2H73A

Crystal structure of thioredoxin mutant d43e in hexagonal (p61) space group
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
108
structure length
108
Chain Sequence
SDKIIHLTDDSFDTDVLKADGAILVDFWAEWCGPCKMIAPILEEIADEYQGKLTVAKLNIDQNPGTAPKYGIRGIPTLLLFKNGEVAATKVGALSKGQLKEFLDANLA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Thioredoxin
publication title Crystal Structure of Thioredoxin Mutant D43E in Hexagonal (p61) Space Group
rcsb
source organism Escherichia coli
molecule tags Electron transport
total genus 32
structure length 108
sequence length 108
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-06-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00085 Thioredoxin Thioredoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 2h73A00
4IVFA 2MMAA 2HZEA 2WJUA 3UIWA 2NTOA 4ECIA 4O32A 2WCIA 1PN9A 3FZ4A 3DKSA 2O87A 5HR0A 6GSTA 4EL1A 3BD2A 4L0WA 5IIZA 3C1SA 4I2TA 5DQSA 5IMCA 4KGIA 4OO5A 5AIVA 1OE7A 2RUFA 5KN0A 2VL9A 3DEXA 1HD2A 1ERUA 1Z7PA 4Q5QA 3EC3A 3ERFA 1SK0A 4AJ8A 2VM1A 3CYNA 3TKSA 4IS0A 1SENA 4BWSA 1W4VA 3EMXA 4OD7A 4MJBA 1DSBA 3D0ZA 1Q98A 3WGXA 3LFLA 5GAPD 3L78A 4MH2A 2GGTA 4MJEA 2P31A 4ULXA 4MDCA 4HZ4A 1AXDA 2B7JA 2CVKA 3LJRA 1GLPA 2L5OA 4J57E 4ECJA 3VI5A 3P7XA 1GULA 4HOJA 2VD1A 3BCKA 4IW9A 5D93A 4N11A 1FHEA 3HVXA 3EVIA 3IK7A 4NWYA 2I4AA 17GSA 4TVEA 2K9FA 1QUWA 3H79A 4YH2A 5CO3A 1SYXA 2C0DA 4PQIA 3TCOA 1FVJA 2GSSA 3WGEA 3WYWA 4LA1A 5JCWA 3CSHA 4TR3A 4GF0A 3LXTA 18GSA 4HUAA 5ELGA 2LTKA 3VWWA 2B5XA 2GLRA 3C8EA 4MF6A 1M0UA 1XPVA 5IO2A 3HJMA 1O6JA 1KNGA 3QR6A 2IMDA 2BJXA 4YAVA 3G9BA 1O73A 4TKYA 5CREA 1SJIA 1TTZA 4GSSA 4EDYA 1F6MC 1Y6EA 2N5FA 1YEXA 4HS1A 4FIWA 6GSWA 4TN8A 2OBKA 2V2GA 4ZL8A 3HZ8A 2V6KA 4XS4B 2B1KA 5ECPB 4IP6A 2DJ0A 1OVNA 2J23A 3TGZA 3TJFA 2FGXA 2PERA 1B48A 4EF0A 4BVXA 3GKMA 2L57A 5LCZA 2L6CA 1QGVA 5KN3A 3IE3A 1DBYA 1SD8A 4WBRD 1M2DA 2H66A 3GFKA 1MD4A 1XIYA 1FW1A 1T4ZA 2I9HA 2GT5A 2V32A 2L4CA 3CRUA 7GSSA 2CV4A 2CVBA 1SK2A 2HZEB 1GSFA 5F06A 2JZRA 2PPTA 1U88A 1EWXA 1M99A 3VWVA 3QDNA 4MCUA 3TJGA 3DMLA 2NPBA 22GSA 3APOA 1XW9A 5LNKe 2D2ZA 1YKCA 2FWFA 4WETA 2WRTA 1A0FA 1V58A 2ALBA 5A4VA 1ZL9A 1DE1A 1O81A 3ZVJA 2YCDA 2RM5A 5GSSA 4PUFC 3PR8A 3TKPA 1THOA 1LJRA 3Q19A 1AC1A 1OC8A 3GKXA 3TRQA 3Q18A 3EURA 1A2LA 2B6MA 2J9HA 3D6IA 1EEJA 4WR4A 2F8AA 1JZDA 2YPMA 3QCPA 2OE3A 1YZXA 4IKHA 3KIJA 3F4SA 3TKSC 2YOIA 3GH6A 4HJMA 2PVQA 4POKA 1XBSA 4RI6A 4L5LA 5IOXA 4CW9A 1PL2A 1MDKA 2V1MA 5B6MA 5B6NA 4EO3A 2TRXA 3ED3A 1IYIA 4ECCA 1Y25A 2WFCA 2QKEA 5J5NA 3AY8A 4XCSA 3FR6A 1E2YA 4HU7A 4IQAA 2HSYA 1XW5A 4MJAA 1M2BA 2LRCA 1Z7RA 4NPBA 5ECOB 4BA7A 2YJ7A 4GLTA 2V41A 4MABA 12GSA 1U6TA 3LXZA 1URMA 2KLXA 2O7KA 4E8HA 3U6VA 2P5RA 2FNOA 2XHFA 3GX8A 3VFIA 3FHKA 4DVCA 1K0MA 1TW9A 2QC7A 5B8BA 2H6XA 1EP8A 3HY2A 3TJKA 1BAYA 3Q6OA 3GURA 5ECSA 3GTUA 1YF0A 2YJHA 4L5OA 2YP6A 1LU4A 1HNCA 1NM3A 4N0VA 5EVOA 3HVVA 3WT1A 1PQNA 3IR4A 4ILFA 1V2AA 1U87A 2JSYA 3WD6A 2EIRA 2LUSA 2I1UA 4AJ6A 3ZLPA 1O7UA 4ZXGA 4XIHA 4H86A 4ACSA 1EP7A 1ABAA 1Z6MA 1RQMA 1YDKA 2AV4A 1GSUA 1X9MB 1EZKA 1MDIA 4ZBAA 2HLSA 2VOCA 2C8UA 5DALB 4MF7A 1CQGA 4V1Ap 3D4MA 2YN1A 4N0ZA 1ON4A 1M7TA 1S3AA 2HYXA 4GTUA 2H1BA 3F6DA 3QOUA 2IFQA 11GSA 1M2AA 4GCIA 1SL0B 1N2AA 2EIOA 2H19A 3GX0A 4IELA 3ERWA 5IMAA 2JL4A 2I3YA 4I6XA 5B8AA 1BG5A 1XOBA 2DLXA 3LG6A 5F0GA 3KTLA 2OA7A 3LYPA 5CYYA 4JEDA 3APSA 3UBKA 1AW9A 2FA8A 2YV9A 5A4WA 1YJ6A 2C0EA 3FKFA 1DUGA 3D21A 2X8HA 4JE1A 3LWAA 5E4WA 5JWQB 4KDUA 5DCGA 1N8JA 3GV1A 2OBIA 3GSTA 3HKRA 1YY7A 4RQXA 4PURA 3Q74A 5H5QA 5IMVA 1YEPA 1ERVA 3WGDA 3ZREA 1HYUA 4EVMA 2ES7A 4FYCA 1UA5A 1ERWA 3HCZA 5ECIB 1F3AA 3KGKA 4IJ3A 2BTOT 1FVKA 3MNGA 3DRNA 4TR1B 1FAAA 3DVXA 3IAM2 1GTUA 2GSRA 2B7KA 2IJYA 3R2QA 4XS4A 4XRAA 2CX4A 1OC3A 1B4PA 3GIXA 1TU8A 2R37A 1PRXA 1ZYEA 1VRSD 3GTUB 2LKUA 1T7PB 5B7CA 2IN3A 1RK4A 1K3LA 3M3MA 2H72A 3IAS2 4MPFA 20GSA 2WGRA 2MBSA 4I97A 3KMOA 4ZILA 1H75A 1GSSA 2AUVA 2YWOA 1GUMA 6GSYA 5EPFA 1FOVA 3KD0A 1NHOA 3EYTA 1SKWB 4ZIJA 3G7JA 2HXKA 3TRPA 4G10A 3RDWA 1NW2A 1XW6A 1XWKA 1B9XC 3MWHA 3IK9A 1B8XA 2CVDA 1PA3A 2XBIA 3UJ1A 2AJQB 3KH9A 3UL3A 2TIRA 3GNJA 3W6GA 1EGRA 1GSYA 5CP1A 3ZRDA 1K0CA 1O85A 1J08A 4Q5RA 2LS5A 4KA0A 2FWGA 2VCQA 1F3BA 4K6XA 2IFQB 1AIUA 1ILOA 4F82A 5JCUA 2DSAA 1TDIA 3F0IA 4ZBDA 4CDOA 4MPGA 1TI1A 4NV5A 1QQ2A 3ZFLA 1W89A 4KSMA 3FY7A 3KH7A 4HU9A 2JU5A 5HR3A 5J41A 1A2JA 2DIYA 2PUKC 6GSVA 3QAVA 3SWLA 4XHMA 4DEJA 1F37A 4ZL7A 3D5JA 4IN0A 5JCGA 4HI7A 3GL5A 2M72A 2VUPA 4N10A 2GTUA 5DVBA 3ZITA 1K0NA 3M1GA 5ECRB 1XXUA 4ZBBA 1K3YA 5L71A 1LBKA 2A2RA 1BJXA 3UOMA 2R4VA 3P2AA 4AJ7A 4V2NA 3IC4A 3LORA 5IQYA 3O3TA 2H01A 2VCXA 1HNAA 5A5KA 4OO4A 2JSZA 5C00A 3A3TA 4K8MA 1XWCA 3HDCA 4MK3A 4TOPA 2F51A 1S3CA 3L9UA 4X0XA 1JHBA 4ECBA 5EY6A 4KW6A 4JBBA 3KMNA 1SL1B 1F9MA 1GLQA 4NV2A 4WF4A 4PUAA 2C1YA 4K7IA 2CX3A 5IPGA 1BX9A 1TXXA 1KTEA 1X9WB 1PL1A 5LD0A 3GKNA 3RPPA 4KCAA 1YKAA 4EXJA 1A2MA 2GQKA 4KB3A 1V40A 2VD0A 3F4TA 3IHQA 3QFBC 3TDGA 3TKSE 2AB6A 2ZCTA 3FRCA 2NBSA 1T4YA 1NHYA 3PINA 4JRRA 1TI3A 2MYGA 1M9AA 1AQWA 2XPDA 2PN8A 5G5FA 3U5RE 1SKSB 1VF1A 3MAKA 3QPMA 1GTBA 4NAXA 5F05A 3UMAA 2YNXA 5C04A 1AUCA 2LV3A 1OKDA 2E2GA 5KN1A 5DALA 3G7YA 1GSQA 1WE0A 1AQVA 2DJ2A 1ZYQB 4FH8A 1EEMA 1KEBA 2VLVA 5F8BA 1XWAA 4BPYA 1RW1A 5JWOB 3E9JB 3CSIA 1K0DA 5ECNB 1MTCA 2PU9C 2VCTA 5AIXA 1SJ6A 2PGTA 2VCWA 3NIVA 2LRTA 2C3QA 3FEUA 2K8SA 4O7HA 3KTBA 6GSSA 4I5QA 3F8UA 1WMJA 3F6FA 1B9YC 1ZOFA 5ECHB 3I69A 1VGLA 1Z9HA 2QGVA 2VLTA 4WKWA 3O6TA 2HE3A 5IO0A 1GRXA 1G0TA 1GSDA 3KCMA 2RLIA 1T8EB 5CAXA 3BCIA 2H1DA 4GSNA 5G1KA 3VWUA 3VI7A 2GVPA 3G7IA 3H1NA 1EV9A 1GSEA 1TP9A 2V6OA 3GN3A 2K6VA 3VWXA 3RBTA 5IMZA 2VLUA 1SU9A 4MP4A 3PGTA 5H5SA 2E7PA 3RHBA 4TW5A 4QL9A 2X8GA 3IA1A 3PH9A 5CRDA 1IYHA 1J0FA 1R26A 1WPIA 2JZTA 2GS3A 4ID0A 3ZYWA 2KOKA 5IM9A 19GSA 2RM6A 5D9WA 1GNWA 3OR5A 3TOTA 3H8QA 3M8NA 4G2EA 2R2JA 4KE3A 2FHEA 1BQ7A 1T00A 1XWBA 2L59A 4LMWA 1TK5B 4KAEA 4DSSA 4TR1A 4MLYA 1ERTA 2R3XA 2XBQA 4GSTA 1O8WA 2A4VA 3ZZXA 2GZPA 2IWTA 1FB6A 2B3SA 2GSQA 1R4WA 2GQMA 2LQQA 3IRAA 1JZWA 3F4RA 1V9WA 2ZNMA 1G6WA 3C1RA 2F8FA 1K0OA 4OFTA 2WZ9A 4MZWA 2B5YA 4K9ZA 1PX6A 1E6BA 2MBTA 3DXBA 2XC2A 3BOAA 5D9XA 3US3A 2MMZA 2RUEA 3H4KA 1MD3A 2KHPA 4K0GA 1CQHA 2H73A 4JU5A 4PXOA 3F9UA 1I5GA 4OFNA 3IV4A 2H74A 2B5EA 3QMXA 1QFNA 1XVQA 2LEGA 4KH7A 3RAZA 2GT6A 4LLRA 1BYEA 2FCHA 3VPQA 4HDEA 3EWLA 4NHWA 1SJZA 1TOFA 4IBPA 2DJ3A 4L8EA 1PSQA 5HQPA 2BMXA 2CQ9A 5ECKB 2O89A 4QL7A 4K7OA 5DJMA 1I9DA 2HFDA 4I8BA 3QFAC 3FK8A 2H30A 2H71A 3DGQA 3GL3A 2H6ZA 2XPEA 1YF1A 5G30A 2HSHA 5GZZB 5ECMB 2PWJA 5D96A 1AQXA 4XS6A 2H76A 5CRHA 2HT9A 3J7Yk 1TKDB 4MH3A 3TUEA 3W8JA 3HHVA 4PX1A 4V2LA 5DCHA 1JLVA 5G31A 1Z5YE 4POMA 2IMKA 2GSTA 3BBYA 5DQYA 4K2DA 5IMDA 4BVYA 2QSIA 3EU4A 2OKAA 1THXA 3L0HA 2DJJA 4DSQA 1OE8A 1GTAA 3FYGA 1XZOA 3FR3A 3O76A 4HZ2A 4RUVA 4NHZA 5CRWA 3NZNA 4EUYA 2DBCA 3LSZA 4GRFA 1V98A 2KP1A 4DSSB 4QQ7A 1K0AA 3ZIJA 4ZL9A 3LQ7A 3ME7A 5HFGA 1S3DA 2I81A 1BEDA 3DWVA 13GSA 2MMNA 4YQUA 1ZMAA 2H8LA 2LJKA 1WP0A 3D4TA 2Z9SA 1A8YA 2HNLA 1A8LA 5GAND 2F9SA 3IXRA 3QD9A 1U3IA 3KM6A 3CSJA 2X64A 5FHIA 5GSTA 4KCEA 1JZOA 3RHCA 2NDOA 3A5WA 4OFMA 3TKQA 3FZ9A 4TRXA 1VF2A 5COHA 1OC9B 2C4JA 2GZZA 5ECLB 1MEKA 1MDJA 3UARA 1SK1A 3A2WA 3S9FA 4GWRA 4MZCA 1TRSA 4V1Ag 5KN2A 3I43A 4Q5FA 3A2XA 1DE2A 2OE0A 2VCZA 3GSSA 2CZ2A 4IJIA 1SKRB 3MSZA 3ZIVA 4IGJA 4GQCA 4L0UA 3C73A 4F0BA 4EKZA 3J7Yb 2L4QA 5CRGA 2YWIA 1R5AA 2FY6A 2CT6A 3EMPA 3L9SA 2X99A 1EOGA 4AF2A 1X0RA 5HR1A 1TK8B 4HJ2A 1GP1A 2YV7A 3GKKA 4X43A 1WWJA 4FYBA 3GUSA 4X1UA 5EL8A 4PNGA 3CMIA 1FB0A 1ML6A 2HRNA 2CZ3A 5ELAA 4O5RA 4E8EA 3DD3A 5J9CA 3F3QA 5AISA 2H1AA 2HI7A 2H0GA 4RI7A 4WXTA 3FW2A 2ON7A 3HXSA 1C72A 4GQFA 3TOUA 1JFUA 1T1VA 4WEYA 2VIMA 3JCML 1Z6NA 3F3RA 3CXGA 3UBLA 4PQ1A 5DDLA 2YZUA 1QK8A 3ISOA 1PKZA 3I6AA 2YANA 2RIIA 3GRXA 3NOFA 3M9KA 1TRUA 1WJKA 2VM2A 4BL7A 2REMA 3CTGA 3M0FA 3GH9A 5J9BA 2C0GA 3VLNA 5IMFA 16GSA 4Q5NA 4OCFA 3QAWA 2E2MA 5DAKA 3VPTA 4TXOA 2B1LA 2OE1A 1WRYA 3D22A 4TR4A 3KP9A 3ERGA 5F07A 2FUG2 5IOWA 10GSA 1GUKA 2LNSA 1GL8A 1EGOA 6GSXA 4CHSA 4P3YB 3HZ4A 1U3AA 3GHAA 1WOUA 4J2FA 1XVWA 2FA4A 2FWHA 2ZUPA 1GNEA 3FZ5A 3KEBA 2VL2C 4WR5A 4BWQA 1X9SB 2H1GA 2EC4A 3TB2A 14GSA 2P0GA 4POLA 1TRVA 2WDUA 1XCCA 3IOSA 4PGTA 2P5QA 4JZQA 4OCEA 2VCVA 6GSUA 5ECQB 2IMIA 5J3RA 4KDYA 1KBNA 4MA9A 1TU7A 3LYKA 3GA4A 3F63A 5D8IA 2LSTA 4KDXA 5G1LA 2M80A 2WULA 2JZSA 2N5AA 2DMLA 1JZRA 1YQ1A 3VURA 3A2VA 1K0BA 3V1WA 4XS1A 4EE0A 2DMMA 1WIKA 4F03A 4TXVA 1K3OA 3P90A 3HD5A 2AHEA 1TK0B 4ZB8A 2DJKA 2H75A 1PGTA 1Q4JA 3MDKA 4KNDA 1PMTA 4AGSA 2KP2A 4FYUA 2CAIA 2IPAA 4MZBA 3N5OA 1UVZA 5J4UA 2NVLA 5HFKA 5ID2A 2MMOA 3M9JA 3KXOA 1M9BA 2LRNA 2PVOC 1EOHA 3IDVA 3BJ5A 2M46A 1V57A 4EC0A 5AN1A 4RQRA 4J56E 2N5BA 4IQ1A 4HQSA 3APQA 4OMVA 4PQHA 1JLWA 4F2IA 4I2UA 2DIZA 2KUCA 3N9JA 2C80A 3HYPA 4KSOA 4EDZA 3UEMA 1ZCPA 8GSSA 4N30A 2X8CA 1B4QA 4XRDA 3VK9A 2K18A 2JACA 3TJJA 1G6YA 4YQVA 3RPNA 5DAKB 2CAQA 4IHUA 3K8NA 3ZFBA 2YWMA 3ZMKA 4PNFA 1G7EA 4ML1A 4TXOB 4ZB9A 3TKRA 2R5GA 4JR4A 4HEA2 4LL1B 3EU3A 5DBQA 3LEFA 1PD21 2H0IA 3CBUA 5INYA 2IIYA 5H5RA 2HZFA 2IMFA 5D9TA 2H70A 2FD3A 4D73A 1OKTA 3ZL5A 1T3BA 4MJCA 4FO5A 1GTIA 3GYKA 1AAZA 2JADA 2WB9A 2LQOA 3ZMLA 3W8SA 2LJAA 1SD9A 3KP8A 3L9VA 1OC9A 5HFIA 3HVSA 3ZTLA 1A23A 2GQLA 5FWGA 4KX4A 4MF5A 1ZGNA 1VF4A 2VL3A 2HRFA 5FT3A 3DIEA 1J9BA 3H93A 4LMVA 4NXIA 3KJYA 2O8VB 1X5CA 2C3NA 3C71A 1H4OA 2YZHA 1A0RP 2R6KA 1VF3A 4IP1A 3HA9A 4K0NA 2G0FA 2C0FA 3P8WA 4POBA 3HJOA 1ST9A 2AAWA 3L4NA 1Z3EA 5KEJA 2PBJA 4LL4B 5D9VA 1XFLA 2L5LA 4YAPA 2MZCA 4V2MA 3C7MA 4ML6A 1F2EA 1USBA 1OAZA 4JR6A 3LGCA 2G2QA 1R7HA 3TRXA 3DYRA 2CA8A 1EV4A 2L6DA 2LNTA 4O92A 3UAPA 4HQZA 4DSRA 1X5DA 2C3TA 4ZB6A 3UVTA 5CNWA 1QXHA 5ID2B 4MMMA 3QAGA 2TRCP 2WS2A 1XOAA 5ABRA 4G19A 3HJPA 1G7OA 3FZAA 4F9ZA 1UN2A 2O85A 3KZQA 3ZVJD 5A4UA 2VAFA 1SL2B 2EIQA 1R5PA 3IBHA 1HNBA 2DJ1A 4WF5A 3GMFA 1FO5A 5HR2A 2AYTA 4ISDA 4F0CA 4WBJA 2K8VA 2PMTA 3I9V2 5G2ZA 2F3MA 1ZZYA 3E3EA 1HQOA 1FG4A 3EINA 4K7NA 2GZYA 3ME8A 2A2SA 2FLSA 3UVHA 4NMUA 2E0QA 5DJLA 1GH2A 3IPZA 5IPHA 2VO4A 2VL2A 1O8XA 1NSWA 2FWEA 4KUNA 3CTFA 3E0UA 1PX7A 3CRTA 4G9HA 1A24A 1XWGA 3SBCA 2DC5A 5D73A 3FR9A 1ACVA 2IMEA 3DVWA 1TRWA 4D73B 4OWYA 2OACA 1TJDA 1GWCA 4K1FA 1UC7A 2OADA 4TR0A 5G5EA 4YQMA 2GDRA 5E59A 1GUHA 2IL3A 5AGYA 5JWRB 2LJRA 2OJLA 2H0HA 2YWNA 5ENUA 3EE2A 4XTSA 4GXZA 2ON5A 3WT2A 9GSSA 1OYJA 3TJBA 1X5EA 2H6YA 1QMVA 1PKWA 1SYRA 4Z7XA
chains in the Genus database with same CATH superfamily
4IVFA 2MMAA 2HZEA 2WJUA 3UIWA 2NTOA 4ECIA 4O32A 2WCIA 1PN9A 3FZ4A 3DKSA 2O87A 5HR0A 6GSTA 4EL1A 3MIXA 3BD2A 4L0WA 5IIZA 3C1SA 4I2TA 5DQSA 5IMCA 4KGIA 4OO5A 5AIVA 1OE7A 2RUFA 5KN0A 2VL9A 3DEXA 1HD2A 1ERUA 1Z7PA 4Q5QA 3EC3A 4EIQA 3ERFA 1SK0A 4AJ8A 2VM1A 3CQFA 3CYNA 3TKSA 4IS0A 1SENA 4BWSA 1W4VA 3EMXA 4OD7A 4MJBA 1DSBA 3D0ZA 1Q98A 3WGXA 3LFLA 4FQUA 5GAPD 3L78A 4MH2A 2GGTA 4MJEA 2P31A 4ULXA 4MDCA 4HZ4A 1AXDA 2B7JA 2CVKA 3LJRA 1GLPA 2L5OA 4J57E 4ECJA 3VI5A 3P7XA 1GULA 4HOJA 2VD1A 3BCKA 4IW9A 5D93A 4N11A 1FHEA 3HVXA 3EVIA 3IK7A 4NWYA 2I4AA 17GSA 4TVEA 2K9FA 1QUWA 3H79A 4YH2A 5CO3A 1SYXA 2C0DA 4PQIA 3TCOA 1FVJA 2GSSA 3WGEA 3WYWA 4LA1A 5JCWA 3CSHA 4TR3A 4GF0A 3LXTA 18GSA 4HUAA 5ELGA 2LTKA 3VWWA 2B5XA 2GLRA 3C8EA 4MF6A 1M0UA 1XPVA 5IO2A 3HJMA 1O6JA 1KNGA 3QR6A 2IMDA 2BJXA 4YAVA 3G9BA 3FMWA 1O73A 4TKYA 5CREA 1SJIA 1TTZA 4GSSA 4EDYA 1F6MC 1Y6EA 2N5FA 1YEXA 4HS1A 4FIWA 6GSWA 4TN8A 2OBKA 2V2GA 4ZL8A 3HZ8A 2V6KA 4XS4B 2B1KA 5ECPB 4IP6A 2DJ0A 1OVNA 2J23A 3TGZA 3TJFA 2FGXA 2PERA 1B48A 4EF0A 4BVXA 3GKMA 2L57A 5LCZA 2L6CA 1QGVA 5KN3A 3IE3A 1DBYA 1SD8A 4WBRD 1M2DA 2H66A 3GFKA 1MD4A 1XIYA 1FW1A 1T4ZA 2I9HA 2GT5A 2V32A 2L4CA 3CRUA 1M3IA 2CV4A 7GSSA 2CVBA 1SK2A 2HZEB 1GSFA 5F06A 2JZRA 2PPTA 1U88A 1EWXA 1M99A 3VWVA 1PN0A 3QDNA 4MCUA 3TJGA 3DMLA 2NPBA 22GSA 3APOA 1XW9A 5LNKe 2D2ZA 1YKCA 2FWFA 4WETA 2WRTA 1A0FA 1V58A 2ALBA 5A4VA 1ZL9A 1DE1A 1O81A 3ZVJA 2YCDA 2RM5A 5GSSA 4PUFC 3PR8A 3TKPA 1THOA 1LJRA 3Q19A 1AC1A 1OC8A 3GKXA 3TRQA 3Q18A 3EURA 1A2LA 2B6MA 2J9HA 3D6IA 1EEJA 4WR4A 2F8AA 1JZDA 2YPMA 3QCPA 2OE3A 1YZXA 4IKHA 3KIJA 3F4SA 4USSA 3TKSC 2YOIA 3GH6A 4HJMA 2PVQA 4PTSA 4POKA 1XBSA 4RI6A 4L5LA 5IOXA 3A5IA 4CW9A 1PL2A 1MDKA 2V1MA 5B6MA 5B6NA 4EO3A 2TRXA 3ED3A 1IYIA 4ECCA 1Y25A 2WFCA 2QKEA 5J5NA 3AY8A 4XCSA 3FR6A 1E2YA 4HU7A 4IQAA 2HSYA 1XW5A 4MJAA 1M2BA 2LRCA 1Z7RA 4NPBA 5ECOB 4BA7A 2YJ7A 4GLTA 2V41A 4MABA 12GSA 1U6TA 3LXZA 1URMA 2KLXA 2O7KA 4E8HA 3U6VA 2P5RA 2FNOA 2XHFA 3GX8A 3VFIA 3FHKA 4DVCA 1K0MA 1TW9A 4MNNA 2QC7A 5B8BA 2H6XA 1EP8A 3HY2A 3TJKA 1BAYA 3Q6OA 3GURA 4BVXB 2R0PA 5ECSA 4Z2UA 3GTUA 1YF0A 2YJHA 4A5PA 4L5OA 2YP6A 1LU4A 1HNCA 1NM3A 4N0VA 5EVOA 3HVVA 3WT1A 1PQNA 3IR4A 1XG8A 4ILFA 1V2AA 1U87A 2JSYA 3WD6A 2EIRA 4G0IA 2LUSA 2I1UA 3IC8A 4AJ6A 3ZLPA 1O7UA 4ZXGA 4XIHA 4H86A 4ACSA 1EP7A 1ABAA 1Z6MA 1RQMA 1YDKA 2AV4A 1GSUA 1X9MB 1EZKA 1MDIA 4ZBAA 2HLSA 2VOCA 2C8UA 5DALB 4MF7A 1CQGA 4V1Ap 3D4MA 2YN1A 4N0ZA 1ON4A 1M7TA 1S3AA 2HYXA 4GTUA 2H1BA 3F6DA 3QOUA 2X49A 2IFQA 11GSA 1M2AA 4GCIA 1SL0B 1N2AA 2EIOA 2H19A 3PPUA 3GX0A 4IELA 3ERWA 5IMAA 2JL4A 2I3YA 4I6XA 5B8AA 1BG5A 1XOBA 2DLXA 2DKIA 3LG6A 5F0GA 3KTLA 2OA7A 3LYPA 5CYYA 4JEDA 3APSA 2HSMA 3UBKA 1AW9A 2FA8A 2YV9A 5A4WA 1YJ6A 2C0EA 3FKFA 1DUGA 3D21A 2X8HA 4JE1A 3LWAA 5E4WA 5JWQB 4KDUA 5DCGA 1N8JA 3GV1A 2OBIA 3GSTA 3HKRA 1YY7A 4RQXA 4PURA 3Q74A 5H5QA 5IMVA 1YEPA 1ERVA 3WGDA 3ZREA 1HYUA 4EVMA 2ES7A 4FYCA 1UA5A 1ERWA 3HCZA 5ECIB 1F3AA 3KGKA 4IJ3A 2BTOT 1FVKA 3MNGA 3DRNA 4TR1B 1FAAA 3DVXA 4KF9A 3IAM2 1GTUA 2GSRA 2B7KA 2IJYA 3R2QA 4XS4A 4XRAA 2CX4A 1OC3A 1B4PA 3GIXA 1TU8A 2R37A 1PFOA 1PRXA 1ZYEA 1VRSD 3GTUB 2LKUA 1T7PB 5B7CA 2IN3A 1RK4A 1K3LA 3M3MA 2H72A 3IAS2 4MPFA 20GSA 2WGRA 2MBSA 4I97A 3KMOA 4ZILA 1H75A 1GSSA 2AUVA 2YWOA 1GUMA 6GSYA 5EPFA 1FOVA 3KD0A 1NHOA 3EYTA 1SKWB 4ZIJA 3G7JA 2HXKA 3TRPA 4G10A 3RDWA 1NW2A 1XW6A 1XWKA 1B9XC 3MWHA 3IK9A 1B8XA 2CVDA 1PA3A 2XBIA 3UJ1A 2AJQB 3KH9A 3UL3A 2TIRA 3GNJA 3W6GA 1EGRA 1GSYA 5CP1A 3ZRDA 1K0CA 1O85A 1J08A 4Q5RA 2LS5A 4KA0A 2FWGA 2VCQA 1F3BA 4K6XA 2IFQB 1AIUA 1ILOA 4F82A 5JCUA 2DSAA 1TDIA 3F0IA 4ZBDA 4CDOA 4MPGA 2QA1A 1TI1A 4NV5A 1QQ2A 3ZFLA 1W89A 4KSMA 3FY7A 3KH7A 4HU9A 2JU5A 5HR3A 5J41A 1A2JA 2DIYA 2PUKC 6GSVA 3QAVA 3SWLA 4XHMA 4DEJA 1F37A 4ZL7A 3D5JA 4IN0A 5JCGA 4HI7A 3GL5A 2M72A 2VUPA 4N10A 2GTUA 4YKGA 5DVBA 3ZITA 1K0NA 3M1GA 5ECRB 1XXUA 4ZBBA 1K3YA 5BRTA 5L71A 4BVYB 1LBKA 2A2RA 1BJXA 3UOMA 2R4VA 3P2AA 4AJ7A 4V2NA 3IC4A 3LORA 5IQYA 3O3TA 2H01A 2VCXA 1HNAA 5A5KA 4OO4A 2JSZA 5C00A 3A3TA 4K8MA 4K5SA 1XWCA 3HDCA 4MK3A 4TOPA 2F51A 1S3CA 3L9UA 4X0XA 1ZYNA 1JHBA 4ECBA 5EY6A 4KW6A 4JBBA 3KMNA 1SL1B 1F9MA 1GLQA 4CY6A 4NV2A 4WF4A 4PUAA 2C1YA 4K7IA 2CX3A 5IPGA 1BX9A 1TXXA 1KTEA 1X9WB 1PL1A 5LD0A 3GKNA 3RPPA 4KCAA 1YKAA 4EXJA 1A2MA 2GQKA 4KB3A 1V40A 2VD0A 3F4TA 3IHQA 3QFBC 3TDGA 3TKSE 2AB6A 2ZCTA 3FRCA 2NBSA 1T4YA 1NHYA 3PINA 4JRRA 1TI3A 2MYGA 1M9AA 1AQWA 2XPDA 2PN8A 5G5FA 3U5RE 1SKSB 1VF1A 3MAKA 3QPMA 1GTBA 4NAXA 5F05A 3UMAA 2YNXA 5C04A 1AUCA 2LV3A 1OKDA 2E2GA 5KN1A 5DALA 3G7YA 1GSQA 1WE0A 1AQVA 2DJ2A 1ZYQB 4FH8A 1EEMA 1KEBA 2VLVA 5F8BA 1XWAA 4BPYA 1RW1A 5JWOB 3E9JB 3CSIA 1K0DA 5ECNB 1MTCA 2PU9C 2VCTA 2X4AA 5AIXA 1SJ6A 2PGTA 2VCWA 3NIVA 5KOWA 2LRTA 2C3QA 3FEUA 2K8SA 4O7HA 3KTBA 6GSSA 4I5QA 3F8UA 1WMJA 3F6FA 1B9YC 1ZOFA 5ECHB 3I69A 1VGLA 1Z9HA 2QGVA 2VLTA 4WKWA 3O6TA 2HE3A 5IO0A 1GRXA 1G0TA 1GSDA 3KCMA 2RLIA 1T8EB 5CAXA 3BCIA 2H1DA 4GSNA 5G1KA 3VWUA 3VI7A 2GVPA 3G7IA 3H1NA 1EV9A 1GSEA 1TP9A 2V6OA 3GN3A 2K6VA 3VWXA 3RBTA 5IMZA 2VLUA 1SU9A 4MP4A 3PGTA 5H5SA 2E7PA 3RHBA 4TW5A 4QL9A 2X8GA 3IA1A 3PH9A 5CRDA 1IYHA 1J0FA 1R26A 1WPIA 2JZTA 2GS3A 4ID0A 3ZYWA 2KOKA 5IM9A 19GSA 2RM6A 5D9WA 1GNWA 3OR5A 3TOTA 4BL7B 3H8QA 4EIPA 3M8NA 4G2EA 2R2JA 4KE3A 2FHEA 1BQ7A 1T00A 1XWBA 2L59A 4LMWA 1TK5B 4KAEA 4DSSA 4TR1A 4MLYA 1ERTA 2R3XA 2XBQA 4GSTA 1O8WA 2A4VA 3ZZXA 4ICYA 2GZPA 2IWTA 1FB6A 2B3SA 2GSQA 1R4WA 2GQMA 2LQQA 3IRAA 1JZWA 3F4RA 1V9WA 2ZNMA 1G6WA 3C1RA 2F8FA 1K0OA 4OFTA 2WZ9A 4MZWA 2B5YA 4K9ZA 1PX6A 1E6BA 2MBTA 3DXBA 2XC2A 3BOAA 5D9XA 3US3A 2MMZA 2RUEA 3H4KA 1MD3A 2KHPA 3EPTA 4K0GA 1CQHA 2H73A 4JU5A 4PXOA 4YKFA 3F9UA 1I5GA 4OFNA 3IV4A 2H74A 2B5EA 3QMXA 1QFNA 1XVQA 2LEGA 4KH7A 3RAZA 2GT6A 4LLRA 1BYEA 2FCHA 3VPQA 4HDEA 3EWLA 4NHWA 1SJZA 1TOFA 4IBPA 2DJ3A 4L8EA 1PSQA 5HQPA 2BMXA 2CQ9A 5ECKB 2O89A 4QL7A 4K7OA 5DJMA 1I9DA 2HFDA 4I8BA 3QFAC 3FK8A 2H30A 2H71A 3DGQA 3GL3A 2H6ZA 2XPEA 1YF1A 5G30A 2HSHA 5GZZB 5ECMB 2PWJA 5D96A 1AQXA 4XS6A 2H76A 5CRHA 2HT9A 3J7Yk 1TKDB 4MH3A 3TUEA 3W8JA 3HHVA 4PX1A 4V2LA 5DCHA 1JLVA 2A2PA 5G31A 1Z5YE 4POMA 2IMKA 2GSTA 3BBYA 5DQYA 4K2DA 5IMDA 4BVYA 2QSIA 3EU4A 2OKAA 1THXA 3L0HA 2DJJA 4DSQA 1OE8A 1GTAA 3FYGA 1XZOA 3FR3A 3O76A 4HZ2A 4RUVA 4NHZA 5CRWA 3NZNA 4EUYA 2DBCA 3LSZA 4GRFA 1V98A 2KP1A 4DSSB 4QQ7A 1K0AA 3ZIJA 4ZL9A 3LQ7A 3ME7A 5HFGA 1S3DA 4K2XA 2I81A 1BEDA 3DWVA 13GSA 2MMNA 4YQUA 1ZMAA 2H8LA 2LJKA 1WP0A 4G0KA 3D4TA 2Z9SA 1A8YA 2HNLA 1A8LA 5GAND 2F9SA 3IXRA 3QD9A 1U3IA 3KM6A 3CSJA 2X64A 5FHIA 5GSTA 4KCEA 1JZOA 2R0GA 3RHCA 2NDOA 3A5WA 4OFMA 3TKQA 3FZ9A 4TRXA 1VF2A 5COHA 1OC9B 2C4JA 2GZZA 5ECLB 1MEKA 1MDJA 3UARA 1SK1A 3A2WA 3S9FA 4GWRA 4MZCA 1TRSA 4V1Ag 5KN2A 3I43A 4Q5FA 3A2XA 1DE2A 2OE0A 4K5RA 2VCZA 3GSSA 2CZ2A 2A4HA 4O5QA 4IJIA 1SKRB 3MSZA 3ZIVA 4IGJA 4GQCA 4L0UA 3C73A 4F0BA 4EKZA 3J7Yb 2L4QA 5CRGA 2YWIA 1R5AA 2FY6A 2CT6A 3EMPA 3L9SA 2X99A 1EOGA 4AF2A 1X0RA 5HR1A 1TK8B 4HJ2A 1GP1A 2YV7A 3GKKA 4X43A 1WWJA 4FYBA 3GUSA 4X1UA 5EL8A 4PNGA 3CMIA 1FB0A 1ML6A 2HRNA 2CZ3A 5ELAA 4O5RA 4E8EA 3DD3A 5J9CA 3F3QA 5AISA 2H1AA 2HI7A 2H0GA 4RI7A 4WXTA 3FW2A 2ON7A 3HXSA 1C72A 4GQFA 3TOUA 1JFUA 1T1VA 4WEYA 2VIMA 3JCML 1Z6NA 3F3RA 3CXGA 3UBLA 4PQ1A 5DDLA 2YZUA 1QK8A 3ISOA 1PKZA 3I6AA 2YANA 2RIIA 3GRXA 3NOFA 3M9KA 1TRUA 1WJKA 2VM2A 4BL7A 2REMA 3CTGA 3M0FA 3GH9A 5J9BA 2C0GA 3VLNA 5IMFA 16GSA 4Q5NA 4OCFA 3MYDA 3QAWA 2E2MA 5DAKA 3VPTA 4TXOA 2B1LA 2OE1A 1WRYA 3D22A 4TR4A 3KP9A 3ERGA 5F07A 3IHGA 2FUG2 5IOWA 4BIKA 10GSA 1GUKA 2LNSA 1GL8A 1EGOA 6GSXA 4CHSA 4P3YB 3HZ4A 1U3AA 3GHAA 1WOUA 4J2FA 1XVWA 2FA4A 2FWHA 2ZUPA 1GNEA 3FZ5A 3KEBA 1S3RA 4O5UA 2VL2C 4WR5A 4BWQA 1X9SB 2H1GA 2EC4A 3TB2A 14GSA 1FOHA 2P0GA 4POLA 1TRVA 2WDUA 1XCCA 4CY8A 2DKHA 3IOSA 4PGTA 2P5QA 1ZYPA 4JZQA 4OCEA 2VCVA 6GSUA 5ECQB 2IMIA 5J3RA 4KDYA 1KBNA 4MA9A 1TU7A 3LYKA 3GA4A 3F63A 5D8IA 2LSTA 4KDXA 5G1LA 2M80A 2WULA 2JZSA 2N5AA 2DMLA 1JZRA 1YQ1A 3VURA 3A2VA 4Z2RA 1K0BA 3V1WA 4XS1A 4EE0A 2DMMA 1WIKA 4F03A 4TXVA 1K3OA 3P90A 3HD5A 2AHEA 1TK0B 4ZB8A 2DJKA 2H75A 4Z2TA 1PGTA 1Q4JA 3MDKA 4KNDA 1PMTA 4AGSA 2KP2A 4FYUA 2CAIA 2IPAA 4MZBA 3N5OA 1UVZA 5J4UA 2NVLA 5HFKA 5ID2A 2MMOA 3M9JA 3KXOA 1M9BA 2LRNA 2PVOC 1EOHA 3IDVA 3BJ5A 2M46A 1V57A 4EC0A 5AN1A 4RQRA 4J56E 2N5BA 5BMUA 4IQ1A 4HQSA 3APQA 4OMVA 4PQHA 1JLWA 4F2IA 4I2UA 2DIZA 2KUCA 3N9JA 2C80A 3HYPA 4KSOA 4EDZA 3UEMA 1ZCPA 3HVNA 8GSSA 4N30A 2X8CA 1B4QA 4XRDA 3VK9A 2K18A 2JACA 3TJJA 1G6YA 4YQVA 3RPNA 5DAKB 2CAQA 4IHUA 3K8NA 3ZFBA 2YWMA 3ZMKA 4PNFA 1G7EA 4ML1A 4TXOB 4ZB9A 3TKRA 2R5GA 4JR4A 4HEA2 4LL1B 3EU3A 5DBQA 3LEFA 1PD21 2H0IA 3CBUA 5INYA 2IIYA 5H5RA 2HZFA 2IMFA 5D9TA 2H70A 2FD3A 4D73A 1OKTA 3ZL5A 1T3BA 4MJCA 4FO5A 1GTIA 3GYKA 1AAZA 2JADA 2WB9A 2LQOA 3ZMLA 3W8SA 2LJAA 1SD9A 3KP8A 3L9VA 1OC9A 5HFIA 3HVSA 3ZTLA 1A23A 2GQLA 5FWGA 4KX4A 4MF5A 1ZGNA 1VF4A 2VL3A 2HRFA 5FT3A 3DIEA 1J9BA 3H93A 4LMVA 4NXIA 3KJYA 2O8VB 1X5CA 2C3NA 3C71A 1H4OA 2YZHA 1A0RP 2R6KA 1VF3A 4IP1A 3HA9A 4K0NA 2G0FA 2C0FA 3P8WA 4POBA 3HJOA 1ST9A 2AAWA 3L4NA 1Z3EA 2R0CA 5KEJA 2PBJA 4LL4B 5D9VA 1XFLA 2L5LA 4YAPA 2MZCA 5KOXA 4V2MA 3C7MA 4ML6A 4X4JA 1F2EA 4HSCX 2UZ8A 1USBA 1OAZA 4JR6A 3LGCA 2G2QA 1R7HA 3TRXA 3DYRA 2CA8A 1EV4A 2L6DA 2LNTA 4O92A 3UAPA 4HQZA 2QA2A 4DSRA 1X5DA 2C3TA 4ZB6A 3LW9A 3UVTA 5CNWA 1QXHA 5ID2B 4MMMA 3QAGA 2TRCP 2WS2A 1XOAA 5ABRA 4G19A 3HJPA 1M3JA 3FZAA 1G7OA 4F9ZA 1UN2A 2O85A 3KZQA 3ZVJD 2HRKA 5A4UA 2VAFA 1SL2B 2EIQA 1R5PA 3IBHA 1HNBA 2DJ1A 4WF5A 3GMFA 1FO5A 5HR2A 2AYTA 4ISDA 4F0CA 4WBJA 2K8VA 2PMTA 3I9V2 5G2ZA 2F3MA 1ZZYA 3E3EA 1HQOA 1FG4A 3EINA 4K7NA 2GZYA 3ME8A 2A2SA 2FLSA 3UVHA 4NMUA 2E0QA 5DJLA 1GH2A 3IPZA 5IPHA 2VO4A 2VL2A 1O8XA 1NSWA 2FWEA 4KUNA 3CTFA 3E0UA 1PX7A 3CRTA 4G9HA 1A24A 1XWGA 3SBCA 2DC5A 5D73A 3FR9A 1ACVA 2IMEA 3DVWA 1TRWA 4D73B 4OWYA 2OACA 2HRAA 1TJDA 3R3EA 1GWCA 4K1FA 1UC7A 2OADA 4TR0A 5G5EA 4YQMA 2GDRA 5E59A 1GUHA 2IL3A 5AGYA 5JWRB 2LJRA 2OJLA 2H0HA 2YWNA 5ENUA 3EE2A 4XTSA 4GXZA 2ON5A 3WT2A 9GSSA 1OYJA 3TJBA 1X5EA 2H6YA 4G0LA 1QMVA 1PKWA 1SYRA 4Z7XA
chains in the Genus database with same CATH topology
4IVFA 2MMAA 2HZEA 2WJUA 3UIWA 2NTOA 4ECIA 4O32A 2WCIA 1PN9A 3FZ4A 3DKSA 2O87A 5HR0A 6GSTA 4EL1A 3MIXA 3BD2A 4L0WA 5IIZA 3C1SA 4I2TA 5DQSA 5IMCA 4KGIA 4OO5A 5AIVA 1OE7A 2RUFA 5KN0A 2VL9A 3DEXA 1HD2A 1ERUA 1Z7PA 4Q5QA 3EC3A 4EIQA 3ERFA 1SK0A 4AJ8A 2VM1A 3CYNA 3TKSA 4IS0A 1SENA 4BWSA 1W4VA 3EMXA 4OD7A 4MJBA 1DSBA 3D0ZA 1Q98A 3WGXA 3LFLA 4FQUA 5GAPD 3L78A 4MH2A 2GGTA 4MJEA 2P31A 4ULXA 4MDCA 4HZ4A 1AXDA 2B7JA 2CVKA 3LJRA 1GLPA 2L5OA 4J57E 4ECJA 3VI5A 3P7XA 1GULA 4HOJA 2VD1A 3BCKA 4IW9A 5D93A 4N11A 1FHEA 3HVXA 3EVIA 3IK7A 4NWYA 2I4AA 17GSA 4TVEA 2K9FA 1QUWA 3H79A 4YH2A 5CO3A 1SYXA 2C0DA 4PQIA 3TCOA 1FVJA 2GSSA 3WGEA 3WYWA 4LA1A 5JCWA 3CSHA 4TR3A 4GF0A 3LXTA 18GSA 4HUAA 5ELGA 2LTKA 3VWWA 2B5XA 2GLRA 3C8EA 4MF6A 1M0UA 1XPVA 5IO2A 3HJMA 1O6JA 1KNGA 3QR6A 2IMDA 2BJXA 4YAVA 3G9BA 3FMWA 1O73A 4TKYA 5CREA 1SJIA 1TTZA 4GSSA 4EDYA 1F6MC 1Y6EA 2N5FA 1YEXA 4HS1A 4FIWA 6GSWA 4TN8A 2OBKA 2V2GA 4ZL8A 3HZ8A 2V6KA 4XS4B 2B1KA 5ECPB 4IP6A 2DJ0A 1OVNA 2J23A 3TGZA 3TJFA 2FGXA 2PERA 1B48A 4EF0A 4BVXA 3GKMA 2L57A 5LCZA 2L6CA 1QGVA 5KN3A 3IE3A 1DBYA 1SD8A 4WBRD 1M2DA 2H66A 3GFKA 1MD4A 1XIYA 1FW1A 1T4ZA 2I9HA 2GT5A 2V32A 2L4CA 3CRUA 7GSSA 2CV4A 2CVBA 1SK2A 2HZEB 1GSFA 5F06A 2JZRA 2PPTA 1U88A 1EWXA 1M99A 3VWVA 1PN0A 3QDNA 4MCUA 3TJGA 3DMLA 2NPBA 22GSA 3APOA 1XW9A 5LNKe 2D2ZA 1YKCA 2FWFA 4WETA 2WRTA 1A0FA 1V58A 2ALBA 5A4VA 1ZL9A 1DE1A 1O81A 3ZVJA 2YCDA 2RM5A 5GSSA 4PUFC 3PR8A 3TKPA 1THOA 1LJRA 3Q19A 1AC1A 1OC8A 3GKXA 3TRQA 3Q18A 3EURA 1A2LA 2B6MA 2J9HA 3D6IA 1EEJA 4WR4A 2F8AA 1JZDA 2YPMA 3QCPA 2OE3A 1YZXA 4IKHA 3KIJA 3F4SA 4USSA 3TKSC 2YOIA 3GH6A 4HJMA 2PVQA 4PTSA 4POKA 1XBSA 4RI6A 4L5LA 5IOXA 3A5IA 4CW9A 1PL2A 1MDKA 2V1MA 5B6MA 5B6NA 4EO3A 2TRXA 3ED3A 1IYIA 4ECCA 1Y25A 2WFCA 2QKEA 5J5NA 3AY8A 4XCSA 3FR6A 1E2YA 4HU7A 4IQAA 2HSYA 1XW5A 4MJAA 1M2BA 2LRCA 1Z7RA 4NPBA 5ECOB 4BA7A 2YJ7A 4GLTA 2V41A 4MABA 12GSA 1U6TA 3LXZA 1URMA 2KLXA 2O7KA 4E8HA 3U6VA 2P5RA 2FNOA 2XHFA 3GX8A 3VFIA 3FHKA 4DVCA 1K0MA 1TW9A 4MNNA 2QC7A 5B8BA 2H6XA 1EP8A 3HY2A 3TJKA 1BAYA 3Q6OA 3GURA 4BVXB 2R0PA 5ECSA 4Z2UA 3GTUA 1YF0A 2YJHA 4A5PA 4L5OA 2YP6A 1LU4A 1HNCA 1NM3A 4N0VA 5EVOA 3HVVA 3WT1A 1PQNA 3IR4A 4ILFA 1V2AA 1U87A 2JSYA 3WD6A 2EIRA 4G0IA 2LUSA 2I1UA 3IC8A 4AJ6A 3ZLPA 1O7UA 4ZXGA 4XIHA 4H86A 4ACSA 1EP7A 1ABAA 1Z6MA 1RQMA 1YDKA 2AV4A 1GSUA 1X9MB 1EZKA 1MDIA 4ZBAA 2HLSA 2VOCA 2C8UA 5DALB 4MF7A 1CQGA 4V1Ap 3D4MA 2YN1A 4N0ZA 1ON4A 1M7TA 1S3AA 2HYXA 4GTUA 2H1BA 3F6DA 3QOUA 2X49A 2IFQA 11GSA 1M2AA 4GCIA 1SL0B 1N2AA 2EIOA 2H19A 3PPUA 3GX0A 4IELA 3ERWA 5IMAA 2JL4A 2I3YA 4I6XA 5B8AA 1BG5A 1XOBA 2DLXA 2DKIA 3LG6A 5F0GA 3KTLA 2OA7A 3LYPA 5CYYA 4JEDA 3APSA 2HSMA 3UBKA 1AW9A 2FA8A 2YV9A 5A4WA 1YJ6A 2C0EA 3FKFA 1DUGA 3D21A 2X8HA 4JE1A 3LWAA 5E4WA 5JWQB 4KDUA 5DCGA 1N8JA 3GV1A 2OBIA 3GSTA 3HKRA 1YY7A 4RQXA 4PURA 3Q74A 5H5QA 5IMVA 1YEPA 1ERVA 3WGDA 3ZREA 1HYUA 4EVMA 2ES7A 4FYCA 1UA5A 1ERWA 3HCZA 5ECIB 1F3AA 3KGKA 4IJ3A 2BTOT 1FVKA 3MNGA 3DRNA 4TR1B 1FAAA 3DVXA 4KF9A 3IAM2 1GTUA 2GSRA 2B7KA 2IJYA 3R2QA 4XS4A 4XRAA 2CX4A 1OC3A 1B4PA 3GIXA 1TU8A 2R37A 1PRXA 1ZYEA 1VRSD 3GTUB 2LKUA 1T7PB 5B7CA 2IN3A 1RK4A 1K3LA 3M3MA 2H72A 3IAS2 4MPFA 20GSA 2WGRA 2MBSA 4I97A 3KMOA 4ZILA 1H75A 1GSSA 2AUVA 2YWOA 1GUMA 6GSYA 5EPFA 1FOVA 3KD0A 1NHOA 3EYTA 1SKWB 4ZIJA 3G7JA 2HXKA 3TRPA 4G10A 3RDWA 1NW2A 1XW6A 1XWKA 1B9XC 3MWHA 3IK9A 1B8XA 2CVDA 1PA3A 2XBIA 3UJ1A 2AJQB 3KH9A 3UL3A 2TIRA 3GNJA 3W6GA 1EGRA 1GSYA 5CP1A 3ZRDA 1K0CA 1O85A 1J08A 4Q5RA 2LS5A 4KA0A 2FWGA 2VCQA 1F3BA 4K6XA 2IFQB 1AIUA 1ILOA 4F82A 5JCUA 2DSAA 1TDIA 3F0IA 4ZBDA 4CDOA 4MPGA 2QA1A 1TI1A 4NV5A 1QQ2A 3ZFLA 1W89A 4KSMA 3FY7A 3KH7A 4HU9A 2JU5A 5HR3A 5J41A 1A2JA 2DIYA 2PUKC 6GSVA 3QAVA 3SWLA 4XHMA 4DEJA 1F37A 4ZL7A 3D5JA 4IN0A 5JCGA 4HI7A 3GL5A 2M72A 2VUPA 4N10A 2GTUA 4YKGA 5DVBA 3ZITA 1K0NA 3M1GA 5ECRB 1XXUA 4ZBBA 1K3YA 5BRTA 5L71A 4BVYB 1LBKA 2A2RA 1BJXA 3UOMA 2R4VA 3P2AA 4AJ7A 4V2NA 3IC4A 3LORA 5IQYA 3O3TA 2H01A 2VCXA 1HNAA 5A5KA 4OO4A 2JSZA 5C00A 3A3TA 4K8MA 4K5SA 1XWCA 3HDCA 4MK3A 4TOPA 2F51A 1S3CA 3L9UA 4X0XA 1ZYNA 1JHBA 4ECBA 5EY6A 4KW6A 4JBBA 3KMNA 1SL1B 1F9MA 1GLQA 4CY6A 4NV2A 4WF4A 4PUAA 2C1YA 4K7IA 2CX3A 5IPGA 1BX9A 1TXXA 1KTEA 1X9WB 1PL1A 5LD0A 3GKNA 3RPPA 4KCAA 1YKAA 4EXJA 1A2MA 2GQKA 4KB3A 1V40A 2VD0A 3F4TA 3IHQA 3QFBC 3TDGA 3TKSE 2AB6A 2ZCTA 3FRCA 2NBSA 1T4YA 1NHYA 3PINA 4JRRA 1TI3A 2MYGA 1M9AA 1AQWA 2XPDA 2PN8A 5G5FA 3U5RE 1SKSB 1VF1A 3MAKA 3QPMA 1GTBA 4NAXA 5F05A 3UMAA 2YNXA 5C04A 1AUCA 2LV3A 1OKDA 2E2GA 5KN1A 5DALA 3G7YA 1GSQA 1WE0A 1AQVA 2DJ2A 1ZYQB 4FH8A 1EEMA 1KEBA 2VLVA 5F8BA 1XWAA 4BPYA 1RW1A 5JWOB 3E9JB 3CSIA 1K0DA 5ECNB 1MTCA 2PU9C 2VCTA 2X4AA 5AIXA 1SJ6A 2PGTA 2VCWA 3NIVA 5KOWA 2LRTA 2C3QA 3FEUA 2K8SA 4O7HA 3KTBA 6GSSA 4I5QA 3F8UA 1WMJA 3F6FA 1B9YC 1ZOFA 5ECHB 3I69A 1VGLA 1Z9HA 2QGVA 2VLTA 4WKWA 3O6TA 2HE3A 5IO0A 1GRXA 1G0TA 1GSDA 3KCMA 2RLIA 1T8EB 5CAXA 3BCIA 2H1DA 4GSNA 5G1KA 3VWUA 3VI7A 2GVPA 3G7IA 3H1NA 1EV9A 1GSEA 1TP9A 2V6OA 3GN3A 2K6VA 3VWXA 3RBTA 5IMZA 2VLUA 1SU9A 4MP4A 3PGTA 5H5SA 2E7PA 3RHBA 4TW5A 4QL9A 2X8GA 3IA1A 3PH9A 5CRDA 1IYHA 1J0FA 1R26A 1WPIA 2JZTA 2GS3A 4ID0A 3ZYWA 2KOKA 5IM9A 19GSA 2RM6A 5D9WA 1GNWA 3OR5A 3TOTA 4BL7B 3H8QA 4EIPA 3M8NA 4G2EA 2R2JA 4KE3A 2FHEA 1BQ7A 1T00A 1XWBA 2L59A 4LMWA 1TK5B 4KAEA 4DSSA 4TR1A 4MLYA 1ERTA 2R3XA 2XBQA 4GSTA 1O8WA 2A4VA 3ZZXA 4ICYA 2GZPA 2IWTA 1FB6A 2B3SA 2GSQA 1R4WA 2GQMA 2LQQA 3IRAA 1JZWA 3F4RA 1V9WA 2ZNMA 1G6WA 3C1RA 2F8FA 1K0OA 4OFTA 2WZ9A 4MZWA 2B5YA 4K9ZA 1PX6A 1E6BA 2MBTA 3DXBA 2XC2A 3BOAA 5D9XA 3US3A 2MMZA 2RUEA 3H4KA 1MD3A 2KHPA 3EPTA 4K0GA 1CQHA 2H73A 4JU5A 4PXOA 4YKFA 3F9UA 1I5GA 4OFNA 3IV4A 2H74A 2B5EA 3QMXA 1QFNA 1XVQA 2LEGA 4KH7A 3RAZA 2GT6A 4LLRA 1BYEA 2FCHA 3VPQA 4HDEA 3EWLA 4NHWA 1SJZA 1TOFA 4IBPA 2DJ3A 4L8EA 1PSQA 5HQPA 2BMXA 2CQ9A 5ECKB 2O89A 4QL7A 4K7OA 5DJMA 1I9DA 2HFDA 4I8BA 3QFAC 3FK8A 2H30A 2H71A 3DGQA 3GL3A 2H6ZA 2XPEA 1YF1A 5G30A 2HSHA 5GZZB 5ECMB 2PWJA 5D96A 1AQXA 4XS6A 2H76A 5CRHA 2HT9A 3J7Yk 1TKDB 4MH3A 3TUEA 3W8JA 3HHVA 4PX1A 4V2LA 5DCHA 1JLVA 2A2PA 5G31A 1Z5YE 4POMA 2IMKA 2GSTA 3BBYA 5DQYA 4K2DA 5IMDA 4BVYA 2QSIA 3EU4A 2OKAA 1THXA 3L0HA 2DJJA 4DSQA 1OE8A 1GTAA 3FYGA 1XZOA 3FR3A 3O76A 4HZ2A 4RUVA 4NHZA 5CRWA 3NZNA 4EUYA 2DBCA 3LSZA 4GRFA 1V98A 2KP1A 4DSSB 4QQ7A 1K0AA 3ZIJA 4ZL9A 3LQ7A 3ME7A 5HFGA 1S3DA 4K2XA 2I81A 1BEDA 3DWVA 13GSA 2MMNA 4YQUA 1ZMAA 2H8LA 2LJKA 1WP0A 4G0KA 3D4TA 2Z9SA 1A8YA 2HNLA 1A8LA 5GAND 2F9SA 3IXRA 3QD9A 1U3IA 3KM6A 3CSJA 2X64A 5FHIA 5GSTA 4KCEA 1JZOA 2R0GA 3RHCA 2NDOA 3A5WA 4OFMA 3TKQA 3FZ9A 4TRXA 1VF2A 5COHA 1OC9B 2C4JA 2GZZA 5ECLB 1MEKA 1MDJA 3UARA 1SK1A 3A2WA 3S9FA 4GWRA 4MZCA 1TRSA 4V1Ag 5KN2A 3I43A 4Q5FA 3A2XA 1DE2A 2OE0A 4K5RA 2VCZA 3GSSA 2CZ2A 2A4HA 4O5QA 4IJIA 1SKRB 3MSZA 3ZIVA 4IGJA 4GQCA 4L0UA 3C73A 4F0BA 4EKZA 3J7Yb 2L4QA 5CRGA 2YWIA 1R5AA 2FY6A 2CT6A 3EMPA 3L9SA 2X99A 1EOGA 4AF2A 1X0RA 5HR1A 1TK8B 4HJ2A 1GP1A 2YV7A 3GKKA 4X43A 1WWJA 4FYBA 3GUSA 4X1UA 5EL8A 4PNGA 3CMIA 1FB0A 1ML6A 2HRNA 2CZ3A 5ELAA 4O5RA 4E8EA 3DD3A 5J9CA 3F3QA 5AISA 2H1AA 2HI7A 2H0GA 4RI7A 4WXTA 3FW2A 2ON7A 3HXSA 1C72A 4GQFA 3TOUA 1JFUA 1T1VA 4WEYA 2VIMA 3JCML 1Z6NA 3F3RA 3CXGA 3UBLA 4PQ1A 5DDLA 2YZUA 1QK8A 3ISOA 1PKZA 3I6AA 2YANA 2RIIA 3GRXA 3NOFA 3M9KA 1TRUA 1WJKA 2VM2A 4BL7A 2REMA 3CTGA 3M0FA 3GH9A 5J9BA 2C0GA 3VLNA 5IMFA 16GSA 4Q5NA 4OCFA 3MYDA 3QAWA 2E2MA 5DAKA 3VPTA 4TXOA 2B1LA 2OE1A 1WRYA 3D22A 4TR4A 3KP9A 3ERGA 5F07A 3IHGA 2FUG2 5IOWA 10GSA 1GUKA 2LNSA 1GL8A 1EGOA 6GSXA 4CHSA 4P3YB 3HZ4A 1U3AA 3GHAA 1WOUA 4J2FA 1XVWA 2FA4A 2FWHA 2ZUPA 1GNEA 3FZ5A 3KEBA 4O5UA 2VL2C 4WR5A 4BWQA 1X9SB 2H1GA 2EC4A 3TB2A 14GSA 1FOHA 2P0GA 4POLA 1TRVA 2WDUA 1XCCA 4CY8A 2DKHA 3IOSA 4PGTA 2P5QA 1ZYPA 4JZQA 4OCEA 2VCVA 6GSUA 5ECQB 2IMIA 5J3RA 4KDYA 1KBNA 4MA9A 1TU7A 3LYKA 3GA4A 3F63A 5D8IA 2LSTA 4KDXA 5G1LA 2M80A 2WULA 2JZSA 2N5AA 2DMLA 1JZRA 1YQ1A 3VURA 3A2VA 4Z2RA 1K0BA 3V1WA 4XS1A 4EE0A 2DMMA 1WIKA 4F03A 4TXVA 1K3OA 3P90A 3HD5A 2AHEA 1TK0B 4ZB8A 2DJKA 2H75A 4Z2TA 1PGTA 1Q4JA 3MDKA 4KNDA 1PMTA 4AGSA 2KP2A 4FYUA 2CAIA 2IPAA 4MZBA 3N5OA 1UVZA 5J4UA 2NVLA 5HFKA 5ID2A 2MMOA 3M9JA 3KXOA 1M9BA 2LRNA 2PVOC 1EOHA 3IDVA 3BJ5A 2M46A 1V57A 4EC0A 5AN1A 4RQRA 4J56E 2N5BA 5BMUA 4IQ1A 4HQSA 3APQA 4OMVA 4PQHA 1JLWA 4F2IA 4I2UA 2DIZA 2KUCA 3N9JA 2C80A 3HYPA 4KSOA 4EDZA 3UEMA 1ZCPA 8GSSA 4N30A 2X8CA 1B4QA 4XRDA 3VK9A 2K18A 2JACA 3TJJA 1G6YA 4YQVA 3RPNA 5DAKB 2CAQA 4IHUA 3K8NA 3ZFBA 2YWMA 3ZMKA 4PNFA 1G7EA 4ML1A 4TXOB 4ZB9A 3TKRA 2R5GA 4JR4A 4HEA2 4LL1B 3EU3A 5DBQA 3LEFA 1PD21 2H0IA 3CBUA 5INYA 2IIYA 5H5RA 2HZFA 2IMFA 5D9TA 2H70A 2FD3A 4D73A 1OKTA 3ZL5A 1T3BA 4MJCA 4FO5A 1GTIA 3GYKA 1AAZA 2JADA 2WB9A 2LQOA 3ZMLA 3W8SA 2LJAA 1SD9A 3KP8A 3L9VA 1OC9A 5HFIA 3HVSA 3ZTLA 1A23A 2GQLA 5FWGA 4KX4A 4MF5A 1ZGNA 1VF4A 2VL3A 2HRFA 5FT3A 3DIEA 1J9BA 3H93A 4LMVA 4NXIA 3KJYA 2O8VB 1X5CA 2C3NA 3C71A 1H4OA 2YZHA 1A0RP 2R6KA 1VF3A 4IP1A 3HA9A 4K0NA 2G0FA 2C0FA 3P8WA 4POBA 3HJOA 1ST9A 2AAWA 3L4NA 1Z3EA 2R0CA 5KEJA 2PBJA 4LL4B 5D9VA 1XFLA 2L5LA 4YAPA 2MZCA 5KOXA 4V2MA 3C7MA 4ML6A 4X4JA 1F2EA 2UZ8A 1USBA 1OAZA 4JR6A 3LGCA 2G2QA 1R7HA 3TRXA 3DYRA 2CA8A 1EV4A 2L6DA 2LNTA 4O92A 3UAPA 4HQZA 2QA2A 4DSRA 1X5DA 2C3TA 4ZB6A 3LW9A 3UVTA 5CNWA 1QXHA 5ID2B 4MMMA 3QAGA 2TRCP 2WS2A 1XOAA 5ABRA 4G19A 3HJPA 1G7OA 3FZAA 4F9ZA 1UN2A 2O85A 3KZQA 3ZVJD 2HRKA 5A4UA 2VAFA 1SL2B 2EIQA 1R5PA 3IBHA 1HNBA 2DJ1A 4WF5A 3GMFA 1FO5A 5HR2A 2AYTA 4ISDA 4F0CA 4WBJA 2K8VA 2PMTA 3I9V2 5G2ZA 2F3MA 1ZZYA 3E3EA 1HQOA 1FG4A 3EINA 4K7NA 2GZYA 3ME8A 2A2SA 2FLSA 3UVHA 4NMUA 2E0QA 5DJLA 1GH2A 3IPZA 5IPHA 2VO4A 2VL2A 1O8XA 1NSWA 2FWEA 4KUNA 3CTFA 3E0UA 1PX7A 3CRTA 4G9HA 1A24A 1XWGA 3SBCA 2DC5A 5D73A 3FR9A 1ACVA 2IMEA 3DVWA 1TRWA 4D73B 4OWYA 2OACA 2HRAA 1TJDA 3R3EA 1GWCA 4K1FA 1UC7A 2OADA 4TR0A 5G5EA 4YQMA 2GDRA 5E59A 1GUHA 2IL3A 5AGYA 5JWRB 2LJRA 2OJLA 2H0HA 2YWNA 5ENUA 3EE2A 4XTSA 4GXZA 2ON5A 3WT2A 9GSSA 1OYJA 3TJBA 1X5EA 2H6YA 4G0LA 1QMVA 1PKWA 1SYRA 4Z7XA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4IVF A;  2MMA A;  2HZE A;  2WJU A;  3UIW A;  2NTO A;  4ECI A;  4O32 A;  2WCI A;  1PN9 A;  3FZ4 A;  3DKS A;  2O87 A;  5HR0 A;  6GST A;  4EL1 A;  3BD2 A;  4L0W A;  5IIZ A;  3C1S A;  4I2T A;  5DQS A;  5IMC A;  4KGI A;  4OO5 A;  5AIV A;  1OE7 A;  2RUF A;  5KN0 A;  2VL9 A;  3DEX A;  1HD2 A;  1ERU A;  1Z7P A;  4Q5Q A;  3EC3 A;  3ERF A;  1SK0 A;  4AJ8 A;  2VM1 A;  3CYN A;  3TKS A;  4IS0 A;  1SEN A;  4BWS A;  1W4V A;  3EMX A;  4OD7 A;  4MJB A;  1DSB A;  3D0Z A;  1Q98 A;  3WGX A;  3LFL A;  5GAP D;  3L78 A;  4MH2 A;  2GGT A;  4MJE A;  2P31 A;  4ULX A;  4MDC A;  4HZ4 A;  1AXD A;  2B7J A;  2CVK A;  3LJR A;  1GLP A;  2L5O A;  4J57 E;  4ECJ A;  3VI5 A;  3P7X A;  1GUL A;  4HOJ A;  2VD1 A;  3BCK A;  4IW9 A;  5D93 A;  4N11 A;  1FHE A;  3HVX A;  3EVI A;  3IK7 A;  4NWY A;  2I4A A;  17GS A;  4TVE A;  2K9F A;  1QUW A;  3H79 A;  4YH2 A;  5CO3 A;  1SYX A;  2C0D A;  4PQI A;  3TCO A;  1FVJ A;  2GSS A;  3WGE A;  3WYW A;  4LA1 A;  5JCW A;  3CSH A;  4TR3 A;  4GF0 A;  3LXT A;  18GS A;  4HUA A;  5ELG A;  2LTK A;  3VWW A;  2B5X A;  2GLR A;  3C8E A;  4MF6 A;  1M0U A;  1XPV A;  5IO2 A;  3HJM A;  1O6J A;  1KNG A;  3QR6 A;  2IMD A;  2BJX A;  4YAV A;  3G9B A;  1O73 A;  4TKY A;  5CRE A;  1SJI A;  1TTZ A;  4GSS A;  4EDY A;  1F6M C;  1Y6E A;  2N5F A;  1YEX A;  4HS1 A;  4FIW A;  6GSW A;  4TN8 A;  2OBK A;  2V2G A;  4ZL8 A;  3HZ8 A;  2V6K A;  4XS4 B;  2B1K A;  5ECP B;  4IP6 A;  2DJ0 A;  1OVN A;  2J23 A;  3TGZ A;  3TJF A;  2FGX A;  2PER A;  1B48 A;  4EF0 A;  4BVX A;  3GKM A;  2L57 A;  5LCZ A;  2L6C A;  1QGV A;  5KN3 A;  3IE3 A;  1DBY A;  1SD8 A;  4WBR D;  1M2D A;  2H66 A;  3GFK A;  1MD4 A;  1XIY A;  1FW1 A;  1T4Z A;  2I9H A;  2GT5 A;  2V32 A;  2L4C A;  3CRU A;  7GSS A;  2CV4 A;  2CVB A;  1SK2 A;  2HZE B;  1GSF A;  5F06 A;  2JZR A;  2PPT A;  1U88 A;  1EWX A;  1M99 A;  3VWV A;  3QDN A;  4MCU A;  3TJG A;  3DML A;  2NPB A;  22GS A;  3APO A;  1XW9 A;  5LNK e;  2D2Z A;  1YKC A;  2FWF A;  4WET A;  2WRT A;  1A0F A;  1V58 A;  2ALB A;  5A4V A;  1ZL9 A;  1DE1 A;  1O81 A;  3ZVJ A;  2YCD A;  2RM5 A;  5GSS A;  4PUF C;  3PR8 A;  3TKP A;  1THO A;  1LJR A;  3Q19 A;  1AC1 A;  1OC8 A;  3GKX A;  3TRQ A;  3Q18 A;  3EUR A;  1A2L A;  2B6M A;  2J9H A;  3D6I A;  1EEJ A;  4WR4 A;  2F8A A;  1JZD A;  2YPM A;  3QCP A;  2OE3 A;  1YZX A;  4IKH A;  3KIJ A;  3F4S A;  3TKS C;  2YOI A;  3GH6 A;  4HJM A;  2PVQ A;  4POK A;  1XBS A;  4RI6 A;  4L5L A;  5IOX A;  4CW9 A;  1PL2 A;  1MDK A;  2V1M A;  5B6M A;  5B6N A;  4EO3 A;  2TRX A;  3ED3 A;  1IYI A;  4ECC A;  1Y25 A;  2WFC A;  2QKE A;  5J5N A;  3AY8 A;  4XCS A;  3FR6 A;  1E2Y A;  4HU7 A;  4IQA A;  2HSY A;  1XW5 A;  4MJA A;  1M2B A;  2LRC A;  1Z7R A;  4NPB A;  5ECO B;  4BA7 A;  2YJ7 A;  4GLT A;  2V41 A;  4MAB A;  12GS A;  1U6T A;  3LXZ A;  1URM A;  2KLX A;  2O7K A;  4E8H A;  3U6V A;  2P5R A;  2FNO A;  2XHF A;  3GX8 A;  3VFI A;  3FHK A;  4DVC A;  1K0M A;  1TW9 A;  2QC7 A;  5B8B A;  2H6X A;  1EP8 A;  3HY2 A;  3TJK A;  1BAY A;  3Q6O A;  3GUR A;  5ECS A;  3GTU A;  1YF0 A;  2YJH A;  4L5O A;  2YP6 A;  1LU4 A;  1HNC A;  1NM3 A;  4N0V A;  5EVO A;  3HVV A;  3WT1 A;  1PQN A;  3IR4 A;  4ILF A;  1V2A A;  1U87 A;  2JSY A;  3WD6 A;  2EIR A;  2LUS A;  2I1U A;  4AJ6 A;  3ZLP A;  1O7U A;  4ZXG A;  4XIH A;  4H86 A;  4ACS A;  1EP7 A;  1ABA A;  1Z6M A;  1RQM A;  1YDK A;  2AV4 A;  1GSU A;  1X9M B;  1EZK A;  1MDI A;  4ZBA A;  2HLS A;  2VOC A;  2C8U A;  5DAL B;  4MF7 A;  1CQG A;  4V1A p;  3D4M A;  2YN1 A;  4N0Z A;  1ON4 A;  1M7T A;  1S3A A;  2HYX A;  4GTU A;  2H1B A;  3F6D A;  3QOU A;  2IFQ A;  11GS A;  1M2A A;  4GCI A;  1SL0 B;  1N2A A;  2EIO A;  2H19 A;  3GX0 A;  4IEL A;  3ERW A;  5IMA A;  2JL4 A;  2I3Y A;  4I6X A;  5B8A A;  1BG5 A;  1XOB A;  2DLX A;  3LG6 A;  5F0G A;  3KTL A;  2OA7 A;  3LYP A;  5CYY A;  4JED A;  3APS A;  3UBK A;  1AW9 A;  2FA8 A;  2YV9 A;  5A4W A;  1YJ6 A;  2C0E A;  3FKF A;  1DUG A;  3D21 A;  2X8H A;  4JE1 A;  3LWA A;  5E4W A;  5JWQ B;  4KDU A;  5DCG A;  1N8J A;  3GV1 A;  2OBI A;  3GST A;  3HKR A;  1YY7 A;  4RQX A;  4PUR A;  3Q74 A;  5H5Q A;  5IMV A;  1YEP A;  1ERV A;  3WGD A;  3ZRE A;  1HYU A;  4EVM A;  2ES7 A;  4FYC A;  1UA5 A;  1ERW A;  3HCZ A;  5ECI B;  1F3A A;  3KGK A;  4IJ3 A;  2BTO T;  1FVK A;  3MNG A;  3DRN A;  4TR1 B;  1FAA A;  3DVX A;  3IAM 2;  1GTU A;  2GSR A;  2B7K A;  2IJY A;  3R2Q A;  4XS4 A;  4XRA A;  2CX4 A;  1OC3 A;  1B4P A;  3GIX A;  1TU8 A;  2R37 A;  1PRX A;  1ZYE A;  1VRS D;  3GTU B;  2LKU A;  1T7P B;  5B7C A;  2IN3 A;  1RK4 A;  1K3L A;  3M3M A;  2H72 A;  3IAS 2;  4MPF A;  20GS A;  2WGR A;  2MBS A;  4I97 A;  3KMO A;  4ZIL A;  1H75 A;  1GSS A;  2AUV A;  2YWO A;  1GUM A;  6GSY A;  5EPF A;  1FOV A;  3KD0 A;  1NHO A;  3EYT A;  1SKW B;  4ZIJ A;  3G7J A;  2HXK A;  3TRP A;  4G10 A;  3RDW A;  1NW2 A;  1XW6 A;  1XWK A;  1B9X C;  3MWH A;  3IK9 A;  1B8X A;  2CVD A;  1PA3 A;  2XBI A;  3UJ1 A;  2AJQ B;  3KH9 A;  3UL3 A;  2TIR A;  3GNJ A;  3W6G A;  1EGR A;  1GSY A;  5CP1 A;  3ZRD A;  1K0C A;  1O85 A;  1J08 A;  4Q5R A;  2LS5 A;  4KA0 A;  2FWG A;  2VCQ A;  1F3B A;  4K6X A;  2IFQ B;  1AIU A;  1ILO A;  4F82 A;  5JCU A;  2DSA A;  1TDI A;  3F0I A;  4ZBD A;  4CDO A;  4MPG A;  1TI1 A;  4NV5 A;  1QQ2 A;  3ZFL A;  1W89 A;  4KSM A;  3FY7 A;  3KH7 A;  4HU9 A;  2JU5 A;  5HR3 A;  5J41 A;  1A2J A;  2DIY A;  2PUK C;  6GSV A;  3QAV A;  3SWL A;  4XHM A;  4DEJ A;  1F37 A;  4ZL7 A;  3D5J A;  4IN0 A;  5JCG A;  4HI7 A;  3GL5 A;  2M72 A;  2VUP A;  4N10 A;  2GTU A;  5DVB A;  3ZIT A;  1K0N A;  3M1G A;  5ECR B;  1XXU A;  4ZBB A;  1K3Y A;  5L71 A;  1LBK A;  2A2R A;  1BJX A;  3UOM A;  2R4V A;  3P2A A;  4AJ7 A;  4V2N A;  3IC4 A;  3LOR A;  5IQY A;  3O3T A;  2H01 A;  2VCX A;  1HNA A;  5A5K A;  4OO4 A;  2JSZ A;  5C00 A;  3A3T A;  4K8M A;  1XWC A;  3HDC A;  4MK3 A;  4TOP A;  2F51 A;  1S3C A;  3L9U A;  4X0X A;  1JHB A;  4ECB A;  5EY6 A;  4KW6 A;  4JBB A;  3KMN A;  1SL1 B;  1F9M A;  1GLQ A;  4NV2 A;  4WF4 A;  4PUA A;  2C1Y A;  4K7I A;  2CX3 A;  5IPG A;  1BX9 A;  1TXX A;  1KTE A;  1X9W B;  1PL1 A;  5LD0 A;  3GKN A;  3RPP A;  4KCA A;  1YKA A;  4EXJ A;  1A2M A;  2GQK A;  4KB3 A;  1V40 A;  2VD0 A;  3F4T A;  3IHQ A;  3QFB C;  3TDG A;  3TKS E;  2AB6 A;  2ZCT A;  3FRC A;  2NBS A;  1T4Y A;  1NHY A;  3PIN A;  4JRR A;  1TI3 A;  2MYG A;  1M9A A;  1AQW A;  2XPD A;  2PN8 A;  5G5F A;  3U5R E;  1SKS B;  1VF1 A;  3MAK A;  3QPM A;  1GTB A;  4NAX A;  5F05 A;  3UMA A;  2YNX A;  5C04 A;  1AUC A;  2LV3 A;  1OKD A;  2E2G A;  5KN1 A;  5DAL A;  3G7Y A;  1GSQ A;  1WE0 A;  1AQV A;  2DJ2 A;  1ZYQ B;  4FH8 A;  1EEM A;  1KEB A;  2VLV A;  5F8B A;  1XWA A;  4BPY A;  1RW1 A;  5JWO B;  3E9J B;  3CSI A;  1K0D A;  5ECN B;  1MTC A;  2PU9 C;  2VCT A;  5AIX A;  1SJ6 A;  2PGT A;  2VCW A;  3NIV A;  2LRT A;  2C3Q A;  3FEU A;  2K8S A;  4O7H A;  3KTB A;  6GSS A;  4I5Q A;  3F8U A;  1WMJ A;  3F6F A;  1B9Y C;  1ZOF A;  5ECH B;  3I69 A;  1VGL A;  1Z9H A;  2QGV A;  2VLT A;  4WKW A;  3O6T A;  2HE3 A;  5IO0 A;  1GRX A;  1G0T A;  1GSD A;  3KCM A;  2RLI A;  1T8E B;  5CAX A;  3BCI A;  2H1D A;  4GSN A;  5G1K A;  3VWU A;  3VI7 A;  2GVP A;  3G7I A;  3H1N A;  1EV9 A;  1GSE A;  1TP9 A;  2V6O A;  3GN3 A;  2K6V A;  3VWX A;  3RBT A;  5IMZ A;  2VLU A;  1SU9 A;  4MP4 A;  3PGT A;  5H5S A;  2E7P A;  3RHB A;  4TW5 A;  4QL9 A;  2X8G A;  3IA1 A;  3PH9 A;  5CRD A;  1IYH A;  1J0F A;  1R26 A;  1WPI A;  2JZT A;  2GS3 A;  4ID0 A;  3ZYW A;  2KOK A;  5IM9 A;  19GS A;  2RM6 A;  5D9W A;  1GNW A;  3OR5 A;  3TOT A;  3H8Q A;  3M8N A;  4G2E A;  2R2J A;  4KE3 A;  2FHE A;  1BQ7 A;  1T00 A;  1XWB A;  2L59 A;  4LMW A;  1TK5 B;  4KAE A;  4DSS A;  4TR1 A;  4MLY A;  1ERT A;  2R3X A;  2XBQ A;  4GST A;  1O8W A;  2A4V A;  3ZZX A;  2GZP A;  2IWT A;  1FB6 A;  2B3S A;  2GSQ A;  1R4W A;  2GQM A;  2LQQ A;  3IRA A;  1JZW A;  3F4R A;  1V9W A;  2ZNM A;  1G6W A;  3C1R A;  2F8F A;  1K0O A;  4OFT A;  2WZ9 A;  4MZW A;  2B5Y A;  4K9Z A;  1PX6 A;  1E6B A;  2MBT A;  3DXB A;  2XC2 A;  3BOA A;  5D9X A;  3US3 A;  2MMZ A;  2RUE A;  3H4K A;  1MD3 A;  2KHP A;  4K0G A;  1CQH A;  2H73 A;  4JU5 A;  4PXO A;  3F9U A;  1I5G A;  4OFN A;  3IV4 A;  2H74 A;  2B5E A;  3QMX A;  1QFN A;  1XVQ A;  2LEG A;  4KH7 A;  3RAZ A;  2GT6 A;  4LLR A;  1BYE A;  2FCH A;  3VPQ A;  4HDE A;  3EWL A;  4NHW A;  1SJZ A;  1TOF A;  4IBP A;  2DJ3 A;  4L8E A;  1PSQ A;  5HQP A;  2BMX A;  2CQ9 A;  5ECK B;  2O89 A;  4QL7 A;  4K7O A;  5DJM A;  1I9D A;  2HFD A;  4I8B A;  3QFA C;  3FK8 A;  2H30 A;  2H71 A;  3DGQ A;  3GL3 A;  2H6Z A;  2XPE A;  1YF1 A;  5G30 A;  2HSH A;  5GZZ B;  5ECM B;  2PWJ A;  5D96 A;  1AQX A;  4XS6 A;  2H76 A;  5CRH A;  2HT9 A;  3J7Y k;  1TKD B;  4MH3 A;  3TUE A;  3W8J A;  3HHV A;  4PX1 A;  4V2L A;  5DCH A;  1JLV A;  5G31 A;  1Z5Y E;  4POM A;  2IMK A;  2GST A;  3BBY A;  5DQY A;  4K2D A;  5IMD A;  4BVY A;  2QSI A;  3EU4 A;  2OKA A;  1THX A;  3L0H A;  2DJJ A;  4DSQ A;  1OE8 A;  1GTA A;  3FYG A;  1XZO A;  3FR3 A;  3O76 A;  4HZ2 A;  4RUV A;  4NHZ A;  5CRW A;  3NZN A;  4EUY A;  2DBC A;  3LSZ A;  4GRF A;  1V98 A;  2KP1 A;  4DSS B;  4QQ7 A;  1K0A A;  3ZIJ A;  4ZL9 A;  3LQ7 A;  3ME7 A;  5HFG A;  1S3D A;  2I81 A;  1BED A;  3DWV A;  13GS A;  2MMN A;  4YQU A;  1ZMA A;  2H8L A;  2LJK A;  1WP0 A;  3D4T A;  2Z9S A;  1A8Y A;  2HNL A;  1A8L A;  5GAN D;  2F9S A;  3IXR A;  3QD9 A;  1U3I A;  3KM6 A;  3CSJ A;  2X64 A;  5FHI A;  5GST A;  4KCE A;  1JZO A;  3RHC A;  2NDO A;  3A5W A;  4OFM A;  3TKQ A;  3FZ9 A;  4TRX A;  1VF2 A;  5COH A;  1OC9 B;  2C4J A;  2GZZ A;  5ECL B;  1MEK A;  1MDJ A;  3UAR A;  1SK1 A;  3A2W A;  3S9F A;  4GWR A;  4MZC A;  1TRS A;  4V1A g;  5KN2 A;  3I43 A;  4Q5F A;  3A2X A;  1DE2 A;  2OE0 A;  2VCZ A;  3GSS A;  2CZ2 A;  4IJI A;  1SKR B;  3MSZ A;  3ZIV A;  4IGJ A;  4GQC A;  4L0U A;  3C73 A;  4F0B A;  4EKZ A;  3J7Y b;  2L4Q A;  5CRG A;  2YWI A;  1R5A A;  2FY6 A;  2CT6 A;  3EMP A;  3L9S A;  2X99 A;  1EOG A;  4AF2 A;  1X0R A;  5HR1 A;  1TK8 B;  4HJ2 A;  1GP1 A;  2YV7 A;  3GKK A;  4X43 A;  1WWJ A;  4FYB A;  3GUS A;  4X1U A;  5EL8 A;  4PNG A;  3CMI A;  1FB0 A;  1ML6 A;  2HRN A;  2CZ3 A;  5ELA A;  4O5R A;  4E8E A;  3DD3 A;  5J9C A;  3F3Q A;  5AIS A;  2H1A A;  2HI7 A;  2H0G A;  4RI7 A;  4WXT A;  3FW2 A;  2ON7 A;  3HXS A;  1C72 A;  4GQF A;  3TOU A;  1JFU A;  1T1V A;  4WEY A;  2VIM A;  3JCM L;  1Z6N A;  3F3R A;  3CXG A;  3UBL A;  4PQ1 A;  5DDL A;  2YZU A;  1QK8 A;  3ISO A;  1PKZ A;  3I6A A;  2YAN A;  2RII A;  3GRX A;  3NOF A;  3M9K A;  1TRU A;  1WJK A;  2VM2 A;  4BL7 A;  2REM A;  3CTG A;  3M0F A;  3GH9 A;  5J9B A;  2C0G A;  3VLN A;  5IMF A;  16GS A;  4Q5N A;  4OCF A;  3QAW A;  2E2M A;  5DAK A;  3VPT A;  4TXO A;  2B1L A;  2OE1 A;  1WRY A;  3D22 A;  4TR4 A;  3KP9 A;  3ERG A;  5F07 A;  2FUG 2;  5IOW A;  10GS A;  1GUK A;  2LNS A;  1GL8 A;  1EGO A;  6GSX A;  4CHS A;  4P3Y B;  3HZ4 A;  1U3A A;  3GHA A;  1WOU A;  4J2F A;  1XVW A;  2FA4 A;  2FWH A;  2ZUP A;  1GNE A;  3FZ5 A;  3KEB A;  2VL2 C;  4WR5 A;  4BWQ A;  1X9S B;  2H1G A;  2EC4 A;  3TB2 A;  14GS A;  2P0G A;  4POL A;  1TRV A;  2WDU A;  1XCC A;  3IOS A;  4PGT A;  2P5Q A;  4JZQ A;  4OCE A;  2VCV A;  6GSU A;  5ECQ B;  2IMI A;  5J3R A;  4KDY A;  1KBN A;  4MA9 A;  1TU7 A;  3LYK A;  3GA4 A;  3F63 A;  5D8I A;  2LST A;  4KDX A;  5G1L A;  2M80 A;  2WUL A;  2JZS A;  2N5A A;  2DML A;  1JZR A;  1YQ1 A;  3VUR A;  3A2V A;  1K0B A;  3V1W A;  4XS1 A;  4EE0 A;  2DMM A;  1WIK A;  4F03 A;  4TXV A;  1K3O A;  3P90 A;  3HD5 A;  2AHE A;  1TK0 B;  4ZB8 A;  2DJK A;  2H75 A;  1PGT A;  1Q4J A;  3MDK A;  4KND A;  1PMT A;  4AGS A;  2KP2 A;  4FYU A;  2CAI A;  2IPA A;  4MZB A;  3N5O A;  1UVZ A;  5J4U A;  2NVL A;  5HFK A;  5ID2 A;  2MMO A;  3M9J A;  3KXO A;  1M9B A;  2LRN A;  2PVO C;  1EOH A;  3IDV A;  3BJ5 A;  2M46 A;  1V57 A;  4EC0 A;  5AN1 A;  4RQR A;  4J56 E;  2N5B A;  4IQ1 A;  4HQS A;  3APQ A;  4OMV A;  4PQH A;  1JLW A;  4F2I A;  4I2U A;  2DIZ A;  2KUC A;  3N9J A;  2C80 A;  3HYP A;  4KSO A;  4EDZ A;  3UEM A;  1ZCP A;  8GSS A;  4N30 A;  2X8C A;  1B4Q A;  4XRD A;  3VK9 A;  2K18 A;  2JAC A;  3TJJ A;  1G6Y A;  4YQV A;  3RPN A;  5DAK B;  2CAQ A;  4IHU A;  3K8N A;  3ZFB A;  2YWM A;  3ZMK A;  4PNF A;  1G7E A;  4ML1 A;  4TXO B;  4ZB9 A;  3TKR A;  2R5G A;  4JR4 A;  4HEA 2;  4LL1 B;  3EU3 A;  5DBQ A;  3LEF A;  1PD2 1;  2H0I A;  3CBU A;  5INY A;  2IIY A;  5H5R A;  2HZF A;  2IMF A;  5D9T A;  2H70 A;  2FD3 A;  4D73 A;  1OKT A;  3ZL5 A;  1T3B A;  4MJC A;  4FO5 A;  1GTI A;  3GYK A;  1AAZ A;  2JAD A;  2WB9 A;  2LQO A;  3ZML A;  3W8S A;  2LJA A;  1SD9 A;  3KP8 A;  3L9V A;  1OC9 A;  5HFI A;  3HVS A;  3ZTL A;  1A23 A;  2GQL A;  5FWG A;  4KX4 A;  4MF5 A;  1ZGN A;  1VF4 A;  2VL3 A;  2HRF A;  5FT3 A;  3DIE A;  1J9B A;  3H93 A;  4LMV A;  4NXI A;  3KJY A;  2O8V B;  1X5C A;  2C3N A;  3C71 A;  1H4O A;  2YZH A;  1A0R P;  2R6K A;  1VF3 A;  4IP1 A;  3HA9 A;  4K0N A;  2G0F A;  2C0F A;  3P8W A;  4POB A;  3HJO A;  1ST9 A;  2AAW A;  3L4N A;  1Z3E A;  5KEJ A;  2PBJ A;  4LL4 B;  5D9V A;  1XFL A;  2L5L A;  4YAP A;  2MZC A;  4V2M A;  3C7M A;  4ML6 A;  1F2E A;  1USB A;  1OAZ A;  4JR6 A;  3LGC A;  2G2Q A;  1R7H A;  3TRX A;  3DYR A;  2CA8 A;  1EV4 A;  2L6D A;  2LNT A;  4O92 A;  3UAP A;  4HQZ A;  4DSR A;  1X5D A;  2C3T A;  4ZB6 A;  3UVT A;  5CNW A;  1QXH A;  5ID2 B;  4MMM A;  3QAG A;  2TRC P;  2WS2 A;  1XOA A;  5ABR A;  4G19 A;  3HJP A;  1G7O A;  3FZA A;  4F9Z A;  1UN2 A;  2O85 A;  3KZQ A;  3ZVJ D;  5A4U A;  2VAF A;  1SL2 B;  2EIQ A;  1R5P A;  3IBH A;  1HNB A;  2DJ1 A;  4WF5 A;  3GMF A;  1FO5 A;  5HR2 A;  2AYT A;  4ISD A;  4F0C A;  4WBJ A;  2K8V A;  2PMT A;  3I9V 2;  5G2Z A;  2F3M A;  1ZZY A;  3E3E A;  1HQO A;  1FG4 A;  3EIN A;  4K7N A;  2GZY A;  3ME8 A;  2A2S A;  2FLS A;  3UVH A;  4NMU A;  2E0Q A;  5DJL A;  1GH2 A;  3IPZ A;  5IPH A;  2VO4 A;  2VL2 A;  1O8X A;  1NSW A;  2FWE A;  4KUN A;  3CTF A;  3E0U A;  1PX7 A;  3CRT A;  4G9H A;  1A24 A;  1XWG A;  3SBC A;  2DC5 A;  5D73 A;  3FR9 A;  1ACV A;  2IME A;  3DVW A;  1TRW A;  4D73 B;  4OWY A;  2OAC A;  1TJD A;  1GWC A;  4K1F A;  1UC7 A;  2OAD A;  4TR0 A;  5G5E A;  4YQM A;  2GDR A;  5E59 A;  1GUH A;  2IL3 A;  5AGY A;  5JWR B;  2LJR A;  2OJL A;  2H0H A;  2YWN A;  5ENU A;  3EE2 A;  4XTS A;  4GXZ A;  2ON5 A;  3WT2 A;  9GSS A;  1OYJ A;  3TJB A;  1X5E A;  2H6Y A;  1QMV A;  1PKW A;  1SYR A;  4Z7X A; 
#chains in the Genus database with same CATH topology
 4IVF A;  2MMA A;  2HZE A;  2WJU A;  3UIW A;  2NTO A;  4ECI A;  4O32 A;  2WCI A;  1PN9 A;  3FZ4 A;  3DKS A;  2O87 A;  5HR0 A;  6GST A;  4EL1 A;  3MIX A;  3BD2 A;  4L0W A;  5IIZ A;  3C1S A;  4I2T A;  5DQS A;  5IMC A;  4KGI A;  4OO5 A;  5AIV A;  1OE7 A;  2RUF A;  5KN0 A;  2VL9 A;  3DEX A;  1HD2 A;  1ERU A;  1Z7P A;  4Q5Q A;  3EC3 A;  4EIQ A;  3ERF A;  1SK0 A;  4AJ8 A;  2VM1 A;  3CQF A;  3CYN A;  3TKS A;  4IS0 A;  1SEN A;  4BWS A;  1W4V A;  3EMX A;  4OD7 A;  4MJB A;  1DSB A;  3D0Z A;  1Q98 A;  3WGX A;  3LFL A;  4FQU A;  5GAP D;  3L78 A;  4MH2 A;  2GGT A;  4MJE A;  2P31 A;  4ULX A;  4MDC A;  4HZ4 A;  1AXD A;  2B7J A;  2CVK A;  3LJR A;  1GLP A;  2L5O A;  4J57 E;  4ECJ A;  3VI5 A;  3P7X A;  1GUL A;  4HOJ A;  2VD1 A;  3BCK A;  4IW9 A;  5D93 A;  4N11 A;  1FHE A;  3HVX A;  3EVI A;  3IK7 A;  4NWY A;  2I4A A;  17GS A;  4TVE A;  2K9F A;  1QUW A;  3H79 A;  4YH2 A;  5CO3 A;  1SYX A;  2C0D A;  4PQI A;  3TCO A;  1FVJ A;  2GSS A;  3WGE A;  3WYW A;  4LA1 A;  5JCW A;  3CSH A;  4TR3 A;  4GF0 A;  3LXT A;  18GS A;  4HUA A;  5ELG A;  2LTK A;  3VWW A;  2B5X A;  2GLR A;  3C8E A;  4MF6 A;  1M0U A;  1XPV A;  5IO2 A;  3HJM A;  1O6J A;  1KNG A;  3QR6 A;  2IMD A;  2BJX A;  4YAV A;  3G9B A;  3FMW A;  1O73 A;  4TKY A;  5CRE A;  1SJI A;  1TTZ A;  4GSS A;  4EDY A;  1F6M C;  1Y6E A;  2N5F A;  1YEX A;  4HS1 A;  4FIW A;  6GSW A;  4TN8 A;  2OBK A;  2V2G A;  4ZL8 A;  3HZ8 A;  2V6K A;  4XS4 B;  2B1K A;  5ECP B;  4IP6 A;  2DJ0 A;  1OVN A;  2J23 A;  3TGZ A;  3TJF A;  2FGX A;  2PER A;  1B48 A;  4EF0 A;  4BVX A;  3GKM A;  2L57 A;  5LCZ A;  2L6C A;  1QGV A;  5KN3 A;  3IE3 A;  1DBY A;  1SD8 A;  4WBR D;  1M2D A;  2H66 A;  3GFK A;  1MD4 A;  1XIY A;  1FW1 A;  1T4Z A;  2I9H A;  2GT5 A;  2V32 A;  2L4C A;  3CRU A;  1M3I A;  2CV4 A;  7GSS A;  2CVB A;  1SK2 A;  2HZE B;  1GSF A;  5F06 A;  2JZR A;  2PPT A;  1U88 A;  1EWX A;  1M99 A;  3VWV A;  1PN0 A;  3QDN A;  4MCU A;  3TJG A;  3DML A;  2NPB A;  22GS A;  3APO A;  1XW9 A;  5LNK e;  2D2Z A;  1YKC A;  2FWF A;  4WET A;  2WRT A;  1A0F A;  1V58 A;  2ALB A;  5A4V A;  1ZL9 A;  1DE1 A;  1O81 A;  3ZVJ A;  2YCD A;  2RM5 A;  5GSS A;  4PUF C;  3PR8 A;  3TKP A;  1THO A;  1LJR A;  3Q19 A;  1AC1 A;  1OC8 A;  3GKX A;  3TRQ A;  3Q18 A;  3EUR A;  1A2L A;  2B6M A;  2J9H A;  3D6I A;  1EEJ A;  4WR4 A;  2F8A A;  1JZD A;  2YPM A;  3QCP A;  2OE3 A;  1YZX A;  4IKH A;  3KIJ A;  3F4S A;  4USS A;  3TKS C;  2YOI A;  3GH6 A;  4HJM A;  2PVQ A;  4PTS A;  4POK A;  1XBS A;  4RI6 A;  4L5L A;  5IOX A;  3A5I A;  4CW9 A;  1PL2 A;  1MDK A;  2V1M A;  5B6M A;  5B6N A;  4EO3 A;  2TRX A;  3ED3 A;  1IYI A;  4ECC A;  1Y25 A;  2WFC A;  2QKE A;  5J5N A;  3AY8 A;  4XCS A;  3FR6 A;  1E2Y A;  4HU7 A;  4IQA A;  2HSY A;  1XW5 A;  4MJA A;  1M2B A;  2LRC A;  1Z7R A;  4NPB A;  5ECO B;  4BA7 A;  2YJ7 A;  4GLT A;  2V41 A;  4MAB A;  12GS A;  1U6T A;  3LXZ A;  1URM A;  2KLX A;  2O7K A;  4E8H A;  3U6V A;  2P5R A;  2FNO A;  2XHF A;  3GX8 A;  3VFI A;  3FHK A;  4DVC A;  1K0M A;  1TW9 A;  4MNN A;  2QC7 A;  5B8B A;  2H6X A;  1EP8 A;  3HY2 A;  3TJK A;  1BAY A;  3Q6O A;  3GUR A;  4BVX B;  2R0P A;  5ECS A;  4Z2U A;  3GTU A;  1YF0 A;  2YJH A;  4A5P A;  4L5O A;  2YP6 A;  1LU4 A;  1HNC A;  1NM3 A;  4N0V A;  5EVO A;  3HVV A;  3WT1 A;  1PQN A;  3IR4 A;  1XG8 A;  4ILF A;  1V2A A;  1U87 A;  2JSY A;  3WD6 A;  2EIR A;  4G0I A;  2LUS A;  2I1U A;  3IC8 A;  4AJ6 A;  3ZLP A;  1O7U A;  4ZXG A;  4XIH A;  4H86 A;  4ACS A;  1EP7 A;  1ABA A;  1Z6M A;  1RQM A;  1YDK A;  2AV4 A;  1GSU A;  1X9M B;  1EZK A;  1MDI A;  4ZBA A;  2HLS A;  2VOC A;  2C8U A;  5DAL B;  4MF7 A;  1CQG A;  4V1A p;  3D4M A;  2YN1 A;  4N0Z A;  1ON4 A;  1M7T A;  1S3A A;  2HYX A;  4GTU A;  2H1B A;  3F6D A;  3QOU A;  2X49 A;  2IFQ A;  11GS A;  1M2A A;  4GCI A;  1SL0 B;  1N2A A;  2EIO A;  2H19 A;  3PPU A;  3GX0 A;  4IEL A;  3ERW A;  5IMA A;  2JL4 A;  2I3Y A;  4I6X A;  5B8A A;  1BG5 A;  1XOB A;  2DLX A;  2DKI A;  3LG6 A;  5F0G A;  3KTL A;  2OA7 A;  3LYP A;  5CYY A;  4JED A;  3APS A;  2HSM A;  3UBK A;  1AW9 A;  2FA8 A;  2YV9 A;  5A4W A;  1YJ6 A;  2C0E A;  3FKF A;  1DUG A;  3D21 A;  2X8H A;  4JE1 A;  3LWA A;  5E4W A;  5JWQ B;  4KDU A;  5DCG A;  1N8J A;  3GV1 A;  2OBI A;  3GST A;  3HKR A;  1YY7 A;  4RQX A;  4PUR A;  3Q74 A;  5H5Q A;  5IMV A;  1YEP A;  1ERV A;  3WGD A;  3ZRE A;  1HYU A;  4EVM A;  2ES7 A;  4FYC A;  1UA5 A;  1ERW A;  3HCZ A;  5ECI B;  1F3A A;  3KGK A;  4IJ3 A;  2BTO T;  1FVK A;  3MNG A;  3DRN A;  4TR1 B;  1FAA A;  3DVX A;  4KF9 A;  3IAM 2;  1GTU A;  2GSR A;  2B7K A;  2IJY A;  3R2Q A;  4XS4 A;  4XRA A;  2CX4 A;  1OC3 A;  1B4P A;  3GIX A;  1TU8 A;  2R37 A;  1PFO A;  1PRX A;  1ZYE A;  1VRS D;  3GTU B;  2LKU A;  1T7P B;  5B7C A;  2IN3 A;  1RK4 A;  1K3L A;  3M3M A;  2H72 A;  3IAS 2;  4MPF A;  20GS A;  2WGR A;  2MBS A;  4I97 A;  3KMO A;  4ZIL A;  1H75 A;  1GSS A;  2AUV A;  2YWO A;  1GUM A;  6GSY A;  5EPF A;  1FOV A;  3KD0 A;  1NHO A;  3EYT A;  1SKW B;  4ZIJ A;  3G7J A;  2HXK A;  3TRP A;  4G10 A;  3RDW A;  1NW2 A;  1XW6 A;  1XWK A;  1B9X C;  3MWH A;  3IK9 A;  1B8X A;  2CVD A;  1PA3 A;  2XBI A;  3UJ1 A;  2AJQ B;  3KH9 A;  3UL3 A;  2TIR A;  3GNJ A;  3W6G A;  1EGR A;  1GSY A;  5CP1 A;  3ZRD A;  1K0C A;  1O85 A;  1J08 A;  4Q5R A;  2LS5 A;  4KA0 A;  2FWG A;  2VCQ A;  1F3B A;  4K6X A;  2IFQ B;  1AIU A;  1ILO A;  4F82 A;  5JCU A;  2DSA A;  1TDI A;  3F0I A;  4ZBD A;  4CDO A;  4MPG A;  2QA1 A;  1TI1 A;  4NV5 A;  1QQ2 A;  3ZFL A;  1W89 A;  4KSM A;  3FY7 A;  3KH7 A;  4HU9 A;  2JU5 A;  5HR3 A;  5J41 A;  1A2J A;  2DIY A;  2PUK C;  6GSV A;  3QAV A;  3SWL A;  4XHM A;  4DEJ A;  1F37 A;  4ZL7 A;  3D5J A;  4IN0 A;  5JCG A;  4HI7 A;  3GL5 A;  2M72 A;  2VUP A;  4N10 A;  2GTU A;  4YKG A;  5DVB A;  3ZIT A;  1K0N A;  3M1G A;  5ECR B;  1XXU A;  4ZBB A;  1K3Y A;  5BRT A;  5L71 A;  4BVY B;  1LBK A;  2A2R A;  1BJX A;  3UOM A;  2R4V A;  3P2A A;  4AJ7 A;  4V2N A;  3IC4 A;  3LOR A;  5IQY A;  3O3T A;  2H01 A;  2VCX A;  1HNA A;  5A5K A;  4OO4 A;  2JSZ A;  5C00 A;  3A3T A;  4K8M A;  4K5S A;  1XWC A;  3HDC A;  4MK3 A;  4TOP A;  2F51 A;  1S3C A;  3L9U A;  4X0X A;  1ZYN A;  1JHB A;  4ECB A;  5EY6 A;  4KW6 A;  4JBB A;  3KMN A;  1SL1 B;  1F9M A;  1GLQ A;  4CY6 A;  4NV2 A;  4WF4 A;  4PUA A;  2C1Y A;  4K7I A;  2CX3 A;  5IPG A;  1BX9 A;  1TXX A;  1KTE A;  1X9W B;  1PL1 A;  5LD0 A;  3GKN A;  3RPP A;  4KCA A;  1YKA A;  4EXJ A;  1A2M A;  2GQK A;  4KB3 A;  1V40 A;  2VD0 A;  3F4T A;  3IHQ A;  3QFB C;  3TDG A;  3TKS E;  2AB6 A;  2ZCT A;  3FRC A;  2NBS A;  1T4Y A;  1NHY A;  3PIN A;  4JRR A;  1TI3 A;  2MYG A;  1M9A A;  1AQW A;  2XPD A;  2PN8 A;  5G5F A;  3U5R E;  1SKS B;  1VF1 A;  3MAK A;  3QPM A;  1GTB A;  4NAX A;  5F05 A;  3UMA A;  2YNX A;  5C04 A;  1AUC A;  2LV3 A;  1OKD A;  2E2G A;  5KN1 A;  5DAL A;  3G7Y A;  1GSQ A;  1WE0 A;  1AQV A;  2DJ2 A;  1ZYQ B;  4FH8 A;  1EEM A;  1KEB A;  2VLV A;  5F8B A;  1XWA A;  4BPY A;  1RW1 A;  5JWO B;  3E9J B;  3CSI A;  1K0D A;  5ECN B;  1MTC A;  2PU9 C;  2VCT A;  2X4A A;  5AIX A;  1SJ6 A;  2PGT A;  2VCW A;  3NIV A;  5KOW A;  2LRT A;  2C3Q A;  3FEU A;  2K8S A;  4O7H A;  3KTB A;  6GSS A;  4I5Q A;  3F8U A;  1WMJ A;  3F6F A;  1B9Y C;  1ZOF A;  5ECH B;  3I69 A;  1VGL A;  1Z9H A;  2QGV A;  2VLT A;  4WKW A;  3O6T A;  2HE3 A;  5IO0 A;  1GRX A;  1G0T A;  1GSD A;  3KCM A;  2RLI A;  1T8E B;  5CAX A;  3BCI A;  2H1D A;  4GSN A;  5G1K A;  3VWU A;  3VI7 A;  2GVP A;  3G7I A;  3H1N A;  1EV9 A;  1GSE A;  1TP9 A;  2V6O A;  3GN3 A;  2K6V A;  3VWX A;  3RBT A;  5IMZ A;  2VLU A;  1SU9 A;  4MP4 A;  3PGT A;  5H5S A;  2E7P A;  3RHB A;  4TW5 A;  4QL9 A;  2X8G A;  3IA1 A;  3PH9 A;  5CRD A;  1IYH A;  1J0F A;  1R26 A;  1WPI A;  2JZT A;  2GS3 A;  4ID0 A;  3ZYW A;  2KOK A;  5IM9 A;  19GS A;  2RM6 A;  5D9W A;  1GNW A;  3OR5 A;  3TOT A;  4BL7 B;  3H8Q A;  4EIP A;  3M8N A;  4G2E A;  2R2J A;  4KE3 A;  2FHE A;  1BQ7 A;  1T00 A;  1XWB A;  2L59 A;  4LMW A;  1TK5 B;  4KAE A;  4DSS A;  4TR1 A;  4MLY A;  1ERT A;  2R3X A;  2XBQ A;  4GST A;  1O8W A;  2A4V A;  3ZZX A;  4ICY A;  2GZP A;  2IWT A;  1FB6 A;  2B3S A;  2GSQ A;  1R4W A;  2GQM A;  2LQQ A;  3IRA A;  1JZW A;  3F4R A;  1V9W A;  2ZNM A;  1G6W A;  3C1R A;  2F8F A;  1K0O A;  4OFT A;  2WZ9 A;  4MZW A;  2B5Y A;  4K9Z A;  1PX6 A;  1E6B A;  2MBT A;  3DXB A;  2XC2 A;  3BOA A;  5D9X A;  3US3 A;  2MMZ A;  2RUE A;  3H4K A;  1MD3 A;  2KHP A;  3EPT A;  4K0G A;  1CQH A;  2H73 A;  4JU5 A;  4PXO A;  4YKF A;  3F9U A;  1I5G A;  4OFN A;  3IV4 A;  2H74 A;  2B5E A;  3QMX A;  1QFN A;  1XVQ A;  2LEG A;  4KH7 A;  3RAZ A;  2GT6 A;  4LLR A;  1BYE A;  2FCH A;  3VPQ A;  4HDE A;  3EWL A;  4NHW A;  1SJZ A;  1TOF A;  4IBP A;  2DJ3 A;  4L8E A;  1PSQ A;  5HQP A;  2BMX A;  2CQ9 A;  5ECK B;  2O89 A;  4QL7 A;  4K7O A;  5DJM A;  1I9D A;  2HFD A;  4I8B A;  3QFA C;  3FK8 A;  2H30 A;  2H71 A;  3DGQ A;  3GL3 A;  2H6Z A;  2XPE A;  1YF1 A;  5G30 A;  2HSH A;  5GZZ B;  5ECM B;  2PWJ A;  5D96 A;  1AQX A;  4XS6 A;  2H76 A;  5CRH A;  2HT9 A;  3J7Y k;  1TKD B;  4MH3 A;  3TUE A;  3W8J A;  3HHV A;  4PX1 A;  4V2L A;  5DCH A;  1JLV A;  2A2P A;  5G31 A;  1Z5Y E;  4POM A;  2IMK A;  2GST A;  3BBY A;  5DQY A;  4K2D A;  5IMD A;  4BVY A;  2QSI A;  3EU4 A;  2OKA A;  1THX A;  3L0H A;  2DJJ A;  4DSQ A;  1OE8 A;  1GTA A;  3FYG A;  1XZO A;  3FR3 A;  3O76 A;  4HZ2 A;  4RUV A;  4NHZ A;  5CRW A;  3NZN A;  4EUY A;  2DBC A;  3LSZ A;  4GRF A;  1V98 A;  2KP1 A;  4DSS B;  4QQ7 A;  1K0A A;  3ZIJ A;  4ZL9 A;  3LQ7 A;  3ME7 A;  5HFG A;  1S3D A;  4K2X A;  2I81 A;  1BED A;  3DWV A;  13GS A;  2MMN A;  4YQU A;  1ZMA A;  2H8L A;  2LJK A;  1WP0 A;  4G0K A;  3D4T A;  2Z9S A;  1A8Y A;  2HNL A;  1A8L A;  5GAN D;  2F9S A;  3IXR A;  3QD9 A;  1U3I A;  3KM6 A;  3CSJ A;  2X64 A;  5FHI A;  5GST A;  4KCE A;  1JZO A;  2R0G A;  3RHC A;  2NDO A;  3A5W A;  4OFM A;  3TKQ A;  3FZ9 A;  4TRX A;  1VF2 A;  5COH A;  1OC9 B;  2C4J A;  2GZZ A;  5ECL B;  1MEK A;  1MDJ A;  3UAR A;  1SK1 A;  3A2W A;  3S9F A;  4GWR A;  4MZC A;  1TRS A;  4V1A g;  5KN2 A;  3I43 A;  4Q5F A;  3A2X A;  1DE2 A;  2OE0 A;  4K5R A;  2VCZ A;  3GSS A;  2CZ2 A;  2A4H A;  4O5Q A;  4IJI A;  1SKR B;  3MSZ A;  3ZIV A;  4IGJ A;  4GQC A;  4L0U A;  3C73 A;  4F0B A;  4EKZ A;  3J7Y b;  2L4Q A;  5CRG A;  2YWI A;  1R5A A;  2FY6 A;  2CT6 A;  3EMP A;  3L9S A;  2X99 A;  1EOG A;  4AF2 A;  1X0R A;  5HR1 A;  1TK8 B;  4HJ2 A;  1GP1 A;  2YV7 A;  3GKK A;  4X43 A;  1WWJ A;  4FYB A;  3GUS A;  4X1U A;  5EL8 A;  4PNG A;  3CMI A;  1FB0 A;  1ML6 A;  2HRN A;  2CZ3 A;  5ELA A;  4O5R A;  4E8E A;  3DD3 A;  5J9C A;  3F3Q A;  5AIS A;  2H1A A;  2HI7 A;  2H0G A;  4RI7 A;  4WXT A;  3FW2 A;  2ON7 A;  3HXS A;  1C72 A;  4GQF A;  3TOU A;  1JFU A;  1T1V A;  4WEY A;  2VIM A;  3JCM L;  1Z6N A;  3F3R A;  3CXG A;  3UBL A;  4PQ1 A;  5DDL A;  2YZU A;  1QK8 A;  3ISO A;  1PKZ A;  3I6A A;  2YAN A;  2RII A;  3GRX A;  3NOF A;  3M9K A;  1TRU A;  1WJK A;  2VM2 A;  4BL7 A;  2REM A;  3CTG A;  3M0F A;  3GH9 A;  5J9B A;  2C0G A;  3VLN A;  5IMF A;  16GS A;  4Q5N A;  4OCF A;  3MYD A;  3QAW A;  2E2M A;  5DAK A;  3VPT A;  4TXO A;  2B1L A;  2OE1 A;  1WRY A;  3D22 A;  4TR4 A;  3KP9 A;  3ERG A;  5F07 A;  3IHG A;  2FUG 2;  5IOW A;  4BIK A;  10GS A;  1GUK A;  2LNS A;  1GL8 A;  1EGO A;  6GSX A;  4CHS A;  4P3Y B;  3HZ4 A;  1U3A A;  3GHA A;  1WOU A;  4J2F A;  1XVW A;  2FA4 A;  2FWH A;  2ZUP A;  1GNE A;  3FZ5 A;  3KEB A;  1S3R A;  4O5U A;  2VL2 C;  4WR5 A;  4BWQ A;  1X9S B;  2H1G A;  2EC4 A;  3TB2 A;  14GS A;  1FOH A;  2P0G A;  4POL A;  1TRV A;  2WDU A;  1XCC A;  4CY8 A;  2DKH A;  3IOS A;  4PGT A;  2P5Q A;  1ZYP A;  4JZQ A;  4OCE A;  2VCV A;  6GSU A;  5ECQ B;  2IMI A;  5J3R A;  4KDY A;  1KBN A;  4MA9 A;  1TU7 A;  3LYK A;  3GA4 A;  3F63 A;  5D8I A;  2LST A;  4KDX A;  5G1L A;  2M80 A;  2WUL A;  2JZS A;  2N5A A;  2DML A;  1JZR A;  1YQ1 A;  3VUR A;  3A2V A;  4Z2R A;  1K0B A;  3V1W A;  4XS1 A;  4EE0 A;  2DMM A;  1WIK A;  4F03 A;  4TXV A;  1K3O A;  3P90 A;  3HD5 A;  2AHE A;  1TK0 B;  4ZB8 A;  2DJK A;  2H75 A;  4Z2T A;  1PGT A;  1Q4J A;  3MDK A;  4KND A;  1PMT A;  4AGS A;  2KP2 A;  4FYU A;  2CAI A;  2IPA A;  4MZB A;  3N5O A;  1UVZ A;  5J4U A;  2NVL A;  5HFK A;  5ID2 A;  2MMO A;  3M9J A;  3KXO A;  1M9B A;  2LRN A;  2PVO C;  1EOH A;  3IDV A;  3BJ5 A;  2M46 A;  1V57 A;  4EC0 A;  5AN1 A;  4RQR A;  4J56 E;  2N5B A;  5BMU A;  4IQ1 A;  4HQS A;  3APQ A;  4OMV A;  4PQH A;  1JLW A;  4F2I A;  4I2U A;  2DIZ A;  2KUC A;  3N9J A;  2C80 A;  3HYP A;  4KSO A;  4EDZ A;  3UEM A;  1ZCP A;  3HVN A;  8GSS A;  4N30 A;  2X8C A;  1B4Q A;  4XRD A;  3VK9 A;  2K18 A;  2JAC A;  3TJJ A;  1G6Y A;  4YQV A;  3RPN A;  5DAK B;  2CAQ A;  4IHU A;  3K8N A;  3ZFB A;  2YWM A;  3ZMK A;  4PNF A;  1G7E A;  4ML1 A;  4TXO B;  4ZB9 A;  3TKR A;  2R5G A;  4JR4 A;  4HEA 2;  4LL1 B;  3EU3 A;  5DBQ A;  3LEF A;  1PD2 1;  2H0I A;  3CBU A;  5INY A;  2IIY A;  5H5R A;  2HZF A;  2IMF A;  5D9T A;  2H70 A;  2FD3 A;  4D73 A;  1OKT A;  3ZL5 A;  1T3B A;  4MJC A;  4FO5 A;  1GTI A;  3GYK A;  1AAZ A;  2JAD A;  2WB9 A;  2LQO A;  3ZML A;  3W8S A;  2LJA A;  1SD9 A;  3KP8 A;  3L9V A;  1OC9 A;  5HFI A;  3HVS A;  3ZTL A;  1A23 A;  2GQL A;  5FWG A;  4KX4 A;  4MF5 A;  1ZGN A;  1VF4 A;  2VL3 A;  2HRF A;  5FT3 A;  3DIE A;  1J9B A;  3H93 A;  4LMV A;  4NXI A;  3KJY A;  2O8V B;  1X5C A;  2C3N A;  3C71 A;  1H4O A;  2YZH A;  1A0R P;  2R6K A;  1VF3 A;  4IP1 A;  3HA9 A;  4K0N A;  2G0F A;  2C0F A;  3P8W A;  4POB A;  3HJO A;  1ST9 A;  2AAW A;  3L4N A;  1Z3E A;  2R0C A;  5KEJ A;  2PBJ A;  4LL4 B;  5D9V A;  1XFL A;  2L5L A;  4YAP A;  2MZC A;  5KOX A;  4V2M A;  3C7M A;  4ML6 A;  4X4J A;  1F2E A;  4HSC X;  2UZ8 A;  1USB A;  1OAZ A;  4JR6 A;  3LGC A;  2G2Q A;  1R7H A;  3TRX A;  3DYR A;  2CA8 A;  1EV4 A;  2L6D A;  2LNT A;  4O92 A;  3UAP A;  4HQZ A;  2QA2 A;  4DSR A;  1X5D A;  2C3T A;  4ZB6 A;  3LW9 A;  3UVT A;  5CNW A;  1QXH A;  5ID2 B;  4MMM A;  3QAG A;  2TRC P;  2WS2 A;  1XOA A;  5ABR A;  4G19 A;  3HJP A;  1M3J A;  3FZA A;  1G7O A;  4F9Z A;  1UN2 A;  2O85 A;  3KZQ A;  3ZVJ D;  2HRK A;  5A4U A;  2VAF A;  1SL2 B;  2EIQ A;  1R5P A;  3IBH A;  1HNB A;  2DJ1 A;  4WF5 A;  3GMF A;  1FO5 A;  5HR2 A;  2AYT A;  4ISD A;  4F0C A;  4WBJ A;  2K8V A;  2PMT A;  3I9V 2;  5G2Z A;  2F3M A;  1ZZY A;  3E3E A;  1HQO A;  1FG4 A;  3EIN A;  4K7N A;  2GZY A;  3ME8 A;  2A2S A;  2FLS A;  3UVH A;  4NMU A;  2E0Q A;  5DJL A;  1GH2 A;  3IPZ A;  5IPH A;  2VO4 A;  2VL2 A;  1O8X A;  1NSW A;  2FWE A;  4KUN A;  3CTF A;  3E0U A;  1PX7 A;  3CRT A;  4G9H A;  1A24 A;  1XWG A;  3SBC A;  2DC5 A;  5D73 A;  3FR9 A;  1ACV A;  2IME A;  3DVW A;  1TRW A;  4D73 B;  4OWY A;  2OAC A;  2HRA A;  1TJD A;  3R3E A;  1GWC A;  4K1F A;  1UC7 A;  2OAD A;  4TR0 A;  5G5E A;  4YQM A;  2GDR A;  5E59 A;  1GUH A;  2IL3 A;  5AGY A;  5JWR B;  2LJR A;  2OJL A;  2H0H A;  2YWN A;  5ENU A;  3EE2 A;  4XTS A;  4GXZ A;  2ON5 A;  3WT2 A;  9GSS A;  1OYJ A;  3TJB A;  1X5E A;  2H6Y A;  4G0L A;  1QMV A;  1PKW A;  1SYR A;  4Z7X A; 
#chains in the Genus database with same CATH homology
 4IVF A;  2MMA A;  2HZE A;  2WJU A;  3UIW A;  2NTO A;  4ECI A;  4O32 A;  2WCI A;  1PN9 A;  3FZ4 A;  3DKS A;  2O87 A;  5HR0 A;  6GST A;  4EL1 A;  3MIX A;  3BD2 A;  4L0W A;  5IIZ A;  3C1S A;  4I2T A;  5DQS A;  5IMC A;  4KGI A;  4OO5 A;  5AIV A;  1OE7 A;  2RUF A;  5KN0 A;  2VL9 A;  3DEX A;  1HD2 A;  1ERU A;  1Z7P A;  4Q5Q A;  3EC3 A;  4EIQ A;  3ERF A;  1SK0 A;  4AJ8 A;  2VM1 A;  3CYN A;  3TKS A;  4IS0 A;  1SEN A;  4BWS A;  1W4V A;  3EMX A;  4OD7 A;  4MJB A;  1DSB A;  3D0Z A;  1Q98 A;  3WGX A;  3LFL A;  4FQU A;  5GAP D;  3L78 A;  4MH2 A;  2GGT A;  4MJE A;  2P31 A;  4ULX A;  4MDC A;  4HZ4 A;  1AXD A;  2B7J A;  2CVK A;  3LJR A;  1GLP A;  2L5O A;  4J57 E;  4ECJ A;  3VI5 A;  3P7X A;  1GUL A;  4HOJ A;  2VD1 A;  3BCK A;  4IW9 A;  5D93 A;  4N11 A;  1FHE A;  3HVX A;  3EVI A;  3IK7 A;  4NWY A;  2I4A A;  17GS A;  4TVE A;  2K9F A;  1QUW A;  3H79 A;  4YH2 A;  5CO3 A;  1SYX A;  2C0D A;  4PQI A;  3TCO A;  1FVJ A;  2GSS A;  3WGE A;  3WYW A;  4LA1 A;  5JCW A;  3CSH A;  4TR3 A;  4GF0 A;  3LXT A;  18GS A;  4HUA A;  5ELG A;  2LTK A;  3VWW A;  2B5X A;  2GLR A;  3C8E A;  4MF6 A;  1M0U A;  1XPV A;  5IO2 A;  3HJM A;  1O6J A;  1KNG A;  3QR6 A;  2IMD A;  2BJX A;  4YAV A;  3G9B A;  3FMW A;  1O73 A;  4TKY A;  5CRE A;  1SJI A;  1TTZ A;  4GSS A;  4EDY A;  1F6M C;  1Y6E A;  2N5F A;  1YEX A;  4HS1 A;  4FIW A;  6GSW A;  4TN8 A;  2OBK A;  2V2G A;  4ZL8 A;  3HZ8 A;  2V6K A;  4XS4 B;  2B1K A;  5ECP B;  4IP6 A;  2DJ0 A;  1OVN A;  2J23 A;  3TGZ A;  3TJF A;  2FGX A;  2PER A;  1B48 A;  4EF0 A;  4BVX A;  3GKM A;  2L57 A;  5LCZ A;  2L6C A;  1QGV A;  5KN3 A;  3IE3 A;  1DBY A;  1SD8 A;  4WBR D;  1M2D A;  2H66 A;  3GFK A;  1MD4 A;  1XIY A;  1FW1 A;  1T4Z A;  2I9H A;  2GT5 A;  2V32 A;  2L4C A;  3CRU A;  7GSS A;  2CV4 A;  2CVB A;  1SK2 A;  2HZE B;  1GSF A;  5F06 A;  2JZR A;  2PPT A;  1U88 A;  1EWX A;  1M99 A;  3VWV A;  1PN0 A;  3QDN A;  4MCU A;  3TJG A;  3DML A;  2NPB A;  22GS A;  3APO A;  1XW9 A;  5LNK e;  2D2Z A;  1YKC A;  2FWF A;  4WET A;  2WRT A;  1A0F A;  1V58 A;  2ALB A;  5A4V A;  1ZL9 A;  1DE1 A;  1O81 A;  3ZVJ A;  2YCD A;  2RM5 A;  5GSS A;  4PUF C;  3PR8 A;  3TKP A;  1THO A;  1LJR A;  3Q19 A;  1AC1 A;  1OC8 A;  3GKX A;  3TRQ A;  3Q18 A;  3EUR A;  1A2L A;  2B6M A;  2J9H A;  3D6I A;  1EEJ A;  4WR4 A;  2F8A A;  1JZD A;  2YPM A;  3QCP A;  2OE3 A;  1YZX A;  4IKH A;  3KIJ A;  3F4S A;  4USS A;  3TKS C;  2YOI A;  3GH6 A;  4HJM A;  2PVQ A;  4PTS A;  4POK A;  1XBS A;  4RI6 A;  4L5L A;  5IOX A;  3A5I A;  4CW9 A;  1PL2 A;  1MDK A;  2V1M A;  5B6M A;  5B6N A;  4EO3 A;  2TRX A;  3ED3 A;  1IYI A;  4ECC A;  1Y25 A;  2WFC A;  2QKE A;  5J5N A;  3AY8 A;  4XCS A;  3FR6 A;  1E2Y A;  4HU7 A;  4IQA A;  2HSY A;  1XW5 A;  4MJA A;  1M2B A;  2LRC A;  1Z7R A;  4NPB A;  5ECO B;  4BA7 A;  2YJ7 A;  4GLT A;  2V41 A;  4MAB A;  12GS A;  1U6T A;  3LXZ A;  1URM A;  2KLX A;  2O7K A;  4E8H A;  3U6V A;  2P5R A;  2FNO A;  2XHF A;  3GX8 A;  3VFI A;  3FHK A;  4DVC A;  1K0M A;  1TW9 A;  4MNN A;  2QC7 A;  5B8B A;  2H6X A;  1EP8 A;  3HY2 A;  3TJK A;  1BAY A;  3Q6O A;  3GUR A;  4BVX B;  2R0P A;  5ECS A;  4Z2U A;  3GTU A;  1YF0 A;  2YJH A;  4A5P A;  4L5O A;  2YP6 A;  1LU4 A;  1HNC A;  1NM3 A;  4N0V A;  5EVO A;  3HVV A;  3WT1 A;  1PQN A;  3IR4 A;  4ILF A;  1V2A A;  1U87 A;  2JSY A;  3WD6 A;  2EIR A;  4G0I A;  2LUS A;  2I1U A;  3IC8 A;  4AJ6 A;  3ZLP A;  1O7U A;  4ZXG A;  4XIH A;  4H86 A;  4ACS A;  1EP7 A;  1ABA A;  1Z6M A;  1RQM A;  1YDK A;  2AV4 A;  1GSU A;  1X9M B;  1EZK A;  1MDI A;  4ZBA A;  2HLS A;  2VOC A;  2C8U A;  5DAL B;  4MF7 A;  1CQG A;  4V1A p;  3D4M A;  2YN1 A;  4N0Z A;  1ON4 A;  1M7T A;  1S3A A;  2HYX A;  4GTU A;  2H1B A;  3F6D A;  3QOU A;  2X49 A;  2IFQ A;  11GS A;  1M2A A;  4GCI A;  1SL0 B;  1N2A A;  2EIO A;  2H19 A;  3PPU A;  3GX0 A;  4IEL A;  3ERW A;  5IMA A;  2JL4 A;  2I3Y A;  4I6X A;  5B8A A;  1BG5 A;  1XOB A;  2DLX A;  2DKI A;  3LG6 A;  5F0G A;  3KTL A;  2OA7 A;  3LYP A;  5CYY A;  4JED A;  3APS A;  2HSM A;  3UBK A;  1AW9 A;  2FA8 A;  2YV9 A;  5A4W A;  1YJ6 A;  2C0E A;  3FKF A;  1DUG A;  3D21 A;  2X8H A;  4JE1 A;  3LWA A;  5E4W A;  5JWQ B;  4KDU A;  5DCG A;  1N8J A;  3GV1 A;  2OBI A;  3GST A;  3HKR A;  1YY7 A;  4RQX A;  4PUR A;  3Q74 A;  5H5Q A;  5IMV A;  1YEP A;  1ERV A;  3WGD A;  3ZRE A;  1HYU A;  4EVM A;  2ES7 A;  4FYC A;  1UA5 A;  1ERW A;  3HCZ A;  5ECI B;  1F3A A;  3KGK A;  4IJ3 A;  2BTO T;  1FVK A;  3MNG A;  3DRN A;  4TR1 B;  1FAA A;  3DVX A;  4KF9 A;  3IAM 2;  1GTU A;  2GSR A;  2B7K A;  2IJY A;  3R2Q A;  4XS4 A;  4XRA A;  2CX4 A;  1OC3 A;  1B4P A;  3GIX A;  1TU8 A;  2R37 A;  1PRX A;  1ZYE A;  1VRS D;  3GTU B;  2LKU A;  1T7P B;  5B7C A;  2IN3 A;  1RK4 A;  1K3L A;  3M3M A;  2H72 A;  3IAS 2;  4MPF A;  20GS A;  2WGR A;  2MBS A;  4I97 A;  3KMO A;  4ZIL A;  1H75 A;  1GSS A;  2AUV A;  2YWO A;  1GUM A;  6GSY A;  5EPF A;  1FOV A;  3KD0 A;  1NHO A;  3EYT A;  1SKW B;  4ZIJ A;  3G7J A;  2HXK A;  3TRP A;  4G10 A;  3RDW A;  1NW2 A;  1XW6 A;  1XWK A;  1B9X C;  3MWH A;  3IK9 A;  1B8X A;  2CVD A;  1PA3 A;  2XBI A;  3UJ1 A;  2AJQ B;  3KH9 A;  3UL3 A;  2TIR A;  3GNJ A;  3W6G A;  1EGR A;  1GSY A;  5CP1 A;  3ZRD A;  1K0C A;  1O85 A;  1J08 A;  4Q5R A;  2LS5 A;  4KA0 A;  2FWG A;  2VCQ A;  1F3B A;  4K6X A;  2IFQ B;  1AIU A;  1ILO A;  4F82 A;  5JCU A;  2DSA A;  1TDI A;  3F0I A;  4ZBD A;  4CDO A;  4MPG A;  2QA1 A;  1TI1 A;  4NV5 A;  1QQ2 A;  3ZFL A;  1W89 A;  4KSM A;  3FY7 A;  3KH7 A;  4HU9 A;  2JU5 A;  5HR3 A;  5J41 A;  1A2J A;  2DIY A;  2PUK C;  6GSV A;  3QAV A;  3SWL A;  4XHM A;  4DEJ A;  1F37 A;  4ZL7 A;  3D5J A;  4IN0 A;  5JCG A;  4HI7 A;  3GL5 A;  2M72 A;  2VUP A;  4N10 A;  2GTU A;  4YKG A;  5DVB A;  3ZIT A;  1K0N A;  3M1G A;  5ECR B;  1XXU A;  4ZBB A;  1K3Y A;  5BRT A;  5L71 A;  4BVY B;  1LBK A;  2A2R A;  1BJX A;  3UOM A;  2R4V A;  3P2A A;  4AJ7 A;  4V2N A;  3IC4 A;  3LOR A;  5IQY A;  3O3T A;  2H01 A;  2VCX A;  1HNA A;  5A5K A;  4OO4 A;  2JSZ A;  5C00 A;  3A3T A;  4K8M A;  4K5S A;  1XWC A;  3HDC A;  4MK3 A;  4TOP A;  2F51 A;  1S3C A;  3L9U A;  4X0X A;  1ZYN A;  1JHB A;  4ECB A;  5EY6 A;  4KW6 A;  4JBB A;  3KMN A;  1SL1 B;  1F9M A;  1GLQ A;  4CY6 A;  4NV2 A;  4WF4 A;  4PUA A;  2C1Y A;  4K7I A;  2CX3 A;  5IPG A;  1BX9 A;  1TXX A;  1KTE A;  1X9W B;  1PL1 A;  5LD0 A;  3GKN A;  3RPP A;  4KCA A;  1YKA A;  4EXJ A;  1A2M A;  2GQK A;  4KB3 A;  1V40 A;  2VD0 A;  3F4T A;  3IHQ A;  3QFB C;  3TDG A;  3TKS E;  2AB6 A;  2ZCT A;  3FRC A;  2NBS A;  1T4Y A;  1NHY A;  3PIN A;  4JRR A;  1TI3 A;  2MYG A;  1M9A A;  1AQW A;  2XPD A;  2PN8 A;  5G5F A;  3U5R E;  1SKS B;  1VF1 A;  3MAK A;  3QPM A;  1GTB A;  4NAX A;  5F05 A;  3UMA A;  2YNX A;  5C04 A;  1AUC A;  2LV3 A;  1OKD A;  2E2G A;  5KN1 A;  5DAL A;  3G7Y A;  1GSQ A;  1WE0 A;  1AQV A;  2DJ2 A;  1ZYQ B;  4FH8 A;  1EEM A;  1KEB A;  2VLV A;  5F8B A;  1XWA A;  4BPY A;  1RW1 A;  5JWO B;  3E9J B;  3CSI A;  1K0D A;  5ECN B;  1MTC A;  2PU9 C;  2VCT A;  2X4A A;  5AIX A;  1SJ6 A;  2PGT A;  2VCW A;  3NIV A;  5KOW A;  2LRT A;  2C3Q A;  3FEU A;  2K8S A;  4O7H A;  3KTB A;  6GSS A;  4I5Q A;  3F8U A;  1WMJ A;  3F6F A;  1B9Y C;  1ZOF A;  5ECH B;  3I69 A;  1VGL A;  1Z9H A;  2QGV A;  2VLT A;  4WKW A;  3O6T A;  2HE3 A;  5IO0 A;  1GRX A;  1G0T A;  1GSD A;  3KCM A;  2RLI A;  1T8E B;  5CAX A;  3BCI A;  2H1D A;  4GSN A;  5G1K A;  3VWU A;  3VI7 A;  2GVP A;  3G7I A;  3H1N A;  1EV9 A;  1GSE A;  1TP9 A;  2V6O A;  3GN3 A;  2K6V A;  3VWX A;  3RBT A;  5IMZ A;  2VLU A;  1SU9 A;  4MP4 A;  3PGT A;  5H5S A;  2E7P A;  3RHB A;  4TW5 A;  4QL9 A;  2X8G A;  3IA1 A;  3PH9 A;  5CRD A;  1IYH A;  1J0F A;  1R26 A;  1WPI A;  2JZT A;  2GS3 A;  4ID0 A;  3ZYW A;  2KOK A;  5IM9 A;  19GS A;  2RM6 A;  5D9W A;  1GNW A;  3OR5 A;  3TOT A;  4BL7 B;  3H8Q A;  4EIP A;  3M8N A;  4G2E A;  2R2J A;  4KE3 A;  2FHE A;  1BQ7 A;  1T00 A;  1XWB A;  2L59 A;  4LMW A;  1TK5 B;  4KAE A;  4DSS A;  4TR1 A;  4MLY A;  1ERT A;  2R3X A;  2XBQ A;  4GST A;  1O8W A;  2A4V A;  3ZZX A;  4ICY A;  2GZP A;  2IWT A;  1FB6 A;  2B3S A;  2GSQ A;  1R4W A;  2GQM A;  2LQQ A;  3IRA A;  1JZW A;  3F4R A;  1V9W A;  2ZNM A;  1G6W A;  3C1R A;  2F8F A;  1K0O A;  4OFT A;  2WZ9 A;  4MZW A;  2B5Y A;  4K9Z A;  1PX6 A;  1E6B A;  2MBT A;  3DXB A;  2XC2 A;  3BOA A;  5D9X A;  3US3 A;  2MMZ A;  2RUE A;  3H4K A;  1MD3 A;  2KHP A;  3EPT A;  4K0G A;  1CQH A;  2H73 A;  4JU5 A;  4PXO A;  4YKF A;  3F9U A;  1I5G A;  4OFN A;  3IV4 A;  2H74 A;  2B5E A;  3QMX A;  1QFN A;  1XVQ A;  2LEG A;  4KH7 A;  3RAZ A;  2GT6 A;  4LLR A;  1BYE A;  2FCH A;  3VPQ A;  4HDE A;  3EWL A;  4NHW A;  1SJZ A;  1TOF A;  4IBP A;  2DJ3 A;  4L8E A;  1PSQ A;  5HQP A;  2BMX A;  2CQ9 A;  5ECK B;  2O89 A;  4QL7 A;  4K7O A;  5DJM A;  1I9D A;  2HFD A;  4I8B A;  3QFA C;  3FK8 A;  2H30 A;  2H71 A;  3DGQ A;  3GL3 A;  2H6Z A;  2XPE A;  1YF1 A;  5G30 A;  2HSH A;  5GZZ B;  5ECM B;  2PWJ A;  5D96 A;  1AQX A;  4XS6 A;  2H76 A;  5CRH A;  2HT9 A;  3J7Y k;  1TKD B;  4MH3 A;  3TUE A;  3W8J A;  3HHV A;  4PX1 A;  4V2L A;  5DCH A;  1JLV A;  2A2P A;  5G31 A;  1Z5Y E;  4POM A;  2IMK A;  2GST A;  3BBY A;  5DQY A;  4K2D A;  5IMD A;  4BVY A;  2QSI A;  3EU4 A;  2OKA A;  1THX A;  3L0H A;  2DJJ A;  4DSQ A;  1OE8 A;  1GTA A;  3FYG A;  1XZO A;  3FR3 A;  3O76 A;  4HZ2 A;  4RUV A;  4NHZ A;  5CRW A;  3NZN A;  4EUY A;  2DBC A;  3LSZ A;  4GRF A;  1V98 A;  2KP1 A;  4DSS B;  4QQ7 A;  1K0A A;  3ZIJ A;  4ZL9 A;  3LQ7 A;  3ME7 A;  5HFG A;  1S3D A;  4K2X A;  2I81 A;  1BED A;  3DWV A;  13GS A;  2MMN A;  4YQU A;  1ZMA A;  2H8L A;  2LJK A;  1WP0 A;  4G0K A;  3D4T A;  2Z9S A;  1A8Y A;  2HNL A;  1A8L A;  5GAN D;  2F9S A;  3IXR A;  3QD9 A;  1U3I A;  3KM6 A;  3CSJ A;  2X64 A;  5FHI A;  5GST A;  4KCE A;  1JZO A;  2R0G A;  3RHC A;  2NDO A;  3A5W A;  4OFM A;  3TKQ A;  3FZ9 A;  4TRX A;  1VF2 A;  5COH A;  1OC9 B;  2C4J A;  2GZZ A;  5ECL B;  1MEK A;  1MDJ A;  3UAR A;  1SK1 A;  3A2W A;  3S9F A;  4GWR A;  4MZC A;  1TRS A;  4V1A g;  5KN2 A;  3I43 A;  4Q5F A;  3A2X A;  1DE2 A;  2OE0 A;  4K5R A;  2VCZ A;  3GSS A;  2CZ2 A;  2A4H A;  4O5Q A;  4IJI A;  1SKR B;  3MSZ A;  3ZIV A;  4IGJ A;  4GQC A;  4L0U A;  3C73 A;  4F0B A;  4EKZ A;  3J7Y b;  2L4Q A;  5CRG A;  2YWI A;  1R5A A;  2FY6 A;  2CT6 A;  3EMP A;  3L9S A;  2X99 A;  1EOG A;  4AF2 A;  1X0R A;  5HR1 A;  1TK8 B;  4HJ2 A;  1GP1 A;  2YV7 A;  3GKK A;  4X43 A;  1WWJ A;  4FYB A;  3GUS A;  4X1U A;  5EL8 A;  4PNG A;  3CMI A;  1FB0 A;  1ML6 A;  2HRN A;  2CZ3 A;  5ELA A;  4O5R A;  4E8E A;  3DD3 A;  5J9C A;  3F3Q A;  5AIS A;  2H1A A;  2HI7 A;  2H0G A;  4RI7 A;  4WXT A;  3FW2 A;  2ON7 A;  3HXS A;  1C72 A;  4GQF A;  3TOU A;  1JFU A;  1T1V A;  4WEY A;  2VIM A;  3JCM L;  1Z6N A;  3F3R A;  3CXG A;  3UBL A;  4PQ1 A;  5DDL A;  2YZU A;  1QK8 A;  3ISO A;  1PKZ A;  3I6A A;  2YAN A;  2RII A;  3GRX A;  3NOF A;  3M9K A;  1TRU A;  1WJK A;  2VM2 A;  4BL7 A;  2REM A;  3CTG A;  3M0F A;  3GH9 A;  5J9B A;  2C0G A;  3VLN A;  5IMF A;  16GS A;  4Q5N A;  4OCF A;  3MYD A;  3QAW A;  2E2M A;  5DAK A;  3VPT A;  4TXO A;  2B1L A;  2OE1 A;  1WRY A;  3D22 A;  4TR4 A;  3KP9 A;  3ERG A;  5F07 A;  3IHG A;  2FUG 2;  5IOW A;  10GS A;  1GUK A;  2LNS A;  1GL8 A;  1EGO A;  6GSX A;  4CHS A;  4P3Y B;  3HZ4 A;  1U3A A;  3GHA A;  1WOU A;  4J2F A;  1XVW A;  2FA4 A;  2FWH A;  2ZUP A;  1GNE A;  3FZ5 A;  3KEB A;  4O5U A;  2VL2 C;  4WR5 A;  4BWQ A;  1X9S B;  2H1G A;  2EC4 A;  3TB2 A;  14GS A;  1FOH A;  2P0G A;  4POL A;  1TRV A;  2WDU A;  1XCC A;  4CY8 A;  2DKH A;  3IOS A;  4PGT A;  2P5Q A;  1ZYP A;  4JZQ A;  4OCE A;  2VCV A;  6GSU A;  5ECQ B;  2IMI A;  5J3R A;  4KDY A;  1KBN A;  4MA9 A;  1TU7 A;  3LYK A;  3GA4 A;  3F63 A;  5D8I A;  2LST A;  4KDX A;  5G1L A;  2M80 A;  2WUL A;  2JZS A;  2N5A A;  2DML A;  1JZR A;  1YQ1 A;  3VUR A;  3A2V A;  4Z2R A;  1K0B A;  3V1W A;  4XS1 A;  4EE0 A;  2DMM A;  1WIK A;  4F03 A;  4TXV A;  1K3O A;  3P90 A;  3HD5 A;  2AHE A;  1TK0 B;  4ZB8 A;  2DJK A;  2H75 A;  4Z2T A;  1PGT A;  1Q4J A;  3MDK A;  4KND A;  1PMT A;  4AGS A;  2KP2 A;  4FYU A;  2CAI A;  2IPA A;  4MZB A;  3N5O A;  1UVZ A;  5J4U A;  2NVL A;  5HFK A;  5ID2 A;  2MMO A;  3M9J A;  3KXO A;  1M9B A;  2LRN A;  2PVO C;  1EOH A;  3IDV A;  3BJ5 A;  2M46 A;  1V57 A;  4EC0 A;  5AN1 A;  4RQR A;  4J56 E;  2N5B A;  5BMU A;  4IQ1 A;  4HQS A;  3APQ A;  4OMV A;  4PQH A;  1JLW A;  4F2I A;  4I2U A;  2DIZ A;  2KUC A;  3N9J A;  2C80 A;  3HYP A;  4KSO A;  4EDZ A;  3UEM A;  1ZCP A;  8GSS A;  4N30 A;  2X8C A;  1B4Q A;  4XRD A;  3VK9 A;  2K18 A;  2JAC A;  3TJJ A;  1G6Y A;  4YQV A;  3RPN A;  5DAK B;  2CAQ A;  4IHU A;  3K8N A;  3ZFB A;  2YWM A;  3ZMK A;  4PNF A;  1G7E A;  4ML1 A;  4TXO B;  4ZB9 A;  3TKR A;  2R5G A;  4JR4 A;  4HEA 2;  4LL1 B;  3EU3 A;  5DBQ A;  3LEF A;  1PD2 1;  2H0I A;  3CBU A;  5INY A;  2IIY A;  5H5R A;  2HZF A;  2IMF A;  5D9T A;  2H70 A;  2FD3 A;  4D73 A;  1OKT A;  3ZL5 A;  1T3B A;  4MJC A;  4FO5 A;  1GTI A;  3GYK A;  1AAZ A;  2JAD A;  2WB9 A;  2LQO A;  3ZML A;  3W8S A;  2LJA A;  1SD9 A;  3KP8 A;  3L9V A;  1OC9 A;  5HFI A;  3HVS A;  3ZTL A;  1A23 A;  2GQL A;  5FWG A;  4KX4 A;  4MF5 A;  1ZGN A;  1VF4 A;  2VL3 A;  2HRF A;  5FT3 A;  3DIE A;  1J9B A;  3H93 A;  4LMV A;  4NXI A;  3KJY A;  2O8V B;  1X5C A;  2C3N A;  3C71 A;  1H4O A;  2YZH A;  1A0R P;  2R6K A;  1VF3 A;  4IP1 A;  3HA9 A;  4K0N A;  2G0F A;  2C0F A;  3P8W A;  4POB A;  3HJO A;  1ST9 A;  2AAW A;  3L4N A;  1Z3E A;  2R0C A;  5KEJ A;  2PBJ A;  4LL4 B;  5D9V A;  1XFL A;  2L5L A;  4YAP A;  2MZC A;  5KOX A;  4V2M A;  3C7M A;  4ML6 A;  4X4J A;  1F2E A;  2UZ8 A;  1USB A;  1OAZ A;  4JR6 A;  3LGC A;  2G2Q A;  1R7H A;  3TRX A;  3DYR A;  2CA8 A;  1EV4 A;  2L6D A;  2LNT A;  4O92 A;  3UAP A;  4HQZ A;  2QA2 A;  4DSR A;  1X5D A;  2C3T A;  4ZB6 A;  3LW9 A;  3UVT A;  5CNW A;  1QXH A;  5ID2 B;  4MMM A;  3QAG A;  2TRC P;  2WS2 A;  1XOA A;  5ABR A;  4G19 A;  3HJP A;  1G7O A;  3FZA A;  4F9Z A;  1UN2 A;  2O85 A;  3KZQ A;  3ZVJ D;  2HRK A;  5A4U A;  2VAF A;  1SL2 B;  2EIQ A;  1R5P A;  3IBH A;  1HNB A;  2DJ1 A;  4WF5 A;  3GMF A;  1FO5 A;  5HR2 A;  2AYT A;  4ISD A;  4F0C A;  4WBJ A;  2K8V A;  2PMT A;  3I9V 2;  5G2Z A;  2F3M A;  1ZZY A;  3E3E A;  1HQO A;  1FG4 A;  3EIN A;  4K7N A;  2GZY A;  3ME8 A;  2A2S A;  2FLS A;  3UVH A;  4NMU A;  2E0Q A;  5DJL A;  1GH2 A;  3IPZ A;  5IPH A;  2VO4 A;  2VL2 A;  1O8X A;  1NSW A;  2FWE A;  4KUN A;  3CTF A;  3E0U A;  1PX7 A;  3CRT A;  4G9H A;  1A24 A;  1XWG A;  3SBC A;  2DC5 A;  5D73 A;  3FR9 A;  1ACV A;  2IME A;  3DVW A;  1TRW A;  4D73 B;  4OWY A;  2OAC A;  2HRA A;  1TJD A;  3R3E A;  1GWC A;  4K1F A;  1UC7 A;  2OAD A;  4TR0 A;  5G5E A;  4YQM A;  2GDR A;  5E59 A;  1GUH A;  2IL3 A;  5AGY A;  5JWR B;  2LJR A;  2OJL A;  2H0H A;  2YWN A;  5ENU A;  3EE2 A;  4XTS A;  4GXZ A;  2ON5 A;  3WT2 A;  9GSS A;  1OYJ A;  3TJB A;  1X5E A;  2H6Y A;  4G0L A;  1QMV A;  1PKW A;  1SYR A;  4Z7X A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...