  1S3D A;  2RLI A;  1J08 A;  3ERW A;  4WXT A;  4O5R A;  1GTB A;  2R4V A;  5ECR B;  3A2V A;  1R5A A;  2TRC P;  5FHI A;  1TRU A;  5INY A;  4BL7 A;  1BAY A;  1H4O A;  3LJR A;  5ELG A;  2A2P A;  4HJ2 A;  1EP8 A;  4POM A;  3VK9 A;  3KM6 A;  3TKP A;  3DIE A;  2R37 A;  3LYK A;  3VUR A;  2IWT A;  2VM1 A;  1SU9 A;  2H1G A;  4WF4 A;  2B7J A;  3LG6 A;  2NDO A;  1A8Y A;  3I9V 2;  2MZC A;  4WF5 A;  3PGT A;  2EIR A;  2OKA A;  1SK0 A;  4PUR A;  2DIY A;  5FWG A;  2WZ9 A;  5G1L A;  5GST A;  3WT1 A;  3IOS A;  3DYR A;  3ZFL A;  4EIQ A;  2H73 A;  1Z3E A;  1I5G A;  1F6M C;  3HZ8 A;  1EP7 A;  1SL1 B;  4AJ7 A;  5L71 A;  2EIQ A;  2M46 A;  5GAN D;  4MJA A;  4G0K A;  2O85 A;  3GUS A;  3LYP A;  4PXO A;  3ZTL A;  4MPF A;  3IC4 A;  2AV4 A;  2LRT A;  1YKA A;  4RQX A;  2IMD A;  1EV9 A;  1OKT A;  3DGQ A;  2NVL A;  2XPD A;  2D2Z A;  4EL1 A;  3A5I A;  5DQY A;  4PNG A;  4G19 A;  1VF2 A;  2H19 A;  2WGR A;  4TXO B;  2AAW A;  2IIY A;  3FW2 A;  4K8M A;  2K9F A;  2C0G A;  2YPM A;  3KTB A;  1O8W A;  3W8S A;  2C0D A;  2L4C A;  3E3E A;  2IFQ B;  2VL2 C;  5IMC A;  1PX7 A;  1ABA A;  3LXT A;  4YH2 A;  4OFM A;  4KA0 A;  4WKW A;  2IMI A;  3ERF A;  1A2J A;  2LJA A;  4PUF C;  1AQX A;  1V58 A;  5ECS A;  5EL8 A;  1XW5 A;  1G6Y A;  2DKH A;  3HCZ A;  5F0G A;  2GSR A;  2R3X A;  2JU5 A;  4ZB6 A;  4OD7 A;  2HYX A;  5COH A;  1K0A A;  2FA4 A;  1GLP A;  2YZH A;  3LW9 A;  5EPF A;  3UOM A;  3QR6 A;  3F8U A;  2GZP A;  4PQI A;  3APS A;  4MJC A;  3CSH A;  4BL7 B;  3QPM A;  5B8A A;  4K9Z A;  2VD0 A;  5GSS A;  2X8G A;  1M2D A;  3M0F A;  4ULX A;  1RW1 A;  2QC7 A;  4EXJ A;  4WEY A;  3P8W A;  4KSO A;  3TRX A;  4I6X A;  4L8E A;  3C73 A;  1TJD A;  1GSY A;  4D73 B;  5DCH A;  4MA9 A;  1WE0 A;  3HD5 A;  1Q98 A;  4X1U A;  1CQG A;  1GSF A;  3IR4 A;  2HFD A;  4G0I A;  2JAD A;  1V98 A;  2MMZ A;  3BCK A;  2RUE A;  3EMX A;  1DE2 A;  3HVV A;  2YJH A;  4HQS A;  2LUS A;  3C7M A;  5HR1 A;  1R5P A;  1O85 A;  3FZ9 A;  3CSJ A;  4YQU A;  3GYK A;  3LOR A;  3G7Y A;  2G0F A;  3HJM A;  2L6D A;  1B48 A;  1RQM A;  2V6O A;  3ZZX A;  2CZ3 A;  2RM6 A;  1SL2 B;  1XW6 A;  1UN2 A;  2L59 A;  4EDY A;  1ERW A;  3O6T A;  5F05 A;  4TR0 A;  1YQ1 A;  3ZRE A;  4CDO A;  1U88 A;  4AF2 A;  1AW9 A;  3EE2 A;  3FY7 A;  3DXB A;  4F82 A;  3FRC A;  2WRT A;  3N5O A;  5HFG A;  4FYC A;  4KSM A;  4K0G A;  3TOU A;  3FHK A;  1FHE A;  3WGE A;  3GKN A;  4MZB A;  3GIX A;  2PWJ A;  3KXO A;  1B4P A;  5DBQ A;  4QL9 A;  1GUM A;  1EEJ A;  2LJR A;  2GQM A;  3MSZ A;  3KH9 A;  20GS A;  3IRA A;  1NSW A;  2WJU A;  1GL8 A;  2LS5 A;  1JLV A;  1XWB A;  4JZQ A;  2IMF A;  2P5R A;  1YEP A;  1EGO A;  1TI3 A;  2V32 A;  2G2Q A;  2DML A;  4NHW A;  3KD0 A;  2VCW A;  1ZOF A;  1B9Y C;  2FWE A;  1DUG A;  1VF3 A;  1SYR A;  2LJK A;  4WET A;  1SK1 A;  3M8N A;  4O5U A;  2C0E A;  3UJ1 A;  3IHQ A;  1TK5 B;  4MPG A;  2GDR A;  2HXK A;  1ERV A;  2R2J A;  2VO4 A;  2ZCT A;  2L4Q A;  1B9X C;  3ZYW A;  3H79 A;  3HHV A;  3S9F A;  4NWY A;  1SL0 B;  2M80 A;  2E7P A;  5ECP B;  3QD9 A;  1A2M A;  1XZO A;  3KGK A;  4XS6 A;  3ZMK A;  4GST A;  1ERT A;  22GS A;  1M3J A;  5KOX A;  4NPB A;  1VF4 A;  3TKS A;  2C1Y A;  4LL4 B;  4HZ4 A;  4E8H A;  4PQ1 A;  2OBI A;  2VL9 A;  3H1N A;  1VGL A;  1Z7P A;  3QCP A;  2J9H A;  1ZYQ B;  4ZL9 A;  1A0R P;  4HOJ A;  4Z2T A;  4CY8 A;  4KW6 A;  2DSA A;  2AJQ B;  2VL3 A;  5F06 A;  1M9B A;  3ME8 A;  1AC1 A;  3GA4 A;  2H0G A;  2GQK A;  4FH8 A;  3EPT A;  1KEB A;  2YWM A;  4A5P A;  3Q74 A;  2H1D A;  3A2W A;  4Q5R A;  4OCF A;  3TKS C;  3EYT A;  5B6M A;  5LNK e;  1PL2 A;  2EIO A;  1UC7 A;  2FUG 2;  3U6V A;  5B7C A;  1U3I A;  1HNA A;  2FHE A;  1Z6N A;  5IPH A;  2GST A;  4KAE A;  1QUW A;  5KOW A;  4J56 E;  3ZFB A;  4OFN A;  3A5W A;  2B1L A;  2B3S A;  3VWV A;  2PER A;  3FR9 A;  4BA7 A;  3FEU A;  1MTC A;  3Q18 A;  1WJK A;  3R3E A;  2H0H A;  4OCE A;  2F8F A;  3IBH A;  5HR2 A;  5DAL A;  5HFI A;  3MAK A;  1O8X A;  4MJB A;  2OE3 A;  1F2E A;  3F6F A;  1GNW A;  5IMA A;  1HD2 A;  2X64 A;  2TRX A;  3DML A;  4YAP A;  4EIP A;  4CHS A;  1K0O A;  3VLN A;  3TRQ A;  2VLV A;  1FG4 A;  3F63 A;  1X5C A;  4ZBA A;  5CRD A;  1O7U A;  3VPT A;  2O7K A;  4IQ1 A;  3UBK A;  1S3C A;  4AJ6 A;  2ALB A;  3L9V A;  3DVW A;  3UL3 A;  1GTU A;  2DIZ A;  2H1A A;  2HRA A;  4HU7 A;  4TW5 A;  1BG5 A;  3MYD A;  1PRX A;  2K6V A;  4GWR A;  3OR5 A;  3BCI A;  3MNG A;  4TOP A;  4I5Q A;  2CA8 A;  3GH6 A;  2I9H A;  2CZ2 A;  1TRS A;  2AUV A;  2VCX A;  3FYG A;  2YV7 A;  4OWY A;  4TKY A;  1BYE A;  1ZZY A;  16GS A;  2DLX A;  4N0V A;  1QGV A;  2CX4 A;  1XPV A;  1X0R A;  4MNN A;  4JED A; 
#chains in the Genus database with same CATH homology
 4HZ2 A;  3R2Q A;  4V2L A;  1E2Y A;  2XPE A;  3GKM A;  4QL7 A;  1JHB A;  3C1S A;  6GSS A;  3KMO A;  3TKQ A;  4MF7 A;  1XWC A;  2A2R A;  3HDC A;  2FY6 A;  2VD1 A;  3APQ A;  4WR5 A;  3TGZ A;  4HS1 A;  1XW9 A;  4FYB A;  1UVZ A;  1T3B A;  4GF0 A;  2FD3 A;  2C3Q A;  1N2A A;  1V2A A;  4FIW A;  4HEA 2;  5D9X A;  3K8N A;  4NV5 A;  4PGT A;  1Z6M A;  4KDY A;  5G2Z A;  3HVS A;  3GH9 A;  4N0Z A;  4G0L A;  1TU8 A;  1TDI A;  2BTO T;  4GSN A;  1HQO A;  1EZK A;  5D9V A;  1YF0 A;  1YJ6 A;  4K1F A;  2NPB A;  5E59 A;  4F0B A;  1GTI A;  1NHY A;  4MMM A;  1AAZ A;  3GTU A;  2PPT A;  1Z7R A;  3QMX A;  1R26 A;  2FNO A;  2GSQ A;  3FMW A;  2PVQ A;  4TXV A;  2DJJ A;  2HI7 A;  5CRH A;  2IL3 A;  3Q6O A;  2H70 A;  4IP6 A;  3RDW A;  2NTO A;  2VIM A;  1KNG A;  8GSS A;  4Q5F A;  2OAD A;  2F8A A;  4IHU A;  2LRN A;  3I6A A;  13GS A;  4K7O A;  4RI7 A;  5J9B A;  5KN3 A;  1U87 A;  4ML6 A;  2WB9 A;  3ZL5 A;  2JZS A;  4IBP A;  1T4Y A;  4XTS A;  2IJY A;  3F4T A;  1FB6 A;  3JCM L;  1OC3 A;  5JCG A;  2KOK A;  1FO5 A;  2MMO A;  1TRW A;  2DJ1 A;  3BJ5 A;  1TK8 B;  4JR6 A;  5GZZ B;  3MIX A;  3GX8 A;  5KN1 A;  1K0C A;  2H66 A;  4BWQ A;  1Z5Y E;  2QA1 A;  1MDK A;  4J2F A;  3F4S A;  2ES7 A;  3UAP A;  2M72 A;  2VL2 A;  3L4N A;  3NZN A;  3RHB A;  1V9W A;  4IN0 A;  5J3R A;  4KUN A;  1SJ6 A;  3GMF A;  1BX9 A;  2C3T A;  1PA3 A;  17GS A;  4PUA A;  3KP9 A;  5A4V A;  2VCZ A;  2C3N A;  3EU3 A;  2YOI A;  2YWN A;  3TCO A;  5GAP D;  4ZBB A;  3GRX A;  2F3M A;  3G7J A;  3ZML A;  3UVH A;  6GSY A;  5IQY A;  1TTZ A;  2R0G A;  2HSH A;  2OAC A;  2OA7 A;  12GS A;  4XRA A;  2DJ2 A;  4MP4 A;  6GSW A;  2YWI A;  5JCU A;  4BVY A;  5HR3 A;  3TKS E;  3IDV A;  3GHA A;  10GS A;  2YN1 A;  4X4J A;  4IVF A;  4WBR D;  1E6B A;  1SD8 A;  3KP8 A;  3GUR A;  4K5S A;  2R0C A;  1EWX A;  4N30 A;  1NW2 A;  4L0U A;  1OE7 A;  2H74 A;  2GS3 A;  1M2A A;  1XWA A;  1ST9 A;  4HU9 A;  3DD3 A;  3CXG A;  2RM5 A;  4TVE A;  4V1A g;  1SKW B;  4GTU A;  5B6N A;  1HYU A;  1W4V A;  3LWA A;  3TJK A;  4KCA A;  1QFN A;  3VWU A;  2YNX A;  2C4J A;  1HNC A;  2FCH A;  4IJI A;  2LV3 A;  1PN0 A;  2FWF A;  2PU9 C;  4MZC A;  1QMV A;  9GSS A;  3GST A;  2WDU A;  4K7N A;  2LKU A;  11GS A;  2AYT A;  3DEX A;  3DVX A;  4FQU A;  4K6X A;  2O87 A;  2DJK A;  2I81 A;  5H5R A;  3F9U A;  3EMP A;  4IEL A;  2L5L A;  2NBS A;  4XRD A;  3WYW A;  2MMN A;  2LNT A;  3WT2 A;  3CSI A;  5BRT A;  2CVK A;  1GP1 A;  3L9S A;  2JSY A;  2X4A A;  3E9J B;  4PNF A;  3KIJ A;  1O81 A;  3TJF A;  1WWJ A;  3D4T A;  3F3R A;  2JAC A;  5HFK A;  1JZD A;  1YZX A;  3ZIJ A;  2FGX A;  1FOV A;  1PD2 1;  2B5X A;  1KBN A;  3GKK A;  4NAX A;  4J57 E;  5ECO B;  2DMM A;  1AXD A;  3C1R A;  5BMU A;  5CYY A;  4DVC A;  4CW9 A;  4K2X A;  3GFK A;  2R5G A;  2CVD A;  3M1G A;  5JWR B;  1A0F A;  1GUH A;  3HJO A;  2VLT A;  3TKR A;  1XCC A;  1SYX A;  4HJM A;  3VWW A;  3TUE A;  3DRN A;  4MAB A;  1QQ2 A;  3D0Z A;  4IKH A;  3RAZ A;  4BVX A;  4K7I A;  6GSX A;  3KEB A;  4OMV A;  4POB A;  4DSS A;  4MLY A;  5CO3 A;  3VWX A;  3HZ4 A;  5IO2 A;  2RII A;  3QFB C;  1NM3 A;  3PR8 A;  3TDG A;  4I97 A;  1QXH A;  2H75 A;  1XFL A;  3LEF A;  1GUL A;  5JWO B;  2R0P A;  1XVW A;  4NMU A;  4O5Q A;  4F2I A;  1FVJ A;  4Z2R A;  3IC8 A;  2F51 A;  6GST A;  4K5R A;  1ON4 A;  1WPI A;  3GNJ A;  1MEK A;  2V1M A;  1MDI A;  1O73 A;  2YWO A;  2GQL A;  3F6D A;  4L5L A;  4AGS A;  2GSS A;  4TR3 A;  2Z9S A;  4MDC A;  1JZW A;  2N5B A;  3W8J A;  3CBU A;  1YDK A;  2FLS A;  4KGI A;  5ECL B;  5C04 A;  4N10 A;  2H01 A;  3FZ4 A;  1AQW A;  3ERG A;  1EOH A;  2A4H A;  3QAV A;  2HZE A;  4LA1 A;  2CV4 A;  1PMT A;  4XCS A;  5DQS A;  4DSQ A;  2AB6 A;  1QK8 A;  3KZQ A;  5D93 A;  3ZIV A;  4YAV A;  2GT6 A;  5AGY A;  2H71 A;  3HYP A;  2OJL A;  1B8X A;  3SBC A;  4ILF A;  2WS2 A;  1THO A;  2VCQ A;  4IQA A;  2ON5 A;  1WMJ A;  5F8B A;  1TK0 B;  5J41 A;  1ILO A;  3VFI A;  2P31 A;  5ECN B;  3EIN A;  1GH2 A;  3EWL A;  2CAQ A;  3QAG A;  3LQ7 A;  1AIU A;  2HRF A;  2H72 A;  5CP1 A;  4QQ7 A;  4TN8 A;  4P3Y B;  4O7H A;  2YZU A;  2VCV A;  4HUA A;  5CAX A;  2HZF A;  3CTF A;  3LFL A;  4EUY A;  3HKR A;  1XWG A;  1A23 A;  2QKE A;  4EO3 A;  1SJZ A;  5IOW A;  5KN2 A;  2JL4 A;  5EVO A;  3F0I A;  1K0M A;  4EE0 A;  5D8I A;  4EKZ A;  4EVM A;  1K3Y A;  5C00 A;  2KP1 A;  1YKC A;  18GS A;  2VOC A;  4I2U A;  5ENU A;  1VRS D;  3LXZ A;  1A8L A;  3MWH A;  5KN0 A;  1FVK A;  2EC4 A;  4H86 A;  1OAZ A;  3DWV A;  1SK2 A;  3IAS 2;  4KF9 A;  2V6K A;  1K0B A;  1K3L A;  4LMV A;  4GXZ A;  5IM9 A;  5IO0 A;  3F3Q A;  1A2L A;  4KE3 A;  1URM A;  4ID0 A;  2HE3 A;  2C0F A;  4IJ3 A;  3HA9 A;  2PGT A;  2IMK A;  1KTE A;  3P7X A;  1F3B A;  2HZE B;  4NV2 A;  4ZL7 A;  1I9D A;  5AN1 A;  4TR4 A;  4ECJ A;  4Z7X A;  4Q5N A;  2H6X A;  3ZIT A;  4USS A;  4LMW A;  3DKS A;  2O8V B;  4JBB A;  3IK9 A;  1EV4 A;  1H75 A;  2TIR A;  2DJ3 A;  3APO A;  1TI1 A;  4HI7 A;  2HLS A;  4DEJ A;  4K2D A;  3EU4 A;  1YEX A;  1C72 A;  2X8C A;  1JFU A;  2MBT A;  1OKD A;  3GL5 A;  4KDU A;  1V57 A;  1M99 A;  2L5O A;  2CAI A;  3PPU A;  3M9K A;  1PQN A;  1GNE A;  4G10 A;  2OE1 A;  4OFT A;  1FB0 A;  2KUC A;  2YP6 A;  3WGD A;  1VF1 A;  2L57 A;  1G0T A;  1ZCP A;  1ZYP A;  3NIV A;  5AIV A;  1RK4 A;  1ML6 A;  3L0H A;  3MDK A;  4WR4 A;  2BJX A;  5CNW A;  1GTA A;  2LTK A;  3N9J A;  5AIX A;  2X99 A;  4WBJ A;  4EDZ A;  3F4R A;  4EC0 A;  4TR1 A;  4OO5 A;  3BBY A;  5IMD A;  1WIK A;  2XBQ A;  1PL1 A;  2R6K A;  3ZLP A;  1OC8 A;  2VM2 A;  5J9C A;  5DAL B;  3H93 A;  1PGT A;  2B7K A;  2E2M A;  4IGJ A;  14GS A;  3J7Y k;  4YKG A;  2YCD A;  1M2B A;  4JE1 A;  2HSY A;  4MK3 A;  5DJL A;  1AQV A;  3Q19 A;  1ZL9 A;  2H1B A;  4Z2U A;  2CX3 A;  1GWC A;  2IN3 A;  4F0C A;  1T8E B;  1FAA A;  5G31 A;  4I2T A;  2P0G A;  3HY2 A;  1ACV A;  4X43 A;  3IV4 A;  2MYG A;  1TU7 A;  3D22 A;  5F07 A;  3D6I A;  5G30 A;  3A2X A;  5DAK A;  4CY6 A;  1U3A A;  1R7H A;  4LLR A;  1PKW A;  4O32 A;  3FZA A;  1HNB A;  1G7E A;  4FYU A;  5CRG A;  2C80 A;  6GSU A;  1WP0 A;  5DVB A;  1Q4J A;  4EF0 A;  4ACS A;  2B5Y A;  3TJG A;  3CMI A;  4ZBD A;  5D96 A;  1JZO A;  4D73 A;  2E2G A;  3W6G A;  3ZVJ A;  3FR3 A;  3C8E A;  2V2G A;  5EY6 A;  4GLT A;  2CVB A;  1SKR B;  3QOU A;  3UEM A;  4Q5Q A;  3EC3 A;  3UVT A;  2FWG A;  3QAW A;  2I1U A;  4ECB A;  4G2E A;  3ED3 A;  2ON7 A;  3UBL A;  3SWL A;  4YQV A;  4E8E A;  2B6M A;  2H6Y A;  1BED A;  2GZY A;  2CT6 A;  2O89 A;  2H30 A;  1OE8 A;  1LBK A;  3KH7 A;  3UIW A;  1XWK A;  2A2S A;  5IMV A;  2H0I A;  1DBY A;  1ZGN A;  2PMT A;  3WD6 A;  4IS0 A;  1W89 A;  5E4W A;  1MD3 A;  5JCW A;  4MF5 A;  2K8S A;  1MDJ A;  2GT5 A;  2K8V A;  4NHZ A;  4TR1 B;  3FKF A;  4MJE A;  2XBI A;  1TOF A;  3O3T A;  2LQQ A;  4V2N A;  2L6C A;  3ZVJ D;  2YV9 A;  3GTU B;  5G5F A;  4ZB8 A;  2YJ7 A;  1GSS A;  4AJ8 A;  2DJ0 A;  5FT3 A;  5A5K A;  1IYH A;  2X8H A;  3GSS A;  1T00 A;  3IXR A;  3I69 A;  4XS1 A;  3P90 A;  4ZXG A;  3M3M A;  4BPY A;  2A4V A;  5H5Q A;  3VI5 A;  2I3Y A;  7GSS A;  1GUK A;  1ZYE A;  3UMA A;  1F3A A;  2KP2 A;  1T1V A;  5D73 A;  5IOX A;  1ZMA A;  2X49 A;  3QFA C;  5DJM A;  2JSZ A;  5DAK B;  3J7Y b;  2C8U A;  1WOU A;  4ZIL A;  4YKF A;  2YAN A;  2HSM A;  1TP9 A;  3G9B A;  2VCT A;  5CRE A;  3QDN A;  2P5Q A;  2MMA A;  2VAF A;  4ZL8 A;  4GQF A;  3P2A A;  1GLQ A;  5ELA A;  3H8Q A;  2VLU A;  2HT9 A;  2PVO C;  4POL A;  1CQH A;  3L78 A;  4ML1 A;  1T4Z A;  5ID2 A;  4JRR A;  2I4A A;  5D9W A;  2KHP A;  3VI7 A;  2V41 A;  5G5E A;  4XIH A;  5J5N A;  2WUL A;  1MD4 A;  3IA1 A;  5ABR A;  2GZZ A;  2LRC A;  4GQC A;  4NXI A;  2GVP A;  2OBK A;  1GRX A;  1J9B A;  4ZIJ A;  1O6J A;  3TJB A;  1YY7 A;  2B5E A;  1XBS A;  2GGT A;  3UAR A;  5ECQ B;  4KB3 A;  3EUR A;  2IPA A;  4KND A;  2QSI A;  1PSQ A;  1XXU A;  5IMF A;  3PIN A;  1PN9 A;  2B1K A;  5DDL A;  4BVY B;  2JZR A;  1ERU A;  4HQZ A;  3GV1 A;  4RUV A;  1WRY A;  4XHM A;  1USB A;  1J0F A;  2WFC A;  4V2M A;  2DKI A;  3D4M A;  4ICY A;  1U6T A;  1EEM A;  1X5E A;  4KCE A;  1N8J A;  3D21 A;  1OC9 A;  3FR6 A;  3U5R E;  4PQH A;  1X9W B;  3GKX A;  1AUC A;  2N5A A;  1DSB A;  3GX0 A;  5D9T A;  3C71 A;  1F9M A;  3IPZ A;  1UA5 A;  3M9J A;  5HR0 A;  4MH2 A;  3I43 A;  3FZ5 A;  2H8L A;  1PKZ A;  5ECM B;  3NOF A;  5IMZ A;  5DCG A;  5AIS A;  1XOB A;  2GTU A;  5J4U A;  2VUP A;  1GSU A;  3ISO A;  3IHG A;  4MCU A;  4KH7 A;  1SEN A;  3RBT A;  2PN8 A;  1S3A A;  2N5F A;  1JLW A;  4JR4 A;  4ISD A;  4OO4 A;  1X5D A;  3EVI A;  1TKD B;  1Z9H A;  3IK7 A;  1TW9 A;  3KJY A;  4MH3 A;  4MF6 A;  2J23 A;  3RHC A;  5ID2 B;  1XIY A;  4IW9 A;  4K0N A;  4XS4 A;  3AY8 A;  2LQO A;  1K0D A;  5IPG A;  4PX1 A;  3ZRD A;  5IIZ A;  1M9A A;  3LSZ A;  1XOA A;  2CQ9 A;  1BJX A;  3PH9 A;  5ECI B;  4MZW A;  1Y6E A;  3IE3 A;  2LEG A;  3HJP A;  3HVX A;  5B8B A;  4RQR A;  2REM A;  3BOA A;  2AHE A;  1EGR A;  3CRT A;  3L9U A;  1FW1 A;  1LU4 A;  4BVX B;  2ZUP A;  3O76 A;  2WCI A;  4DSS B;  2RUF A;  4KX4 A;  2FWH A;  4RI6 A;  3CTG A;  1K3O A;  2F9S A;  3D5J A;  1BQ7 A;  1YF1 A;  4BWS A;  5G1K A;  1OC9 B;  4GCI A;  5KEJ A;  4PTS A;  2H76 A;  1IYI A;  6GSV A;  2MBS A;  2XHF A;  2FA8 A;  4LL1 B;  4KDX A;  2OE0 A;  2BMX A;  5HQP A;  3H4K A;  4GRF A;  3V1W A;  1A24 A;  3ME7 A;  2PUK C;  1K0N A;  2E0Q A;  4I8B A;  3GL3 A;  1PX6 A;  1G6W A;  1GSE A;  2UZ8 A;  2GLR A;  5CRW A;  2XC2 A;  1NHO A;  4F03 A;  2JZT A;  4HDE A;  4JU5 A;  3A3T A;  4POK A;  1OYJ A;  3KTL A;  1M0U A;  3CYN A;  3G7I A;  1B4Q A;  4TRX A;  1TRV A;  2QGV A;  3BD2 A;  3HXS A;  1T7P B;  3TOT A;  4V1A p;  4G9H A;  4GSS A;  5A4U A;  1FOH A;  1OVN A;  4L0W A;  4YQM A;  4N11 A;  4FO5 A;  2DBC A;  2H6Z A;  2ZNM A;  1G7O A;  4XS4 B;  2KLX A;  5ECK B;  1XVQ A;  1X9M B;  1GSD A;  2HNL A;  3IAM 2;  1SKS B;  3FK8 A;  5JWQ B;  2HRN A;  1LJR A;  4ZB9 A;  1DE1 A;  3US3 A;  2PBJ A;  19GS A;  2HRK A;  3CRU A;  4L5O A;  2LST A;  2IME A;  4ECC A;  1ZYN A;  4IP1 A;  3LGC A;  3RPN A;  3VPQ A;  4TXO A;  3TJJ A;  1THX A;  4O92 A;  3TB2 A;  4F9Z A;  2DC5 A;  1V40 A;  1JZR A;  1TXX A;  1Y25 A;  5H5S A;  1X9S B;  3E0U A;  1M7T A;  4X0X A;  5ECH B;  3KMN A;  1GSQ A;  1F37 A;  5LCZ A;  1SD9 A;  2IFQ A;  3RPP A;  4ECI A;  4DSR A;  3GN3 A;  1R4W A;  3KCM A;  2QA2 A;  2K18 A;  1SJI A;  5LD0 A;  1EOG A;  3WGX A;  3TRP A;  2LNS A;  5A4W A;  1S3D A;  2RLI A;  1J08 A;  3ERW A;  4WXT A;  4O5R A;  1GTB A;  2R4V A;  5ECR B;  3A2V A;  1R5A A;  2TRC P;  5FHI A;  1TRU A;  5INY A;  4BL7 A;  1BAY A;  1H4O A;  3LJR A;  5ELG A;  2A2P A;  4HJ2 A;  1EP8 A;  4POM A;  3VK9 A;  3KM6 A;  3TKP A;  3DIE A;  2R37 A;  3LYK A;  3VUR A;  2IWT A;  2VM1 A;  1SU9 A;  2H1G A;  4WF4 A;  2B7J A;  3LG6 A;  2NDO A;  1A8Y A;  3I9V 2;  2MZC A;  4WF5 A;  3PGT A;  2EIR A;  2OKA A;  1SK0 A;  4PUR A;  2DIY A;  5FWG A;  2WZ9 A;  5G1L A;  5GST A;  3WT1 A;  3IOS A;  3DYR A;  3ZFL A;  4EIQ A;  2H73 A;  1Z3E A;  1I5G A;  1F6M C;  3HZ8 A;  1EP7 A;  1SL1 B;  4AJ7 A;  5L71 A;  2EIQ A;  2M46 A;  5GAN D;  4MJA A;  4G0K A;  2O85 A;  3GUS A;  3LYP A;  4PXO A;  3ZTL A;  4MPF A;  3IC4 A;  2AV4 A;  2LRT A;  1YKA A;  4RQX A;  2IMD A;  1EV9 A;  1OKT A;  3DGQ A;  2NVL A;  2XPD A;  2D2Z A;  4EL1 A;  3A5I A;  5DQY A;  4PNG A;  4G19 A;  1VF2 A;  2H19 A;  2WGR A;  4TXO B;  2AAW A;  2IIY A;  3FW2 A;  4K8M A;  2K9F A;  2C0G A;  2YPM A;  3KTB A;  1O8W A;  3W8S A;  2C0D A;  2L4C A;  3E3E A;  2IFQ B;  2VL2 C;  5IMC A;  1PX7 A;  1ABA A;  3LXT A;  4YH2 A;  4OFM A;  4KA0 A;  4WKW A;  2IMI A;  3ERF A;  1A2J A;  2LJA A;  4PUF C;  1AQX A;  1V58 A;  5ECS A;  5EL8 A;  1XW5 A;  1G6Y A;  2DKH A;  3HCZ A;  5F0G A;  2GSR A;  2R3X A;  2JU5 A;  4ZB6 A;  4OD7 A;  2HYX A;  5COH A;  1K0A A;  2FA4 A;  1GLP A;  2YZH A;  3LW9 A;  5EPF A;  3UOM A;  3QR6 A;  3F8U A;  2GZP A;  4PQI A;  3APS A;  4MJC A;  3CSH A;  4BL7 B;  3QPM A;  5B8A A;  4K9Z A;  2VD0 A;  5GSS A;  2X8G A;  1M2D A;  3M0F A;  4ULX A;  1RW1 A;  2QC7 A;  4EXJ A;  4WEY A;  3P8W A;  4KSO A;  3TRX A;  4I6X A;  4L8E A;  3C73 A;  1TJD A;  1GSY A;  4D73 B;  5DCH A;  4MA9 A;  1WE0 A;  3HD5 A;  1Q98 A;  4X1U A;  1CQG A;  1GSF A;  3IR4 A;  2HFD A;  4G0I A;  2JAD A;  1V98 A;  2MMZ A;  3BCK A;  2RUE A;  3EMX A;  1DE2 A;  3HVV A;  2YJH A;  4HQS A;  2LUS A;  3C7M A;  5HR1 A;  1R5P A;  1O85 A;  3FZ9 A;  3CSJ A;  4YQU A;  3GYK A;  3LOR A;  3G7Y A;  2G0F A;  3HJM A;  2L6D A;  1B48 A;  1RQM A;  2V6O A;  3ZZX A;  2CZ3 A;  2RM6 A;  1SL2 B;  1XW6 A;  1UN2 A;  2L59 A;  4EDY A;  1ERW A;  3O6T A;  5F05 A;  4TR0 A;  1YQ1 A;  3ZRE A;  4CDO A;  1U88 A;  4AF2 A;  1AW9 A;  3EE2 A;  3FY7 A;  3DXB A;  4F82 A;  3FRC A;  2WRT A;  3N5O A;  5HFG A;  4FYC A;  4KSM A;  4K0G A;  3TOU A;  3FHK A;  1FHE A;  3WGE A;  3GKN A;  4MZB A;  3GIX A;  2PWJ A;  3KXO A;  1B4P A;  5DBQ A;  4QL9 A;  1GUM A;  1EEJ A;  2LJR A;  2GQM A;  3MSZ A;  3KH9 A;  20GS A;  3IRA A;  1NSW A;  2WJU A;  1GL8 A;  2LS5 A;  1JLV A;  1XWB A;  4JZQ A;  2IMF A;  2P5R A;  1YEP A;  1EGO A;  1TI3 A;  2V32 A;  2G2Q A;  2DML A;  4NHW A;  3KD0 A;  2VCW A;  1ZOF A;  1B9Y C;  2FWE A;  1DUG A;  1VF3 A;  1SYR A;  2LJK A;  4WET A;  1SK1 A;  3M8N A;  4O5U A;  2C0E A;  3UJ1 A;  3IHQ A;  1TK5 B;  4MPG A;  2GDR A;  2HXK A;  1ERV A;  2R2J A;  2VO4 A;  2ZCT A;  2L4Q A;  1B9X C;  3ZYW A;  3H79 A;  3HHV A;  3S9F A;  4NWY A;  1SL0 B;  2M80 A;  2E7P A;  5ECP B;  3QD9 A;  1A2M A;  1XZO A;  3KGK A;  4XS6 A;  3ZMK A;  4GST A;  1ERT A;  22GS A;  5KOX A;  4NPB A;  1VF4 A;  3TKS A;  2C1Y A;  4LL4 B;  4HZ4 A;  4E8H A;  4PQ1 A;  2OBI A;  2VL9 A;  3H1N A;  1VGL A;  1Z7P A;  3QCP A;  2J9H A;  1ZYQ B;  4ZL9 A;  1A0R P;  4HOJ A;  4Z2T A;  4CY8 A;  4KW6 A;  2DSA A;  2AJQ B;  2VL3 A;  5F06 A;  1M9B A;  3ME8 A;  1AC1 A;  3GA4 A;  2H0G A;  2GQK A;  4FH8 A;  3EPT A;  1KEB A;  2YWM A;  4A5P A;  3Q74 A;  2H1D A;  3A2W A;  4Q5R A;  4OCF A;  3TKS C;  3EYT A;  5B6M A;  5LNK e;  1PL2 A;  2EIO A;  1UC7 A;  2FUG 2;  3U6V A;  5B7C A;  1U3I A;  1HNA A;  2FHE A;  1Z6N A;  5IPH A;  2GST A;  4KAE A;  1QUW A;  5KOW A;  4J56 E;  3ZFB A;  4OFN A;  3A5W A;  2B1L A;  2B3S A;  3VWV A;  2PER A;  3FR9 A;  4BA7 A;  3FEU A;  1MTC A;  3Q18 A;  1WJK A;  3R3E A;  2H0H A;  4OCE A;  2F8F A;  3IBH A;  5HR2 A;  5DAL A;  5HFI A;  3MAK A;  1O8X A;  4MJB A;  2OE3 A;  1F2E A;  3F6F A;  1GNW A;  5IMA A;  1HD2 A;  2X64 A;  2TRX A;  3DML A;  4YAP A;  4EIP A;  4CHS A;  1K0O A;  3VLN A;  3TRQ A;  2VLV A;  1FG4 A;  3F63 A;  1X5C A;  4ZBA A;  5CRD A;  1O7U A;  3VPT A;  2O7K A;  4IQ1 A;  3UBK A;  1S3C A;  4AJ6 A;  2ALB A;  3L9V A;  3DVW A;  3UL3 A;  1GTU A;  2DIZ A;  2H1A A;  2HRA A;  4HU7 A;  4TW5 A;  1BG5 A;  3MYD A;  1PRX A;  2K6V A;  4GWR A;  3OR5 A;  3BCI A;  3MNG A;  4TOP A;  4I5Q A;  2CA8 A;  3GH6 A;  2I9H A;  2CZ2 A;  1TRS A;  2AUV A;  2VCX A;  3FYG A;  2YV7 A;  4OWY A;  4TKY A;  1BYE A;  1ZZY A;  16GS A;  2DLX A;  4N0V A;  1QGV A;  2CX4 A;  1XPV A;  1X0R A;  4MNN A;  4JED A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...