2H70A

Crystal structure of thioredoxin mutant d9e in hexagonal (p61) space group
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
107
structure length
107
Chain Sequence
DKIIHLTEDSFDTDVLKADGAILVDFWAEWCGPCKMIAPILDEIADEYQGKLTVAKLNIDQNPGTAPKYGIRGIPTLLLFKNGEVAATKVGALSKGQLKEFLDANLA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Thioredoxin
publication title A stability pattern of protein hydrophobic mutations that reflects evolutionary structural optimization.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Electron transport
total genus 30
structure length 107
sequence length 107
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-06-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00085 Thioredoxin Thioredoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 2h70A00
1ERVA 4NV2A 3GH9A 2RIIA 3RPNA 1MDKA 3O6TA 4L8EA 2Z9SA 3ERFA 2YP6A 1ST9A 1M2BA 4IBPA 1U87A 1XXUA 1SL1B 1QQ2A 3UIWA 3L9SA 3G7IA 1TK5B 3A3TA 1PL2A 4WXTA 1SK1A 1YF1A 1FOVA 2CX4A 4L5LA 4K9ZA 4EXJA 4NMUA 2MBSA 1URMA 3E0UA 1EOHA 3H8QA 1GSEA 2YN1A 2HRNA 3EVIA 3C7MA 5ECIB 3TJFA 5IM9A 2EIQA 3SWLA 3DVXA 3U5RE 4AJ8A 2GQMA 4EVMA 1EOGA 3GIXA 1TI1A 1H4OA 1R5PA 1EGOA 2YJ7A 4PGTA 1HQOA 3A5WA 3TRQA 2FWGA 3M9KA 4IHUA 2TRCP 3KTBA 1WE0A 1XW6A 4ZB9A 3MWHA 3ZVJD 4PXOA 2FA8A 4QQ7A 2JSYA 4CHSA 3NIVA 2RUEA 4ECIA 13GSA 4JR4A 3F6DA 3A2VA 2C3QA 1HYUA 4EKZA 3GSTA 4GWRA 4G9HA 4PNGA 2L59A 3GL5A 5DCHA 2B1KA 4GSSA 4GRFA 16GSA 3GX8A 1FB6A 3P7XA 3G7JA 2WS2A 1Z5YE 2F9SA 5J41A 4CW9A 4KA0A 4KDXA 1GLQA 4Q5NA 5E4WA 2FLSA 2V41A 4BPYA 1J9BA 4HU9A 1T8EB 4JZQA 1K0CA 1SD9A 4KB3A 3TJBA 5F07A 2CVDA 1V9WA 6GSUA 2H66A 2MMAA 4ECBA 5ECOB 4NXIA 2LS5A 2YV9A 2H0GA 3MAKA 3IC4A 5A4WA 4BWSA 4MF7A 1H75A 4POBA 3P8WA 5EPFA 3UBKA 2GGTA 5IO2A 1BJXA 3C1SA 3QFBC 1MDIA 1X5EA 2H1BA 3GH6A 2C0EA 1SK2A 2TIRA 4EF0A 2FA4A 4MK3A 4DEJA 2H74A 3KP9A 4IGJA 1TTZA 5ECSA 2C0FA 1V40A 3TJKA 3F4SA 2LTKA 4GQFA 6GSTA 3VURA 2E2GA 2VLVA 3CMIA 2WZ9A 4QL9A 2VCVA 1AAZA 2PUKC 2RUFA 1OC3A 3V1WA 1JLVA 1SU9A 1T3BA 5DQSA 2YOIA 17GSA 1A24A 3ZIJA 4HU7A 4ID0A 2GZZA 1R7HA 4JU5A 2KP2A 1KNGA 2F3MA 2IPAA 4MZCA 1XIYA 5B8BA 4D73A 1YEXA 18GSA 3VI5A 3FR3A 3KCMA 2FWHA 5KN0A 1X9SB 4ZILA 3CTGA 5CYYA 4MJCA 2H1AA 2P31A 3UAPA 1GSQA 3TCOA 3F4RA 3VLNA 3I43A 3LWAA 6GSWA 1M7TA 5IPHA 4ECJA 3FK8A 4PUAA 2B7KA 2I9HA 1XCCA 1X0RA 3QDNA 3KMNA 4LMWA 2EIOA 1TU8A 2D2ZA 3NOFA 3WGDA 5GZZB 3DYRA 5CP1A 3EC3A 3LYPA 4HZ4A 4LMVA 5HR1A 3RAZA 2NPBA 1XW9A 3FHKA 2X64A 4IQ1A 3M8NA 6GSSA 2I1UA 2LJKA 1K0MA 5ECLB 1XWGA 6GSXA 4JEDA 4N11A 5KN1A 3QPMA 1YKCA 5DALB 4TN8A 5J3RA 1ILOA 2GSQA 3FYGA 3GTUB 4MF6A 2C3NA 3GKKA 2HI7A 3HA9A 4F0CA 4K2DA 1LBKA 2B5EA 3CTFA 10GSA 4HJMA 2O89A 1F3AA 2I4AA 1S3AA 1T4YA 2O87A 4QL7A 3TKPA 3UEMA 1YKAA 1SJIA 1BYEA 4KW6A 2GT5A 3FEUA 4YQMA 2PVQA 4HEA2 5H5RA 5JWOB 3C8EA 9GSSA 1I9DA 3Q18A 1O81A 2MMZA 2VO4A 1PMTA 5HQPA 4V2NA 2VL9A 3VWUA 5J9CA 1LJRA 4NPBA 4XS4B 4WEYA 4OFMA 3C73A 3UL3A 3KZQA 4F03A 1GLPA 2IWTA 1PL1A 5ECPB 3HJOA 3C71A 3WT1A 4IQAA 3DGQA 1XZOA 2LRTA 2LKUA 1K3OA 5ECQB 1A2MA 4MLYA 1GWCA 4MDCA 2R4VA 3F0IA 4JE1A 1M2AA 1X5DA 2VL2C 4YAPA 2TRXA 4KX4A 1SJZA 1VF2A 1CQHA 1SYXA 4K0NA 4PURA 1TRVA 4TRXA 5E59A 2V32A 1GSDA 3H4KA 4TR1B 2WGRA 4V2LA 1V58A 3L78A 2ZNMA 2LEGA 4N10A 5FT3A 1SD8A 2IMIA 1FAAA 1O85A 1ZCPA 4OMVA 3M9JA 3EMXA 2E2MA 1K0AA 1WPIA 3HZ8A 5LCZA 1KEBA 1W4VA 2KOKA 4NWYA 4ISDA 3ZRDA 4KSOA 4X43A 2IJYA 3TJJA 3QOUA 2AUVA 2CAQA 1SKRB 1QFNA 4F82A 1GH2A 3VWVA 4KGIA 5CO3A 4ZB6A 1EP8A 5HFKA 3FZ9A 2RM5A 4XS6A 3M1GA 1A0FA 5DJLA 3L0HA 3KXOA 2B5YA 1ZYQB 2LNSA 4FH8A 1MTCA 2HSYA 2E7PA 1GUKA 1UA5A 4DSSA 5HR0A 4ZBAA 5ID2A 3A2XA 2VCXA 2DSAA 1YF0A 5FWGA 5EVOA 3F63A 3LEFA 4OWYA 2IN3A 3M0FA 1OC9A 5G5FA 1E2YA 4PQHA 2IIYA 3ZL5A 1R26A 2GVPA 1FB0A 1U6TA 3ZVJA 3ZFBA 3QFAC 6GSVA 4KDUA 3LXZA 5G2ZA 2LUSA 2X8CA 5LNKe 3W8JA 3PH9A 1M0UA 5KN3A 4MZBA 5DAKA 4BVYA 4X1UA 2CVBA 1OYJA 2ZUPA 1YY7A 2YPMA 5L71A 3GKMA 5ECRB 4I97A 5IOWA 5G1KA 4TXOB 4MA9A 4ILFA 2MYGA 2DIZA 2PWJA 4EDYA 1M2DA 1UC7A 1SKWB 3IE3A 1TDIA 1HD2A 2C80A 5JCGA 5H5SA 1C72A 4WR4A 4BA7A 2QSIA 5AISA 5CREA 1BAYA 1DSBA 4BL7A 5DQYA 3BD2A 5IQYA 3GURA 2PVOC 1VF4A 2R6KA 1AQXA 5IMZA 2AJQB 4V2MA 3HJMA 4I8BA 3TRXA 3TUEA 3KTLA 2BMXA 2JADA 1OKDA 1VGLA 2K6VA 2K8VA 2BTOT 4E8EA 2YWNA 5DDLA 1NSWA 3ZYWA 4KSMA 2KLXA 4ML6A 2LJRA 4Q5FA 1A8LA 4FYUA 2LNTA 1XVWA 2L4CA 4L5OA 2PERA 3IRAA 3HY2A 2MMNA 2AAWA 1OAZA 1TK8B 1HNCA 1G6WA 2H6YA 3FRCA 5HFGA 5AGYA 1QK8A 3HKRA 2QKEA 4HS1A 1XWAA 1OVNA 4XCSA 1O8WA 3D5JA 2H6XA 1VRSD 2LJAA 5D9VA 1FVJA 3GKNA 1A2JA 2WJUA 4ZL8A 2JZRA 3KEBA 4K1FA 2O85A 3TKSA 4ULXA 3WD6A 2KP1A 2GS3A 2R5GA 1AC1A 3Q74A 5ECHB 2K8SA 2L6CA 2OJLA 1T4ZA 1OKTA 1F37A 2B6MA 1RQMA 2O7KA 3IOSA 5DBQA 3UOMA 1ZOFA 2H8LA 4JRRA 4F2IA 1G7EA 3KP8A 4N0VA 2ALBA 4L0WA 4PNFA 4POMA 2ON5A 4GTUA 5D73A 2H1GA 4MH2A 2PGTA 1J0FA 3ME7A 4OFNA 3LG6A 3RHCA 14GSA 1NM3A 5KN2A 4YQVA 3GV1A 2XC2A 5ABRA 1RK4A 2B7JA 4G19A 3RDWA 3LGCA 2C4JA 2C8UA 3CYNA 2IMFA 1THXA 3CXGA 5IMVA 4LA1A 1SJ6A 2HFDA 1Z6NA 2J23A 2GSRA 2H01A 2VM1A 3GSSA 3VWWA 2H6ZA 1TU7A 4KNDA 3Q19A 4NHZA 3BCIA 1EGRA 3F3QA 2N5BA 3IA1A 4EO3A 1PX7A 3KD0A 3KMOA 1YEPA 5H5QA 2OBKA 1O7UA 1IYHA 2IFQB 3N9JA 4J2FA 2ZCTA 1BX9A 3PINA 2WDUA 3K8NA 1WRYA 1A23A 2IL3A 20GSA 2A2RA 3I9V2 1ZYEA 4N30A 3ZIVA 2M80A 4F0BA 3KH7A 4XRDA 2K9FA 2L57A 4IVFA 1J08A 2VL2A 2DMMA 5G30A 3IBHA 2WRTA 4POLA 1LU4A 1BEDA 1OE8A 1TJDA 3OR5A 1FO5A 2E0QA 4ACSA 2CV4A 3TKSC 4WBJA 4IJIA 2IMDA 3R2QA 4IW9A 1BG5A 3DKSA 5B8AA 1XOBA 5D8IA 2FD3A 3O76A 3D4MA 3HVVA 2YV7A 1TOFA 2H0IA 5IMDA 5LD0A 1VF1A 2LRNA 1BQ7A 5GSTA 1SK0A 2OE3A 3ZLPA 2X8HA 2A4VA 4OCFA 1JHBA 1GSSA 3IAM2 4G2EA 2HYXA 1EZKA 3CSHA 1O8XA 2GTUA 4IP6A 1K3LA 1V57A 2LQOA 2RLIA 3DD3A 3PR8A 3UMAA 3MSZA 3ERGA 4O7HA 1SL0B 3GRXA 1S3DA 1AQWA 3PGTA 3DRNA 5A4VA 3DWVA 5COHA 1XWBA 2CAIA 1K0BA 4LLRA 1G0TA 2DIYA 1HNAA 1TK0B 1T00A 2H75A 3LYKA 4N0ZA 4HI7A 3U6VA 5AN1A 3VI7A 5DJMA 3IK9A 2OKAA 5INYA 2H71A 2WB9A 1WIKA 1TKDB 3JCML 1GRXA 2IMKA 1N8JA 3I69A 4BWQA 3FKFA 1KBNA 1IYIA 4MJEA 2V2GA 4TR0A 5IMFA 2HZEB 3HDCA 3HXSA 3G7YA 3FR6A 4XRAA 1Z6MA 4I6XA 1GNWA 1XPVA 2YWMA 4OCEA 1QXHA 2WULA 1M99A 2NDOA 1DE1A 3ME8A 1AUCA 2N5AA 2F8FA 2QGVA 3EU4A 3ZITA 5KEJA 12GSA 4MH3A 3L9VA 5J5NA 2H19A 3FY7A 4KCAA 1TRSA 2PPTA 1WP0A 4WR5A 3BOAA 1AQVA 4MABA 5CRDA 1JZWA 5CRWA 1PKWA 1TW9A 2HT9A 3IPZA 5F05A 4AF2A 3TOUA 2MMOA 4MPFA 4AJ7A 1F6MC 3LQ7A 2NVLA 3HD5A 2C0DA 2JU5A 2ES7A 4MF5A 2AHEA 2DJ0A 4TW5A 3EYTA 2VUPA 1FG4A 3Q6OA 2VL3A 2FWEA 4G10A 2CA8A 2XBQA 5IPGA 1GP1A 3ZFLA 4FYCA 1ZMAA 3ZTLA 2OA7A 3HVXA 2LQQA 5GAPD 4GSTA 1TXXA 4FO5A 1UVZA 1JZRA 4AJ6A 1G7OA 2FUG2 4ZBBA 4EC0A 2YZHA 3GHAA 4XS1A 4GSNA 1NW2A 1Z3EA 1GSYA 4KUNA 5IO0A 5J9BA 3I6AA 2YJHA 3FW2A 3VK9A 3L9UA 4MJAA 4LL1B 5B7CA 4WF4A 1GTUA 1Q4JA 1XBSA 3E9JB 4TR4A 3H93A 1Z7PA 1XWCA 1X5CA 4IELA 2HE3A 4O92A 3J7Yb 3HCZA 3GKXA 4Q5QA 3UVTA 1K0NA 2HRFA 1EP7A 2I81A 1I5GA 2OACA 3QR6A 4GCIA 5JCUA 1QUWA 2JSZA 5CRGA 4H86A 1Z7RA 2AYTA 2GSSA 4JR6A 2CZ3A 2H72A 2H76A 4K7IA 1PA3A 5ENUA 4LL4B 2REMA 5CNWA 3UARA 5F06A 3FZ4A 4GQCA 1GTBA 2VAFA 5DALA 1ERTA 2HNLA 4KAEA 3IV4A 2ON7A 4ML1A 1TRUA 4WKWA 3GTUA 2OBIA 1U3AA 3D21A 1SKSB 5ECKB 3TGZA 2YZUA 4I5QA 5JWQB 2VCQA 4GXZA 1X9WB 4V1Ag 4RQXA 4D73B 3TKSE 2VLTA 3ZZXA 4RI6A 5J4UA 1T1VA 5IMCA 2RM6A 4PQIA 4ECCA 5ELAA 1Y6EA 4ZXGA 3KJYA 4Q5RA 5DCGA 2OE1A 5JCWA 3AY8A 2KHPA 2VCTA 3LXTA 3S9FA 2FY6A 1TP9A 5G1LA 4TVEA 3D22A 1Y25A 11GSA 3F8UA 1Q98A 5D9WA 1B9XC 1XWKA 3VFIA 1PKZA 2H70A 2N5FA 4I2TA 3RPPA 3UJ1A 1JFUA 2DJ3A 1FW1A 1S3CA 1JZDA 2EC4A 1ERWA 4NV5A 2PMTA 4XS4A 2A2SA 4TOPA 2YNXA 3NZNA 4IN0A 1XW5A 2DBCA 1YDKA 4WETA 3IHQA 3IDVA 1USBA 3G9BA 3H79A 2HZEA 3FZ5A 3SBCA 4OO4A 4XTSA 3ISOA 4HQZA 22GSA 2HZFA 3GA4A 3W8SA 2XBIA 1UN2A 1A8YA 4IJ3A 4IS0A 3EINA 5FHIA 1JZOA 2C1YA 6GSYA 3EWLA 3EURA 3W6GA 1TI3A 2GSTA 4TR1A 2VD0A 2GZYA 1GUHA 3WYWA 1SENA 1GUMA 3O3TA 3QD9A 5D9TA 1R4WA 2B1LA 1M9AA 2I3YA 3QAVA 5DVBA 2DJ1A 4NAXA 2AV4A 5AIVA 3QAGA 4Z7XA 4HDEA 19GSA 1EEJA 2CX3A 3ERWA 1CQGA 3CRTA 1YJ6A 4MPGA 2YCDA 1THOA 1ZZYA 2VCWA 4YH2A 4I2UA 3A2WA 3HYPA 1GULA 3J7Yk 4GF0A 1YQ1A 4ZB8A 3IK7A 1SYRA 1B4QA 3BBYA 1K0OA 2VIMA 1Z9HA 3DXBA 3E3EA 4EUYA 3BJ5A 3IR4A 2PBJA 4HQSA 3TRPA 3FR9A 4P3YB 3VPTA 2YWOA 5D96A 4HOJA 2FWFA 4J57E 1EWXA 2LRCA 3GX0A 3CSIA 4K7NA 1MD4A 2X99A 4ZBDA 4PUFC 2B3SA 3GFKA 4K0GA 1PN9A 2MBTA 5GSSA 1DUGA 2OE0A 4YQUA 1T7PB 1V2AA 3QAWA 2GZPA 3BCKA 3RBTA 1MEKA 1QGVA 5B6MA 2R37A 4KCEA 1FVKA 1M9BA 2P5RA 3P90A 2FCHA 3GN3A 1HNBA 2HLSA 2R3XA 3ZMKA 3QCPA 2GT6A 2F8AA 2IMEA 3WT2A 4OD7A 3GNJA 3LORA 2DC5A 1V98A 2V6OA 1ERUA 2CT6A 3VPQA 2HSHA 1OE7A 2XPEA 2QC7A 1WOUA 5B6NA 5C00A 2CQ9A 4ZL7A 5IMAA 4MZWA 2DJJA 4K8MA 1N2AA 1XOAA 3D6IA 4TKYA 3ED3A 2M46A 3GYKA 4TXOA 4TR3A 4EE0A 3F6FA 5ECMB 1SL2B 3D4TA 4MCUA 5ELGA 4JBBA 2LSTA 5JWRB 1K3YA 4BVXA 1EV9A 3GMFA 2NBSA 3EMPA 1GL8A 1R5AA 4KDYA 4WF5A 4CDOA 3L4NA 1GSFA 4DSSB 3KIJA 4IP1A 5ID2B 2CVKA 4ZL9A 1B48A 2EIRA 3HJPA 4KH7A 3TB2A 3HHVA 1DBYA 1OC9B 1ABAA 4J56E 2H1DA 1W89A 2P5QA 5D93A 3LJRA 2PN8A 4DSRA 1B9YC 5IOXA 4GLTA 8GSSA 2H73A 1O73A 1ACVA 5HR3A 3DIEA 2L5LA 5C04A 2VLUA 1A2LA 2VM2A 1E6BA 1QMVA 2BJXA 3LSZA 2O8VB 3LFLA 3D0ZA 3KH9A 5DAKB 1K0DA 4WBRD 3F9UA 1YZXA 3RHBA 2C3TA 4AGSA 1FHEA 2J9HA 3IAS2 2X8GA 2XHFA 3DMLA 1PQNA 1VF3A 5EL8A 5AIXA 2DJ2A 4DSQA 5CAXA 2MZCA 2VCZA 2H30A 3M3MA 3P2AA 3ZREA 1GTAA 2NTOA 2YWIA 2M72A 3H1NA 1ZL9A 2KUCA 1F2EA 2PU9C 1WMJA 2DMLA 7GSSA 1X9MB 2L6DA 2H0HA 3GUSA 4X0XA 3FZAA 3MDKA 4POKA 4E8HA 2VOCA 4YAVA 5G31A 3TJGA 1ML6A 2AB6A 2P0GA 2VD1A 3IXRA 1ZGNA 2K18A 2L4QA 2C0GA 2LV3A 4NHWA 5CRHA 1A0RP 4RQRA 1U88A 2FGXA 2R2JA 4MP4A 4EL1A 3ZMLA 4RI7A 1WWJA 5GAND 4RUVA 4ZIJA 2JL4A 2JZSA 3HZ4A 4XHMA 4IKHA 2YANA 1AXDA 2G0FA 1GNEA 3MNGA 1PRXA 2FHEA 1GSUA 4FIWA 1AW9A 3UBLA 1NHOA 3APOA 5D9XA 4O32A 1XVQA 1WJKA 3GL3A 1MD3A 2CZ2A 4HJ2A 4TXVA 4K7OA 4OFTA 5A4UA 4K6XA 2WCIA 3US3A 4MMMA 1B4PA 5F8BA 3KM6A 3TDGA 3VWXA 3KGKA 2G2QA 2F51A 5ECNB 4F9ZA 1RW1A 2V1MA 2XPDA 2OADA 1AIUA 3APQA 5G5EA 1O6JA 1OC8A 1JLWA 1GTIA 2DJKA 5A5KA 1XFLA 5HFIA 1PGTA 4HZ2A 3UVHA 3WGXA 4OO5A 2V6KA 3QMXA 1F9MA 2IFQA 3C1RA 4FYBA 3DEXA 1G6YA 3CRUA 2WFCA 2GLRA 1DE2A 4HUAA 1B8XA 2HXKA 1F3BA 4XIHA 3CBUA 3F4TA 1PSQA 1TRWA 3TKQA 2GQKA 4PQ1A 1EV4A 3HVSA 1EEMA 2JACA 5F0GA 4EDZA 4MJBA 3WGEA 3CSJA 2L5OA 1U3IA 5IIZA 1PX6A 3TKRA 1KTEA 4O5RA 3N5OA 5EY6A 3EU3A 3F3RA 2FNOA 1ON4A 2GDRA 1PD21 2B5XA 5HR2A 3DVWA 4L0UA 3APSA 1MDJA 2JZTA 4KE3A 2GQLA 3TOTA 3EE2A 2DLXA 4V1Ap 1NHYA 4PX1A 4DVCA
chains in the Genus database with same CATH superfamily
1ERVA 4NV2A 3GH9A 2RIIA 3RPNA 1MDKA 3O6TA 4L8EA 2Z9SA 3ERFA 2YP6A 1ST9A 1M2BA 4IBPA 1U87A 1XXUA 1SL1B 1QQ2A 3UIWA 3L9SA 3G7IA 1TK5B 3A3TA 1PL2A 4WXTA 1SK1A 1YF1A 1FOVA 2CX4A 4L5LA 4K9ZA 4EXJA 4NMUA 2MBSA 1URMA 3E0UA 1EOHA 3H8QA 1GSEA 2YN1A 2HRNA 3EVIA 3C7MA 5ECIB 3TJFA 5IM9A 2EIQA 3SWLA 3DVXA 3U5RE 4AJ8A 2GQMA 4EVMA 1EOGA 3GIXA 1TI1A 1H4OA 1R5PA 1EGOA 2YJ7A 4PGTA 1HQOA 3A5WA 3TRQA 2FWGA 3M9KA 4IHUA 2TRCP 3KTBA 1WE0A 1XW6A 4ZB9A 3MWHA 3ZVJD 4PXOA 2FA8A 4QQ7A 2JSYA 4CHSA 3NIVA 2RUEA 4ECIA 13GSA 4JR4A 3F6DA 3A2VA 2C3QA 1HYUA 4EKZA 4EIQA 3GSTA 4GWRA 4G9HA 4PNGA 2L59A 3GL5A 5DCHA 2B1KA 4GSSA 4GRFA 16GSA 3GX8A 1FB6A 3P7XA 3G7JA 2WS2A 1Z5YE 2F9SA 5J41A 4CW9A 4KA0A 4KDXA 1GLQA 3MIXA 4Q5NA 5E4WA 2FLSA 2V41A 4BPYA 1J9BA 4HU9A 1T8EB 4JZQA 1K0CA 1SD9A 4KB3A 3TJBA 5F07A 2CVDA 1V9WA 1ZYNA 6GSUA 2H66A 2MMAA 4ECBA 5ECOB 4NXIA 2LS5A 2YV9A 2H0GA 3MAKA 3IC4A 5A4WA 4BWSA 4MF7A 1H75A 4POBA 3P8WA 5EPFA 3UBKA 2GGTA 5IO2A 1BJXA 3C1SA 3QFBC 1MDIA 1X5EA 2H1BA 3GH6A 2C0EA 1SK2A 2TIRA 4EF0A 2FA4A 4MK3A 4DEJA 2H74A 3KP9A 4IGJA 1TTZA 5ECSA 2C0FA 1V40A 3TJKA 3F4SA 2LTKA 4GQFA 6GSTA 3VURA 2E2GA 2VLVA 3CMIA 2WZ9A 4QL9A 2VCVA 1AAZA 2PUKC 2RUFA 1OC3A 3V1WA 1JLVA 1SU9A 1T3BA 5DQSA 2UZ8A 2YOIA 17GSA 1A24A 3ZIJA 4HU7A 4ID0A 2GZZA 1R7HA 4JU5A 2KP2A 1KNGA 2F3MA 2IPAA 4MZCA 1XIYA 5B8BA 3CQFA 4D73A 1YEXA 18GSA 3VI5A 5BRTA 3FR3A 3KCMA 2FWHA 5KN0A 1X9SB 4ZILA 3CTGA 4O5UA 5CYYA 4MJCA 5KOXA 2H1AA 2P31A 3UAPA 1GSQA 3TCOA 3F4RA 3VLNA 3I43A 3LWAA 6GSWA 1M7TA 5IPHA 4ECJA 3FK8A 4PUAA 2B7KA 2I9HA 1XCCA 1X0RA 3QDNA 3KMNA 4LMWA 2EIOA 1TU8A 2D2ZA 3NOFA 3WGDA 5GZZB 3DYRA 5CP1A 3EC3A 3LYPA 4HZ4A 4LMVA 5HR1A 3RAZA 2NPBA 1XW9A 3FHKA 2X64A 4IQ1A 3M8NA 6GSSA 2I1UA 2LJKA 1K0MA 5ECLB 1XWGA 6GSXA 4JEDA 4N11A 5KN1A 3QPMA 1YKCA 5DALB 4TN8A 5J3RA 1ILOA 2GSQA 3FYGA 3GTUB 4MF6A 2C3NA 3GKKA 2HI7A 3HA9A 4YKGA 4F0CA 4K2DA 1LBKA 2B5EA 3CTFA 10GSA 4HJMA 2O89A 1F3AA 2I4AA 1S3AA 1T4YA 2O87A 4QL7A 3TKPA 3UEMA 1YKAA 1SJIA 1BYEA 4KW6A 1PFOA 2QA1A 2GT5A 3FEUA 4YQMA 2PVQA 4HEA2 5H5RA 5BMUA 5JWOB 3C8EA 9GSSA 1I9DA 3Q18A 2R0PA 1O81A 2MMZA 2VO4A 1PMTA 5HQPA 1M3IA 2VL9A 4V2NA 3VWUA 5J9CA 1LJRA 4NPBA 4XS4B 4WEYA 4OFMA 3C73A 3UL3A 3KZQA 4F03A 1GLPA 2IWTA 1PL1A 5ECPB 3HJOA 3C71A 3WT1A 4IQAA 3DGQA 1XZOA 2LRTA 2LKUA 1K3OA 5ECQB 1A2MA 5KOWA 4MLYA 1GWCA 4MDCA 2R4VA 3F0IA 4JE1A 1M2AA 1X5DA 2VL2C 4YAPA 2TRXA 4KX4A 1SJZA 1VF2A 1CQHA 1SYXA 4K0NA 4PURA 1TRVA 4TRXA 5E59A 2V32A 1GSDA 3H4KA 4TR1B 2WGRA 4V2LA 1V58A 3L78A 2ZNMA 2LEGA 4N10A 5FT3A 1SD8A 2IMIA 1FAAA 1O85A 2DKHA 2R0GA 1ZCPA 4OMVA 3M9JA 3EMXA 2E2MA 1K0AA 1WPIA 3HZ8A 5LCZA 1KEBA 1W4VA 2KOKA 4NWYA 4ISDA 3ZRDA 4KSOA 4X43A 2IJYA 3TJJA 1XG8A 3QOUA 2AUVA 2CAQA 1SKRB 1QFNA 4F82A 1GH2A 3VWVA 4KGIA 5CO3A 4ZB6A 1EP8A 5HFKA 3FZ9A 2RM5A 4XS6A 3M1GA 1A0FA 5DJLA 3L0HA 3KXOA 2B5YA 1ZYQB 2LNSA 4FH8A 1MTCA 2HSYA 1PN0A 2E7PA 1GUKA 1UA5A 4DSSA 5HR0A 4ZBAA 5ID2A 3A2XA 2VCXA 2DSAA 1YF0A 5FWGA 5EVOA 3F63A 3LEFA 4OWYA 3IC8A 2IN3A 3M0FA 1OC9A 4G0IA 5G5FA 1E2YA 4PQHA 2IIYA 3ZL5A 1R26A 2GVPA 1FB0A 1U6TA 3ZVJA 3ZFBA 3QFAC 6GSVA 4KDUA 3LXZA 5G2ZA 2LUSA 2X8CA 5LNKe 3W8JA 3PH9A 1M0UA 4HSCX 5KN3A 4MZBA 5DAKA 4BVYA 4X1UA 2CVBA 1OYJA 2ZUPA 1YY7A 2YPMA 5L71A 2HRKA 1S3RA 3GKMA 5ECRB 4Z2TA 4I97A 5IOWA 5G1KA 4TXOB 4MA9A 4ILFA 2MYGA 2DIZA 2PWJA 4EDYA 1M2DA 4CY6A 1UC7A 1SKWB 3IE3A 1TDIA 1HD2A 2C80A 5JCGA 5H5SA 1C72A 4WR4A 4BA7A 2QSIA 5AISA 5CREA 1BAYA 1DSBA 4BL7A 5DQYA 3BD2A 5IQYA 3GURA 2PVOC 1VF4A 2R6KA 1AQXA 5IMZA 2AJQB 4V2MA 3HJMA 4I8BA 3TRXA 3TUEA 3KTLA 2BMXA 2JADA 1OKDA 1VGLA 2K6VA 2K8VA 2BTOT 4E8EA 2YWNA 5DDLA 1NSWA 3ZYWA 4KSMA 2KLXA 4ML6A 2LJRA 4Q5FA 1A8LA 4FYUA 2LNTA 1XVWA 2L4CA 4L5OA 2PERA 3IRAA 3HY2A 2MMNA 2AAWA 1OAZA 1TK8B 1HNCA 1G6WA 2H6YA 3FRCA 5HFGA 5AGYA 1QK8A 3HKRA 2QKEA 4HS1A 1XWAA 1OVNA 4XCSA 1O8WA 3D5JA 2H6XA 1VRSD 2LJAA 5D9VA 1FVJA 3GKNA 1A2JA 2WJUA 4ZL8A 2JZRA 3KEBA 4K1FA 3MYDA 2O85A 3TKSA 4ULXA 3WD6A 2KP1A 2GS3A 2R5GA 1AC1A 3Q74A 5ECHB 2K8SA 2L6CA 2OJLA 1T4ZA 1OKTA 1F37A 2B6MA 1RQMA 2O7KA 3IOSA 5DBQA 3UOMA 1ZOFA 2H8LA 4JRRA 2X4AA 4F2IA 1G7EA 3KP8A 4G0KA 4N0VA 2ALBA 2HRAA 4L0WA 4PNFA 4POMA 2ON5A 4GTUA 5D73A 2H1GA 4MH2A 2PGTA 1J0FA 3ME7A 4OFNA 2A2PA 3LG6A 3RHCA 14GSA 1NM3A 5KN2A 4YQVA 3GV1A 2XC2A 5ABRA 1RK4A 2B7JA 4G19A 3RDWA 3LGCA 2C4JA 2C8UA 3CYNA 2IMFA 1THXA 3CXGA 5IMVA 4LA1A 1SJ6A 2HFDA 1Z6NA 3PPUA 2J23A 4CY8A 2GSRA 2H01A 2VM1A 3GSSA 3VWWA 2H6ZA 1TU7A 4KNDA 3Q19A 4NHZA 3BCIA 1EGRA 3F3QA 2N5BA 3IA1A 4EO3A 1PX7A 3KD0A 3KMOA 1YEPA 5H5QA 2OBKA 1O7UA 1IYHA 2IFQB 3N9JA 4J2FA 4BIKA 2ZCTA 1BX9A 3PINA 2WDUA 3K8NA 1WRYA 1A23A 2IL3A 20GSA 2A2RA 3I9V2 1ZYEA 4N30A 3ZIVA 2M80A 4F0BA 3KH7A 4XRDA 2K9FA 2L57A 4IVFA 1J08A 2VL2A 2DMMA 5G30A 3IBHA 2WRTA 2HSMA 4POLA 1LU4A 1BEDA 1OE8A 1TJDA 3OR5A 1FO5A 2E0QA 4ACSA 2CV4A 3TKSC 4WBJA 4IJIA 2IMDA 3R2QA 4IW9A 1BG5A 3DKSA 5B8AA 1XOBA 5D8IA 2FD3A 3O76A 3D4MA 3HVVA 2YV7A 1TOFA 2H0IA 5IMDA 5LD0A 1VF1A 2LRNA 1BQ7A 5GSTA 1SK0A 2OE3A 3ZLPA 4ICYA 2X8HA 2A4VA 4OCFA 1JHBA 1GSSA 4Z2RA 3IAM2 4G2EA 2HYXA 1EZKA 3CSHA 1O8XA 2GTUA 4IP6A 1K3LA 1V57A 2LQOA 2RLIA 3DD3A 3PR8A 3UMAA 3MSZA 3ERGA 4O7HA 1SL0B 3GRXA 1S3DA 1AQWA 3PGTA 3DRNA 5A4VA 3DWVA 5COHA 1XWBA 2CAIA 1K0BA 4LLRA 1G0TA 2DIYA 1HNAA 1TK0B 1T00A 2H75A 3LYKA 4N0ZA 4HI7A 3U6VA 5AN1A 3VI7A 5DJMA 3IK9A 2OKAA 5INYA 2H71A 2WB9A 1WIKA 1TKDB 3JCML 1GRXA 2IMKA 1N8JA 3I69A 4BWQA 3FKFA 1KBNA 1IYIA 4MJEA 2V2GA 4TR0A 5IMFA 2HZEB 3HDCA 3HXSA 3G7YA 3FR6A 4XRAA 1Z6MA 4I6XA 1GNWA 1XPVA 2YWMA 4OCEA 1QXHA 2WULA 1M99A 2NDOA 1DE1A 3ME8A 1AUCA 2N5AA 2F8FA 2QGVA 3EU4A 3ZITA 5KEJA 12GSA 4MH3A 3L9VA 5J5NA 2H19A 3FY7A 4PTSA 4KCAA 1TRSA 2PPTA 1WP0A 4EIPA 4WR5A 3BOAA 1AQVA 4MABA 5CRDA 1JZWA 5CRWA 1PKWA 1TW9A 2HT9A 3IPZA 5F05A 4AF2A 3TOUA 2MMOA 4MPFA 4AJ7A 1F6MC 3LQ7A 2NVLA 3HD5A 2C0DA 2JU5A 2ES7A 4MF5A 2AHEA 2DJ0A 4TW5A 3EYTA 2VUPA 1FG4A 4FQUA 3Q6OA 2VL3A 2FWEA 4G10A 2CA8A 2XBQA 5IPGA 1GP1A 3ZFLA 4FYCA 1ZMAA 3ZTLA 2OA7A 3HVXA 2LQQA 5GAPD 4GSTA 1TXXA 4FO5A 1UVZA 1JZRA 4AJ6A 1G7OA 1M3JA 2FUG2 4ZBBA 4EC0A 2YZHA 3GHAA 4XS1A 4GSNA 1NW2A 1Z3EA 1GSYA 4KUNA 5IO0A 5J9BA 3I6AA 2YJHA 3FW2A 2QA2A 3VK9A 3L9UA 4MJAA 4LL1B 5B7CA 4WF4A 1GTUA 1Q4JA 1XBSA 3E9JB 4TR4A 3H93A 1Z7PA 1XWCA 1X5CA 4IELA 2HE3A 4O92A 3J7Yb 3HCZA 3GKXA 4Q5QA 3UVTA 1K0NA 2HRFA 1EP7A 2I81A 1I5GA 2OACA 3QR6A 4GCIA 5JCUA 1QUWA 2JSZA 5CRGA 4H86A 1Z7RA 2AYTA 2GSSA 4JR6A 2CZ3A 2H72A 2H76A 4K7IA 1PA3A 5ENUA 4LL4B 2REMA 5CNWA 3UARA 5F06A 3FZ4A 4GQCA 1GTBA 2VAFA 5DALA 1ERTA 2HNLA 4KAEA 3IV4A 2ON7A 4ML1A 1TRUA 4WKWA 3GTUA 2OBIA 1U3AA 3D21A 1SKSB 5ECKB 3TGZA 2YZUA 4I5QA 5JWQB 2VCQA 4GXZA 1X9WB 4V1Ag 4RQXA 4D73B 3TKSE 2VLTA 3ZZXA 4RI6A 5J4UA 1T1VA 5IMCA 2RM6A 4PQIA 4ECCA 5ELAA 1Y6EA 4ZXGA 3KJYA 4Q5RA 5DCGA 2OE1A 5JCWA 3AY8A 2KHPA 4BVXB 2VCTA 3LXTA 3S9FA 2FY6A 1TP9A 5G1LA 4TVEA 3D22A 1Y25A 11GSA 3F8UA 1Q98A 5D9WA 1B9XC 1XWKA 3VFIA 1PKZA 2H70A 2N5FA 4I2TA 3RPPA 3UJ1A 1JFUA 2DJ3A 1FW1A 1S3CA 1JZDA 4K5SA 2EC4A 1ERWA 4NV5A 2PMTA 4XS4A 2A2SA 4TOPA 2YNXA 3NZNA 4IN0A 1XW5A 2DBCA 1YDKA 4WETA 3IHQA 3IDVA 1USBA 3G9BA 4G0LA 3H79A 2HZEA 3FZ5A 3SBCA 3LW9A 4OO4A 4XTSA 3ISOA 4HQZA 22GSA 2HZFA 3GA4A 3W8SA 2XBIA 1UN2A 1A8YA 4IJ3A 4IS0A 3EINA 5FHIA 3EPTA 1JZOA 2C1YA 6GSYA 3EWLA 3EURA 3W6GA 1TI3A 2GSTA 4TR1A 2VD0A 2GZYA 1GUHA 3WYWA 1SENA 1GUMA 3O3TA 3QD9A 5D9TA 1R4WA 2B1LA 1M9AA 2I3YA 3QAVA 5DVBA 2DJ1A 4USSA 4NAXA 2AV4A 5AIVA 3QAGA 4Z7XA 4HDEA 4A5PA 19GSA 1EEJA 2CX3A 3ERWA 1CQGA 3CRTA 1YJ6A 4MPGA 2YCDA 1THOA 1ZZYA 2VCWA 4YH2A 4I2UA 3A2WA 4K2XA 3HYPA 1GULA 3J7Yk 4GF0A 1YQ1A 4ZB8A 3IK7A 1SYRA 1B4QA 3BBYA 1K0OA 2VIMA 1Z9HA 3DXBA 3E3EA 4EUYA 3BJ5A 3IR4A 2PBJA 4HQSA 3TRPA 3FR9A 4P3YB 3VPTA 2YWOA 5D96A 4HOJA 2FWFA 4J57E 1EWXA 2LRCA 3GX0A 3CSIA 4K7NA 1MD4A 3IHGA 2X99A 4ZBDA 4PUFC 2B3SA 3GFKA 4K0GA 4K5RA 1PN9A 2MBTA 5GSSA 1DUGA 2OE0A 4YQUA 1T7PB 1V2AA 3QAWA 2GZPA 3BCKA 3RBTA 1MEKA 1QGVA 5B6MA 2R37A 4KCEA 1FVKA 1M9BA 2P5RA 3P90A 2FCHA 3GN3A 4X4JA 1HNBA 2HLSA 2R3XA 3ZMKA 2X49A 3QCPA 2GT6A 2F8AA 2IMEA 3WT2A 4OD7A 3GNJA 3LORA 2DC5A 1V98A 2V6OA 1ERUA 2CT6A 3VPQA 2HSHA 1OE7A 2XPEA 2QC7A 1WOUA 5B6NA 5C00A 2CQ9A 4ZL7A 3HVNA 5IMAA 4MZWA 2DJJA 4K8MA 1N2AA 1XOAA 3D6IA 4TKYA 3ED3A 2M46A 3GYKA 4TXOA 4TR3A 4EE0A 3F6FA 5ECMB 1SL2B 3D4TA 4MCUA 5ELGA 4JBBA 2LSTA 5JWRB 1K3YA 4BVXA 1EV9A 3GMFA 2NBSA 3EMPA 1GL8A 1R5AA 4KDYA 4WF5A 4CDOA 3L4NA 1GSFA 4DSSB 3KIJA 4IP1A 5ID2B 2CVKA 4ZL9A 1B48A 2EIRA 3HJPA 4KH7A 3TB2A 3HHVA 1DBYA 1OC9B 1ABAA 4J56E 2H1DA 1W89A 2P5QA 2R0CA 5D93A 3LJRA 2PN8A 4DSRA 1B9YC 5IOXA 4GLTA 8GSSA 2H73A 1O73A 1ACVA 5HR3A 3DIEA 2L5LA 1FOHA 5C04A 2VLUA 1A2LA 2VM2A 1E6BA 1QMVA 2BJXA 3LSZA 2O8VB 3LFLA 3D0ZA 3KH9A 5DAKB 4BVYB 1K0DA 3FMWA 4WBRD 3F9UA 1YZXA 3RHBA 2C3TA 4AGSA 1FHEA 2J9HA 3IAS2 2X8GA 2XHFA 3DMLA 4Z2UA 1PQNA 1VF3A 5EL8A 5AIXA 2DJ2A 4DSQA 5CAXA 2MZCA 2VCZA 2H30A 3M3MA 3P2AA 3ZREA 1GTAA 2NTOA 2YWIA 2M72A 3H1NA 1ZL9A 2KUCA 1F2EA 2PU9C 1WMJA 2DMLA 7GSSA 4O5QA 1X9MB 2L6DA 2H0HA 3GUSA 4X0XA 3FZAA 3MDKA 4POKA 4E8HA 2VOCA 4YAVA 5G31A 3TJGA 1ML6A 4BL7B 2AB6A 2P0GA 2VD1A 3IXRA 1ZGNA 2K18A 2L4QA 2C0GA 2LV3A 4NHWA 5CRHA 1A0RP 4RQRA 1U88A 2FGXA 2R2JA 4MP4A 4EL1A 3ZMLA 4RI7A 1WWJA 2DKIA 5GAND 4RUVA 4ZIJA 2JL4A 2JZSA 3HZ4A 4XHMA 4IKHA 4YKFA 2YANA 1AXDA 2G0FA 1GNEA 3R3EA 3MNGA 1PRXA 2FHEA 1GSUA 4FIWA 1AW9A 3UBLA 1NHOA 3APOA 5D9XA 4O32A 1XVQA 1WJKA 3GL3A 1MD3A 2CZ2A 4HJ2A 4TXVA 4K7OA 4OFTA 5A4UA 4K6XA 4MNNA 2WCIA 3US3A 4MMMA 1B4PA 5F8BA 3KM6A 3TDGA 3VWXA 3KGKA 2G2QA 2F51A 5ECNB 4F9ZA 1RW1A 2V1MA 2XPDA 2OADA 1AIUA 3APQA 5G5EA 1O6JA 1OC8A 1JLWA 1GTIA 2DJKA 5A5KA 1XFLA 5HFIA 1PGTA 4HZ2A 3UVHA 3WGXA 4OO5A 2V6KA 3QMXA 1F9MA 2IFQA 3C1RA 4FYBA 3DEXA 1G6YA 3CRUA 2WFCA 2GLRA 3A5IA 1DE2A 4HUAA 1B8XA 2HXKA 1F3BA 4XIHA 3CBUA 2A4HA 3F4TA 1ZYPA 1PSQA 1TRWA 3TKQA 2GQKA 4PQ1A 1EV4A 3HVSA 1EEMA 2JACA 5F0GA 4EDZA 4MJBA 3WGEA 3CSJA 2L5OA 1U3IA 5IIZA 1PX6A 3TKRA 1KTEA 4O5RA 3N5OA 5EY6A 3EU3A 3F3RA 2FNOA 1ON4A 2GDRA 1PD21 2B5XA 5HR2A 3DVWA 4L0UA 3APSA 1MDJA 2JZTA 4KE3A 2GQLA 3TOTA 4KF9A 3EE2A 2DLXA 4V1Ap 1NHYA 4PX1A 4DVCA
chains in the Genus database with same CATH topology
1ERVA 4NV2A 3GH9A 2RIIA 3RPNA 1MDKA 3O6TA 4L8EA 2Z9SA 3ERFA 2YP6A 1ST9A 1M2BA 4IBPA 1U87A 1XXUA 1SL1B 1QQ2A 3UIWA 3L9SA 3G7IA 1TK5B 3A3TA 1PL2A 4WXTA 1SK1A 1YF1A 1FOVA 2CX4A 4L5LA 4K9ZA 4EXJA 4NMUA 2MBSA 1URMA 3E0UA 1EOHA 3H8QA 1GSEA 2YN1A 2HRNA 3EVIA 3C7MA 5ECIB 3TJFA 5IM9A 2EIQA 3SWLA 3DVXA 3U5RE 4AJ8A 2GQMA 4EVMA 1EOGA 3GIXA 1TI1A 1H4OA 1R5PA 1EGOA 2YJ7A 4PGTA 1HQOA 3A5WA 3TRQA 2FWGA 3M9KA 4IHUA 2TRCP 3KTBA 1WE0A 1XW6A 4ZB9A 3MWHA 3ZVJD 4PXOA 2FA8A 4QQ7A 2JSYA 4CHSA 3NIVA 2RUEA 4ECIA 13GSA 4JR4A 3F6DA 3A2VA 2C3QA 1HYUA 4EKZA 4EIQA 3GSTA 4GWRA 4G9HA 4PNGA 2L59A 3GL5A 5DCHA 2B1KA 4GSSA 4GRFA 16GSA 3GX8A 1FB6A 3P7XA 3G7JA 2WS2A 1Z5YE 2F9SA 5J41A 4CW9A 4KA0A 4KDXA 1GLQA 3MIXA 4Q5NA 5E4WA 2FLSA 2V41A 4BPYA 1J9BA 4HU9A 1T8EB 4JZQA 1K0CA 1SD9A 4KB3A 3TJBA 5F07A 2CVDA 1V9WA 1ZYNA 6GSUA 2H66A 2MMAA 4ECBA 5ECOB 4NXIA 2LS5A 2YV9A 2H0GA 3MAKA 3IC4A 5A4WA 4BWSA 4MF7A 1H75A 4POBA 3P8WA 5EPFA 3UBKA 2GGTA 5IO2A 1BJXA 3C1SA 3QFBC 1MDIA 1X5EA 2H1BA 3GH6A 2C0EA 1SK2A 2TIRA 4EF0A 2FA4A 4MK3A 4DEJA 2H74A 3KP9A 4IGJA 1TTZA 5ECSA 2C0FA 1V40A 3TJKA 3F4SA 2LTKA 4GQFA 6GSTA 3VURA 2E2GA 2VLVA 3CMIA 2WZ9A 4QL9A 2VCVA 1AAZA 2PUKC 2RUFA 1OC3A 3V1WA 1JLVA 1SU9A 1T3BA 5DQSA 2UZ8A 2YOIA 17GSA 1A24A 3ZIJA 4HU7A 4ID0A 2GZZA 1R7HA 4JU5A 2KP2A 1KNGA 2F3MA 2IPAA 4MZCA 1XIYA 5B8BA 4D73A 1YEXA 18GSA 3VI5A 5BRTA 3FR3A 3KCMA 2FWHA 5KN0A 1X9SB 4ZILA 3CTGA 4O5UA 5CYYA 4MJCA 5KOXA 2H1AA 2P31A 3UAPA 1GSQA 3TCOA 3F4RA 3VLNA 3I43A 3LWAA 6GSWA 1M7TA 5IPHA 4ECJA 3FK8A 4PUAA 2B7KA 2I9HA 1XCCA 1X0RA 3QDNA 3KMNA 4LMWA 2EIOA 1TU8A 2D2ZA 3NOFA 3WGDA 5GZZB 3DYRA 5CP1A 3EC3A 3LYPA 4HZ4A 4LMVA 5HR1A 3RAZA 2NPBA 1XW9A 3FHKA 2X64A 4IQ1A 3M8NA 6GSSA 2I1UA 2LJKA 1K0MA 5ECLB 1XWGA 6GSXA 4JEDA 4N11A 5KN1A 3QPMA 1YKCA 5DALB 4TN8A 5J3RA 1ILOA 2GSQA 3FYGA 3GTUB 4MF6A 2C3NA 3GKKA 2HI7A 3HA9A 4YKGA 4F0CA 4K2DA 1LBKA 2B5EA 3CTFA 10GSA 4HJMA 2O89A 1F3AA 2I4AA 1S3AA 1T4YA 2O87A 4QL7A 3TKPA 3UEMA 1YKAA 1SJIA 1BYEA 4KW6A 2QA1A 2GT5A 3FEUA 4YQMA 2PVQA 4HEA2 5H5RA 5BMUA 5JWOB 3C8EA 9GSSA 1I9DA 3Q18A 2R0PA 1O81A 2MMZA 2VO4A 1PMTA 5HQPA 4V2NA 2VL9A 3VWUA 5J9CA 1LJRA 4NPBA 4XS4B 4WEYA 4OFMA 3C73A 3UL3A 3KZQA 4F03A 1GLPA 2IWTA 1PL1A 5ECPB 3HJOA 3C71A 3WT1A 4IQAA 3DGQA 1XZOA 2LRTA 2LKUA 1K3OA 5ECQB 1A2MA 5KOWA 4MLYA 1GWCA 4MDCA 2R4VA 3F0IA 4JE1A 1M2AA 1X5DA 2VL2C 4YAPA 2TRXA 4KX4A 1SJZA 1VF2A 1CQHA 1SYXA 4K0NA 4PURA 1TRVA 4TRXA 5E59A 2V32A 1GSDA 3H4KA 4TR1B 2WGRA 4V2LA 1V58A 3L78A 2ZNMA 2LEGA 4N10A 5FT3A 1SD8A 2IMIA 1FAAA 1O85A 2DKHA 2R0GA 1ZCPA 4OMVA 3M9JA 3EMXA 2E2MA 1K0AA 1WPIA 3HZ8A 5LCZA 1KEBA 1W4VA 2KOKA 4NWYA 4ISDA 3ZRDA 4KSOA 4X43A 2IJYA 3TJJA 3QOUA 2AUVA 2CAQA 1SKRB 1QFNA 4F82A 1GH2A 3VWVA 4KGIA 5CO3A 4ZB6A 1EP8A 5HFKA 3FZ9A 2RM5A 4XS6A 3M1GA 1A0FA 5DJLA 3L0HA 3KXOA 2B5YA 1ZYQB 2LNSA 4FH8A 1MTCA 2HSYA 1PN0A 2E7PA 1GUKA 1UA5A 4DSSA 5HR0A 4ZBAA 5ID2A 3A2XA 2VCXA 2DSAA 1YF0A 5FWGA 5EVOA 3F63A 3LEFA 4OWYA 3IC8A 2IN3A 3M0FA 1OC9A 4G0IA 5G5FA 1E2YA 4PQHA 2IIYA 3ZL5A 1R26A 2GVPA 1FB0A 1U6TA 3ZVJA 3ZFBA 3QFAC 6GSVA 4KDUA 3LXZA 5G2ZA 2LUSA 2X8CA 5LNKe 3W8JA 3PH9A 1M0UA 5KN3A 4MZBA 5DAKA 4BVYA 4X1UA 2CVBA 1OYJA 2ZUPA 1YY7A 2YPMA 5L71A 2HRKA 3GKMA 5ECRB 4Z2TA 4I97A 5IOWA 5G1KA 4TXOB 4MA9A 4ILFA 2MYGA 2DIZA 2PWJA 4EDYA 1M2DA 4CY6A 1UC7A 1SKWB 3IE3A 1TDIA 1HD2A 2C80A 5JCGA 5H5SA 1C72A 4WR4A 4BA7A 2QSIA 5AISA 5CREA 1BAYA 1DSBA 4BL7A 5DQYA 3BD2A 5IQYA 3GURA 2PVOC 1VF4A 2R6KA 1AQXA 5IMZA 2AJQB 4V2MA 3HJMA 4I8BA 3TRXA 3TUEA 3KTLA 2BMXA 2JADA 1OKDA 1VGLA 2K6VA 2K8VA 2BTOT 4E8EA 2YWNA 5DDLA 1NSWA 3ZYWA 4KSMA 2KLXA 4ML6A 2LJRA 4Q5FA 1A8LA 4FYUA 2LNTA 1XVWA 2L4CA 4L5OA 2PERA 3IRAA 3HY2A 2MMNA 2AAWA 1OAZA 1TK8B 1HNCA 1G6WA 2H6YA 3FRCA 5HFGA 5AGYA 1QK8A 3HKRA 2QKEA 4HS1A 1XWAA 1OVNA 4XCSA 1O8WA 3D5JA 2H6XA 1VRSD 2LJAA 5D9VA 1FVJA 3GKNA 1A2JA 2WJUA 4ZL8A 2JZRA 3KEBA 4K1FA 3MYDA 2O85A 3TKSA 4ULXA 3WD6A 2KP1A 2GS3A 2R5GA 1AC1A 3Q74A 5ECHB 2K8SA 2L6CA 2OJLA 1T4ZA 1OKTA 1F37A 2B6MA 1RQMA 2O7KA 3IOSA 5DBQA 3UOMA 1ZOFA 2H8LA 4JRRA 2X4AA 4F2IA 1G7EA 3KP8A 4G0KA 4N0VA 2ALBA 2HRAA 4L0WA 4PNFA 4POMA 2ON5A 4GTUA 5D73A 2H1GA 4MH2A 2PGTA 1J0FA 3ME7A 4OFNA 2A2PA 3LG6A 3RHCA 14GSA 1NM3A 5KN2A 4YQVA 3GV1A 2XC2A 5ABRA 1RK4A 2B7JA 4G19A 3RDWA 3LGCA 2C4JA 2C8UA 3CYNA 2IMFA 1THXA 3CXGA 5IMVA 4LA1A 1SJ6A 2HFDA 1Z6NA 3PPUA 2J23A 4CY8A 2GSRA 2H01A 2VM1A 3GSSA 3VWWA 2H6ZA 1TU7A 4KNDA 3Q19A 4NHZA 3BCIA 1EGRA 3F3QA 2N5BA 3IA1A 4EO3A 1PX7A 3KD0A 3KMOA 1YEPA 5H5QA 2OBKA 1O7UA 1IYHA 2IFQB 3N9JA 4J2FA 2ZCTA 1BX9A 3PINA 2WDUA 3K8NA 1WRYA 1A23A 2IL3A 20GSA 2A2RA 3I9V2 1ZYEA 4N30A 3ZIVA 2M80A 4F0BA 3KH7A 4XRDA 2K9FA 2L57A 4IVFA 1J08A 2VL2A 2DMMA 5G30A 3IBHA 2WRTA 2HSMA 4POLA 1LU4A 1BEDA 1OE8A 1TJDA 3OR5A 1FO5A 2E0QA 4ACSA 2CV4A 3TKSC 4WBJA 4IJIA 2IMDA 3R2QA 4IW9A 1BG5A 3DKSA 5B8AA 1XOBA 5D8IA 2FD3A 3O76A 3D4MA 3HVVA 2YV7A 1TOFA 2H0IA 5IMDA 5LD0A 1VF1A 2LRNA 1BQ7A 5GSTA 1SK0A 2OE3A 3ZLPA 4ICYA 2X8HA 2A4VA 4OCFA 1JHBA 1GSSA 4Z2RA 3IAM2 4G2EA 2HYXA 1EZKA 3CSHA 1O8XA 2GTUA 4IP6A 1K3LA 1V57A 2LQOA 2RLIA 3DD3A 3PR8A 3UMAA 3MSZA 3ERGA 4O7HA 1SL0B 3GRXA 1S3DA 1AQWA 3PGTA 3DRNA 5A4VA 3DWVA 5COHA 1XWBA 2CAIA 1K0BA 4LLRA 1G0TA 2DIYA 1HNAA 1TK0B 1T00A 2H75A 3LYKA 4N0ZA 4HI7A 3U6VA 5AN1A 3VI7A 5DJMA 3IK9A 2OKAA 5INYA 2H71A 2WB9A 1WIKA 1TKDB 3JCML 1GRXA 2IMKA 1N8JA 3I69A 4BWQA 3FKFA 1KBNA 1IYIA 4MJEA 2V2GA 4TR0A 5IMFA 2HZEB 3HDCA 3HXSA 3G7YA 3FR6A 4XRAA 1Z6MA 4I6XA 1GNWA 1XPVA 2YWMA 4OCEA 1QXHA 2WULA 1M99A 2NDOA 1DE1A 3ME8A 1AUCA 2N5AA 2F8FA 2QGVA 3EU4A 3ZITA 5KEJA 12GSA 4MH3A 3L9VA 5J5NA 2H19A 3FY7A 4PTSA 4KCAA 1TRSA 2PPTA 1WP0A 4EIPA 4WR5A 3BOAA 1AQVA 4MABA 5CRDA 1JZWA 5CRWA 1PKWA 1TW9A 2HT9A 3IPZA 5F05A 4AF2A 3TOUA 2MMOA 4MPFA 4AJ7A 1F6MC 3LQ7A 2NVLA 3HD5A 2C0DA 2JU5A 2ES7A 4MF5A 2AHEA 2DJ0A 4TW5A 3EYTA 2VUPA 1FG4A 4FQUA 3Q6OA 2VL3A 2FWEA 4G10A 2CA8A 2XBQA 5IPGA 1GP1A 3ZFLA 4FYCA 1ZMAA 3ZTLA 2OA7A 3HVXA 2LQQA 5GAPD 4GSTA 1TXXA 4FO5A 1UVZA 1JZRA 4AJ6A 1G7OA 2FUG2 4ZBBA 4EC0A 2YZHA 3GHAA 4XS1A 4GSNA 1NW2A 1Z3EA 1GSYA 4KUNA 5IO0A 5J9BA 3I6AA 2YJHA 3FW2A 2QA2A 3VK9A 3L9UA 4MJAA 4LL1B 5B7CA 4WF4A 1GTUA 1Q4JA 1XBSA 3E9JB 4TR4A 3H93A 1Z7PA 1XWCA 1X5CA 4IELA 2HE3A 4O92A 3J7Yb 3HCZA 3GKXA 4Q5QA 3UVTA 1K0NA 2HRFA 1EP7A 2I81A 1I5GA 2OACA 3QR6A 4GCIA 5JCUA 1QUWA 2JSZA 5CRGA 4H86A 1Z7RA 2AYTA 2GSSA 4JR6A 2CZ3A 2H72A 2H76A 4K7IA 1PA3A 5ENUA 4LL4B 2REMA 5CNWA 3UARA 5F06A 3FZ4A 4GQCA 1GTBA 2VAFA 5DALA 1ERTA 2HNLA 4KAEA 3IV4A 2ON7A 4ML1A 1TRUA 4WKWA 3GTUA 2OBIA 1U3AA 3D21A 1SKSB 5ECKB 3TGZA 2YZUA 4I5QA 5JWQB 2VCQA 4GXZA 1X9WB 4V1Ag 4RQXA 4D73B 3TKSE 2VLTA 3ZZXA 4RI6A 5J4UA 1T1VA 5IMCA 2RM6A 4PQIA 4ECCA 5ELAA 1Y6EA 4ZXGA 3KJYA 4Q5RA 5DCGA 2OE1A 5JCWA 3AY8A 2KHPA 4BVXB 2VCTA 3LXTA 3S9FA 2FY6A 1TP9A 5G1LA 4TVEA 3D22A 1Y25A 11GSA 3F8UA 1Q98A 5D9WA 1B9XC 1XWKA 3VFIA 1PKZA 2H70A 2N5FA 4I2TA 3RPPA 3UJ1A 1JFUA 2DJ3A 1FW1A 1S3CA 1JZDA 4K5SA 2EC4A 1ERWA 4NV5A 2PMTA 4XS4A 2A2SA 4TOPA 2YNXA 3NZNA 4IN0A 1XW5A 2DBCA 1YDKA 4WETA 3IHQA 3IDVA 1USBA 3G9BA 4G0LA 3H79A 2HZEA 3FZ5A 3SBCA 3LW9A 4OO4A 4XTSA 3ISOA 4HQZA 22GSA 2HZFA 3GA4A 3W8SA 2XBIA 1UN2A 1A8YA 4IJ3A 4IS0A 3EINA 5FHIA 3EPTA 1JZOA 2C1YA 6GSYA 3EWLA 3EURA 3W6GA 1TI3A 2GSTA 4TR1A 2VD0A 2GZYA 1GUHA 3WYWA 1SENA 1GUMA 3O3TA 3QD9A 5D9TA 1R4WA 2B1LA 1M9AA 2I3YA 3QAVA 5DVBA 2DJ1A 4USSA 4NAXA 2AV4A 5AIVA 3QAGA 4Z7XA 4HDEA 4A5PA 19GSA 1EEJA 2CX3A 3ERWA 1CQGA 3CRTA 1YJ6A 4MPGA 2YCDA 1THOA 1ZZYA 2VCWA 4YH2A 4I2UA 3A2WA 4K2XA 3HYPA 1GULA 3J7Yk 4GF0A 1YQ1A 4ZB8A 3IK7A 1SYRA 1B4QA 3BBYA 1K0OA 2VIMA 1Z9HA 3DXBA 3E3EA 4EUYA 3BJ5A 3IR4A 2PBJA 4HQSA 3TRPA 3FR9A 4P3YB 3VPTA 2YWOA 5D96A 4HOJA 2FWFA 4J57E 1EWXA 2LRCA 3GX0A 3CSIA 4K7NA 1MD4A 3IHGA 2X99A 4ZBDA 4PUFC 2B3SA 3GFKA 4K0GA 4K5RA 1PN9A 2MBTA 5GSSA 1DUGA 2OE0A 4YQUA 1T7PB 1V2AA 3QAWA 2GZPA 3BCKA 3RBTA 1MEKA 1QGVA 5B6MA 2R37A 4KCEA 1FVKA 1M9BA 2P5RA 3P90A 2FCHA 3GN3A 4X4JA 1HNBA 2HLSA 2R3XA 3ZMKA 2X49A 3QCPA 2GT6A 2F8AA 2IMEA 3WT2A 4OD7A 3GNJA 3LORA 2DC5A 1V98A 2V6OA 1ERUA 2CT6A 3VPQA 2HSHA 1OE7A 2XPEA 2QC7A 1WOUA 5B6NA 5C00A 2CQ9A 4ZL7A 5IMAA 4MZWA 2DJJA 4K8MA 1N2AA 1XOAA 3D6IA 4TKYA 3ED3A 2M46A 3GYKA 4TXOA 4TR3A 4EE0A 3F6FA 5ECMB 1SL2B 3D4TA 4MCUA 5ELGA 4JBBA 2LSTA 5JWRB 1K3YA 4BVXA 1EV9A 3GMFA 2NBSA 3EMPA 1GL8A 1R5AA 4KDYA 4WF5A 4CDOA 3L4NA 1GSFA 4DSSB 3KIJA 4IP1A 5ID2B 2CVKA 4ZL9A 1B48A 2EIRA 3HJPA 4KH7A 3TB2A 3HHVA 1DBYA 1OC9B 1ABAA 4J56E 2H1DA 1W89A 2P5QA 2R0CA 5D93A 3LJRA 2PN8A 4DSRA 1B9YC 5IOXA 4GLTA 8GSSA 2H73A 1O73A 1ACVA 5HR3A 3DIEA 2L5LA 1FOHA 5C04A 2VLUA 1A2LA 2VM2A 1E6BA 1QMVA 2BJXA 3LSZA 2O8VB 3LFLA 3D0ZA 3KH9A 5DAKB 4BVYB 1K0DA 3FMWA 4WBRD 3F9UA 1YZXA 3RHBA 2C3TA 4AGSA 1FHEA 2J9HA 3IAS2 2X8GA 2XHFA 3DMLA 4Z2UA 1PQNA 1VF3A 5EL8A 5AIXA 2DJ2A 4DSQA 5CAXA 2MZCA 2VCZA 2H30A 3M3MA 3P2AA 3ZREA 1GTAA 2NTOA 2YWIA 2M72A 3H1NA 1ZL9A 2KUCA 1F2EA 2PU9C 1WMJA 2DMLA 7GSSA 4O5QA 1X9MB 2L6DA 2H0HA 3GUSA 4X0XA 3FZAA 3MDKA 4POKA 4E8HA 2VOCA 4YAVA 5G31A 3TJGA 1ML6A 4BL7B 2AB6A 2P0GA 2VD1A 3IXRA 1ZGNA 2K18A 2L4QA 2C0GA 2LV3A 4NHWA 5CRHA 1A0RP 4RQRA 1U88A 2FGXA 2R2JA 4MP4A 4EL1A 3ZMLA 4RI7A 1WWJA 2DKIA 5GAND 4RUVA 4ZIJA 2JL4A 2JZSA 3HZ4A 4XHMA 4IKHA 4YKFA 2YANA 1AXDA 2G0FA 1GNEA 3R3EA 3MNGA 1PRXA 2FHEA 1GSUA 4FIWA 1AW9A 3UBLA 1NHOA 3APOA 5D9XA 4O32A 1XVQA 1WJKA 3GL3A 1MD3A 2CZ2A 4HJ2A 4TXVA 4K7OA 4OFTA 5A4UA 4K6XA 4MNNA 2WCIA 3US3A 4MMMA 1B4PA 5F8BA 3KM6A 3TDGA 3VWXA 3KGKA 2G2QA 2F51A 5ECNB 4F9ZA 1RW1A 2V1MA 2XPDA 2OADA 1AIUA 3APQA 5G5EA 1O6JA 1OC8A 1JLWA 1GTIA 2DJKA 5A5KA 1XFLA 5HFIA 1PGTA 4HZ2A 3UVHA 3WGXA 4OO5A 2V6KA 3QMXA 1F9MA 2IFQA 3C1RA 4FYBA 3DEXA 1G6YA 3CRUA 2WFCA 2GLRA 3A5IA 1DE2A 4HUAA 1B8XA 2HXKA 1F3BA 4XIHA 3CBUA 2A4HA 3F4TA 1ZYPA 1PSQA 1TRWA 3TKQA 2GQKA 4PQ1A 1EV4A 3HVSA 1EEMA 2JACA 5F0GA 4EDZA 4MJBA 3WGEA 3CSJA 2L5OA 1U3IA 5IIZA 1PX6A 3TKRA 1KTEA 4O5RA 3N5OA 5EY6A 3EU3A 3F3RA 2FNOA 1ON4A 2GDRA 1PD21 2B5XA 5HR2A 3DVWA 4L0UA 3APSA 1MDJA 2JZTA 4KE3A 2GQLA 3TOTA 4KF9A 3EE2A 2DLXA 4V1Ap 1NHYA 4PX1A 4DVCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ERV A;  4NV2 A;  3GH9 A;  2RII A;  3RPN A;  1MDK A;  3O6T A;  4L8E A;  2Z9S A;  3ERF A;  2YP6 A;  1ST9 A;  1M2B A;  4IBP A;  1U87 A;  1XXU A;  1SL1 B;  1QQ2 A;  3UIW A;  3L9S A;  3G7I A;  1TK5 B;  3A3T A;  1PL2 A;  4WXT A;  1SK1 A;  1YF1 A;  1FOV A;  2CX4 A;  4L5L A;  4K9Z A;  4EXJ A;  4NMU A;  2MBS A;  1URM A;  3E0U A;  1EOH A;  3H8Q A;  1GSE A;  2YN1 A;  2HRN A;  3EVI A;  3C7M A;  5ECI B;  3TJF A;  5IM9 A;  2EIQ A;  3SWL A;  3DVX A;  3U5R E;  4AJ8 A;  2GQM A;  4EVM A;  1EOG A;  3GIX A;  1TI1 A;  1H4O A;  1R5P A;  1EGO A;  2YJ7 A;  4PGT A;  1HQO A;  3A5W A;  3TRQ A;  2FWG A;  3M9K A;  4IHU A;  2TRC P;  3KTB A;  1WE0 A;  1XW6 A;  4ZB9 A;  3MWH A;  3ZVJ D;  4PXO A;  2FA8 A;  4QQ7 A;  2JSY A;  4CHS A;  3NIV A;  2RUE A;  4ECI A;  13GS A;  4JR4 A;  3F6D A;  3A2V A;  2C3Q A;  1HYU A;  4EKZ A;  3GST A;  4GWR A;  4G9H A;  4PNG A;  2L59 A;  3GL5 A;  5DCH A;  2B1K A;  4GSS A;  4GRF A;  16GS A;  3GX8 A;  1FB6 A;  3P7X A;  3G7J A;  2WS2 A;  1Z5Y E;  2F9S A;  5J41 A;  4CW9 A;  4KA0 A;  4KDX A;  1GLQ A;  4Q5N A;  5E4W A;  2FLS A;  2V41 A;  4BPY A;  1J9B A;  4HU9 A;  1T8E B;  4JZQ A;  1K0C A;  1SD9 A;  4KB3 A;  3TJB A;  5F07 A;  2CVD A;  1V9W A;  6GSU A;  2H66 A;  2MMA A;  4ECB A;  5ECO B;  4NXI A;  2LS5 A;  2YV9 A;  2H0G A;  3MAK A;  3IC4 A;  5A4W A;  4BWS A;  4MF7 A;  1H75 A;  4POB A;  3P8W A;  5EPF A;  3UBK A;  2GGT A;  5IO2 A;  1BJX A;  3C1S A;  3QFB C;  1MDI A;  1X5E A;  2H1B A;  3GH6 A;  2C0E A;  1SK2 A;  2TIR A;  4EF0 A;  2FA4 A;  4MK3 A;  4DEJ A;  2H74 A;  3KP9 A;  4IGJ A;  1TTZ A;  5ECS A;  2C0F A;  1V40 A;  3TJK A;  3F4S A;  2LTK A;  4GQF A;  6GST A;  3VUR A;  2E2G A;  2VLV A;  3CMI A;  2WZ9 A;  4QL9 A;  2VCV A;  1AAZ A;  2PUK C;  2RUF A;  1OC3 A;  3V1W A;  1JLV A;  1SU9 A;  1T3B A;  5DQS A;  2YOI A;  17GS A;  1A24 A;  3ZIJ A;  4HU7 A;  4ID0 A;  2GZZ A;  1R7H A;  4JU5 A;  2KP2 A;  1KNG A;  2F3M A;  2IPA A;  4MZC A;  1XIY A;  5B8B A;  4D73 A;  1YEX A;  18GS A;  3VI5 A;  3FR3 A;  3KCM A;  2FWH A;  5KN0 A;  1X9S B;  4ZIL A;  3CTG A;  5CYY A;  4MJC A;  2H1A A;  2P31 A;  3UAP A;  1GSQ A;  3TCO A;  3F4R A;  3VLN A;  3I43 A;  3LWA A;  6GSW A;  1M7T A;  5IPH A;  4ECJ A;  3FK8 A;  4PUA A;  2B7K A;  2I9H A;  1XCC A;  1X0R A;  3QDN A;  3KMN A;  4LMW A;  2EIO A;  1TU8 A;  2D2Z A;  3NOF A;  3WGD A;  5GZZ B;  3DYR A;  5CP1 A;  3EC3 A;  3LYP A;  4HZ4 A;  4LMV A;  5HR1 A;  3RAZ A;  2NPB A;  1XW9 A;  3FHK A;  2X64 A;  4IQ1 A;  3M8N A;  6GSS A;  2I1U A;  2LJK A;  1K0M A;  5ECL B;  1XWG A;  6GSX A;  4JED A;  4N11 A;  5KN1 A;  3QPM A;  1YKC A;  5DAL B;  4TN8 A;  5J3R A;  1ILO A;  2GSQ A;  3FYG A;  3GTU B;  4MF6 A;  2C3N A;  3GKK A;  2HI7 A;  3HA9 A;  4F0C A;  4K2D A;  1LBK A;  2B5E A;  3CTF A;  10GS A;  4HJM A;  2O89 A;  1F3A A;  2I4A A;  1S3A A;  1T4Y A;  2O87 A;  4QL7 A;  3TKP A;  3UEM A;  1YKA A;  1SJI A;  1BYE A;  4KW6 A;  2GT5 A;  3FEU A;  4YQM A;  2PVQ A;  4HEA 2;  5H5R A;  5JWO B;  3C8E A;  9GSS A;  1I9D A;  3Q18 A;  1O81 A;  2MMZ A;  2VO4 A;  1PMT A;  5HQP A;  4V2N A;  2VL9 A;  3VWU A;  5J9C A;  1LJR A;  4NPB A;  4XS4 B;  4WEY A;  4OFM A;  3C73 A;  3UL3 A;  3KZQ A;  4F03 A;  1GLP A;  2IWT A;  1PL1 A;  5ECP B;  3HJO A;  3C71 A;  3WT1 A;  4IQA A;  3DGQ A;  1XZO A;  2LRT A;  2LKU A;  1K3O A;  5ECQ B;  1A2M A;  4MLY A;  1GWC A;  4MDC A;  2R4V A;  3F0I A;  4JE1 A;  1M2A A;  1X5D A;  2VL2 C;  4YAP A;  2TRX A;  4KX4 A;  1SJZ A;  1VF2 A;  1CQH A;  1SYX A;  4K0N A;  4PUR A;  1TRV A;  4TRX A;  5E59 A;  2V32 A;  1GSD A;  3H4K A;  4TR1 B;  2WGR A;  4V2L A;  1V58 A;  3L78 A;  2ZNM A;  2LEG A;  4N10 A;  5FT3 A;  1SD8 A;  2IMI A;  1FAA A;  1O85 A;  1ZCP A;  4OMV A;  3M9J A;  3EMX A;  2E2M A;  1K0A A;  1WPI A;  3HZ8 A;  5LCZ A;  1KEB A;  1W4V A;  2KOK A;  4NWY A;  4ISD A;  3ZRD A;  4KSO A;  4X43 A;  2IJY A;  3TJJ A;  3QOU A;  2AUV A;  2CAQ A;  1SKR B;  1QFN A;  4F82 A;  1GH2 A;  3VWV A;  4KGI A;  5CO3 A;  4ZB6 A;  1EP8 A;  5HFK A;  3FZ9 A;  2RM5 A;  4XS6 A;  3M1G A;  1A0F A;  5DJL A;  3L0H A;  3KXO A;  2B5Y A;  1ZYQ B;  2LNS A;  4FH8 A;  1MTC A;  2HSY A;  2E7P A;  1GUK A;  1UA5 A;  4DSS A;  5HR0 A;  4ZBA A;  5ID2 A;  3A2X A;  2VCX A;  2DSA A;  1YF0 A;  5FWG A;  5EVO A;  3F63 A;  3LEF A;  4OWY A;  2IN3 A;  3M0F A;  1OC9 A;  5G5F A;  1E2Y A;  4PQH A;  2IIY A;  3ZL5 A;  1R26 A;  2GVP A;  1FB0 A;  1U6T A;  3ZVJ A;  3ZFB A;  3QFA C;  6GSV A;  4KDU A;  3LXZ A;  5G2Z A;  2LUS A;  2X8C A;  5LNK e;  3W8J A;  3PH9 A;  1M0U A;  5KN3 A;  4MZB A;  5DAK A;  4BVY A;  4X1U A;  2CVB A;  1OYJ A;  2ZUP A;  1YY7 A;  2YPM A;  5L71 A;  3GKM A;  5ECR B;  4I97 A;  5IOW A;  5G1K A;  4TXO B;  4MA9 A;  4ILF A;  2MYG A;  2DIZ A;  2PWJ A;  4EDY A;  1M2D A;  1UC7 A;  1SKW B;  3IE3 A;  1TDI A;  1HD2 A;  2C80 A;  5JCG A;  5H5S A;  1C72 A;  4WR4 A;  4BA7 A;  2QSI A;  5AIS A;  5CRE A;  1BAY A;  1DSB A;  4BL7 A;  5DQY A;  3BD2 A;  5IQY A;  3GUR A;  2PVO C;  1VF4 A;  2R6K A;  1AQX A;  5IMZ A;  2AJQ B;  4V2M A;  3HJM A;  4I8B A;  3TRX A;  3TUE A;  3KTL A;  2BMX A;  2JAD A;  1OKD A;  1VGL A;  2K6V A;  2K8V A;  2BTO T;  4E8E A;  2YWN A;  5DDL A;  1NSW A;  3ZYW A;  4KSM A;  2KLX A;  4ML6 A;  2LJR A;  4Q5F A;  1A8L A;  4FYU A;  2LNT A;  1XVW A;  2L4C A;  4L5O A;  2PER A;  3IRA A;  3HY2 A;  2MMN A;  2AAW A;  1OAZ A;  1TK8 B;  1HNC A;  1G6W A;  2H6Y A;  3FRC A;  5HFG A;  5AGY A;  1QK8 A;  3HKR A;  2QKE A;  4HS1 A;  1XWA A;  1OVN A;  4XCS A;  1O8W A;  3D5J A;  2H6X A;  1VRS D;  2LJA A;  5D9V A;  1FVJ A;  3GKN A;  1A2J A;  2WJU A;  4ZL8 A;  2JZR A;  3KEB A;  4K1F A;  2O85 A;  3TKS A;  4ULX A;  3WD6 A;  2KP1 A;  2GS3 A;  2R5G A;  1AC1 A;  3Q74 A;  5ECH B;  2K8S A;  2L6C A;  2OJL A;  1T4Z A;  1OKT A;  1F37 A;  2B6M A;  1RQM A;  2O7K A;  3IOS A;  5DBQ A;  3UOM A;  1ZOF A;  2H8L A;  4JRR A;  4F2I A;  1G7E A;  3KP8 A;  4N0V A;  2ALB A;  4L0W A;  4PNF A;  4POM A;  2ON5 A;  4GTU A;  5D73 A;  2H1G A;  4MH2 A;  2PGT A;  1J0F A;  3ME7 A;  4OFN A;  3LG6 A;  3RHC A;  14GS A;  1NM3 A;  5KN2 A;  4YQV A;  3GV1 A;  2XC2 A;  5ABR A;  1RK4 A;  2B7J A;  4G19 A;  3RDW A;  3LGC A;  2C4J A;  2C8U A;  3CYN A;  2IMF A;  1THX A;  3CXG A;  5IMV A;  4LA1 A;  1SJ6 A;  2HFD A;  1Z6N A;  2J23 A;  2GSR A;  2H01 A;  2VM1 A;  3GSS A;  3VWW A;  2H6Z A;  1TU7 A;  4KND A;  3Q19 A;  4NHZ A;  3BCI A;  1EGR A;  3F3Q A;  2N5B A;  3IA1 A;  4EO3 A;  1PX7 A;  3KD0 A;  3KMO A;  1YEP A;  5H5Q A;  2OBK A;  1O7U A;  1IYH A;  2IFQ B;  3N9J A;  4J2F A;  2ZCT A;  1BX9 A;  3PIN A;  2WDU A;  3K8N A;  1WRY A;  1A23 A;  2IL3 A;  20GS A;  2A2R A;  3I9V 2;  1ZYE A;  4N30 A;  3ZIV A;  2M80 A;  4F0B A;  3KH7 A;  4XRD A;  2K9F A;  2L57 A;  4IVF A;  1J08 A;  2VL2 A;  2DMM A;  5G30 A;  3IBH A;  2WRT A;  4POL A;  1LU4 A;  1BED A;  1OE8 A;  1TJD A;  3OR5 A;  1FO5 A;  2E0Q A;  4ACS A;  2CV4 A;  3TKS C;  4WBJ A;  4IJI A;  2IMD A;  3R2Q A;  4IW9 A;  1BG5 A;  3DKS A;  5B8A A;  1XOB A;  5D8I A;  2FD3 A;  3O76 A;  3D4M A;  3HVV A;  2YV7 A;  1TOF A;  2H0I A;  5IMD A;  5LD0 A;  1VF1 A;  2LRN A;  1BQ7 A;  5GST A;  1SK0 A;  2OE3 A;  3ZLP A;  2X8H A;  2A4V A;  4OCF A;  1JHB A;  1GSS A;  3IAM 2;  4G2E A;  2HYX A;  1EZK A;  3CSH A;  1O8X A;  2GTU A;  4IP6 A;  1K3L A;  1V57 A;  2LQO A;  2RLI A;  3DD3 A;  3PR8 A;  3UMA A;  3MSZ A;  3ERG A;  4O7H A;  1SL0 B;  3GRX A;  1S3D A;  1AQW A;  3PGT A;  3DRN A;  5A4V A;  3DWV A;  5COH A;  1XWB A;  2CAI A;  1K0B A;  4LLR A;  1G0T A;  2DIY A;  1HNA A;  1TK0 B;  1T00 A;  2H75 A;  3LYK A;  4N0Z A;  4HI7 A;  3U6V A;  5AN1 A;  3VI7 A;  5DJM A;  3IK9 A;  2OKA A;  5INY A;  2H71 A;  2WB9 A;  1WIK A;  1TKD B;  3JCM L;  1GRX A;  2IMK A;  1N8J A;  3I69 A;  4BWQ A;  3FKF A;  1KBN A;  1IYI A;  4MJE A;  2V2G A;  4TR0 A;  5IMF A;  2HZE B;  3HDC A;  3HXS A;  3G7Y A;  3FR6 A;  4XRA A;  1Z6M A;  4I6X A;  1GNW A;  1XPV A;  2YWM A;  4OCE A;  1QXH A;  2WUL A;  1M99 A;  2NDO A;  1DE1 A;  3ME8 A;  1AUC A;  2N5A A;  2F8F A;  2QGV A;  3EU4 A;  3ZIT A;  5KEJ A;  12GS A;  4MH3 A;  3L9V A;  5J5N A;  2H19 A;  3FY7 A;  4KCA A;  1TRS A;  2PPT A;  1WP0 A;  4WR5 A;  3BOA A;  1AQV A;  4MAB A;  5CRD A;  1JZW A;  5CRW A;  1PKW A;  1TW9 A;  2HT9 A;  3IPZ A;  5F05 A;  4AF2 A;  3TOU A;  2MMO A;  4MPF A;  4AJ7 A;  1F6M C;  3LQ7 A;  2NVL A;  3HD5 A;  2C0D A;  2JU5 A;  2ES7 A;  4MF5 A;  2AHE A;  2DJ0 A;  4TW5 A;  3EYT A;  2VUP A;  1FG4 A;  3Q6O A;  2VL3 A;  2FWE A;  4G10 A;  2CA8 A;  2XBQ A;  5IPG A;  1GP1 A;  3ZFL A;  4FYC A;  1ZMA A;  3ZTL A;  2OA7 A;  3HVX A;  2LQQ A;  5GAP D;  4GST A;  1TXX A;  4FO5 A;  1UVZ A;  1JZR A;  4AJ6 A;  1G7O A;  2FUG 2;  4ZBB A;  4EC0 A;  2YZH A;  3GHA A;  4XS1 A;  4GSN A;  1NW2 A;  1Z3E A;  1GSY A;  4KUN A;  5IO0 A;  5J9B A;  3I6A A;  2YJH A;  3FW2 A;  3VK9 A;  3L9U A;  4MJA A;  4LL1 B;  5B7C A;  4WF4 A;  1GTU A;  1Q4J A;  1XBS A;  3E9J B;  4TR4 A;  3H93 A;  1Z7P A;  1XWC A;  1X5C A;  4IEL A;  2HE3 A;  4O92 A;  3J7Y b;  3HCZ A;  3GKX A;  4Q5Q A;  3UVT A;  1K0N A;  2HRF A;  1EP7 A;  2I81 A;  1I5G A;  2OAC A;  3QR6 A;  4GCI A;  5JCU A;  1QUW A;  2JSZ A;  5CRG A;  4H86 A;  1Z7R A;  2AYT A;  2GSS A;  4JR6 A;  2CZ3 A;  2H72 A;  2H76 A;  4K7I A;  1PA3 A;  5ENU A;  4LL4 B;  2REM A;  5CNW A;  3UAR A;  5F06 A;  3FZ4 A;  4GQC A;  1GTB A;  2VAF A;  5DAL A;  1ERT A;  2HNL A;  4KAE A;  3IV4 A;  2ON7 A;  4ML1 A;  1TRU A;  4WKW A;  3GTU A;  2OBI A;  1U3A A;  3D21 A;  1SKS B;  5ECK B;  3TGZ A;  2YZU A;  4I5Q A;  5JWQ B;  2VCQ A;  4GXZ A;  1X9W B;  4V1A g;  4RQX A;  4D73 B;  3TKS E;  2VLT A;  3ZZX A;  4RI6 A;  5J4U A;  1T1V A;  5IMC A;  2RM6 A;  4PQI A;  4ECC A;  5ELA A;  1Y6E A;  4ZXG A;  3KJY A;  4Q5R A;  5DCG A;  2OE1 A;  5JCW A;  3AY8 A;  2KHP A;  2VCT A;  3LXT A;  3S9F A;  2FY6 A;  1TP9 A;  5G1L A;  4TVE A;  3D22 A;  1Y25 A;  11GS A;  3F8U A;  1Q98 A;  5D9W A;  1B9X C;  1XWK A;  3VFI A;  1PKZ A;  2H70 A;  2N5F A;  4I2T A;  3RPP A;  3UJ1 A;  1JFU A;  2DJ3 A;  1FW1 A;  1S3C A;  1JZD A;  2EC4 A;  1ERW A;  4NV5 A;  2PMT A;  4XS4 A;  2A2S A;  4TOP A;  2YNX A;  3NZN A;  4IN0 A;  1XW5 A;  2DBC A;  1YDK A;  4WET A;  3IHQ A;  3IDV A;  1USB A;  3G9B A;  3H79 A;  2HZE A;  3FZ5 A;  3SBC A;  4OO4 A;  4XTS A;  3ISO A;  4HQZ A;  22GS A;  2HZF A;  3GA4 A;  3W8S A;  2XBI A;  1UN2 A;  1A8Y A;  4IJ3 A;  4IS0 A;  3EIN A;  5FHI A;  1JZO A;  2C1Y A;  6GSY A;  3EWL A;  3EUR A;  3W6G A;  1TI3 A;  2GST A;  4TR1 A;  2VD0 A;  2GZY A;  1GUH A;  3WYW A;  1SEN A;  1GUM A;  3O3T A;  3QD9 A;  5D9T A;  1R4W A;  2B1L A;  1M9A A;  2I3Y A;  3QAV A;  5DVB A;  2DJ1 A;  4NAX A;  2AV4 A;  5AIV A;  3QAG A;  4Z7X A;  4HDE A;  19GS A;  1EEJ A;  2CX3 A;  3ERW A;  1CQG A;  3CRT A;  1YJ6 A;  4MPG A;  2YCD A;  1THO A;  1ZZY A;  2VCW A;  4YH2 A;  4I2U A;  3A2W A;  3HYP A;  1GUL A;  3J7Y k;  4GF0 A;  1YQ1 A;  4ZB8 A;  3IK7 A;  1SYR A;  1B4Q A;  3BBY A;  1K0O A;  2VIM A;  1Z9H A;  3DXB A;  3E3E A;  4EUY A;  3BJ5 A;  3IR4 A;  2PBJ A;  4HQS A;  3TRP A;  3FR9 A;  4P3Y B;  3VPT A;  2YWO A;  5D96 A;  4HOJ A;  2FWF A;  4J57 E;  1EWX A;  2LRC A;  3GX0 A;  3CSI A;  4K7N A;  1MD4 A;  2X99 A;  4ZBD A;  4PUF C;  2B3S A;  3GFK A;  4K0G A;  1PN9 A;  2MBT A;  5GSS A;  1DUG A;  2OE0 A;  4YQU A;  1T7P B;  1V2A A;  3QAW A;  2GZP A;  3BCK A;  3RBT A;  1MEK A;  1QGV A;  5B6M A;  2R37 A;  4KCE A;  1FVK A;  1M9B A;  2P5R A;  3P90 A;  2FCH A;  3GN3 A;  1HNB A;  2HLS A;  2R3X A;  3ZMK A;  3QCP A;  2GT6 A;  2F8A A;  2IME A;  3WT2 A;  4OD7 A;  3GNJ A;  3LOR A;  2DC5 A;  1V98 A;  2V6O A;  1ERU A;  2CT6 A;  3VPQ A;  2HSH A;  1OE7 A;  2XPE A;  2QC7 A;  1WOU A;  5B6N A;  5C00 A;  2CQ9 A;  4ZL7 A;  5IMA A;  4MZW A;  2DJJ A;  4K8M A;  1N2A A;  1XOA A;  3D6I A;  4TKY A;  3ED3 A;  2M46 A;  3GYK A;  4TXO A;  4TR3 A;  4EE0 A;  3F6F A;  5ECM B;  1SL2 B;  3D4T A;  4MCU A;  5ELG A;  4JBB A;  2LST A;  5JWR B;  1K3Y A;  4BVX A;  1EV9 A;  3GMF A;  2NBS A;  3EMP A;  1GL8 A;  1R5A A;  4KDY A;  4WF5 A;  4CDO A;  3L4N A;  1GSF A;  4DSS B;  3KIJ A;  4IP1 A;  5ID2 B;  2CVK A;  4ZL9 A;  1B48 A;  2EIR A;  3HJP A;  4KH7 A;  3TB2 A;  3HHV A;  1DBY A;  1OC9 B;  1ABA A;  4J56 E;  2H1D A;  1W89 A;  2P5Q A;  5D93 A;  3LJR A;  2PN8 A;  4DSR A;  1B9Y C;  5IOX A;  4GLT A;  8GSS A;  2H73 A;  1O73 A;  1ACV A;  5HR3 A;  3DIE A;  2L5L A;  5C04 A;  2VLU A;  1A2L A;  2VM2 A;  1E6B A;  1QMV A;  2BJX A;  3LSZ A;  2O8V B;  3LFL A;  3D0Z A;  3KH9 A;  5DAK B;  1K0D A;  4WBR D;  3F9U A;  1YZX A;  3RHB A;  2C3T A;  4AGS A;  1FHE A;  2J9H A;  3IAS 2;  2X8G A;  2XHF A;  3DML A;  1PQN A;  1VF3 A;  5EL8 A;  5AIX A;  2DJ2 A;  4DSQ A;  5CAX A;  2MZC A;  2VCZ A;  2H30 A;  3M3M A;  3P2A A;  3ZRE A;  1GTA A;  2NTO A;  2YWI A;  2M72 A;  3H1N A;  1ZL9 A;  2KUC A;  1F2E A;  2PU9 C;  1WMJ A;  2DML A;  7GSS A;  1X9M B;  2L6D A;  2H0H A;  3GUS A;  4X0X A;  3FZA A;  3MDK A;  4POK A;  4E8H A;  2VOC A;  4YAV A;  5G31 A;  3TJG A;  1ML6 A;  2AB6 A;  2P0G A;  2VD1 A;  3IXR A;  1ZGN A;  2K18 A;  2L4Q A;  2C0G A;  2LV3 A;  4NHW A;  5CRH A;  1A0R P;  4RQR A;  1U88 A;  2FGX A;  2R2J A;  4MP4 A;  4EL1 A;  3ZML A;  4RI7 A;  1WWJ A;  5GAN D;  4RUV A;  4ZIJ A;  2JL4 A;  2JZS A;  3HZ4 A;  4XHM A;  4IKH A;  2YAN A;  1AXD A;  2G0F A;  1GNE A;  3MNG A;  1PRX A;  2FHE A;  1GSU A;  4FIW A;  1AW9 A;  3UBL A;  1NHO A;  3APO A;  5D9X A;  4O32 A;  1XVQ A;  1WJK A;  3GL3 A;  1MD3 A;  2CZ2 A;  4HJ2 A;  4TXV A;  4K7O A;  4OFT A;  5A4U A;  4K6X A;  2WCI A;  3US3 A;  4MMM A;  1B4P A;  5F8B A;  3KM6 A;  3TDG A;  3VWX A;  3KGK A;  2G2Q A;  2F51 A;  5ECN B;  4F9Z A;  1RW1 A;  2V1M A;  2XPD A;  2OAD A;  1AIU A;  3APQ A;  5G5E A;  1O6J A;  1OC8 A;  1JLW A;  1GTI A;  2DJK A;  5A5K A;  1XFL A;  5HFI A;  1PGT A;  4HZ2 A;  3UVH A;  3WGX A;  4OO5 A;  2V6K A;  3QMX A;  1F9M A;  2IFQ A;  3C1R A;  4FYB A;  3DEX A;  1G6Y A;  3CRU A;  2WFC A;  2GLR A;  1DE2 A;  4HUA A;  1B8X A;  2HXK A;  1F3B A;  4XIH A;  3CBU A;  3F4T A;  1PSQ A;  1TRW A;  3TKQ A;  2GQK A;  4PQ1 A;  1EV4 A;  3HVS A;  1EEM A;  2JAC A;  5F0G A;  4EDZ A;  4MJB A;  3WGE A;  3CSJ A;  2L5O A;  1U3I A;  5IIZ A;  1PX6 A;  3TKR A;  1KTE A;  4O5R A;  3N5O A;  5EY6 A;  3EU3 A;  3F3R A;  2FNO A;  1ON4 A;  2GDR A;  1PD2 1;  2B5X A;  5HR2 A;  3DVW A;  4L0U A;  3APS A;  1MDJ A;  2JZT A;  4KE3 A;  2GQL A;  3TOT A;  3EE2 A;  2DLX A;  4V1A p;  1NHY A;  4PX1 A;  4DVC A; 
#chains in the Genus database with same CATH topology
 1ERV A;  4NV2 A;  3GH9 A;  2RII A;  3RPN A;  1MDK A;  3O6T A;  4L8E A;  2Z9S A;  3ERF A;  2YP6 A;  1ST9 A;  1M2B A;  4IBP A;  1U87 A;  1XXU A;  1SL1 B;  1QQ2 A;  3UIW A;  3L9S A;  3G7I A;  1TK5 B;  3A3T A;  1PL2 A;  4WXT A;  1SK1 A;  1YF1 A;  1FOV A;  2CX4 A;  4L5L A;  4K9Z A;  4EXJ A;  4NMU A;  2MBS A;  1URM A;  3E0U A;  1EOH A;  3H8Q A;  1GSE A;  2YN1 A;  2HRN A;  3EVI A;  3C7M A;  5ECI B;  3TJF A;  5IM9 A;  2EIQ A;  3SWL A;  3DVX A;  3U5R E;  4AJ8 A;  2GQM A;  4EVM A;  1EOG A;  3GIX A;  1TI1 A;  1H4O A;  1R5P A;  1EGO A;  2YJ7 A;  4PGT A;  1HQO A;  3A5W A;  3TRQ A;  2FWG A;  3M9K A;  4IHU A;  2TRC P;  3KTB A;  1WE0 A;  1XW6 A;  4ZB9 A;  3MWH A;  3ZVJ D;  4PXO A;  2FA8 A;  4QQ7 A;  2JSY A;  4CHS A;  3NIV A;  2RUE A;  4ECI A;  13GS A;  4JR4 A;  3F6D A;  3A2V A;  2C3Q A;  1HYU A;  4EKZ A;  4EIQ A;  3GST A;  4GWR A;  4G9H A;  4PNG A;  2L59 A;  3GL5 A;  5DCH A;  2B1K A;  4GSS A;  4GRF A;  16GS A;  3GX8 A;  1FB6 A;  3P7X A;  3G7J A;  2WS2 A;  1Z5Y E;  2F9S A;  5J41 A;  4CW9 A;  4KA0 A;  4KDX A;  1GLQ A;  3MIX A;  4Q5N A;  5E4W A;  2FLS A;  2V41 A;  4BPY A;  1J9B A;  4HU9 A;  1T8E B;  4JZQ A;  1K0C A;  1SD9 A;  4KB3 A;  3TJB A;  5F07 A;  2CVD A;  1V9W A;  1ZYN A;  6GSU A;  2H66 A;  2MMA A;  4ECB A;  5ECO B;  4NXI A;  2LS5 A;  2YV9 A;  2H0G A;  3MAK A;  3IC4 A;  5A4W A;  4BWS A;  4MF7 A;  1H75 A;  4POB A;  3P8W A;  5EPF A;  3UBK A;  2GGT A;  5IO2 A;  1BJX A;  3C1S A;  3QFB C;  1MDI A;  1X5E A;  2H1B A;  3GH6 A;  2C0E A;  1SK2 A;  2TIR A;  4EF0 A;  2FA4 A;  4MK3 A;  4DEJ A;  2H74 A;  3KP9 A;  4IGJ A;  1TTZ A;  5ECS A;  2C0F A;  1V40 A;  3TJK A;  3F4S A;  2LTK A;  4GQF A;  6GST A;  3VUR A;  2E2G A;  2VLV A;  3CMI A;  2WZ9 A;  4QL9 A;  2VCV A;  1AAZ A;  2PUK C;  2RUF A;  1OC3 A;  3V1W A;  1JLV A;  1SU9 A;  1T3B A;  5DQS A;  2UZ8 A;  2YOI A;  17GS A;  1A24 A;  3ZIJ A;  4HU7 A;  4ID0 A;  2GZZ A;  1R7H A;  4JU5 A;  2KP2 A;  1KNG A;  2F3M A;  2IPA A;  4MZC A;  1XIY A;  5B8B A;  3CQF A;  4D73 A;  1YEX A;  18GS A;  3VI5 A;  5BRT A;  3FR3 A;  3KCM A;  2FWH A;  5KN0 A;  1X9S B;  4ZIL A;  3CTG A;  4O5U A;  5CYY A;  4MJC A;  5KOX A;  2H1A A;  2P31 A;  3UAP A;  1GSQ A;  3TCO A;  3F4R A;  3VLN A;  3I43 A;  3LWA A;  6GSW A;  1M7T A;  5IPH A;  4ECJ A;  3FK8 A;  4PUA A;  2B7K A;  2I9H A;  1XCC A;  1X0R A;  3QDN A;  3KMN A;  4LMW A;  2EIO A;  1TU8 A;  2D2Z A;  3NOF A;  3WGD A;  5GZZ B;  3DYR A;  5CP1 A;  3EC3 A;  3LYP A;  4HZ4 A;  4LMV A;  5HR1 A;  3RAZ A;  2NPB A;  1XW9 A;  3FHK A;  2X64 A;  4IQ1 A;  3M8N A;  6GSS A;  2I1U A;  2LJK A;  1K0M A;  5ECL B;  1XWG A;  6GSX A;  4JED A;  4N11 A;  5KN1 A;  3QPM A;  1YKC A;  5DAL B;  4TN8 A;  5J3R A;  1ILO A;  2GSQ A;  3FYG A;  3GTU B;  4MF6 A;  2C3N A;  3GKK A;  2HI7 A;  3HA9 A;  4YKG A;  4F0C A;  4K2D A;  1LBK A;  2B5E A;  3CTF A;  10GS A;  4HJM A;  2O89 A;  1F3A A;  2I4A A;  1S3A A;  1T4Y A;  2O87 A;  4QL7 A;  3TKP A;  3UEM A;  1YKA A;  1SJI A;  1BYE A;  4KW6 A;  1PFO A;  2QA1 A;  2GT5 A;  3FEU A;  4YQM A;  2PVQ A;  4HEA 2;  5H5R A;  5BMU A;  5JWO B;  3C8E A;  9GSS A;  1I9D A;  3Q18 A;  2R0P A;  1O81 A;  2MMZ A;  2VO4 A;  1PMT A;  5HQP A;  1M3I A;  2VL9 A;  4V2N A;  3VWU A;  5J9C A;  1LJR A;  4NPB A;  4XS4 B;  4WEY A;  4OFM A;  3C73 A;  3UL3 A;  3KZQ A;  4F03 A;  1GLP A;  2IWT A;  1PL1 A;  5ECP B;  3HJO A;  3C71 A;  3WT1 A;  4IQA A;  3DGQ A;  1XZO A;  2LRT A;  2LKU A;  1K3O A;  5ECQ B;  1A2M A;  5KOW A;  4MLY A;  1GWC A;  4MDC A;  2R4V A;  3F0I A;  4JE1 A;  1M2A A;  1X5D A;  2VL2 C;  4YAP A;  2TRX A;  4KX4 A;  1SJZ A;  1VF2 A;  1CQH A;  1SYX A;  4K0N A;  4PUR A;  1TRV A;  4TRX A;  5E59 A;  2V32 A;  1GSD A;  3H4K A;  4TR1 B;  2WGR A;  4V2L A;  1V58 A;  3L78 A;  2ZNM A;  2LEG A;  4N10 A;  5FT3 A;  1SD8 A;  2IMI A;  1FAA A;  1O85 A;  2DKH A;  2R0G A;  1ZCP A;  4OMV A;  3M9J A;  3EMX A;  2E2M A;  1K0A A;  1WPI A;  3HZ8 A;  5LCZ A;  1KEB A;  1W4V A;  2KOK A;  4NWY A;  4ISD A;  3ZRD A;  4KSO A;  4X43 A;  2IJY A;  3TJJ A;  1XG8 A;  3QOU A;  2AUV A;  2CAQ A;  1SKR B;  1QFN A;  4F82 A;  1GH2 A;  3VWV A;  4KGI A;  5CO3 A;  4ZB6 A;  1EP8 A;  5HFK A;  3FZ9 A;  2RM5 A;  4XS6 A;  3M1G A;  1A0F A;  5DJL A;  3L0H A;  3KXO A;  2B5Y A;  1ZYQ B;  2LNS A;  4FH8 A;  1MTC A;  2HSY A;  1PN0 A;  2E7P A;  1GUK A;  1UA5 A;  4DSS A;  5HR0 A;  4ZBA A;  5ID2 A;  3A2X A;  2VCX A;  2DSA A;  1YF0 A;  5FWG A;  5EVO A;  3F63 A;  3LEF A;  4OWY A;  3IC8 A;  2IN3 A;  3M0F A;  1OC9 A;  4G0I A;  5G5F A;  1E2Y A;  4PQH A;  2IIY A;  3ZL5 A;  1R26 A;  2GVP A;  1FB0 A;  1U6T A;  3ZVJ A;  3ZFB A;  3QFA C;  6GSV A;  4KDU A;  3LXZ A;  5G2Z A;  2LUS A;  2X8C A;  5LNK e;  3W8J A;  3PH9 A;  1M0U A;  4HSC X;  5KN3 A;  4MZB A;  5DAK A;  4BVY A;  4X1U A;  2CVB A;  1OYJ A;  2ZUP A;  1YY7 A;  2YPM A;  5L71 A;  2HRK A;  1S3R A;  3GKM A;  5ECR B;  4Z2T A;  4I97 A;  5IOW A;  5G1K A;  4TXO B;  4MA9 A;  4ILF A;  2MYG A;  2DIZ A;  2PWJ A;  4EDY A;  1M2D A;  4CY6 A;  1UC7 A;  1SKW B;  3IE3 A;  1TDI A;  1HD2 A;  2C80 A;  5JCG A;  5H5S A;  1C72 A;  4WR4 A;  4BA7 A;  2QSI A;  5AIS A;  5CRE A;  1BAY A;  1DSB A;  4BL7 A;  5DQY A;  3BD2 A;  5IQY A;  3GUR A;  2PVO C;  1VF4 A;  2R6K A;  1AQX A;  5IMZ A;  2AJQ B;  4V2M A;  3HJM A;  4I8B A;  3TRX A;  3TUE A;  3KTL A;  2BMX A;  2JAD A;  1OKD A;  1VGL A;  2K6V A;  2K8V A;  2BTO T;  4E8E A;  2YWN A;  5DDL A;  1NSW A;  3ZYW A;  4KSM A;  2KLX A;  4ML6 A;  2LJR A;  4Q5F A;  1A8L A;  4FYU A;  2LNT A;  1XVW A;  2L4C A;  4L5O A;  2PER A;  3IRA A;  3HY2 A;  2MMN A;  2AAW A;  1OAZ A;  1TK8 B;  1HNC A;  1G6W A;  2H6Y A;  3FRC A;  5HFG A;  5AGY A;  1QK8 A;  3HKR A;  2QKE A;  4HS1 A;  1XWA A;  1OVN A;  4XCS A;  1O8W A;  3D5J A;  2H6X A;  1VRS D;  2LJA A;  5D9V A;  1FVJ A;  3GKN A;  1A2J A;  2WJU A;  4ZL8 A;  2JZR A;  3KEB A;  4K1F A;  3MYD A;  2O85 A;  3TKS A;  4ULX A;  3WD6 A;  2KP1 A;  2GS3 A;  2R5G A;  1AC1 A;  3Q74 A;  5ECH B;  2K8S A;  2L6C A;  2OJL A;  1T4Z A;  1OKT A;  1F37 A;  2B6M A;  1RQM A;  2O7K A;  3IOS A;  5DBQ A;  3UOM A;  1ZOF A;  2H8L A;  4JRR A;  2X4A A;  4F2I A;  1G7E A;  3KP8 A;  4G0K A;  4N0V A;  2ALB A;  2HRA A;  4L0W A;  4PNF A;  4POM A;  2ON5 A;  4GTU A;  5D73 A;  2H1G A;  4MH2 A;  2PGT A;  1J0F A;  3ME7 A;  4OFN A;  2A2P A;  3LG6 A;  3RHC A;  14GS A;  1NM3 A;  5KN2 A;  4YQV A;  3GV1 A;  2XC2 A;  5ABR A;  1RK4 A;  2B7J A;  4G19 A;  3RDW A;  3LGC A;  2C4J A;  2C8U A;  3CYN A;  2IMF A;  1THX A;  3CXG A;  5IMV A;  4LA1 A;  1SJ6 A;  2HFD A;  1Z6N A;  3PPU A;  2J23 A;  4CY8 A;  2GSR A;  2H01 A;  2VM1 A;  3GSS A;  3VWW A;  2H6Z A;  1TU7 A;  4KND A;  3Q19 A;  4NHZ A;  3BCI A;  1EGR A;  3F3Q A;  2N5B A;  3IA1 A;  4EO3 A;  1PX7 A;  3KD0 A;  3KMO A;  1YEP A;  5H5Q A;  2OBK A;  1O7U A;  1IYH A;  2IFQ B;  3N9J A;  4J2F A;  4BIK A;  2ZCT A;  1BX9 A;  3PIN A;  2WDU A;  3K8N A;  1WRY A;  1A23 A;  2IL3 A;  20GS A;  2A2R A;  3I9V 2;  1ZYE A;  4N30 A;  3ZIV A;  2M80 A;  4F0B A;  3KH7 A;  4XRD A;  2K9F A;  2L57 A;  4IVF A;  1J08 A;  2VL2 A;  2DMM A;  5G30 A;  3IBH A;  2WRT A;  2HSM A;  4POL A;  1LU4 A;  1BED A;  1OE8 A;  1TJD A;  3OR5 A;  1FO5 A;  2E0Q A;  4ACS A;  2CV4 A;  3TKS C;  4WBJ A;  4IJI A;  2IMD A;  3R2Q A;  4IW9 A;  1BG5 A;  3DKS A;  5B8A A;  1XOB A;  5D8I A;  2FD3 A;  3O76 A;  3D4M A;  3HVV A;  2YV7 A;  1TOF A;  2H0I A;  5IMD A;  5LD0 A;  1VF1 A;  2LRN A;  1BQ7 A;  5GST A;  1SK0 A;  2OE3 A;  3ZLP A;  4ICY A;  2X8H A;  2A4V A;  4OCF A;  1JHB A;  1GSS A;  4Z2R A;  3IAM 2;  4G2E A;  2HYX A;  1EZK A;  3CSH A;  1O8X A;  2GTU A;  4IP6 A;  1K3L A;  1V57 A;  2LQO A;  2RLI A;  3DD3 A;  3PR8 A;  3UMA A;  3MSZ A;  3ERG A;  4O7H A;  1SL0 B;  3GRX A;  1S3D A;  1AQW A;  3PGT A;  3DRN A;  5A4V A;  3DWV A;  5COH A;  1XWB A;  2CAI A;  1K0B A;  4LLR A;  1G0T A;  2DIY A;  1HNA A;  1TK0 B;  1T00 A;  2H75 A;  3LYK A;  4N0Z A;  4HI7 A;  3U6V A;  5AN1 A;  3VI7 A;  5DJM A;  3IK9 A;  2OKA A;  5INY A;  2H71 A;  2WB9 A;  1WIK A;  1TKD B;  3JCM L;  1GRX A;  2IMK A;  1N8J A;  3I69 A;  4BWQ A;  3FKF A;  1KBN A;  1IYI A;  4MJE A;  2V2G A;  4TR0 A;  5IMF A;  2HZE B;  3HDC A;  3HXS A;  3G7Y A;  3FR6 A;  4XRA A;  1Z6M A;  4I6X A;  1GNW A;  1XPV A;  2YWM A;  4OCE A;  1QXH A;  2WUL A;  1M99 A;  2NDO A;  1DE1 A;  3ME8 A;  1AUC A;  2N5A A;  2F8F A;  2QGV A;  3EU4 A;  3ZIT A;  5KEJ A;  12GS A;  4MH3 A;  3L9V A;  5J5N A;  2H19 A;  3FY7 A;  4PTS A;  4KCA A;  1TRS A;  2PPT A;  1WP0 A;  4EIP A;  4WR5 A;  3BOA A;  1AQV A;  4MAB A;  5CRD A;  1JZW A;  5CRW A;  1PKW A;  1TW9 A;  2HT9 A;  3IPZ A;  5F05 A;  4AF2 A;  3TOU A;  2MMO A;  4MPF A;  4AJ7 A;  1F6M C;  3LQ7 A;  2NVL A;  3HD5 A;  2C0D A;  2JU5 A;  2ES7 A;  4MF5 A;  2AHE A;  2DJ0 A;  4TW5 A;  3EYT A;  2VUP A;  1FG4 A;  4FQU A;  3Q6O A;  2VL3 A;  2FWE A;  4G10 A;  2CA8 A;  2XBQ A;  5IPG A;  1GP1 A;  3ZFL A;  4FYC A;  1ZMA A;  3ZTL A;  2OA7 A;  3HVX A;  2LQQ A;  5GAP D;  4GST A;  1TXX A;  4FO5 A;  1UVZ A;  1JZR A;  4AJ6 A;  1G7O A;  1M3J A;  2FUG 2;  4ZBB A;  4EC0 A;  2YZH A;  3GHA A;  4XS1 A;  4GSN A;  1NW2 A;  1Z3E A;  1GSY A;  4KUN A;  5IO0 A;  5J9B A;  3I6A A;  2YJH A;  3FW2 A;  2QA2 A;  3VK9 A;  3L9U A;  4MJA A;  4LL1 B;  5B7C A;  4WF4 A;  1GTU A;  1Q4J A;  1XBS A;  3E9J B;  4TR4 A;  3H93 A;  1Z7P A;  1XWC A;  1X5C A;  4IEL A;  2HE3 A;  4O92 A;  3J7Y b;  3HCZ A;  3GKX A;  4Q5Q A;  3UVT A;  1K0N A;  2HRF A;  1EP7 A;  2I81 A;  1I5G A;  2OAC A;  3QR6 A;  4GCI A;  5JCU A;  1QUW A;  2JSZ A;  5CRG A;  4H86 A;  1Z7R A;  2AYT A;  2GSS A;  4JR6 A;  2CZ3 A;  2H72 A;  2H76 A;  4K7I A;  1PA3 A;  5ENU A;  4LL4 B;  2REM A;  5CNW A;  3UAR A;  5F06 A;  3FZ4 A;  4GQC A;  1GTB A;  2VAF A;  5DAL A;  1ERT A;  2HNL A;  4KAE A;  3IV4 A;  2ON7 A;  4ML1 A;  1TRU A;  4WKW A;  3GTU A;  2OBI A;  1U3A A;  3D21 A;  1SKS B;  5ECK B;  3TGZ A;  2YZU A;  4I5Q A;  5JWQ B;  2VCQ A;  4GXZ A;  1X9W B;  4V1A g;  4RQX A;  4D73 B;  3TKS E;  2VLT A;  3ZZX A;  4RI6 A;  5J4U A;  1T1V A;  5IMC A;  2RM6 A;  4PQI A;  4ECC A;  5ELA A;  1Y6E A;  4ZXG A;  3KJY A;  4Q5R A;  5DCG A;  2OE1 A;  5JCW A;  3AY8 A;  2KHP A;  4BVX B;  2VCT A;  3LXT A;  3S9F A;  2FY6 A;  1TP9 A;  5G1L A;  4TVE A;  3D22 A;  1Y25 A;  11GS A;  3F8U A;  1Q98 A;  5D9W A;  1B9X C;  1XWK A;  3VFI A;  1PKZ A;  2H70 A;  2N5F A;  4I2T A;  3RPP A;  3UJ1 A;  1JFU A;  2DJ3 A;  1FW1 A;  1S3C A;  1JZD A;  4K5S A;  2EC4 A;  1ERW A;  4NV5 A;  2PMT A;  4XS4 A;  2A2S A;  4TOP A;  2YNX A;  3NZN A;  4IN0 A;  1XW5 A;  2DBC A;  1YDK A;  4WET A;  3IHQ A;  3IDV A;  1USB A;  3G9B A;  4G0L A;  3H79 A;  2HZE A;  3FZ5 A;  3SBC A;  3LW9 A;  4OO4 A;  4XTS A;  3ISO A;  4HQZ A;  22GS A;  2HZF A;  3GA4 A;  3W8S A;  2XBI A;  1UN2 A;  1A8Y A;  4IJ3 A;  4IS0 A;  3EIN A;  5FHI A;  3EPT A;  1JZO A;  2C1Y A;  6GSY A;  3EWL A;  3EUR A;  3W6G A;  1TI3 A;  2GST A;  4TR1 A;  2VD0 A;  2GZY A;  1GUH A;  3WYW A;  1SEN A;  1GUM A;  3O3T A;  3QD9 A;  5D9T A;  1R4W A;  2B1L A;  1M9A A;  2I3Y A;  3QAV A;  5DVB A;  2DJ1 A;  4USS A;  4NAX A;  2AV4 A;  5AIV A;  3QAG A;  4Z7X A;  4HDE A;  4A5P A;  19GS A;  1EEJ A;  2CX3 A;  3ERW A;  1CQG A;  3CRT A;  1YJ6 A;  4MPG A;  2YCD A;  1THO A;  1ZZY A;  2VCW A;  4YH2 A;  4I2U A;  3A2W A;  4K2X A;  3HYP A;  1GUL A;  3J7Y k;  4GF0 A;  1YQ1 A;  4ZB8 A;  3IK7 A;  1SYR A;  1B4Q A;  3BBY A;  1K0O A;  2VIM A;  1Z9H A;  3DXB A;  3E3E A;  4EUY A;  3BJ5 A;  3IR4 A;  2PBJ A;  4HQS A;  3TRP A;  3FR9 A;  4P3Y B;  3VPT A;  2YWO A;  5D96 A;  4HOJ A;  2FWF A;  4J57 E;  1EWX A;  2LRC A;  3GX0 A;  3CSI A;  4K7N A;  1MD4 A;  3IHG A;  2X99 A;  4ZBD A;  4PUF C;  2B3S A;  3GFK A;  4K0G A;  4K5R A;  1PN9 A;  2MBT A;  5GSS A;  1DUG A;  2OE0 A;  4YQU A;  1T7P B;  1V2A A;  3QAW A;  2GZP A;  3BCK A;  3RBT A;  1MEK A;  1QGV A;  5B6M A;  2R37 A;  4KCE A;  1FVK A;  1M9B A;  2P5R A;  3P90 A;  2FCH A;  3GN3 A;  4X4J A;  1HNB A;  2HLS A;  2R3X A;  3ZMK A;  2X49 A;  3QCP A;  2GT6 A;  2F8A A;  2IME A;  3WT2 A;  4OD7 A;  3GNJ A;  3LOR A;  2DC5 A;  1V98 A;  2V6O A;  1ERU A;  2CT6 A;  3VPQ A;  2HSH A;  1OE7 A;  2XPE A;  2QC7 A;  1WOU A;  5B6N A;  5C00 A;  2CQ9 A;  4ZL7 A;  3HVN A;  5IMA A;  4MZW A;  2DJJ A;  4K8M A;  1N2A A;  1XOA A;  3D6I A;  4TKY A;  3ED3 A;  2M46 A;  3GYK A;  4TXO A;  4TR3 A;  4EE0 A;  3F6F A;  5ECM B;  1SL2 B;  3D4T A;  4MCU A;  5ELG A;  4JBB A;  2LST A;  5JWR B;  1K3Y A;  4BVX A;  1EV9 A;  3GMF A;  2NBS A;  3EMP A;  1GL8 A;  1R5A A;  4KDY A;  4WF5 A;  4CDO A;  3L4N A;  1GSF A;  4DSS B;  3KIJ A;  4IP1 A;  5ID2 B;  2CVK A;  4ZL9 A;  1B48 A;  2EIR A;  3HJP A;  4KH7 A;  3TB2 A;  3HHV A;  1DBY A;  1OC9 B;  1ABA A;  4J56 E;  2H1D A;  1W89 A;  2P5Q A;  2R0C A;  5D93 A;  3LJR A;  2PN8 A;  4DSR A;  1B9Y C;  5IOX A;  4GLT A;  8GSS A;  2H73 A;  1O73 A;  1ACV A;  5HR3 A;  3DIE A;  2L5L A;  1FOH A;  5C04 A;  2VLU A;  1A2L A;  2VM2 A;  1E6B A;  1QMV A;  2BJX A;  3LSZ A;  2O8V B;  3LFL A;  3D0Z A;  3KH9 A;  5DAK B;  4BVY B;  1K0D A;  3FMW A;  4WBR D;  3F9U A;  1YZX A;  3RHB A;  2C3T A;  4AGS A;  1FHE A;  2J9H A;  3IAS 2;  2X8G A;  2XHF A;  3DML A;  4Z2U A;  1PQN A;  1VF3 A;  5EL8 A;  5AIX A;  2DJ2 A;  4DSQ A;  5CAX A;  2MZC A;  2VCZ A;  2H30 A;  3M3M A;  3P2A A;  3ZRE A;  1GTA A;  2NTO A;  2YWI A;  2M72 A;  3H1N A;  1ZL9 A;  2KUC A;  1F2E A;  2PU9 C;  1WMJ A;  2DML A;  7GSS A;  4O5Q A;  1X9M B;  2L6D A;  2H0H A;  3GUS A;  4X0X A;  3FZA A;  3MDK A;  4POK A;  4E8H A;  2VOC A;  4YAV A;  5G31 A;  3TJG A;  1ML6 A;  4BL7 B;  2AB6 A;  2P0G A;  2VD1 A;  3IXR A;  1ZGN A;  2K18 A;  2L4Q A;  2C0G A;  2LV3 A;  4NHW A;  5CRH A;  1A0R P;  4RQR A;  1U88 A;  2FGX A;  2R2J A;  4MP4 A;  4EL1 A;  3ZML A;  4RI7 A;  1WWJ A;  2DKI A;  5GAN D;  4RUV A;  4ZIJ A;  2JL4 A;  2JZS A;  3HZ4 A;  4XHM A;  4IKH A;  4YKF A;  2YAN A;  1AXD A;  2G0F A;  1GNE A;  3R3E A;  3MNG A;  1PRX A;  2FHE A;  1GSU A;  4FIW A;  1AW9 A;  3UBL A;  1NHO A;  3APO A;  5D9X A;  4O32 A;  1XVQ A;  1WJK A;  3GL3 A;  1MD3 A;  2CZ2 A;  4HJ2 A;  4TXV A;  4K7O A;  4OFT A;  5A4U A;  4K6X A;  4MNN A;  2WCI A;  3US3 A;  4MMM A;  1B4P A;  5F8B A;  3KM6 A;  3TDG A;  3VWX A;  3KGK A;  2G2Q A;  2F51 A;  5ECN B;  4F9Z A;  1RW1 A;  2V1M A;  2XPD A;  2OAD A;  1AIU A;  3APQ A;  5G5E A;  1O6J A;  1OC8 A;  1JLW A;  1GTI A;  2DJK A;  5A5K A;  1XFL A;  5HFI A;  1PGT A;  4HZ2 A;  3UVH A;  3WGX A;  4OO5 A;  2V6K A;  3QMX A;  1F9M A;  2IFQ A;  3C1R A;  4FYB A;  3DEX A;  1G6Y A;  3CRU A;  2WFC A;  2GLR A;  3A5I A;  1DE2 A;  4HUA A;  1B8X A;  2HXK A;  1F3B A;  4XIH A;  3CBU A;  2A4H A;  3F4T A;  1ZYP A;  1PSQ A;  1TRW A;  3TKQ A;  2GQK A;  4PQ1 A;  1EV4 A;  3HVS A;  1EEM A;  2JAC A;  5F0G A;  4EDZ A;  4MJB A;  3WGE A;  3CSJ A;  2L5O A;  1U3I A;  5IIZ A;  1PX6 A;  3TKR A;  1KTE A;  4O5R A;  3N5O A;  5EY6 A;  3EU3 A;  3F3R A;  2FNO A;  1ON4 A;  2GDR A;  1PD2 1;  2B5X A;  5HR2 A;  3DVW A;  4L0U A;  3APS A;  1MDJ A;  2JZT A;  4KE3 A;  2GQL A;  3TOT A;  4KF9 A;  3EE2 A;  2DLX A;  4V1A p;  1NHY A;  4PX1 A;  4DVC A; 
#chains in the Genus database with same CATH homology
 1ERV A;  4NV2 A;  3GH9 A;  2RII A;  3RPN A;  1MDK A;  3O6T A;  4L8E A;  2Z9S A;  3ERF A;  2YP6 A;  1ST9 A;  1M2B A;  4IBP A;  1U87 A;  1XXU A;  1SL1 B;  1QQ2 A;  3UIW A;  3L9S A;  3G7I A;  1TK5 B;  3A3T A;  1PL2 A;  4WXT A;  1SK1 A;  1YF1 A;  1FOV A;  2CX4 A;  4L5L A;  4K9Z A;  4EXJ A;  4NMU A;  2MBS A;  1URM A;  3E0U A;  1EOH A;  3H8Q A;  1GSE A;  2YN1 A;  2HRN A;  3EVI A;  3C7M A;  5ECI B;  3TJF A;  5IM9 A;  2EIQ A;  3SWL A;  3DVX A;  3U5R E;  4AJ8 A;  2GQM A;  4EVM A;  1EOG A;  3GIX A;  1TI1 A;  1H4O A;  1R5P A;  1EGO A;  2YJ7 A;  4PGT A;  1HQO A;  3A5W A;  3TRQ A;  2FWG A;  3M9K A;  4IHU A;  2TRC P;  3KTB A;  1WE0 A;  1XW6 A;  4ZB9 A;  3MWH A;  3ZVJ D;  4PXO A;  2FA8 A;  4QQ7 A;  2JSY A;  4CHS A;  3NIV A;  2RUE A;  4ECI A;  13GS A;  4JR4 A;  3F6D A;  3A2V A;  2C3Q A;  1HYU A;  4EKZ A;  4EIQ A;  3GST A;  4GWR A;  4G9H A;  4PNG A;  2L59 A;  3GL5 A;  5DCH A;  2B1K A;  4GSS A;  4GRF A;  16GS A;  3GX8 A;  1FB6 A;  3P7X A;  3G7J A;  2WS2 A;  1Z5Y E;  2F9S A;  5J41 A;  4CW9 A;  4KA0 A;  4KDX A;  1GLQ A;  3MIX A;  4Q5N A;  5E4W A;  2FLS A;  2V41 A;  4BPY A;  1J9B A;  4HU9 A;  1T8E B;  4JZQ A;  1K0C A;  1SD9 A;  4KB3 A;  3TJB A;  5F07 A;  2CVD A;  1V9W A;  1ZYN A;  6GSU A;  2H66 A;  2MMA A;  4ECB A;  5ECO B;  4NXI A;  2LS5 A;  2YV9 A;  2H0G A;  3MAK A;  3IC4 A;  5A4W A;  4BWS A;  4MF7 A;  1H75 A;  4POB A;  3P8W A;  5EPF A;  3UBK A;  2GGT A;  5IO2 A;  1BJX A;  3C1S A;  3QFB C;  1MDI A;  1X5E A;  2H1B A;  3GH6 A;  2C0E A;  1SK2 A;  2TIR A;  4EF0 A;  2FA4 A;  4MK3 A;  4DEJ A;  2H74 A;  3KP9 A;  4IGJ A;  1TTZ A;  5ECS A;  2C0F A;  1V40 A;  3TJK A;  3F4S A;  2LTK A;  4GQF A;  6GST A;  3VUR A;  2E2G A;  2VLV A;  3CMI A;  2WZ9 A;  4QL9 A;  2VCV A;  1AAZ A;  2PUK C;  2RUF A;  1OC3 A;  3V1W A;  1JLV A;  1SU9 A;  1T3B A;  5DQS A;  2UZ8 A;  2YOI A;  17GS A;  1A24 A;  3ZIJ A;  4HU7 A;  4ID0 A;  2GZZ A;  1R7H A;  4JU5 A;  2KP2 A;  1KNG A;  2F3M A;  2IPA A;  4MZC A;  1XIY A;  5B8B A;  4D73 A;  1YEX A;  18GS A;  3VI5 A;  5BRT A;  3FR3 A;  3KCM A;  2FWH A;  5KN0 A;  1X9S B;  4ZIL A;  3CTG A;  4O5U A;  5CYY A;  4MJC A;  5KOX A;  2H1A A;  2P31 A;  3UAP A;  1GSQ A;  3TCO A;  3F4R A;  3VLN A;  3I43 A;  3LWA A;  6GSW A;  1M7T A;  5IPH A;  4ECJ A;  3FK8 A;  4PUA A;  2B7K A;  2I9H A;  1XCC A;  1X0R A;  3QDN A;  3KMN A;  4LMW A;  2EIO A;  1TU8 A;  2D2Z A;  3NOF A;  3WGD A;  5GZZ B;  3DYR A;  5CP1 A;  3EC3 A;  3LYP A;  4HZ4 A;  4LMV A;  5HR1 A;  3RAZ A;  2NPB A;  1XW9 A;  3FHK A;  2X64 A;  4IQ1 A;  3M8N A;  6GSS A;  2I1U A;  2LJK A;  1K0M A;  5ECL B;  1XWG A;  6GSX A;  4JED A;  4N11 A;  5KN1 A;  3QPM A;  1YKC A;  5DAL B;  4TN8 A;  5J3R A;  1ILO A;  2GSQ A;  3FYG A;  3GTU B;  4MF6 A;  2C3N A;  3GKK A;  2HI7 A;  3HA9 A;  4YKG A;  4F0C A;  4K2D A;  1LBK A;  2B5E A;  3CTF A;  10GS A;  4HJM A;  2O89 A;  1F3A A;  2I4A A;  1S3A A;  1T4Y A;  2O87 A;  4QL7 A;  3TKP A;  3UEM A;  1YKA A;  1SJI A;  1BYE A;  4KW6 A;  2QA1 A;  2GT5 A;  3FEU A;  4YQM A;  2PVQ A;  4HEA 2;  5H5R A;  5BMU A;  5JWO B;  3C8E A;  9GSS A;  1I9D A;  3Q18 A;  2R0P A;  1O81 A;  2MMZ A;  2VO4 A;  1PMT A;  5HQP A;  4V2N A;  2VL9 A;  3VWU A;  5J9C A;  1LJR A;  4NPB A;  4XS4 B;  4WEY A;  4OFM A;  3C73 A;  3UL3 A;  3KZQ A;  4F03 A;  1GLP A;  2IWT A;  1PL1 A;  5ECP B;  3HJO A;  3C71 A;  3WT1 A;  4IQA A;  3DGQ A;  1XZO A;  2LRT A;  2LKU A;  1K3O A;  5ECQ B;  1A2M A;  5KOW A;  4MLY A;  1GWC A;  4MDC A;  2R4V A;  3F0I A;  4JE1 A;  1M2A A;  1X5D A;  2VL2 C;  4YAP A;  2TRX A;  4KX4 A;  1SJZ A;  1VF2 A;  1CQH A;  1SYX A;  4K0N A;  4PUR A;  1TRV A;  4TRX A;  5E59 A;  2V32 A;  1GSD A;  3H4K A;  4TR1 B;  2WGR A;  4V2L A;  1V58 A;  3L78 A;  2ZNM A;  2LEG A;  4N10 A;  5FT3 A;  1SD8 A;  2IMI A;  1FAA A;  1O85 A;  2DKH A;  2R0G A;  1ZCP A;  4OMV A;  3M9J A;  3EMX A;  2E2M A;  1K0A A;  1WPI A;  3HZ8 A;  5LCZ A;  1KEB A;  1W4V A;  2KOK A;  4NWY A;  4ISD A;  3ZRD A;  4KSO A;  4X43 A;  2IJY A;  3TJJ A;  3QOU A;  2AUV A;  2CAQ A;  1SKR B;  1QFN A;  4F82 A;  1GH2 A;  3VWV A;  4KGI A;  5CO3 A;  4ZB6 A;  1EP8 A;  5HFK A;  3FZ9 A;  2RM5 A;  4XS6 A;  3M1G A;  1A0F A;  5DJL A;  3L0H A;  3KXO A;  2B5Y A;  1ZYQ B;  2LNS A;  4FH8 A;  1MTC A;  2HSY A;  1PN0 A;  2E7P A;  1GUK A;  1UA5 A;  4DSS A;  5HR0 A;  4ZBA A;  5ID2 A;  3A2X A;  2VCX A;  2DSA A;  1YF0 A;  5FWG A;  5EVO A;  3F63 A;  3LEF A;  4OWY A;  3IC8 A;  2IN3 A;  3M0F A;  1OC9 A;  4G0I A;  5G5F A;  1E2Y A;  4PQH A;  2IIY A;  3ZL5 A;  1R26 A;  2GVP A;  1FB0 A;  1U6T A;  3ZVJ A;  3ZFB A;  3QFA C;  6GSV A;  4KDU A;  3LXZ A;  5G2Z A;  2LUS A;  2X8C A;  5LNK e;  3W8J A;  3PH9 A;  1M0U A;  5KN3 A;  4MZB A;  5DAK A;  4BVY A;  4X1U A;  2CVB A;  1OYJ A;  2ZUP A;  1YY7 A;  2YPM A;  5L71 A;  2HRK A;  3GKM A;  5ECR B;  4Z2T A;  4I97 A;  5IOW A;  5G1K A;  4TXO B;  4MA9 A;  4ILF A;  2MYG A;  2DIZ A;  2PWJ A;  4EDY A;  1M2D A;  4CY6 A;  1UC7 A;  1SKW B;  3IE3 A;  1TDI A;  1HD2 A;  2C80 A;  5JCG A;  5H5S A;  1C72 A;  4WR4 A;  4BA7 A;  2QSI A;  5AIS A;  5CRE A;  1BAY A;  1DSB A;  4BL7 A;  5DQY A;  3BD2 A;  5IQY A;  3GUR A;  2PVO C;  1VF4 A;  2R6K A;  1AQX A;  5IMZ A;  2AJQ B;  4V2M A;  3HJM A;  4I8B A;  3TRX A;  3TUE A;  3KTL A;  2BMX A;  2JAD A;  1OKD A;  1VGL A;  2K6V A;  2K8V A;  2BTO T;  4E8E A;  2YWN A;  5DDL A;  1NSW A;  3ZYW A;  4KSM A;  2KLX A;  4ML6 A;  2LJR A;  4Q5F A;  1A8L A;  4FYU A;  2LNT A;  1XVW A;  2L4C A;  4L5O A;  2PER A;  3IRA A;  3HY2 A;  2MMN A;  2AAW A;  1OAZ A;  1TK8 B;  1HNC A;  1G6W A;  2H6Y A;  3FRC A;  5HFG A;  5AGY A;  1QK8 A;  3HKR A;  2QKE A;  4HS1 A;  1XWA A;  1OVN A;  4XCS A;  1O8W A;  3D5J A;  2H6X A;  1VRS D;  2LJA A;  5D9V A;  1FVJ A;  3GKN A;  1A2J A;  2WJU A;  4ZL8 A;  2JZR A;  3KEB A;  4K1F A;  3MYD A;  2O85 A;  3TKS A;  4ULX A;  3WD6 A;  2KP1 A;  2GS3 A;  2R5G A;  1AC1 A;  3Q74 A;  5ECH B;  2K8S A;  2L6C A;  2OJL A;  1T4Z A;  1OKT A;  1F37 A;  2B6M A;  1RQM A;  2O7K A;  3IOS A;  5DBQ A;  3UOM A;  1ZOF A;  2H8L A;  4JRR A;  2X4A A;  4F2I A;  1G7E A;  3KP8 A;  4G0K A;  4N0V A;  2ALB A;  2HRA A;  4L0W A;  4PNF A;  4POM A;  2ON5 A;  4GTU A;  5D73 A;  2H1G A;  4MH2 A;  2PGT A;  1J0F A;  3ME7 A;  4OFN A;  2A2P A;  3LG6 A;  3RHC A;  14GS A;  1NM3 A;  5KN2 A;  4YQV A;  3GV1 A;  2XC2 A;  5ABR A;  1RK4 A;  2B7J A;  4G19 A;  3RDW A;  3LGC A;  2C4J A;  2C8U A;  3CYN A;  2IMF A;  1THX A;  3CXG A;  5IMV A;  4LA1 A;  1SJ6 A;  2HFD A;  1Z6N A;  3PPU A;  2J23 A;  4CY8 A;  2GSR A;  2H01 A;  2VM1 A;  3GSS A;  3VWW A;  2H6Z A;  1TU7 A;  4KND A;  3Q19 A;  4NHZ A;  3BCI A;  1EGR A;  3F3Q A;  2N5B A;  3IA1 A;  4EO3 A;  1PX7 A;  3KD0 A;  3KMO A;  1YEP A;  5H5Q A;  2OBK A;  1O7U A;  1IYH A;  2IFQ B;  3N9J A;  4J2F A;  2ZCT A;  1BX9 A;  3PIN A;  2WDU A;  3K8N A;  1WRY A;  1A23 A;  2IL3 A;  20GS A;  2A2R A;  3I9V 2;  1ZYE A;  4N30 A;  3ZIV A;  2M80 A;  4F0B A;  3KH7 A;  4XRD A;  2K9F A;  2L57 A;  4IVF A;  1J08 A;  2VL2 A;  2DMM A;  5G30 A;  3IBH A;  2WRT A;  2HSM A;  4POL A;  1LU4 A;  1BED A;  1OE8 A;  1TJD A;  3OR5 A;  1FO5 A;  2E0Q A;  4ACS A;  2CV4 A;  3TKS C;  4WBJ A;  4IJI A;  2IMD A;  3R2Q A;  4IW9 A;  1BG5 A;  3DKS A;  5B8A A;  1XOB A;  5D8I A;  2FD3 A;  3O76 A;  3D4M A;  3HVV A;  2YV7 A;  1TOF A;  2H0I A;  5IMD A;  5LD0 A;  1VF1 A;  2LRN A;  1BQ7 A;  5GST A;  1SK0 A;  2OE3 A;  3ZLP A;  4ICY A;  2X8H A;  2A4V A;  4OCF A;  1JHB A;  1GSS A;  4Z2R A;  3IAM 2;  4G2E A;  2HYX A;  1EZK A;  3CSH A;  1O8X A;  2GTU A;  4IP6 A;  1K3L A;  1V57 A;  2LQO A;  2RLI A;  3DD3 A;  3PR8 A;  3UMA A;  3MSZ A;  3ERG A;  4O7H A;  1SL0 B;  3GRX A;  1S3D A;  1AQW A;  3PGT A;  3DRN A;  5A4V A;  3DWV A;  5COH A;  1XWB A;  2CAI A;  1K0B A;  4LLR A;  1G0T A;  2DIY A;  1HNA A;  1TK0 B;  1T00 A;  2H75 A;  3LYK A;  4N0Z A;  4HI7 A;  3U6V A;  5AN1 A;  3VI7 A;  5DJM A;  3IK9 A;  2OKA A;  5INY A;  2H71 A;  2WB9 A;  1WIK A;  1TKD B;  3JCM L;  1GRX A;  2IMK A;  1N8J A;  3I69 A;  4BWQ A;  3FKF A;  1KBN A;  1IYI A;  4MJE A;  2V2G A;  4TR0 A;  5IMF A;  2HZE B;  3HDC A;  3HXS A;  3G7Y A;  3FR6 A;  4XRA A;  1Z6M A;  4I6X A;  1GNW A;  1XPV A;  2YWM A;  4OCE A;  1QXH A;  2WUL A;  1M99 A;  2NDO A;  1DE1 A;  3ME8 A;  1AUC A;  2N5A A;  2F8F A;  2QGV A;  3EU4 A;  3ZIT A;  5KEJ A;  12GS A;  4MH3 A;  3L9V A;  5J5N A;  2H19 A;  3FY7 A;  4PTS A;  4KCA A;  1TRS A;  2PPT A;  1WP0 A;  4EIP A;  4WR5 A;  3BOA A;  1AQV A;  4MAB A;  5CRD A;  1JZW A;  5CRW A;  1PKW A;  1TW9 A;  2HT9 A;  3IPZ A;  5F05 A;  4AF2 A;  3TOU A;  2MMO A;  4MPF A;  4AJ7 A;  1F6M C;  3LQ7 A;  2NVL A;  3HD5 A;  2C0D A;  2JU5 A;  2ES7 A;  4MF5 A;  2AHE A;  2DJ0 A;  4TW5 A;  3EYT A;  2VUP A;  1FG4 A;  4FQU A;  3Q6O A;  2VL3 A;  2FWE A;  4G10 A;  2CA8 A;  2XBQ A;  5IPG A;  1GP1 A;  3ZFL A;  4FYC A;  1ZMA A;  3ZTL A;  2OA7 A;  3HVX A;  2LQQ A;  5GAP D;  4GST A;  1TXX A;  4FO5 A;  1UVZ A;  1JZR A;  4AJ6 A;  1G7O A;  2FUG 2;  4ZBB A;  4EC0 A;  2YZH A;  3GHA A;  4XS1 A;  4GSN A;  1NW2 A;  1Z3E A;  1GSY A;  4KUN A;  5IO0 A;  5J9B A;  3I6A A;  2YJH A;  3FW2 A;  2QA2 A;  3VK9 A;  3L9U A;  4MJA A;  4LL1 B;  5B7C A;  4WF4 A;  1GTU A;  1Q4J A;  1XBS A;  3E9J B;  4TR4 A;  3H93 A;  1Z7P A;  1XWC A;  1X5C A;  4IEL A;  2HE3 A;  4O92 A;  3J7Y b;  3HCZ A;  3GKX A;  4Q5Q A;  3UVT A;  1K0N A;  2HRF A;  1EP7 A;  2I81 A;  1I5G A;  2OAC A;  3QR6 A;  4GCI A;  5JCU A;  1QUW A;  2JSZ A;  5CRG A;  4H86 A;  1Z7R A;  2AYT A;  2GSS A;  4JR6 A;  2CZ3 A;  2H72 A;  2H76 A;  4K7I A;  1PA3 A;  5ENU A;  4LL4 B;  2REM A;  5CNW A;  3UAR A;  5F06 A;  3FZ4 A;  4GQC A;  1GTB A;  2VAF A;  5DAL A;  1ERT A;  2HNL A;  4KAE A;  3IV4 A;  2ON7 A;  4ML1 A;  1TRU A;  4WKW A;  3GTU A;  2OBI A;  1U3A A;  3D21 A;  1SKS B;  5ECK B;  3TGZ A;  2YZU A;  4I5Q A;  5JWQ B;  2VCQ A;  4GXZ A;  1X9W B;  4V1A g;  4RQX A;  4D73 B;  3TKS E;  2VLT A;  3ZZX A;  4RI6 A;  5J4U A;  1T1V A;  5IMC A;  2RM6 A;  4PQI A;  4ECC A;  5ELA A;  1Y6E A;  4ZXG A;  3KJY A;  4Q5R A;  5DCG A;  2OE1 A;  5JCW A;  3AY8 A;  2KHP A;  4BVX B;  2VCT A;  3LXT A;  3S9F A;  2FY6 A;  1TP9 A;  5G1L A;  4TVE A;  3D22 A;  1Y25 A;  11GS A;  3F8U A;  1Q98 A;  5D9W A;  1B9X C;  1XWK A;  3VFI A;  1PKZ A;  2H70 A;  2N5F A;  4I2T A;  3RPP A;  3UJ1 A;  1JFU A;  2DJ3 A;  1FW1 A;  1S3C A;  1JZD A;  4K5S A;  2EC4 A;  1ERW A;  4NV5 A;  2PMT A;  4XS4 A;  2A2S A;  4TOP A;  2YNX A;  3NZN A;  4IN0 A;  1XW5 A;  2DBC A;  1YDK A;  4WET A;  3IHQ A;  3IDV A;  1USB A;  3G9B A;  4G0L A;  3H79 A;  2HZE A;  3FZ5 A;  3SBC A;  3LW9 A;  4OO4 A;  4XTS A;  3ISO A;  4HQZ A;  22GS A;  2HZF A;  3GA4 A;  3W8S A;  2XBI A;  1UN2 A;  1A8Y A;  4IJ3 A;  4IS0 A;  3EIN A;  5FHI A;  3EPT A;  1JZO A;  2C1Y A;  6GSY A;  3EWL A;  3EUR A;  3W6G A;  1TI3 A;  2GST A;  4TR1 A;  2VD0 A;  2GZY A;  1GUH A;  3WYW A;  1SEN A;  1GUM A;  3O3T A;  3QD9 A;  5D9T A;  1R4W A;  2B1L A;  1M9A A;  2I3Y A;  3QAV A;  5DVB A;  2DJ1 A;  4USS A;  4NAX A;  2AV4 A;  5AIV A;  3QAG A;  4Z7X A;  4HDE A;  4A5P A;  19GS A;  1EEJ A;  2CX3 A;  3ERW A;  1CQG A;  3CRT A;  1YJ6 A;  4MPG A;  2YCD A;  1THO A;  1ZZY A;  2VCW A;  4YH2 A;  4I2U A;  3A2W A;  4K2X A;  3HYP A;  1GUL A;  3J7Y k;  4GF0 A;  1YQ1 A;  4ZB8 A;  3IK7 A;  1SYR A;  1B4Q A;  3BBY A;  1K0O A;  2VIM A;  1Z9H A;  3DXB A;  3E3E A;  4EUY A;  3BJ5 A;  3IR4 A;  2PBJ A;  4HQS A;  3TRP A;  3FR9 A;  4P3Y B;  3VPT A;  2YWO A;  5D96 A;  4HOJ A;  2FWF A;  4J57 E;  1EWX A;  2LRC A;  3GX0 A;  3CSI A;  4K7N A;  1MD4 A;  3IHG A;  2X99 A;  4ZBD A;  4PUF C;  2B3S A;  3GFK A;  4K0G A;  4K5R A;  1PN9 A;  2MBT A;  5GSS A;  1DUG A;  2OE0 A;  4YQU A;  1T7P B;  1V2A A;  3QAW A;  2GZP A;  3BCK A;  3RBT A;  1MEK A;  1QGV A;  5B6M A;  2R37 A;  4KCE A;  1FVK A;  1M9B A;  2P5R A;  3P90 A;  2FCH A;  3GN3 A;  4X4J A;  1HNB A;  2HLS A;  2R3X A;  3ZMK A;  2X49 A;  3QCP A;  2GT6 A;  2F8A A;  2IME A;  3WT2 A;  4OD7 A;  3GNJ A;  3LOR A;  2DC5 A;  1V98 A;  2V6O A;  1ERU A;  2CT6 A;  3VPQ A;  2HSH A;  1OE7 A;  2XPE A;  2QC7 A;  1WOU A;  5B6N A;  5C00 A;  2CQ9 A;  4ZL7 A;  5IMA A;  4MZW A;  2DJJ A;  4K8M A;  1N2A A;  1XOA A;  3D6I A;  4TKY A;  3ED3 A;  2M46 A;  3GYK A;  4TXO A;  4TR3 A;  4EE0 A;  3F6F A;  5ECM B;  1SL2 B;  3D4T A;  4MCU A;  5ELG A;  4JBB A;  2LST A;  5JWR B;  1K3Y A;  4BVX A;  1EV9 A;  3GMF A;  2NBS A;  3EMP A;  1GL8 A;  1R5A A;  4KDY A;  4WF5 A;  4CDO A;  3L4N A;  1GSF A;  4DSS B;  3KIJ A;  4IP1 A;  5ID2 B;  2CVK A;  4ZL9 A;  1B48 A;  2EIR A;  3HJP A;  4KH7 A;  3TB2 A;  3HHV A;  1DBY A;  1OC9 B;  1ABA A;  4J56 E;  2H1D A;  1W89 A;  2P5Q A;  2R0C A;  5D93 A;  3LJR A;  2PN8 A;  4DSR A;  1B9Y C;  5IOX A;  4GLT A;  8GSS A;  2H73 A;  1O73 A;  1ACV A;  5HR3 A;  3DIE A;  2L5L A;  1FOH A;  5C04 A;  2VLU A;  1A2L A;  2VM2 A;  1E6B A;  1QMV A;  2BJX A;  3LSZ A;  2O8V B;  3LFL A;  3D0Z A;  3KH9 A;  5DAK B;  4BVY B;  1K0D A;  3FMW A;  4WBR D;  3F9U A;  1YZX A;  3RHB A;  2C3T A;  4AGS A;  1FHE A;  2J9H A;  3IAS 2;  2X8G A;  2XHF A;  3DML A;  4Z2U A;  1PQN A;  1VF3 A;  5EL8 A;  5AIX A;  2DJ2 A;  4DSQ A;  5CAX A;  2MZC A;  2VCZ A;  2H30 A;  3M3M A;  3P2A A;  3ZRE A;  1GTA A;  2NTO A;  2YWI A;  2M72 A;  3H1N A;  1ZL9 A;  2KUC A;  1F2E A;  2PU9 C;  1WMJ A;  2DML A;  7GSS A;  4O5Q A;  1X9M B;  2L6D A;  2H0H A;  3GUS A;  4X0X A;  3FZA A;  3MDK A;  4POK A;  4E8H A;  2VOC A;  4YAV A;  5G31 A;  3TJG A;  1ML6 A;  4BL7 B;  2AB6 A;  2P0G A;  2VD1 A;  3IXR A;  1ZGN A;  2K18 A;  2L4Q A;  2C0G A;  2LV3 A;  4NHW A;  5CRH A;  1A0R P;  4RQR A;  1U88 A;  2FGX A;  2R2J A;  4MP4 A;  4EL1 A;  3ZML A;  4RI7 A;  1WWJ A;  2DKI A;  5GAN D;  4RUV A;  4ZIJ A;  2JL4 A;  2JZS A;  3HZ4 A;  4XHM A;  4IKH A;  4YKF A;  2YAN A;  1AXD A;  2G0F A;  1GNE A;  3R3E A;  3MNG A;  1PRX A;  2FHE A;  1GSU A;  4FIW A;  1AW9 A;  3UBL A;  1NHO A;  3APO A;  5D9X A;  4O32 A;  1XVQ A;  1WJK A;  3GL3 A;  1MD3 A;  2CZ2 A;  4HJ2 A;  4TXV A;  4K7O A;  4OFT A;  5A4U A;  4K6X A;  4MNN A;  2WCI A;  3US3 A;  4MMM A;  1B4P A;  5F8B A;  3KM6 A;  3TDG A;  3VWX A;  3KGK A;  2G2Q A;  2F51 A;  5ECN B;  4F9Z A;  1RW1 A;  2V1M A;  2XPD A;  2OAD A;  1AIU A;  3APQ A;  5G5E A;  1O6J A;  1OC8 A;  1JLW A;  1GTI A;  2DJK A;  5A5K A;  1XFL A;  5HFI A;  1PGT A;  4HZ2 A;  3UVH A;  3WGX A;  4OO5 A;  2V6K A;  3QMX A;  1F9M A;  2IFQ A;  3C1R A;  4FYB A;  3DEX A;  1G6Y A;  3CRU A;  2WFC A;  2GLR A;  3A5I A;  1DE2 A;  4HUA A;  1B8X A;  2HXK A;  1F3B A;  4XIH A;  3CBU A;  2A4H A;  3F4T A;  1ZYP A;  1PSQ A;  1TRW A;  3TKQ A;  2GQK A;  4PQ1 A;  1EV4 A;  3HVS A;  1EEM A;  2JAC A;  5F0G A;  4EDZ A;  4MJB A;  3WGE A;  3CSJ A;  2L5O A;  1U3I A;  5IIZ A;  1PX6 A;  3TKR A;  1KTE A;  4O5R A;  3N5O A;  5EY6 A;  3EU3 A;  3F3R A;  2FNO A;  1ON4 A;  2GDR A;  1PD2 1;  2B5X A;  5HR2 A;  3DVW A;  4L0U A;  3APS A;  1MDJ A;  2JZT A;  4KE3 A;  2GQL A;  3TOT A;  4KF9 A;  3EE2 A;  2DLX A;  4V1A p;  1NHY A;  4PX1 A;  4DVC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...