2H74A

Crystal structure of thioredoxin mutant d2e in hexagonal (p61) space group
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
108
structure length
108
Chain Sequence
SEKIIHLTDDSFDTDVLKADGAILVDFWAEWCGPCKMIAPILDEIADEYQGKLTVAKLNIDQNPGTAPKYGIRGIPTLLLFKNGEVAATKVGALSKGQLKEFLDANLA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Thioredoxin
publication title Crystal Structure of Thioredoxin Mutant D2E in Hexagonal (p61) Space Group
rcsb
source organism Escherichia coli
molecule tags Electron transport
total genus 30
structure length 108
sequence length 108
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-06-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00085 Thioredoxin Thioredoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 2h74A00
1GSEA 2NVLA 2B5EA 2C0DA 2IJYA 3GHAA 3RAZA 2BMXA 1MD4A 2O85A 2VD1A 3WGEA 2DLXA 5ABRA 1GTUA 1AIUA 1FAAA 3GL3A 3L9SA 1A2JA 3GMFA 4XRAA 2FGXA 4MF6A 4FYUA 4RQRA 2C0FA 3E9JB 3O76A 1Z5YE 3A2WA 1T7PB 4D73B 2P31A 5J41A 4HZ4A 3IAM2 1SD9A 1AQWA 4MH3A 3IA1A 2VL2C 1SJZA 4TW5A 5ECPB 2HZFA 4DEJA 3ZFLA 4WR5A 4NWYA 1FW1A 4GCIA 1MEKA 1SK1A 4MZWA 5HR0A 1NM3A 2H1BA 1TKDB 1XPVA 5CP1A 7GSSA 1JHBA 5E4WA 3BBYA 2K8VA 1T00A 2YWMA 1JZDA 2GS3A 2FA8A 2NTOA 2LKUA 3TKRA 4XS1A 3F8UA 4J2FA 2K8SA 3IC4A 2EIOA 4HQSA 3FR3A 3BD2A 4ZXGA 2FWHA 3TKQA 2DBCA 4GF0A 4EE0A 3G9BA 4O5RA 3L9UA 4AJ7A 3GH6A 2HZEB 5D9TA 3UBKA 4WBRD 1ACVA 3PINA 3R2QA 2X64A 2PVQA 1OKDA 5G5FA 2FD3A 1FVKA 2FLSA 2AYTA 1TW9A 4K0NA 5CRWA 1ERTA 5IMDA 3FRCA 3GKNA 2WFCA 1QGVA 5DALB 4GWRA 4TN8A 4XRDA 1SU9A 3GKKA 2ZUPA 3QCPA 4XS4A 2XBIA 3TJBA 2HT9A 11GSA 4WF4A 3E3EA 2WGRA 2H30A 2OA7A 3RDWA 1ST9A 1EV4A 2QC7A 1YJ6A 5HFIA 2NDOA 4ISDA 1TU8A 3M0FA 4TR4A 5INYA 1BX9A 9GSSA 1GNWA 2JL4A 5COHA 1KEBA 2YP6A 5D9XA 4RI7A 4O7HA 4ZB6A 8GSSA 1H4OA 4OD7A 4MMMA 1PA3A 3D22A 3HJPA 3A2VA 1S3DA 3UVTA 5A4WA 3ERGA 4ML1A 3BOAA 4EDYA 5F8BA 3LJRA 1T4ZA 1K0CA 4KE3A 2AV4A 4Z7XA 4IVFA 3TJJA 1JZRA 5EL8A 2JZRA 1TRUA 1XWKA 5ECQB 5J9CA 1V58A 1O85A 1K3LA 4F2IA 2E2GA 2R37A 2O7KA 5CAXA 2PPTA 2EIRA 2WZ9A 1OVNA 4OCEA 5A5KA 16GSA 4EKZA 2I9HA 1PD21 12GSA 5KN0A 2AB6A 3VPTA 3KTBA 4TVEA 1A2LA 4XTSA 2CT6A 1WIKA 3VLNA 4GXZA 4WR4A 2VLVA 4KSMA 1SKSB 1S3CA 2LRCA 4EO3A 2P5RA 3GRXA 1X5DA 5ECMB 1N2AA 2M72A 3APSA 3GURA 4Q5NA 1W89A 4ZILA 2CV4A 3PH9A 3C7MA 3EMPA 2OBKA 1PRXA 4GSTA 1OC9A 4IJ3A 4ZL7A 1DBYA 2ZCTA 3BCKA 1WJKA 4IKHA 1ERWA 1EP7A 1GTIA 4L5OA 4I5QA 3KH7A 1LBKA 2LQOA 1XW9A 4JZQA 3HKRA 2DJJA 3GIXA 3EU4A 2X99A 5F06A 2GT6A 1ZGNA 2DMLA 3NZNA 2H8LA 3ED3A 3P90A 3UOMA 1HQOA 1GTAA 2YZUA 2KHPA 3KXOA 3OR5A 1O6JA 1ON4A 5IMCA 1OAZA 4N0VA 3WGXA 1JLWA 2FCHA 1TK0B 1YZXA 5E59A 4POLA 2B1LA 3O6TA 5DAKA 1ZZYA 2L4CA 2L6DA 1V98A 1SENA 4I6XA 4RI6A 2MMNA 2RM5A 2MBTA 3A3TA 3HJOA 3UARA 1B4PA 2PGTA 1HD2A 1ABAA 4XCSA 2REMA 1QXHA 2HFDA 2LSTA 5DCGA 4N10A 3KM6A 4ZIJA 1XW6A 1B9YC 3EU3A 3G7YA 3TJGA 3L4NA 4CHSA 5G1LA 3D6IA 5HR1A 1XOAA 3GYKA 4YQVA 1BAYA 2C1YA 2XBQA 2IMFA 1QFNA 1GSQA 1JLVA 1O7UA 4IN0A 5HFGA 4L5LA 1F37A 4TXOB 5IMZA 4K2DA 5L71A 3ZVJD 2B1KA 2IMDA 4KAEA 3CBUA 1BJXA 4DSSB 1AQXA 2I4AA 3UVHA 5FWGA 4AJ6A 3ZFBA 1CQHA 4LL1B 1ML6A 2PMTA 1TRSA 2VL3A 1XVQA 1K0DA 3IOSA 4K8MA 1K3YA 2CA8A 1A0FA 4NHZA 4YAPA 2JSYA 2GQMA 3GKMA 3NOFA 5IQYA 1XW5A 2LNTA 2HNLA 3BJ5A 2MBSA 2L59A 3VI7A 6GSUA 4KGIA 4F03A 5H5RA 5F0GA 2LRTA 2VM2A 4WETA 2MYGA 3GSSA 1AC1A 4QL7A 1J0FA 3DVXA 2DIZA 3ZMKA 1G0TA 4HQZA 3DKSA 4ECCA 1B8XA 2C4JA 2F8AA 3FZAA 3VWXA 5ELGA 1XWCA 2R3XA 2IMEA 4ECBA 5G5EA 3TRPA 2L4QA 2DJKA 2YANA 4D73A 4ID0A 3KMOA 2VL9A 1U87A 4ECIA 3LG6A 1T3BA 4GQFA 1XZOA 1EZKA 3APOA 3WD6A 2M46A 2BJXA 4FYBA 2YWOA 1TI1A 3KJYA 4MLYA 2E2MA 5F05A 3M8NA 2PERA 1EEMA 2LJKA 3PR8A 3LEFA 1QQ2A 1A24A 4HUAA 2VCTA 4L0WA 3TUEA 2DJ0A 5KN2A 3F4TA 3C71A 4TR0A 1BYEA 3CRUA 2IMKA 5CNWA 1Q98A 5GAND 3GA4A 5ECLB 20GSA 5D73A 2CVKA 2QGVA 4LL4B 4OMVA 1XWBA 1GUHA 4KUNA 5FT3A 2GTUA 1J9BA 4KA0A 3CTFA 1THXA 2G2QA 2VUPA 5HQPA 2HZEA 3GTUB 4GTUA 3TKSE 2H0GA 1QUWA 2D2ZA 3ZYWA 1HYUA 5LCZA 2H0HA 1YY7A 1MD3A 3ERWA 3UEMA 5GSTA 1ERVA 3KP9A 1PKWA 1O8XA 4EXJA 3EURA 3IPZA 1VF4A 3F63A 5DALA 1TXXA 5J5NA 4ZBAA 2XHFA 4X43A 2J23A 2H6YA 2IN3A 1MDIA 3HVSA 2YJHA 1U88A 4HEA2 4QQ7A 1K0BA 3E0UA 5AIVA 1NHYA 1G6YA 2CVBA 1M9BA 5DBQA 3KIJA 4ULXA 1M7TA 3GV1A 4JU5A 1GSUA 1X9WB 2VD0A 3CSHA 1HNAA 3DRNA 3CSJA 5ECKB 1GLQA 2PVOC 1FO5A 4BA7A 3EYTA 1TTZA 2QSIA 5CRDA 2X8HA 3F6FA 3MAKA 4OO4A 4EVMA 2PN8A 4MF7A 1KBNA 5JWOB 4YH2A 3AY8A 4OCFA 1WMJA 1SKRB 1A8LA 2OACA 2HRNA 1V40A 3EINA 2RLIA 1TU7A 3VURA 4KX4A 2GZPA 4GRFA 1PN9A 3CMIA 4JR4A 1UVZA 3L9VA 1SJIA 1V57A 4KNDA 3I69A 4WKWA 2GQLA 1EV9A 4OFTA 2ON5A 3QR6A 13GSA 1URMA 5ECHB 1VRSD 2YV7A 5KEJA 4PUAA 3MNGA 5A4UA 2GSTA 2B5YA 4KSOA 2PBJA 1AAZA 3W6GA 1Z6MA 5ID2B 1WP0A 3ISOA 2YOIA 4MPFA 3FR6A 3H79A 3FR9A 2L5OA 2HYXA 3HVVA 5DVBA 2VCZA 4GLTA 3VWUA 1FB0A 4X0XA 3IHQA 3NIVA 2RM6A 1HNCA 2ES7A 4HDEA 4I2TA 3CYNA 4DVCA 1A0RP 3QOUA 5B6MA 3S9FA 3QFBC 2PWJA 1YKCA 1GP1A 4IP6A 1M2BA 1F3AA 2C8UA 4NPBA 3KMNA 4TOPA 5J4UA 5ECSA 2GT5A 4MP4A 2H0IA 2YN1A 3HHVA 1M0UA 3APQA 1GL8A 3IR4A 3EWLA 4JR6A 2X8GA 2JZTA 4MJBA 3HDCA 3BCIA 2P0GA 2FA4A 3VI5A 2B3SA 3DWVA 1R5PA 4IQAA 1OC3A 2CX4A 4P3YB 5ECOB 2TIRA 4JBBA 3TCOA 1DUGA 4OWYA 6GSSA 3KH9A 1R5AA 4V2NA 2ALBA 4IS0A 1F2EA 3F4SA 3FKFA 2H75A 4MJCA 1AW9A 3HZ4A 2O8VB 4MJEA 4GSSA 2VM1A 1YDKA 5IO2A 4EDZA 1XFLA 4K6XA 2B7JA 1RW1A 3US3A 2C0EA 2RIIA 1GUMA 3HZ8A 3FEUA 1B48A 3HA9A 3UMAA 2YZHA 1CQGA 2L6CA 5IOXA 1M99A 2JSZA 2C0GA 2H01A 2VL2A 1WWJA 2CZ2A 1GSSA 4KW6A 4FYCA 4YQMA 2YNXA 5G2ZA 1XCCA 1EGRA 5ECNB 3CRTA 5DJMA 4EUYA 2OJLA 4TRXA 4AGSA 4GQCA 3TRQA 5D9VA 3P8WA 4BVXA 5B6NA 2BTOT 3LYKA 1G7EA 4V2MA 3LXTA 2DJ1A 3M3MA 2GVPA 2MMAA 2IIYA 1NHOA 6GSVA 4L8EA 1PKZA 1UA5A 2A4VA 5B8BA 3M9KA 2HI7A 4V1Ag 4Q5RA 3J7Yk 2CAQA 2YV9A 4X1UA 1F9MA 2LJAA 4F9ZA 2IL3A 2R2JA 4TXOA 5AGYA 3TOUA 3IV4A 4DSSA 2LTKA 1IYHA 1GH2A 2MMOA 3H1NA 5D8IA 3KCMA 1SJ6A 3KP8A 1RK4A 3LORA 1XIYA 2C3QA 2NPBA 4LA1A 3U6VA 2Z9SA 3WT1A 2H1AA 1PL1A 3TDGA 2FWGA 4MPGA 4LMVA 4WEYA 3ZZXA 2I3YA 3LGCA 2JADA 1R7HA 3H93A 3GUSA 2AAWA 2YCDA 3QPMA 5JWRB 2L57A 1GWCA 2VLTA 3VFIA 1EGOA 3HCZA 1GNEA 2DMMA 5GZZB 4KDUA 1HNBA 1TRVA 1XVWA 5LNKe 2LQQA 4N0ZA 3HYPA 5HR2A 4PQHA 1F3BA 2IFQB 1GSFA 4G2EA 3P7XA 2FUG2 2V1MA 1EOHA 5B8AA 3QDNA 4YAVA 1YKAA 6GSXA 1MDKA 2VCWA 1PMTA 4LLRA 1E2YA 4EC0A 3RPPA 4G19A 3ERFA 3VK9A 1ZOFA 5JCGA 2HRFA 3CTGA 1JFUA 2OADA 1Z7RA 5EVOA 1K0OA 3DXBA 4MK3A 4PXOA 4YQUA 3M9JA 1PGTA 1YF0A 4TR1B 5IMFA 2OE3A 4HJ2A 3P2AA 2LS5A 4DSQA 2PU9C 3EVIA 1XWAA 4HI7A 5B7CA 1OE8A 2I81A 1FG4A 5AISA 1ILOA 1SD8A 3FW2A 1SKWB 3WGDA 3W8JA 1TP9A 3IBHA 4IBPA 4J56E 5ECRB 1QMVA 5IO0A 4NAXA 1EP8A 1FHEA 4POMA 2O89A 1T4YA 3FYGA 1T8EB 2AJQB 3DD3A 3KTLA 3A2XA 2PUKC 3GL5A 3HXSA 4HJMA 1F6MC 4HU9A 2DIYA 4PNFA 18GSA 4G10A 3GTUA 4I2UA 4ZL9A 2F9SA 4IHUA 1EEJA 3DYRA 5HFKA 2OBIA 4MCUA 3CSIA 3F6DA 1A23A 3QAGA 5LD0A 1M2DA 2K9FA 3HJMA 4KDXA 5CREA 1H75A 5EPFA 2IMIA 3CXGA 5ECIB 4TR3A 3UBLA 1PX7A 3GSTA 5AIXA 1WOUA 1DSBA 4RUVA 1QK8A 2H76A 4CW9A 3H8QA 1NSWA 3HVXA 2DJ2A 2JZSA 3EC3A 2MMZA 5DQSA 2E0QA 3FHKA 1PX6A 2IWTA 4FIWA 4MJAA 4LMWA 4IQ1A 1JZWA 1FVJA 2WULA 2ZNMA 3WT2A 1EOGA 2HSYA 3W8SA 2FWFA 3KGKA 2R5GA 3MSZA 3TB2A 4PX1A 2DSAA 3UIWA 2V41A 1U6TA 1VGLA 2LEGA 5D93A 1YEXA 3TOTA 2A2RA 4E8HA 1TK8B 4V2LA 2VAFA 2CAIA 3LWAA 4JE1A 4TXVA 1TJDA 4NXIA 4AJ8A 3IK7A 3IDVA 5C00A 4BWQA 3F3RA 1I9DA 2N5AA 1Z3EA 2QKEA 6GSWA 1YQ1A 2VO4A 2GSRA 3G7JA 3TKPA 2F8FA 4IGJA 2GQKA 3DGQA 2M80A 3I43A 4POKA 1ZCPA 5CO3A 5ID2A 4L0UA 2E7PA 2DC5A 3QAVA 5EY6A 1TOFA 1X9SB 3TJKA 3FZ5A 2IPAA 2XPDA 2R6KA 3O3TA 3IK9A 1ZL9A 1K0NA 2JACA 1SL1B 2CX3A 2JU5A 2FWEA 4CDOA 1WE0A 3L0HA 1SYRA 2HE3A 5IPGA 2K18A 4H86A 4EL1A 2WB9A 1VF1A 2H19A 3RHCA 4BWSA 5DQYA 2P5QA 1AQVA 6GSYA 2HSHA 2CZ3A 2OE1A 3F0IA 1EWXA 2WCIA 2AHEA 5JCWA 1GUKA 2H6ZA 4I8BA 4BL7A 1XXUA 4ZB9A 3D4MA 3Q6OA 22GSA 2EIQA 4ECJA 3RBTA 4ZL8A 3GX8A 2XC2A 4ML6A 1R4WA 2H72A 4HU7A 5J3RA 1XBSA 4TKYA 1G6WA 2VCQA 3FK8A 1G7OA 1WRYA 4K1FA 2CVDA 3TKSA 2WDUA 2GSSA 5KN3A 5J9BA 4PURA 3JCML 1KNGA 3HY2A 4V1Ap 1S3AA 3ME7A 2KUCA 2VCVA 1VF2A 1VF3A 1T1VA 2R4VA 17GSA 3H4KA 4IP1A 2HXKA 5AN1A 5HR3A 2WS2A 4E8EA 3GFKA 3M1GA 5KN1A 3Q74A 3N9JA 2B6MA 3UL3A 1M2AA 1GSYA 1E6BA 3ZREA 4N30A 4WBJA 3FY7A 3MDKA 3VWWA 2YWNA 5D96A 2GZZA 5DJLA 5IM9A 2VLUA 4I97A 4K7NA 5A4VA 5D9WA 2V6OA 1A8YA 2HLSA 1Y25A 4FH8A 2H6XA 1Y6EA 5IMVA 1B9XC 5IOWA 1GULA 2B7KA 4OO5A 4MF5A 5G1KA 3QD9A 1NW2A 4JEDA 3ZIJA 2V32A 2FY6A 5JWQB 2G0FA 3IXRA 1MDJA 3TJFA 3HD5A 4MDCA 4AF2A 3KD0A 2J9HA 1O8WA 1KTEA 1OKTA 4XS4B 3I6AA 1MTCA 1O81A 3LFLA 3Q18A 1XOBA 3IAS2 1OC8A 1BEDA 3LXZA 2LV3A 3V1WA 3TRXA 3GX0A 2RUEA 3C1RA 3SWLA 2TRXA 2FNOA 4KCEA 4MA9A 5IMAA 1YEPA 2V2GA 3ME8A 4ZB8A 1SYXA 3DEXA 2V6KA 3G7IA 10GSA 1PL2A 4OFMA 3C1SA 3TGZA 2YWIA 2OE0A 1SL2B 5JCUA 2WRTA 1V2AA 4KB3A 1X0RA 1USBA 2VOCA 4KH7A 2H70A 3KZQA 4K7OA 3ZLPA 4HOJA 1PSQA 1X5EA 5GAPD 4NHWA 4F82A 4FO5A 2F51A 3QAWA 3RPNA 2IFQA 3ZTLA 1RQMA 2C3TA 3FZ9A 1K0AA 4JRRA 5IPHA 3F3QA 4PUFC 4NV2A 3UJ1A 1O73A 4Q5QA 1UC7A 1FOVA 3ZRDA 2DJ3A 3ZITA 4POBA 1OE7A 1DE2A 3IRAA 4XIHA 1Q4JA 4MH2A 3QFAC 1GRXA 4N11A 1U3AA 3PGTA 5G30A 1TK5B 3GNJA 3DIEA 4DSRA 4XS6A 5F07A 4K9ZA 5G31A 2OKAA 2L5LA 2GDRA 2N5FA 1TI3A 2H1DA 3MWHA 3U5RE 4TR1A 3D5JA 4GSNA 2H71A 2FHEA 1M9AA 4O32A 2K6VA 5ENUA 3LYPA 2RUFA 2X8CA 3DVWA 3GN3A 3L78A 4QL9A 4O92A 3QMXA 3SBCA 1J08A 1IYIA 1WPIA 3F9UA 4OFNA 2VCXA 3ZIVA 1OC9B 1K3OA 1TRWA 3VWVA 1ZYQB 4KDYA 2WJUA 14GSA 5H5QA 1W4VA 1U3IA 2C80A 3IE3A 2EC4A 1UN2A 3FZ4A 4G9HA 1OYJA 5H5SA 1X5CA 2F3MA 3ZL5A 1N8JA 3RHBA 1Z6NA 1AUCA 2H74A 1SL0B 2H73A 1GLPA 2LUSA 2KP1A 3UAPA 4F0CA 4BPYA 2GGTA 3Q19A 4Q5FA 4ZBBA 3KEBA 3C73A 1SK0A 1GTBA 3GH9A 3F4RA 4NV5A 4K7IA 4EF0A 1Z7PA 4WF5A 4NMUA 5CRGA 5CYYA 5DAKB 1XWGA 4IW9A 5CRHA 3DMLA 1V9WA 1K0MA 2I1UA 2KOKA 2YPMA 4IELA 1AXDA 2GZYA 2H66A 2LRNA 2GLRA 1PQNA 4XHMA 4ACSA 1ZMAA 4KCAA 1FB6A 3J7Yb 3D21A 3K8NA 2LJRA 1LJRA 4MABA 5GSSA 3LQ7A 1R26A 4K0GA 5C04A 4PQIA 2AUVA 5DCHA 3A5WA 3EMXA 2VIMA 1JZOA 1SK2A 1LU4A 3D4TA 6GSTA 2B5XA 4BVYA 2ON7A 4PQ1A 3LSZA 4ZBDA 4MZCA 1YF1A 4RQXA 3TKSC 1I5GA 3ZMLA 2LNSA 2O87A 1THOA 2H1GA 1Z9HA 2KP2A 3I9V2 3N5OA 2NBSA 5ELAA 5DDLA 2C3NA 1BG5A 5FHIA 5IIZA 1DE1A 1TDIA 3WYWA 2GSQA 2YJ7A 2KLXA 1BQ7A 2A2SA 2CQ9A 4IJIA 4F0BA 2XPEA 4PNGA 1C72A 1ZYEA 4HZ2A 3C8EA 4WXTA 1B4QA 4MZBA 4HS1A 1A2MA 3EE2A 3ZVJA 2TRCP 19GSA 4J57E 2MZCA 2N5BA 1ERUA 3GKXA 1GSDA 1X9MB 3D0ZA 3VPQA 4ILFA 4PGTA
chains in the Genus database with same CATH superfamily
1GSEA 2NVLA 2B5EA 2C0DA 2IJYA 3GHAA 3RAZA 2BMXA 1MD4A 2O85A 2VD1A 3WGEA 2DLXA 5ABRA 1GTUA 1AIUA 1FAAA 3GL3A 3L9SA 1A2JA 3GMFA 4XRAA 2FGXA 4MF6A 4FYUA 4RQRA 2C0FA 4K5SA 3E9JB 3O76A 1Z5YE 3A2WA 1T7PB 4D73B 2P31A 5J41A 4HZ4A 3IAM2 1SD9A 1AQWA 4MH3A 3IA1A 2VL2C 1SJZA 4TW5A 5ECPB 2HZFA 4DEJA 3ZFLA 4WR5A 4NWYA 1FW1A 4GCIA 1MEKA 1SK1A 4MZWA 5HR0A 1NM3A 2H1BA 1TKDB 1XPVA 5CP1A 7GSSA 1JHBA 5E4WA 3BBYA 2K8VA 1T00A 2YWMA 1JZDA 2GS3A 2FA8A 2NTOA 2LKUA 3TKRA 4XS1A 3F8UA 4J2FA 2K8SA 3IC4A 2EIOA 4HQSA 3FR3A 3BD2A 4ZXGA 2FWHA 3TKQA 2DBCA 4GF0A 4EE0A 3G9BA 4O5RA 3L9UA 4AJ7A 3GH6A 2HZEB 5D9TA 3UBKA 4WBRD 1ACVA 3PINA 3R2QA 2X64A 2PVQA 1OKDA 5G5FA 2FD3A 1FVKA 2FLSA 2AYTA 1TW9A 4K0NA 5CRWA 1ERTA 5IMDA 3FRCA 3GKNA 2WFCA 1QGVA 5DALB 4GWRA 4TN8A 4XRDA 1SU9A 3GKKA 2ZUPA 3QCPA 4XS4A 2XBIA 3TJBA 2HT9A 4G0IA 4Z2UA 11GSA 4WF4A 3E3EA 2WGRA 2H30A 2OA7A 3RDWA 1ST9A 1EV4A 2QC7A 1YJ6A 5HFIA 2NDOA 4ISDA 1TU8A 3M0FA 3HVNA 4TR4A 5INYA 1BX9A 9GSSA 3MIXA 1GNWA 4K2XA 2JL4A 5COHA 1KEBA 2YP6A 5D9XA 4RI7A 4O7HA 4ZB6A 8GSSA 1H4OA 4OD7A 4MMMA 1PA3A 3D22A 3HJPA 3A2VA 1S3DA 3UVTA 5A4WA 3ERGA 4ML1A 3BOAA 4EDYA 5F8BA 3LJRA 1T4ZA 1K0CA 4KE3A 3MYDA 2A4HA 2AV4A 4Z7XA 4IVFA 3TJJA 1JZRA 5EL8A 2JZRA 1TRUA 1XWKA 5ECQB 5J9CA 1V58A 1O85A 1K3LA 4F2IA 2E2GA 2R37A 2O7KA 2QA1A 5CAXA 2PPTA 2EIRA 2WZ9A 1OVNA 4OCEA 5A5KA 16GSA 4EKZA 2I9HA 1PD21 12GSA 5KN0A 2AB6A 3VPTA 3KTBA 4TVEA 1A2LA 4XTSA 2CT6A 1WIKA 3VLNA 4GXZA 4WR4A 2VLVA 4KSMA 1SKSB 1S3CA 2LRCA 4EO3A 2P5RA 3GRXA 1X5DA 5ECMB 1N2AA 1FOHA 2M72A 4A5PA 3APSA 3GURA 4Q5NA 1W89A 4ZILA 2CV4A 3PH9A 4Z2RA 3C7MA 3EMPA 2OBKA 1PRXA 4GSTA 1OC9A 4IJ3A 4ZL7A 1DBYA 2ZCTA 3BCKA 1WJKA 4IKHA 1ERWA 1EP7A 1GTIA 4L5OA 4I5QA 3KH7A 1LBKA 2LQOA 1XW9A 4JZQA 1PFOA 3HKRA 2DJJA 3GIXA 3EU4A 2X99A 5F06A 2GT6A 1ZGNA 2DMLA 3NZNA 4CY6A 2H8LA 3ED3A 3P90A 3UOMA 1HQOA 1GTAA 2YZUA 2KHPA 3KXOA 3OR5A 1O6JA 1ON4A 5IMCA 1OAZA 4N0VA 3WGXA 1JLWA 2FCHA 1TK0B 1YZXA 5E59A 4POLA 2B1LA 3O6TA 5DAKA 1ZZYA 2L4CA 4YKGA 2L6DA 1V98A 1SENA 4I6XA 4RI6A 2MMNA 2RM5A 2MBTA 3A3TA 3HJOA 3UARA 1B4PA 2PGTA 4BVXB 1HD2A 1ABAA 4XCSA 2REMA 1QXHA 2HFDA 2LSTA 5DCGA 4N10A 3KM6A 4ZIJA 1XW6A 1B9YC 3EU3A 3G7YA 3TJGA 3L4NA 4CHSA 5G1LA 3D6IA 5HR1A 1XOAA 3GYKA 4YQVA 1BAYA 2C1YA 2XBQA 2IMFA 1QFNA 1GSQA 4KF9A 1JLVA 1O7UA 4IN0A 5HFGA 4L5LA 1F37A 4TXOB 5IMZA 4K2DA 5L71A 3ZVJD 2B1KA 2IMDA 4KAEA 3CBUA 1BJXA 4DSSB 1AQXA 2I4AA 3UVHA 5FWGA 4AJ6A 3ZFBA 1CQHA 4LL1B 1ML6A 2PMTA 1TRSA 2VL3A 1XVQA 4Z2TA 1K0DA 3IOSA 4K8MA 4ICYA 1K3YA 2CA8A 3EPTA 1A0FA 4NHZA 4YAPA 2JSYA 2GQMA 3GKMA 3NOFA 5IQYA 4YKFA 1XW5A 2LNTA 2HNLA 3BJ5A 2MBSA 2L59A 3VI7A 6GSUA 4KGIA 4F03A 5H5RA 5F0GA 2LRTA 2VM2A 4WETA 2MYGA 3GSSA 1AC1A 4QL7A 1J0FA 3DVXA 2DIZA 3ZMKA 1G0TA 4HQZA 3DKSA 4ECCA 4EIQA 1B8XA 2C4JA 2F8AA 3FZAA 3VWXA 5ELGA 1XWCA 2R3XA 2IMEA 4ECBA 5G5EA 3TRPA 2L4QA 2DJKA 2YANA 4D73A 4ID0A 3KMOA 2VL9A 1U87A 4ECIA 3LG6A 1T3BA 4GQFA 1XZOA 1EZKA 3APOA 3WD6A 2M46A 2BJXA 4FYBA 2YWOA 1TI1A 3KJYA 4MLYA 2E2MA 5F05A 3M8NA 2PERA 1EEMA 2LJKA 3PR8A 3LEFA 1QQ2A 1A24A 4HUAA 2VCTA 4L0WA 3TUEA 2DJ0A 5KN2A 3F4TA 3C71A 4TR0A 1BYEA 3CRUA 2IMKA 5CNWA 1Q98A 5GAND 3GA4A 5ECLB 20GSA 5D73A 2CVKA 2QGVA 4LL4B 4OMVA 1XWBA 1GUHA 4KUNA 5FT3A 2GTUA 1J9BA 4KA0A 4CY8A 3CTFA 1THXA 2G2QA 2VUPA 1M3IA 5HQPA 2HZEA 3GTUB 4GTUA 3TKSE 2H0GA 1QUWA 2D2ZA 3ZYWA 1HYUA 5LCZA 2H0HA 1YY7A 1MD3A 3ERWA 3UEMA 5GSTA 1ERVA 3KP9A 1PKWA 1O8XA 4EXJA 3EURA 3IPZA 1VF4A 3F63A 5DALA 1TXXA 5J5NA 4ZBAA 2XHFA 4X43A 2J23A 2H6YA 2IN3A 1MDIA 1PN0A 3HVSA 2YJHA 1U88A 4HEA2 4QQ7A 1K0BA 3E0UA 5AIVA 1NHYA 1G6YA 2CVBA 1M9BA 4HSCX 5DBQA 3KIJA 4ULXA 1M7TA 3GV1A 4JU5A 1GSUA 1X9WB 2VD0A 3CSHA 1HNAA 3DRNA 3CSJA 5ECKB 1GLQA 2QA2A 2PVOC 1FO5A 4BA7A 3EYTA 1TTZA 2QSIA 5CRDA 4G0LA 2X8HA 3F6FA 3MAKA 4OO4A 4EVMA 2PN8A 4MF7A 1KBNA 5JWOB 4YH2A 3AY8A 4OCFA 1WMJA 1SKRB 1A8LA 2OACA 2HRNA 1V40A 3EINA 2RLIA 1TU7A 3VURA 4KX4A 2GZPA 4GRFA 1PN9A 3CMIA 4JR4A 1UVZA 3L9VA 1SJIA 1V57A 4G0KA 4KNDA 3I69A 4WKWA 2GQLA 1EV9A 4OFTA 2ON5A 3QR6A 13GSA 1URMA 5ECHB 1VRSD 2YV7A 5KEJA 4PUAA 3MNGA 5A4UA 1ZYNA 2GSTA 2B5YA 4KSOA 2PBJA 1AAZA 3W6GA 1Z6MA 5ID2B 1WP0A 3ISOA 2A2PA 2YOIA 4MPFA 3FR6A 3H79A 3FR9A 2L5OA 2HYXA 3HVVA 5DVBA 2VCZA 4GLTA 3VWUA 1FB0A 4X0XA 3IHQA 3NIVA 2RM6A 1HNCA 2ES7A 4HDEA 4I2TA 4O5UA 3CYNA 4DVCA 1A0RP 3QOUA 5B6MA 3S9FA 5BRTA 3QFBC 2PWJA 1YKCA 1GP1A 4IP6A 1M2BA 1F3AA 2C8UA 4NPBA 3KMNA 4TOPA 5J4UA 5ECSA 2GT5A 4MP4A 2H0IA 2YN1A 3HHVA 1M0UA 3APQA 1GL8A 3IR4A 3EWLA 4JR6A 2X8GA 2JZTA 4BL7B 4MJBA 3HDCA 3BCIA 2P0GA 2FA4A 3VI5A 2B3SA 3DWVA 1R5PA 4IQAA 1OC3A 2CX4A 4P3YB 5ECOB 2TIRA 4JBBA 3TCOA 1DUGA 4OWYA 6GSSA 3KH9A 1R5AA 4V2NA 2ALBA 4IS0A 1F2EA 3F4SA 3FKFA 2H75A 4MJCA 1AW9A 3HZ4A 2O8VB 4MJEA 4GSSA 2VM1A 1YDKA 5IO2A 4EDZA 1XFLA 4K6XA 2B7JA 1RW1A 3US3A 2C0EA 2RIIA 1GUMA 3HZ8A 3FEUA 1B48A 3HA9A 3UMAA 2YZHA 1CQGA 2L6CA 5IOXA 1M99A 2JSZA 2C0GA 2H01A 2VL2A 1WWJA 2CZ2A 2DKIA 1GSSA 4KW6A 4FYCA 4YQMA 2YNXA 5G2ZA 2R0PA 1XCCA 1EGRA 5ECNB 3CRTA 5DJMA 4EUYA 2OJLA 4TRXA 4AGSA 4GQCA 3TRQA 5D9VA 3P8WA 4BVXA 5B6NA 2BTOT 3LYKA 4O5QA 1G7EA 4V2MA 3LXTA 2DJ1A 3M3MA 2GVPA 2MMAA 2IIYA 1NHOA 6GSVA 4L8EA 1PKZA 1UA5A 2A4VA 5B8BA 3M9KA 2HI7A 4V1Ag 4Q5RA 3J7Yk 2CAQA 2YV9A 4X1UA 1F9MA 2LJAA 4F9ZA 2IL3A 2R2JA 4TXOA 5AGYA 3TOUA 3IV4A 1S3RA 4DSSA 2LTKA 1IYHA 1GH2A 2MMOA 3H1NA 5D8IA 3KCMA 1SJ6A 3KP8A 1RK4A 3LORA 1XIYA 2DKHA 3A5IA 2C3QA 2NPBA 4LA1A 3U6VA 2Z9SA 3WT1A 2X4AA 2H1AA 1PL1A 3TDGA 2FWGA 4MPGA 4LMVA 4WEYA 3ZZXA 2I3YA 3LGCA 2JADA 1R7HA 3H93A 3GUSA 2AAWA 2YCDA 3QPMA 5JWRB 2L57A 1GWCA 2VLTA 3VFIA 1EGOA 3HCZA 1GNEA 2DMMA 5GZZB 4KDUA 1HNBA 1TRVA 1XVWA 5LNKe 2LQQA 4N0ZA 3HYPA 5HR2A 4PQHA 1F3BA 2IFQB 1GSFA 1M3JA 4G2EA 3P7XA 2FUG2 2V1MA 1EOHA 3CQFA 5B8AA 3QDNA 4YAVA 2HSMA 1YKAA 6GSXA 1MDKA 2VCWA 1PMTA 4LLRA 1E2YA 4EC0A 3RPPA 4G19A 3ERFA 3VK9A 1ZOFA 5JCGA 2HRFA 3CTGA 1JFUA 2OADA 1Z7RA 5EVOA 1K0OA 3DXBA 3IHGA 4MK3A 4PXOA 4YQUA 3M9JA 1PGTA 1YF0A 4TR1B 5IMFA 2OE3A 4HJ2A 3P2AA 2LS5A 4DSQA 2PU9C 3EVIA 1XWAA 4HI7A 5B7CA 1OE8A 2I81A 1FG4A 1ZYPA 5KOWA 5AISA 1ILOA 1SD8A 3FW2A 1SKWB 3WGDA 3W8JA 1TP9A 3IBHA 4IBPA 4J56E 5ECRB 1QMVA 5IO0A 4NAXA 1EP8A 1FHEA 4POMA 2O89A 5KOXA 1T4YA 3FYGA 1T8EB 2AJQB 3DD3A 3KTLA 3A2XA 2PUKC 3GL5A 3HXSA 4HJMA 1F6MC 4HU9A 2DIYA 4PNFA 18GSA 4G10A 3GTUA 4I2UA 4ZL9A 2F9SA 4IHUA 1EEJA 3DYRA 5HFKA 2OBIA 2R0GA 4MCUA 3CSIA 3F6DA 1A23A 3QAGA 5LD0A 1M2DA 2K9FA 3HJMA 4KDXA 5CREA 1H75A 5EPFA 2IMIA 3CXGA 5ECIB 4TR3A 3UBLA 1PX7A 3GSTA 5AIXA 1WOUA 1DSBA 4RUVA 1QK8A 2H76A 4CW9A 3H8QA 1NSWA 3HVXA 2DJ2A 2JZSA 3EC3A 2MMZA 5DQSA 2E0QA 3FHKA 1PX6A 2IWTA 4FIWA 4MJAA 4LMWA 4IQ1A 1JZWA 1FVJA 2WULA 2ZNMA 3WT2A 4BVYB 1EOGA 2HSYA 3W8SA 2FWFA 5BMUA 3KGKA 2R5GA 3MSZA 3TB2A 4PX1A 2DSAA 3UIWA 2V41A 1U6TA 1VGLA 2LEGA 5D93A 1YEXA 3TOTA 2A2RA 4E8HA 1TK8B 4V2LA 2VAFA 2CAIA 3LWAA 4USSA 4JE1A 4TXVA 1TJDA 4NXIA 4AJ8A 3IK7A 3IDVA 5C00A 4BWQA 3F3RA 1I9DA 2N5AA 1Z3EA 2HRKA 2QKEA 1YQ1A 6GSWA 2VO4A 2GSRA 3G7JA 3TKPA 2F8FA 4IGJA 2GQKA 3DGQA 2M80A 3I43A 4POKA 1ZCPA 5CO3A 5ID2A 4L0UA 2E7PA 2DC5A 3QAVA 2UZ8A 5EY6A 1TOFA 1X9SB 3TJKA 3FZ5A 2IPAA 2XPDA 2R6KA 3O3TA 3IK9A 1ZL9A 1K0NA 2JACA 1SL1B 2CX3A 2JU5A 2FWEA 4CDOA 1WE0A 3L0HA 4K5RA 1SYRA 2HE3A 5IPGA 2K18A 4H86A 4EL1A 2WB9A 1VF1A 2H19A 3RHCA 4BWSA 5DQYA 2P5QA 1AQVA 6GSYA 2HSHA 2CZ3A 2OE1A 3F0IA 1EWXA 2WCIA 2AHEA 5JCWA 1GUKA 2H6ZA 4I8BA 4BL7A 1XXUA 4ZB9A 3D4MA 3Q6OA 22GSA 2EIQA 4ECJA 3RBTA 4ZL8A 3GX8A 2XC2A 2X49A 4ML6A 1R4WA 2H72A 4HU7A 5J3RA 1XBSA 4TKYA 1G6WA 2VCQA 3FK8A 1G7OA 1WRYA 4K1FA 2CVDA 3TKSA 2WDUA 2GSSA 5KN3A 5J9BA 4PURA 3JCML 1KNGA 3HY2A 4V1Ap 1S3AA 3ME7A 2KUCA 2VCVA 1VF2A 1VF3A 1T1VA 2R4VA 17GSA 3H4KA 4IP1A 2HXKA 5AN1A 5HR3A 2WS2A 4E8EA 3GFKA 3M1GA 5KN1A 3Q74A 3N9JA 2B6MA 3UL3A 1M2AA 1GSYA 1E6BA 3ZREA 4MNNA 4N30A 3FY7A 4WBJA 2R0CA 3MDKA 3VWWA 2YWNA 5D96A 2GZZA 5DJLA 5IM9A 2VLUA 4I97A 4K7NA 5A4VA 5D9WA 2V6OA 1A8YA 2HLSA 1Y25A 4FH8A 3PPUA 2H6XA 1Y6EA 5IMVA 1B9XC 5IOWA 1GULA 2B7KA 4OO5A 4MF5A 5G1KA 3QD9A 1NW2A 4JEDA 3ZIJA 2V32A 2FY6A 5JWQB 2G0FA 3IXRA 1MDJA 3TJFA 3HD5A 4MDCA 4AF2A 3KD0A 2J9HA 1O8WA 1KTEA 1OKTA 4XS4B 3I6AA 1MTCA 1O81A 3LFLA 3Q18A 1XOBA 3IAS2 1OC8A 1BEDA 3LXZA 4BIKA 2LV3A 3V1WA 3TRXA 3GX0A 2RUEA 3C1RA 3SWLA 2TRXA 2FNOA 4KCEA 4MA9A 5IMAA 1YEPA 2V2GA 3ME8A 4ZB8A 1SYXA 3DEXA 2V6KA 3G7IA 10GSA 1PL2A 4OFMA 3LW9A 3C1SA 3TGZA 2YWIA 2OE0A 1SL2B 5JCUA 2WRTA 1V2AA 4KB3A 1X0RA 1USBA 2VOCA 4KH7A 4X4JA 2H70A 3KZQA 4K7OA 3ZLPA 4HOJA 1PSQA 4PTSA 1X5EA 5GAPD 4NHWA 4F82A 4FO5A 2F51A 3QAWA 3RPNA 2IFQA 3ZTLA 1RQMA 2C3TA 3FZ9A 1K0AA 4JRRA 5IPHA 3F3QA 4PUFC 4NV2A 3UJ1A 1O73A 4Q5QA 1UC7A 1FOVA 3ZRDA 2DJ3A 3ZITA 4POBA 2HRAA 1OE7A 1DE2A 3IRAA 4XIHA 1Q4JA 4MH2A 3QFAC 1GRXA 4N11A 1U3AA 3PGTA 5G30A 1TK5B 3GNJA 3DIEA 4DSRA 4XS6A 5F07A 4K9ZA 5G31A 2OKAA 2L5LA 2GDRA 2N5FA 1TI3A 2H1DA 3MWHA 3U5RE 4TR1A 3D5JA 4GSNA 2H71A 2FHEA 1M9AA 4O32A 2K6VA 5ENUA 3LYPA 2RUFA 2X8CA 3DVWA 3GN3A 3L78A 4QL9A 4O92A 3QMXA 3SBCA 1J08A 1IYIA 1WPIA 3F9UA 4OFNA 2VCXA 3ZIVA 1OC9B 1K3OA 1TRWA 3VWVA 1ZYQB 4KDYA 2WJUA 14GSA 5H5QA 1W4VA 3FMWA 1U3IA 2C80A 3IE3A 2EC4A 1UN2A 3FZ4A 4G9HA 1OYJA 5H5SA 1X5CA 2F3MA 3ZL5A 1N8JA 3RHBA 1Z6NA 1AUCA 2H74A 1SL0B 2H73A 1GLPA 2LUSA 2KP1A 3UAPA 4F0CA 4BPYA 2GGTA 3Q19A 4Q5FA 4ZBBA 3KEBA 3C73A 1SK0A 1GTBA 3GH9A 4EIPA 3F4RA 4NV5A 4K7IA 4EF0A 1Z7PA 4WF5A 4NMUA 5CRGA 5CYYA 5DAKB 1XWGA 4IW9A 5CRHA 3DMLA 1V9WA 1K0MA 2I1UA 2KOKA 2YPMA 4IELA 1AXDA 2GZYA 2H66A 2LRNA 2GLRA 1PQNA 4XHMA 4ACSA 1ZMAA 4KCAA 1FB6A 3J7Yb 3D21A 3K8NA 2LJRA 1LJRA 4MABA 5GSSA 3LQ7A 1R26A 4K0GA 5C04A 4PQIA 2AUVA 3A5WA 3EMXA 5DCHA 2VIMA 1JZOA 1SK2A 1LU4A 3D4TA 1XG8A 4FQUA 6GSTA 2B5XA 4BVYA 2ON7A 4PQ1A 3LSZA 4ZBDA 4MZCA 1YF1A 4RQXA 3TKSC 1I5GA 3ZMLA 2LNSA 2O87A 1THOA 2H1GA 1Z9HA 2KP2A 3I9V2 3N5OA 2NBSA 5ELAA 5DDLA 2C3NA 1BG5A 5FHIA 5IIZA 1DE1A 1TDIA 3WYWA 2GSQA 2YJ7A 3IC8A 2KLXA 1BQ7A 2A2SA 2CQ9A 4IJIA 4F0BA 2XPEA 4PNGA 3R3EA 1C72A 1ZYEA 4HZ2A 3C8EA 4WXTA 1B4QA 4MZBA 4HS1A 1A2MA 3EE2A 3ZVJA 2TRCP 19GSA 4J57E 2MZCA 2N5BA 1ERUA 3GKXA 1GSDA 1X9MB 3D0ZA 3VPQA 4ILFA 4PGTA
chains in the Genus database with same CATH topology
1GSEA 2NVLA 2B5EA 2C0DA 2IJYA 3GHAA 3RAZA 2BMXA 1MD4A 2O85A 2VD1A 3WGEA 2DLXA 5ABRA 1GTUA 1AIUA 1FAAA 3GL3A 3L9SA 1A2JA 3GMFA 4XRAA 2FGXA 4MF6A 4FYUA 4RQRA 2C0FA 4K5SA 3E9JB 3O76A 1Z5YE 3A2WA 1T7PB 4D73B 2P31A 5J41A 4HZ4A 3IAM2 1SD9A 1AQWA 4MH3A 3IA1A 2VL2C 1SJZA 4TW5A 5ECPB 2HZFA 4DEJA 3ZFLA 4WR5A 4NWYA 1FW1A 4GCIA 1MEKA 1SK1A 4MZWA 5HR0A 1NM3A 2H1BA 1TKDB 1XPVA 5CP1A 7GSSA 1JHBA 5E4WA 3BBYA 2K8VA 1T00A 2YWMA 1JZDA 2GS3A 2FA8A 2NTOA 2LKUA 3TKRA 4XS1A 3F8UA 4J2FA 2K8SA 3IC4A 2EIOA 4HQSA 3FR3A 3BD2A 4ZXGA 2FWHA 3TKQA 2DBCA 4GF0A 4EE0A 3G9BA 4O5RA 3L9UA 4AJ7A 3GH6A 2HZEB 5D9TA 3UBKA 4WBRD 1ACVA 3PINA 3R2QA 2X64A 2PVQA 1OKDA 5G5FA 2FD3A 1FVKA 2FLSA 2AYTA 1TW9A 4K0NA 5CRWA 1ERTA 5IMDA 3FRCA 3GKNA 2WFCA 1QGVA 5DALB 4GWRA 4TN8A 4XRDA 1SU9A 3GKKA 2ZUPA 3QCPA 4XS4A 2XBIA 3TJBA 2HT9A 4G0IA 4Z2UA 11GSA 4WF4A 3E3EA 2WGRA 2H30A 2OA7A 3RDWA 1ST9A 1EV4A 2QC7A 1YJ6A 5HFIA 2NDOA 4ISDA 1TU8A 3M0FA 4TR4A 5INYA 1BX9A 9GSSA 3MIXA 1GNWA 4K2XA 2JL4A 5COHA 1KEBA 2YP6A 5D9XA 4RI7A 4O7HA 4ZB6A 8GSSA 1H4OA 4OD7A 4MMMA 1PA3A 3D22A 3HJPA 3A2VA 1S3DA 3UVTA 5A4WA 3ERGA 4ML1A 3BOAA 4EDYA 5F8BA 3LJRA 1T4ZA 1K0CA 4KE3A 3MYDA 2A4HA 2AV4A 4Z7XA 4IVFA 3TJJA 1JZRA 5EL8A 2JZRA 1TRUA 1XWKA 5ECQB 5J9CA 1V58A 1O85A 1K3LA 4F2IA 2E2GA 2R37A 2O7KA 2QA1A 5CAXA 2PPTA 2EIRA 2WZ9A 1OVNA 4OCEA 5A5KA 16GSA 4EKZA 2I9HA 1PD21 12GSA 5KN0A 2AB6A 3VPTA 3KTBA 4TVEA 1A2LA 4XTSA 2CT6A 1WIKA 3VLNA 4GXZA 4WR4A 2VLVA 4KSMA 1SKSB 1S3CA 2LRCA 4EO3A 2P5RA 3GRXA 1X5DA 5ECMB 1N2AA 1FOHA 2M72A 4A5PA 3APSA 3GURA 4Q5NA 1W89A 4ZILA 2CV4A 3PH9A 4Z2RA 3C7MA 3EMPA 2OBKA 1PRXA 4GSTA 1OC9A 4IJ3A 4ZL7A 1DBYA 2ZCTA 3BCKA 1WJKA 4IKHA 1ERWA 1EP7A 1GTIA 4L5OA 4I5QA 3KH7A 1LBKA 2LQOA 1XW9A 4JZQA 3HKRA 2DJJA 3GIXA 3EU4A 2X99A 5F06A 2GT6A 1ZGNA 2DMLA 3NZNA 4CY6A 2H8LA 3ED3A 3P90A 3UOMA 1HQOA 1GTAA 2YZUA 2KHPA 3KXOA 3OR5A 1O6JA 1ON4A 5IMCA 1OAZA 4N0VA 3WGXA 1JLWA 2FCHA 1TK0B 1YZXA 5E59A 4POLA 2B1LA 3O6TA 5DAKA 1ZZYA 2L4CA 4YKGA 2L6DA 1V98A 1SENA 4I6XA 4RI6A 2MMNA 2RM5A 2MBTA 3A3TA 3HJOA 3UARA 1B4PA 2PGTA 4BVXB 1HD2A 1ABAA 4XCSA 2REMA 1QXHA 2HFDA 2LSTA 5DCGA 4N10A 3KM6A 4ZIJA 1XW6A 1B9YC 3EU3A 3G7YA 3TJGA 3L4NA 4CHSA 5G1LA 3D6IA 5HR1A 1XOAA 3GYKA 4YQVA 1BAYA 2C1YA 2XBQA 2IMFA 1QFNA 1GSQA 4KF9A 1JLVA 1O7UA 4IN0A 5HFGA 4L5LA 1F37A 4TXOB 5IMZA 4K2DA 5L71A 3ZVJD 2B1KA 2IMDA 4KAEA 3CBUA 1BJXA 4DSSB 1AQXA 2I4AA 3UVHA 5FWGA 4AJ6A 3ZFBA 1CQHA 4LL1B 1ML6A 2PMTA 1TRSA 2VL3A 1XVQA 4Z2TA 1K0DA 3IOSA 4K8MA 4ICYA 1K3YA 2CA8A 3EPTA 1A0FA 4NHZA 4YAPA 2JSYA 2GQMA 3GKMA 3NOFA 5IQYA 4YKFA 1XW5A 2LNTA 2HNLA 3BJ5A 2MBSA 2L59A 3VI7A 6GSUA 4KGIA 4F03A 5H5RA 5F0GA 2LRTA 2VM2A 4WETA 2MYGA 3GSSA 1AC1A 4QL7A 1J0FA 3DVXA 2DIZA 3ZMKA 1G0TA 4HQZA 3DKSA 4ECCA 4EIQA 1B8XA 2C4JA 2F8AA 3FZAA 3VWXA 5ELGA 1XWCA 2R3XA 2IMEA 4ECBA 5G5EA 3TRPA 2L4QA 2DJKA 2YANA 4D73A 4ID0A 3KMOA 2VL9A 1U87A 4ECIA 3LG6A 1T3BA 4GQFA 1XZOA 1EZKA 3APOA 3WD6A 2M46A 2BJXA 4FYBA 2YWOA 1TI1A 3KJYA 4MLYA 2E2MA 5F05A 3M8NA 2PERA 1EEMA 2LJKA 3PR8A 3LEFA 1QQ2A 1A24A 4HUAA 2VCTA 4L0WA 3TUEA 2DJ0A 5KN2A 3F4TA 3C71A 4TR0A 1BYEA 3CRUA 2IMKA 5CNWA 1Q98A 5GAND 3GA4A 5ECLB 20GSA 5D73A 2CVKA 2QGVA 4LL4B 4OMVA 1XWBA 1GUHA 4KUNA 5FT3A 2GTUA 1J9BA 4KA0A 4CY8A 3CTFA 1THXA 2G2QA 2VUPA 5HQPA 2HZEA 3GTUB 4GTUA 3TKSE 2H0GA 1QUWA 2D2ZA 3ZYWA 1HYUA 5LCZA 2H0HA 1YY7A 1MD3A 3ERWA 3UEMA 5GSTA 1ERVA 3KP9A 1PKWA 1O8XA 4EXJA 3EURA 3IPZA 1VF4A 3F63A 5DALA 1TXXA 5J5NA 4ZBAA 2XHFA 4X43A 2J23A 2H6YA 2IN3A 1MDIA 1PN0A 3HVSA 2YJHA 1U88A 4HEA2 4QQ7A 1K0BA 3E0UA 5AIVA 1NHYA 1G6YA 2CVBA 1M9BA 5DBQA 3KIJA 4ULXA 1M7TA 3GV1A 4JU5A 1GSUA 1X9WB 2VD0A 3CSHA 1HNAA 3DRNA 3CSJA 5ECKB 1GLQA 2QA2A 2PVOC 1FO5A 4BA7A 3EYTA 1TTZA 2QSIA 5CRDA 4G0LA 2X8HA 3F6FA 3MAKA 4OO4A 4EVMA 2PN8A 4MF7A 1KBNA 5JWOB 4YH2A 3AY8A 4OCFA 1WMJA 1SKRB 1A8LA 2OACA 2HRNA 1V40A 3EINA 2RLIA 1TU7A 3VURA 4KX4A 2GZPA 4GRFA 1PN9A 3CMIA 4JR4A 1UVZA 3L9VA 1SJIA 1V57A 4G0KA 4KNDA 3I69A 4WKWA 2GQLA 1EV9A 4OFTA 2ON5A 3QR6A 13GSA 1URMA 5ECHB 1VRSD 2YV7A 5KEJA 4PUAA 3MNGA 5A4UA 1ZYNA 2GSTA 2B5YA 4KSOA 2PBJA 1AAZA 3W6GA 1Z6MA 5ID2B 1WP0A 3ISOA 2A2PA 2YOIA 4MPFA 3FR6A 3H79A 3FR9A 2L5OA 2HYXA 3HVVA 5DVBA 2VCZA 4GLTA 3VWUA 1FB0A 4X0XA 3IHQA 3NIVA 2RM6A 1HNCA 2ES7A 4HDEA 4I2TA 4O5UA 3CYNA 4DVCA 1A0RP 3QOUA 5B6MA 3S9FA 5BRTA 3QFBC 2PWJA 1YKCA 1GP1A 4IP6A 1M2BA 1F3AA 2C8UA 4NPBA 3KMNA 4TOPA 5J4UA 5ECSA 2GT5A 4MP4A 2H0IA 2YN1A 3HHVA 1M0UA 3APQA 1GL8A 3IR4A 3EWLA 4JR6A 2X8GA 2JZTA 4BL7B 4MJBA 3HDCA 3BCIA 2P0GA 2FA4A 3VI5A 2B3SA 3DWVA 1R5PA 4IQAA 1OC3A 2CX4A 4P3YB 5ECOB 2TIRA 4JBBA 3TCOA 1DUGA 4OWYA 6GSSA 3KH9A 1R5AA 4V2NA 2ALBA 4IS0A 1F2EA 3F4SA 3FKFA 2H75A 4MJCA 1AW9A 3HZ4A 2O8VB 4MJEA 4GSSA 2VM1A 1YDKA 5IO2A 4EDZA 1XFLA 4K6XA 2B7JA 1RW1A 3US3A 2C0EA 2RIIA 1GUMA 3HZ8A 3FEUA 1B48A 3HA9A 3UMAA 2YZHA 1CQGA 2L6CA 5IOXA 1M99A 2JSZA 2C0GA 2H01A 2VL2A 1WWJA 2CZ2A 2DKIA 1GSSA 4KW6A 4FYCA 4YQMA 2YNXA 5G2ZA 2R0PA 1XCCA 1EGRA 5ECNB 3CRTA 5DJMA 4EUYA 2OJLA 4TRXA 4AGSA 4GQCA 3TRQA 5D9VA 3P8WA 4BVXA 5B6NA 2BTOT 3LYKA 4O5QA 1G7EA 4V2MA 3LXTA 2DJ1A 3M3MA 2GVPA 2MMAA 2IIYA 1NHOA 6GSVA 4L8EA 1PKZA 1UA5A 2A4VA 5B8BA 3M9KA 2HI7A 4V1Ag 4Q5RA 3J7Yk 2CAQA 2YV9A 4X1UA 1F9MA 2LJAA 4F9ZA 2IL3A 2R2JA 4TXOA 5AGYA 3TOUA 3IV4A 4DSSA 2LTKA 1IYHA 1GH2A 2MMOA 3H1NA 5D8IA 3KCMA 1SJ6A 3KP8A 1RK4A 3LORA 1XIYA 2DKHA 3A5IA 2C3QA 2NPBA 4LA1A 3U6VA 2Z9SA 3WT1A 2X4AA 2H1AA 1PL1A 3TDGA 2FWGA 4MPGA 4LMVA 4WEYA 3ZZXA 2I3YA 3LGCA 2JADA 1R7HA 3H93A 3GUSA 2AAWA 2YCDA 3QPMA 5JWRB 2L57A 1GWCA 2VLTA 3VFIA 1EGOA 3HCZA 1GNEA 2DMMA 5GZZB 4KDUA 1HNBA 1TRVA 1XVWA 5LNKe 2LQQA 4N0ZA 3HYPA 5HR2A 4PQHA 1F3BA 2IFQB 1GSFA 4G2EA 3P7XA 2FUG2 2V1MA 1EOHA 5B8AA 3QDNA 4YAVA 2HSMA 1YKAA 6GSXA 1MDKA 2VCWA 1PMTA 4LLRA 1E2YA 4EC0A 3RPPA 4G19A 3ERFA 3VK9A 1ZOFA 5JCGA 2HRFA 3CTGA 1JFUA 2OADA 1Z7RA 5EVOA 1K0OA 3DXBA 3IHGA 4MK3A 4PXOA 4YQUA 3M9JA 1PGTA 1YF0A 4TR1B 5IMFA 2OE3A 4HJ2A 3P2AA 2LS5A 4DSQA 2PU9C 3EVIA 1XWAA 4HI7A 5B7CA 1OE8A 2I81A 1FG4A 1ZYPA 5KOWA 5AISA 1ILOA 1SD8A 3FW2A 1SKWB 3WGDA 3W8JA 1TP9A 3IBHA 4IBPA 4J56E 5ECRB 1QMVA 5IO0A 4NAXA 1EP8A 1FHEA 4POMA 2O89A 5KOXA 1T4YA 3FYGA 1T8EB 2AJQB 3DD3A 3KTLA 3A2XA 2PUKC 3GL5A 3HXSA 4HJMA 1F6MC 4HU9A 2DIYA 4PNFA 18GSA 4G10A 3GTUA 4I2UA 4ZL9A 2F9SA 4IHUA 1EEJA 3DYRA 5HFKA 2OBIA 2R0GA 4MCUA 3CSIA 3F6DA 1A23A 3QAGA 5LD0A 1M2DA 2K9FA 3HJMA 4KDXA 5CREA 1H75A 5EPFA 2IMIA 3CXGA 5ECIB 4TR3A 3UBLA 1PX7A 3GSTA 5AIXA 1WOUA 1DSBA 4RUVA 1QK8A 2H76A 4CW9A 3H8QA 1NSWA 3HVXA 2DJ2A 2JZSA 3EC3A 2MMZA 5DQSA 2E0QA 3FHKA 1PX6A 2IWTA 4FIWA 4MJAA 4LMWA 4IQ1A 1JZWA 1FVJA 2WULA 2ZNMA 3WT2A 4BVYB 1EOGA 2HSYA 3W8SA 2FWFA 5BMUA 3KGKA 2R5GA 3MSZA 3TB2A 4PX1A 2DSAA 3UIWA 2V41A 1U6TA 1VGLA 2LEGA 5D93A 1YEXA 3TOTA 2A2RA 4E8HA 1TK8B 4V2LA 2VAFA 2CAIA 3LWAA 4USSA 4JE1A 4TXVA 1TJDA 4NXIA 4AJ8A 3IK7A 3IDVA 5C00A 4BWQA 3F3RA 1I9DA 2N5AA 1Z3EA 2HRKA 2QKEA 1YQ1A 6GSWA 2VO4A 2GSRA 3G7JA 3TKPA 2F8FA 4IGJA 2GQKA 3DGQA 2M80A 3I43A 4POKA 1ZCPA 5CO3A 5ID2A 4L0UA 2E7PA 2DC5A 3QAVA 2UZ8A 5EY6A 1TOFA 1X9SB 3TJKA 3FZ5A 2IPAA 2XPDA 2R6KA 3O3TA 3IK9A 1ZL9A 1K0NA 2JACA 1SL1B 2CX3A 2JU5A 2FWEA 4CDOA 1WE0A 3L0HA 4K5RA 1SYRA 2HE3A 5IPGA 2K18A 4H86A 4EL1A 2WB9A 1VF1A 2H19A 3RHCA 4BWSA 5DQYA 2P5QA 1AQVA 6GSYA 2HSHA 2CZ3A 2OE1A 3F0IA 1EWXA 2WCIA 2AHEA 5JCWA 1GUKA 2H6ZA 4I8BA 4BL7A 1XXUA 4ZB9A 3D4MA 3Q6OA 22GSA 2EIQA 4ECJA 3RBTA 4ZL8A 3GX8A 2XC2A 2X49A 4ML6A 1R4WA 2H72A 4HU7A 5J3RA 1XBSA 4TKYA 1G6WA 2VCQA 3FK8A 1G7OA 1WRYA 4K1FA 2CVDA 3TKSA 2WDUA 2GSSA 5KN3A 5J9BA 4PURA 3JCML 1KNGA 3HY2A 4V1Ap 1S3AA 3ME7A 2KUCA 2VCVA 1VF2A 1VF3A 1T1VA 2R4VA 17GSA 3H4KA 4IP1A 2HXKA 5AN1A 5HR3A 2WS2A 4E8EA 3GFKA 3M1GA 5KN1A 3Q74A 3N9JA 2B6MA 3UL3A 1M2AA 1GSYA 1E6BA 3ZREA 4MNNA 4N30A 3FY7A 4WBJA 2R0CA 3MDKA 3VWWA 2YWNA 5D96A 2GZZA 5DJLA 5IM9A 2VLUA 4I97A 4K7NA 5A4VA 5D9WA 2V6OA 1A8YA 2HLSA 1Y25A 4FH8A 3PPUA 2H6XA 1Y6EA 5IMVA 1B9XC 5IOWA 1GULA 2B7KA 4OO5A 4MF5A 5G1KA 3QD9A 1NW2A 4JEDA 3ZIJA 2V32A 2FY6A 5JWQB 2G0FA 3IXRA 1MDJA 3TJFA 3HD5A 4MDCA 4AF2A 3KD0A 2J9HA 1O8WA 1KTEA 1OKTA 4XS4B 3I6AA 1MTCA 1O81A 3LFLA 3Q18A 1XOBA 3IAS2 1OC8A 1BEDA 3LXZA 2LV3A 3V1WA 3TRXA 3GX0A 2RUEA 3C1RA 3SWLA 2TRXA 2FNOA 4KCEA 4MA9A 5IMAA 1YEPA 2V2GA 3ME8A 4ZB8A 1SYXA 3DEXA 2V6KA 3G7IA 10GSA 1PL2A 4OFMA 3LW9A 3C1SA 3TGZA 2YWIA 2OE0A 1SL2B 5JCUA 2WRTA 1V2AA 4KB3A 1X0RA 1USBA 2VOCA 4KH7A 4X4JA 2H70A 3KZQA 4K7OA 3ZLPA 4HOJA 1PSQA 4PTSA 1X5EA 5GAPD 4NHWA 4F82A 4FO5A 2F51A 3QAWA 3RPNA 2IFQA 3ZTLA 1RQMA 2C3TA 3FZ9A 1K0AA 4JRRA 5IPHA 3F3QA 4PUFC 4NV2A 3UJ1A 1O73A 4Q5QA 1UC7A 1FOVA 3ZRDA 2DJ3A 3ZITA 4POBA 2HRAA 1OE7A 1DE2A 3IRAA 4XIHA 1Q4JA 4MH2A 3QFAC 1GRXA 4N11A 1U3AA 3PGTA 5G30A 1TK5B 3GNJA 3DIEA 4DSRA 4XS6A 5F07A 4K9ZA 5G31A 2OKAA 2L5LA 2GDRA 2N5FA 1TI3A 2H1DA 3MWHA 3U5RE 4TR1A 3D5JA 4GSNA 2H71A 2FHEA 1M9AA 4O32A 2K6VA 5ENUA 3LYPA 2RUFA 2X8CA 3DVWA 3GN3A 3L78A 4QL9A 4O92A 3QMXA 3SBCA 1J08A 1IYIA 1WPIA 3F9UA 4OFNA 2VCXA 3ZIVA 1OC9B 1K3OA 1TRWA 3VWVA 1ZYQB 4KDYA 2WJUA 14GSA 5H5QA 1W4VA 3FMWA 1U3IA 2C80A 3IE3A 2EC4A 1UN2A 3FZ4A 4G9HA 1OYJA 5H5SA 1X5CA 2F3MA 3ZL5A 1N8JA 3RHBA 1Z6NA 1AUCA 2H74A 1SL0B 2H73A 1GLPA 2LUSA 2KP1A 3UAPA 4F0CA 4BPYA 2GGTA 3Q19A 4Q5FA 4ZBBA 3KEBA 3C73A 1SK0A 1GTBA 3GH9A 4EIPA 3F4RA 4NV5A 4K7IA 4EF0A 1Z7PA 4WF5A 4NMUA 5CRGA 5CYYA 5DAKB 1XWGA 4IW9A 5CRHA 3DMLA 1V9WA 1K0MA 2I1UA 2KOKA 2YPMA 4IELA 1AXDA 2GZYA 2H66A 2LRNA 2GLRA 1PQNA 4XHMA 4ACSA 1ZMAA 4KCAA 1FB6A 3J7Yb 3D21A 3K8NA 2LJRA 1LJRA 4MABA 5GSSA 3LQ7A 1R26A 4K0GA 5C04A 4PQIA 2AUVA 3A5WA 3EMXA 5DCHA 2VIMA 1JZOA 1SK2A 1LU4A 3D4TA 4FQUA 6GSTA 2B5XA 4BVYA 2ON7A 4PQ1A 3LSZA 4ZBDA 4MZCA 1YF1A 4RQXA 3TKSC 1I5GA 3ZMLA 2LNSA 2O87A 1THOA 2H1GA 1Z9HA 2KP2A 3I9V2 3N5OA 2NBSA 5ELAA 5DDLA 2C3NA 1BG5A 5FHIA 5IIZA 1DE1A 1TDIA 3WYWA 2GSQA 2YJ7A 3IC8A 2KLXA 1BQ7A 2A2SA 2CQ9A 4IJIA 4F0BA 2XPEA 4PNGA 3R3EA 1C72A 1ZYEA 4HZ2A 3C8EA 4WXTA 1B4QA 4MZBA 4HS1A 1A2MA 3EE2A 3ZVJA 2TRCP 19GSA 4J57E 2MZCA 2N5BA 1ERUA 3GKXA 1GSDA 1X9MB 3D0ZA 3VPQA 4ILFA 4PGTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1GSE A;  2NVL A;  2B5E A;  2C0D A;  2IJY A;  3GHA A;  3RAZ A;  2BMX A;  1MD4 A;  2O85 A;  2VD1 A;  3WGE A;  2DLX A;  5ABR A;  1GTU A;  1AIU A;  1FAA A;  3GL3 A;  3L9S A;  1A2J A;  3GMF A;  4XRA A;  2FGX A;  4MF6 A;  4FYU A;  4RQR A;  2C0F A;  3E9J B;  3O76 A;  1Z5Y E;  3A2W A;  1T7P B;  4D73 B;  2P31 A;  5J41 A;  4HZ4 A;  3IAM 2;  1SD9 A;  1AQW A;  4MH3 A;  3IA1 A;  2VL2 C;  1SJZ A;  4TW5 A;  5ECP B;  2HZF A;  4DEJ A;  3ZFL A;  4WR5 A;  4NWY A;  1FW1 A;  4GCI A;  1MEK A;  1SK1 A;  4MZW A;  5HR0 A;  1NM3 A;  2H1B A;  1TKD B;  1XPV A;  5CP1 A;  7GSS A;  1JHB A;  5E4W A;  3BBY A;  2K8V A;  1T00 A;  2YWM A;  1JZD A;  2GS3 A;  2FA8 A;  2NTO A;  2LKU A;  3TKR A;  4XS1 A;  3F8U A;  4J2F A;  2K8S A;  3IC4 A;  2EIO A;  4HQS A;  3FR3 A;  3BD2 A;  4ZXG A;  2FWH A;  3TKQ A;  2DBC A;  4GF0 A;  4EE0 A;  3G9B A;  4O5R A;  3L9U A;  4AJ7 A;  3GH6 A;  2HZE B;  5D9T A;  3UBK A;  4WBR D;  1ACV A;  3PIN A;  3R2Q A;  2X64 A;  2PVQ A;  1OKD A;  5G5F A;  2FD3 A;  1FVK A;  2FLS A;  2AYT A;  1TW9 A;  4K0N A;  5CRW A;  1ERT A;  5IMD A;  3FRC A;  3GKN A;  2WFC A;  1QGV A;  5DAL B;  4GWR A;  4TN8 A;  4XRD A;  1SU9 A;  3GKK A;  2ZUP A;  3QCP A;  4XS4 A;  2XBI A;  3TJB A;  2HT9 A;  11GS A;  4WF4 A;  3E3E A;  2WGR A;  2H30 A;  2OA7 A;  3RDW A;  1ST9 A;  1EV4 A;  2QC7 A;  1YJ6 A;  5HFI A;  2NDO A;  4ISD A;  1TU8 A;  3M0F A;  4TR4 A;  5INY A;  1BX9 A;  9GSS A;  1GNW A;  2JL4 A;  5COH A;  1KEB A;  2YP6 A;  5D9X A;  4RI7 A;  4O7H A;  4ZB6 A;  8GSS A;  1H4O A;  4OD7 A;  4MMM A;  1PA3 A;  3D22 A;  3HJP A;  3A2V A;  1S3D A;  3UVT A;  5A4W A;  3ERG A;  4ML1 A;  3BOA A;  4EDY A;  5F8B A;  3LJR A;  1T4Z A;  1K0C A;  4KE3 A;  2AV4 A;  4Z7X A;  4IVF A;  3TJJ A;  1JZR A;  5EL8 A;  2JZR A;  1TRU A;  1XWK A;  5ECQ B;  5J9C A;  1V58 A;  1O85 A;  1K3L A;  4F2I A;  2E2G A;  2R37 A;  2O7K A;  5CAX A;  2PPT A;  2EIR A;  2WZ9 A;  1OVN A;  4OCE A;  5A5K A;  16GS A;  4EKZ A;  2I9H A;  1PD2 1;  12GS A;  5KN0 A;  2AB6 A;  3VPT A;  3KTB A;  4TVE A;  1A2L A;  4XTS A;  2CT6 A;  1WIK A;  3VLN A;  4GXZ A;  4WR4 A;  2VLV A;  4KSM A;  1SKS B;  1S3C A;  2LRC A;  4EO3 A;  2P5R A;  3GRX A;  1X5D A;  5ECM B;  1N2A A;  2M72 A;  3APS A;  3GUR A;  4Q5N A;  1W89 A;  4ZIL A;  2CV4 A;  3PH9 A;  3C7M A;  3EMP A;  2OBK A;  1PRX A;  4GST A;  1OC9 A;  4IJ3 A;  4ZL7 A;  1DBY A;  2ZCT A;  3BCK A;  1WJK A;  4IKH A;  1ERW A;  1EP7 A;  1GTI A;  4L5O A;  4I5Q A;  3KH7 A;  1LBK A;  2LQO A;  1XW9 A;  4JZQ A;  3HKR A;  2DJJ A;  3GIX A;  3EU4 A;  2X99 A;  5F06 A;  2GT6 A;  1ZGN A;  2DML A;  3NZN A;  2H8L A;  3ED3 A;  3P90 A;  3UOM A;  1HQO A;  1GTA A;  2YZU A;  2KHP A;  3KXO A;  3OR5 A;  1O6J A;  1ON4 A;  5IMC A;  1OAZ A;  4N0V A;  3WGX A;  1JLW A;  2FCH A;  1TK0 B;  1YZX A;  5E59 A;  4POL A;  2B1L A;  3O6T A;  5DAK A;  1ZZY A;  2L4C A;  2L6D A;  1V98 A;  1SEN A;  4I6X A;  4RI6 A;  2MMN A;  2RM5 A;  2MBT A;  3A3T A;  3HJO A;  3UAR A;  1B4P A;  2PGT A;  1HD2 A;  1ABA A;  4XCS A;  2REM A;  1QXH A;  2HFD A;  2LST A;  5DCG A;  4N10 A;  3KM6 A;  4ZIJ A;  1XW6 A;  1B9Y C;  3EU3 A;  3G7Y A;  3TJG A;  3L4N A;  4CHS A;  5G1L A;  3D6I A;  5HR1 A;  1XOA A;  3GYK A;  4YQV A;  1BAY A;  2C1Y A;  2XBQ A;  2IMF A;  1QFN A;  1GSQ A;  1JLV A;  1O7U A;  4IN0 A;  5HFG A;  4L5L A;  1F37 A;  4TXO B;  5IMZ A;  4K2D A;  5L71 A;  3ZVJ D;  2B1K A;  2IMD A;  4KAE A;  3CBU A;  1BJX A;  4DSS B;  1AQX A;  2I4A A;  3UVH A;  5FWG A;  4AJ6 A;  3ZFB A;  1CQH A;  4LL1 B;  1ML6 A;  2PMT A;  1TRS A;  2VL3 A;  1XVQ A;  1K0D A;  3IOS A;  4K8M A;  1K3Y A;  2CA8 A;  1A0F A;  4NHZ A;  4YAP A;  2JSY A;  2GQM A;  3GKM A;  3NOF A;  5IQY A;  1XW5 A;  2LNT A;  2HNL A;  3BJ5 A;  2MBS A;  2L59 A;  3VI7 A;  6GSU A;  4KGI A;  4F03 A;  5H5R A;  5F0G A;  2LRT A;  2VM2 A;  4WET A;  2MYG A;  3GSS A;  1AC1 A;  4QL7 A;  1J0F A;  3DVX A;  2DIZ A;  3ZMK A;  1G0T A;  4HQZ A;  3DKS A;  4ECC A;  1B8X A;  2C4J A;  2F8A A;  3FZA A;  3VWX A;  5ELG A;  1XWC A;  2R3X A;  2IME A;  4ECB A;  5G5E A;  3TRP A;  2L4Q A;  2DJK A;  2YAN A;  4D73 A;  4ID0 A;  3KMO A;  2VL9 A;  1U87 A;  4ECI A;  3LG6 A;  1T3B A;  4GQF A;  1XZO A;  1EZK A;  3APO A;  3WD6 A;  2M46 A;  2BJX A;  4FYB A;  2YWO A;  1TI1 A;  3KJY A;  4MLY A;  2E2M A;  5F05 A;  3M8N A;  2PER A;  1EEM A;  2LJK A;  3PR8 A;  3LEF A;  1QQ2 A;  1A24 A;  4HUA A;  2VCT A;  4L0W A;  3TUE A;  2DJ0 A;  5KN2 A;  3F4T A;  3C71 A;  4TR0 A;  1BYE A;  3CRU A;  2IMK A;  5CNW A;  1Q98 A;  5GAN D;  3GA4 A;  5ECL B;  20GS A;  5D73 A;  2CVK A;  2QGV A;  4LL4 B;  4OMV A;  1XWB A;  1GUH A;  4KUN A;  5FT3 A;  2GTU A;  1J9B A;  4KA0 A;  3CTF A;  1THX A;  2G2Q A;  2VUP A;  5HQP A;  2HZE A;  3GTU B;  4GTU A;  3TKS E;  2H0G A;  1QUW A;  2D2Z A;  3ZYW A;  1HYU A;  5LCZ A;  2H0H A;  1YY7 A;  1MD3 A;  3ERW A;  3UEM A;  5GST A;  1ERV A;  3KP9 A;  1PKW A;  1O8X A;  4EXJ A;  3EUR A;  3IPZ A;  1VF4 A;  3F63 A;  5DAL A;  1TXX A;  5J5N A;  4ZBA A;  2XHF A;  4X43 A;  2J23 A;  2H6Y A;  2IN3 A;  1MDI A;  3HVS A;  2YJH A;  1U88 A;  4HEA 2;  4QQ7 A;  1K0B A;  3E0U A;  5AIV A;  1NHY A;  1G6Y A;  2CVB A;  1M9B A;  5DBQ A;  3KIJ A;  4ULX A;  1M7T A;  3GV1 A;  4JU5 A;  1GSU A;  1X9W B;  2VD0 A;  3CSH A;  1HNA A;  3DRN A;  3CSJ A;  5ECK B;  1GLQ A;  2PVO C;  1FO5 A;  4BA7 A;  3EYT A;  1TTZ A;  2QSI A;  5CRD A;  2X8H A;  3F6F A;  3MAK A;  4OO4 A;  4EVM A;  2PN8 A;  4MF7 A;  1KBN A;  5JWO B;  4YH2 A;  3AY8 A;  4OCF A;  1WMJ A;  1SKR B;  1A8L A;  2OAC A;  2HRN A;  1V40 A;  3EIN A;  2RLI A;  1TU7 A;  3VUR A;  4KX4 A;  2GZP A;  4GRF A;  1PN9 A;  3CMI A;  4JR4 A;  1UVZ A;  3L9V A;  1SJI A;  1V57 A;  4KND A;  3I69 A;  4WKW A;  2GQL A;  1EV9 A;  4OFT A;  2ON5 A;  3QR6 A;  13GS A;  1URM A;  5ECH B;  1VRS D;  2YV7 A;  5KEJ A;  4PUA A;  3MNG A;  5A4U A;  2GST A;  2B5Y A;  4KSO A;  2PBJ A;  1AAZ A;  3W6G A;  1Z6M A;  5ID2 B;  1WP0 A;  3ISO A;  2YOI A;  4MPF A;  3FR6 A;  3H79 A;  3FR9 A;  2L5O A;  2HYX A;  3HVV A;  5DVB A;  2VCZ A;  4GLT A;  3VWU A;  1FB0 A;  4X0X A;  3IHQ A;  3NIV A;  2RM6 A;  1HNC A;  2ES7 A;  4HDE A;  4I2T A;  3CYN A;  4DVC A;  1A0R P;  3QOU A;  5B6M A;  3S9F A;  3QFB C;  2PWJ A;  1YKC A;  1GP1 A;  4IP6 A;  1M2B A;  1F3A A;  2C8U A;  4NPB A;  3KMN A;  4TOP A;  5J4U A;  5ECS A;  2GT5 A;  4MP4 A;  2H0I A;  2YN1 A;  3HHV A;  1M0U A;  3APQ A;  1GL8 A;  3IR4 A;  3EWL A;  4JR6 A;  2X8G A;  2JZT A;  4MJB A;  3HDC A;  3BCI A;  2P0G A;  2FA4 A;  3VI5 A;  2B3S A;  3DWV A;  1R5P A;  4IQA A;  1OC3 A;  2CX4 A;  4P3Y B;  5ECO B;  2TIR A;  4JBB A;  3TCO A;  1DUG A;  4OWY A;  6GSS A;  3KH9 A;  1R5A A;  4V2N A;  2ALB A;  4IS0 A;  1F2E A;  3F4S A;  3FKF A;  2H75 A;  4MJC A;  1AW9 A;  3HZ4 A;  2O8V B;  4MJE A;  4GSS A;  2VM1 A;  1YDK A;  5IO2 A;  4EDZ A;  1XFL A;  4K6X A;  2B7J A;  1RW1 A;  3US3 A;  2C0E A;  2RII A;  1GUM A;  3HZ8 A;  3FEU A;  1B48 A;  3HA9 A;  3UMA A;  2YZH A;  1CQG A;  2L6C A;  5IOX A;  1M99 A;  2JSZ A;  2C0G A;  2H01 A;  2VL2 A;  1WWJ A;  2CZ2 A;  1GSS A;  4KW6 A;  4FYC A;  4YQM A;  2YNX A;  5G2Z A;  1XCC A;  1EGR A;  5ECN B;  3CRT A;  5DJM A;  4EUY A;  2OJL A;  4TRX A;  4AGS A;  4GQC A;  3TRQ A;  5D9V A;  3P8W A;  4BVX A;  5B6N A;  2BTO T;  3LYK A;  1G7E A;  4V2M A;  3LXT A;  2DJ1 A;  3M3M A;  2GVP A;  2MMA A;  2IIY A;  1NHO A;  6GSV A;  4L8E A;  1PKZ A;  1UA5 A;  2A4V A;  5B8B A;  3M9K A;  2HI7 A;  4V1A g;  4Q5R A;  3J7Y k;  2CAQ A;  2YV9 A;  4X1U A;  1F9M A;  2LJA A;  4F9Z A;  2IL3 A;  2R2J A;  4TXO A;  5AGY A;  3TOU A;  3IV4 A;  4DSS A;  2LTK A;  1IYH A;  1GH2 A;  2MMO A;  3H1N A;  5D8I A;  3KCM A;  1SJ6 A;  3KP8 A;  1RK4 A;  3LOR A;  1XIY A;  2C3Q A;  2NPB A;  4LA1 A;  3U6V A;  2Z9S A;  3WT1 A;  2H1A A;  1PL1 A;  3TDG A;  2FWG A;  4MPG A;  4LMV A;  4WEY A;  3ZZX A;  2I3Y A;  3LGC A;  2JAD A;  1R7H A;  3H93 A;  3GUS A;  2AAW A;  2YCD A;  3QPM A;  5JWR B;  2L57 A;  1GWC A;  2VLT A;  3VFI A;  1EGO A;  3HCZ A;  1GNE A;  2DMM A;  5GZZ B;  4KDU A;  1HNB A;  1TRV A;  1XVW A;  5LNK e;  2LQQ A;  4N0Z A;  3HYP A;  5HR2 A;  4PQH A;  1F3B A;  2IFQ B;  1GSF A;  4G2E A;  3P7X A;  2FUG 2;  2V1M A;  1EOH A;  5B8A A;  3QDN A;  4YAV A;  1YKA A;  6GSX A;  1MDK A;  2VCW A;  1PMT A;  4LLR A;  1E2Y A;  4EC0 A;  3RPP A;  4G19 A;  3ERF A;  3VK9 A;  1ZOF A;  5JCG A;  2HRF A;  3CTG A;  1JFU A;  2OAD A;  1Z7R A;  5EVO A;  1K0O A;  3DXB A;  4MK3 A;  4PXO A;  4YQU A;  3M9J A;  1PGT A;  1YF0 A;  4TR1 B;  5IMF A;  2OE3 A;  4HJ2 A;  3P2A A;  2LS5 A;  4DSQ A;  2PU9 C;  3EVI A;  1XWA A;  4HI7 A;  5B7C A;  1OE8 A;  2I81 A;  1FG4 A;  5AIS A;  1ILO A;  1SD8 A;  3FW2 A;  1SKW B;  3WGD A;  3W8J A;  1TP9 A;  3IBH A;  4IBP A;  4J56 E;  5ECR B;  1QMV A;  5IO0 A;  4NAX A;  1EP8 A;  1FHE A;  4POM A;  2O89 A;  1T4Y A;  3FYG A;  1T8E B;  2AJQ B;  3DD3 A;  3KTL A;  3A2X A;  2PUK C;  3GL5 A;  3HXS A;  4HJM A;  1F6M C;  4HU9 A;  2DIY A;  4PNF A;  18GS A;  4G10 A;  3GTU A;  4I2U A;  4ZL9 A;  2F9S A;  4IHU A;  1EEJ A;  3DYR A;  5HFK A;  2OBI A;  4MCU A;  3CSI A;  3F6D A;  1A23 A;  3QAG A;  5LD0 A;  1M2D A;  2K9F A;  3HJM A;  4KDX A;  5CRE A;  1H75 A;  5EPF A;  2IMI A;  3CXG A;  5ECI B;  4TR3 A;  3UBL A;  1PX7 A;  3GST A;  5AIX A;  1WOU A;  1DSB A;  4RUV A;  1QK8 A;  2H76 A;  4CW9 A;  3H8Q A;  1NSW A;  3HVX A;  2DJ2 A;  2JZS A;  3EC3 A;  2MMZ A;  5DQS A;  2E0Q A;  3FHK A;  1PX6 A;  2IWT A;  4FIW A;  4MJA A;  4LMW A;  4IQ1 A;  1JZW A;  1FVJ A;  2WUL A;  2ZNM A;  3WT2 A;  1EOG A;  2HSY A;  3W8S A;  2FWF A;  3KGK A;  2R5G A;  3MSZ A;  3TB2 A;  4PX1 A;  2DSA A;  3UIW A;  2V41 A;  1U6T A;  1VGL A;  2LEG A;  5D93 A;  1YEX A;  3TOT A;  2A2R A;  4E8H A;  1TK8 B;  4V2L A;  2VAF A;  2CAI A;  3LWA A;  4JE1 A;  4TXV A;  1TJD A;  4NXI A;  4AJ8 A;  3IK7 A;  3IDV A;  5C00 A;  4BWQ A;  3F3R A;  1I9D A;  2N5A A;  1Z3E A;  2QKE A;  6GSW A;  1YQ1 A;  2VO4 A;  2GSR A;  3G7J A;  3TKP A;  2F8F A;  4IGJ A;  2GQK A;  3DGQ A;  2M80 A;  3I43 A;  4POK A;  1ZCP A;  5CO3 A;  5ID2 A;  4L0U A;  2E7P A;  2DC5 A;  3QAV A;  5EY6 A;  1TOF A;  1X9S B;  3TJK A;  3FZ5 A;  2IPA A;  2XPD A;  2R6K A;  3O3T A;  3IK9 A;  1ZL9 A;  1K0N A;  2JAC A;  1SL1 B;  2CX3 A;  2JU5 A;  2FWE A;  4CDO A;  1WE0 A;  3L0H A;  1SYR A;  2HE3 A;  5IPG A;  2K18 A;  4H86 A;  4EL1 A;  2WB9 A;  1VF1 A;  2H19 A;  3RHC A;  4BWS A;  5DQY A;  2P5Q A;  1AQV A;  6GSY A;  2HSH A;  2CZ3 A;  2OE1 A;  3F0I A;  1EWX A;  2WCI A;  2AHE A;  5JCW A;  1GUK A;  2H6Z A;  4I8B A;  4BL7 A;  1XXU A;  4ZB9 A;  3D4M A;  3Q6O A;  22GS A;  2EIQ A;  4ECJ A;  3RBT A;  4ZL8 A;  3GX8 A;  2XC2 A;  4ML6 A;  1R4W A;  2H72 A;  4HU7 A;  5J3R A;  1XBS A;  4TKY A;  1G6W A;  2VCQ A;  3FK8 A;  1G7O A;  1WRY A;  4K1F A;  2CVD A;  3TKS A;  2WDU A;  2GSS A;  5KN3 A;  5J9B A;  4PUR A;  3JCM L;  1KNG A;  3HY2 A;  4V1A p;  1S3A A;  3ME7 A;  2KUC A;  2VCV A;  1VF2 A;  1VF3 A;  1T1V A;  2R4V A;  17GS A;  3H4K A;  4IP1 A;  2HXK A;  5AN1 A;  5HR3 A;  2WS2 A;  4E8E A;  3GFK A;  3M1G A;  5KN1 A;  3Q74 A;  3N9J A;  2B6M A;  3UL3 A;  1M2A A;  1GSY A;  1E6B A;  3ZRE A;  4N30 A;  4WBJ A;  3FY7 A;  3MDK A;  3VWW A;  2YWN A;  5D96 A;  2GZZ A;  5DJL A;  5IM9 A;  2VLU A;  4I97 A;  4K7N A;  5A4V A;  5D9W A;  2V6O A;  1A8Y A;  2HLS A;  1Y25 A;  4FH8 A;  2H6X A;  1Y6E A;  5IMV A;  1B9X C;  5IOW A;  1GUL A;  2B7K A;  4OO5 A;  4MF5 A;  5G1K A;  3QD9 A;  1NW2 A;  4JED A;  3ZIJ A;  2V32 A;  2FY6 A;  5JWQ B;  2G0F A;  3IXR A;  1MDJ A;  3TJF A;  3HD5 A;  4MDC A;  4AF2 A;  3KD0 A;  2J9H A;  1O8W A;  1KTE A;  1OKT A;  4XS4 B;  3I6A A;  1MTC A;  1O81 A;  3LFL A;  3Q18 A;  1XOB A;  3IAS 2;  1OC8 A;  1BED A;  3LXZ A;  2LV3 A;  3V1W A;  3TRX A;  3GX0 A;  2RUE A;  3C1R A;  3SWL A;  2TRX A;  2FNO A;  4KCE A;  4MA9 A;  5IMA A;  1YEP A;  2V2G A;  3ME8 A;  4ZB8 A;  1SYX A;  3DEX A;  2V6K A;  3G7I A;  10GS A;  1PL2 A;  4OFM A;  3C1S A;  3TGZ A;  2YWI A;  2OE0 A;  1SL2 B;  5JCU A;  2WRT A;  1V2A A;  4KB3 A;  1X0R A;  1USB A;  2VOC A;  4KH7 A;  2H70 A;  3KZQ A;  4K7O A;  3ZLP A;  4HOJ A;  1PSQ A;  1X5E A;  5GAP D;  4NHW A;  4F82 A;  4FO5 A;  2F51 A;  3QAW A;  3RPN A;  2IFQ A;  3ZTL A;  1RQM A;  2C3T A;  3FZ9 A;  1K0A A;  4JRR A;  5IPH A;  3F3Q A;  4PUF C;  4NV2 A;  3UJ1 A;  1O73 A;  4Q5Q A;  1UC7 A;  1FOV A;  3ZRD A;  2DJ3 A;  3ZIT A;  4POB A;  1OE7 A;  1DE2 A;  3IRA A;  4XIH A;  1Q4J A;  4MH2 A;  3QFA C;  1GRX A;  4N11 A;  1U3A A;  3PGT A;  5G30 A;  1TK5 B;  3GNJ A;  3DIE A;  4DSR A;  4XS6 A;  5F07 A;  4K9Z A;  5G31 A;  2OKA A;  2L5L A;  2GDR A;  2N5F A;  1TI3 A;  2H1D A;  3MWH A;  3U5R E;  4TR1 A;  3D5J A;  4GSN A;  2H71 A;  2FHE A;  1M9A A;  4O32 A;  2K6V A;  5ENU A;  3LYP A;  2RUF A;  2X8C A;  3DVW A;  3GN3 A;  3L78 A;  4QL9 A;  4O92 A;  3QMX A;  3SBC A;  1J08 A;  1IYI A;  1WPI A;  3F9U A;  4OFN A;  2VCX A;  3ZIV A;  1OC9 B;  1K3O A;  1TRW A;  3VWV A;  1ZYQ B;  4KDY A;  2WJU A;  14GS A;  5H5Q A;  1W4V A;  1U3I A;  2C80 A;  3IE3 A;  2EC4 A;  1UN2 A;  3FZ4 A;  4G9H A;  1OYJ A;  5H5S A;  1X5C A;  2F3M A;  3ZL5 A;  1N8J A;  3RHB A;  1Z6N A;  1AUC A;  2H74 A;  1SL0 B;  2H73 A;  1GLP A;  2LUS A;  2KP1 A;  3UAP A;  4F0C A;  4BPY A;  2GGT A;  3Q19 A;  4Q5F A;  4ZBB A;  3KEB A;  3C73 A;  1SK0 A;  1GTB A;  3GH9 A;  3F4R A;  4NV5 A;  4K7I A;  4EF0 A;  1Z7P A;  4WF5 A;  4NMU A;  5CRG A;  5CYY A;  5DAK B;  1XWG A;  4IW9 A;  5CRH A;  3DML A;  1V9W A;  1K0M A;  2I1U A;  2KOK A;  2YPM A;  4IEL A;  1AXD A;  2GZY A;  2H66 A;  2LRN A;  2GLR A;  1PQN A;  4XHM A;  4ACS A;  1ZMA A;  4KCA A;  1FB6 A;  3J7Y b;  3D21 A;  3K8N A;  2LJR A;  1LJR A;  4MAB A;  5GSS A;  3LQ7 A;  1R26 A;  4K0G A;  5C04 A;  4PQI A;  2AUV A;  5DCH A;  3A5W A;  3EMX A;  2VIM A;  1JZO A;  1SK2 A;  1LU4 A;  3D4T A;  6GST A;  2B5X A;  4BVY A;  2ON7 A;  4PQ1 A;  3LSZ A;  4ZBD A;  4MZC A;  1YF1 A;  4RQX A;  3TKS C;  1I5G A;  3ZML A;  2LNS A;  2O87 A;  1THO A;  2H1G A;  1Z9H A;  2KP2 A;  3I9V 2;  3N5O A;  2NBS A;  5ELA A;  5DDL A;  2C3N A;  1BG5 A;  5FHI A;  5IIZ A;  1DE1 A;  1TDI A;  3WYW A;  2GSQ A;  2YJ7 A;  2KLX A;  1BQ7 A;  2A2S A;  2CQ9 A;  4IJI A;  4F0B A;  2XPE A;  4PNG A;  1C72 A;  1ZYE A;  4HZ2 A;  3C8E A;  4WXT A;  1B4Q A;  4MZB A;  4HS1 A;  1A2M A;  3EE2 A;  3ZVJ A;  2TRC P;  19GS A;  4J57 E;  2MZC A;  2N5B A;  1ERU A;  3GKX A;  1GSD A;  1X9M B;  3D0Z A;  3VPQ A;  4ILF A;  4PGT A; 
#chains in the Genus database with same CATH topology
 1GSE A;  2NVL A;  2B5E A;  2C0D A;  2IJY A;  3GHA A;  3RAZ A;  2BMX A;  1MD4 A;  2O85 A;  2VD1 A;  3WGE A;  2DLX A;  5ABR A;  1GTU A;  1AIU A;  1FAA A;  3GL3 A;  3L9S A;  1A2J A;  3GMF A;  4XRA A;  2FGX A;  4MF6 A;  4FYU A;  4RQR A;  2C0F A;  4K5S A;  3E9J B;  3O76 A;  1Z5Y E;  3A2W A;  1T7P B;  4D73 B;  2P31 A;  5J41 A;  4HZ4 A;  3IAM 2;  1SD9 A;  1AQW A;  4MH3 A;  3IA1 A;  2VL2 C;  1SJZ A;  4TW5 A;  5ECP B;  2HZF A;  4DEJ A;  3ZFL A;  4WR5 A;  4NWY A;  1FW1 A;  4GCI A;  1MEK A;  1SK1 A;  4MZW A;  5HR0 A;  1NM3 A;  2H1B A;  1TKD B;  1XPV A;  5CP1 A;  7GSS A;  1JHB A;  5E4W A;  3BBY A;  2K8V A;  1T00 A;  2YWM A;  1JZD A;  2GS3 A;  2FA8 A;  2NTO A;  2LKU A;  3TKR A;  4XS1 A;  3F8U A;  4J2F A;  2K8S A;  3IC4 A;  2EIO A;  4HQS A;  3FR3 A;  3BD2 A;  4ZXG A;  2FWH A;  3TKQ A;  2DBC A;  4GF0 A;  4EE0 A;  3G9B A;  4O5R A;  3L9U A;  4AJ7 A;  3GH6 A;  2HZE B;  5D9T A;  3UBK A;  4WBR D;  1ACV A;  3PIN A;  3R2Q A;  2X64 A;  2PVQ A;  1OKD A;  5G5F A;  2FD3 A;  1FVK A;  2FLS A;  2AYT A;  1TW9 A;  4K0N A;  5CRW A;  1ERT A;  5IMD A;  3FRC A;  3GKN A;  2WFC A;  1QGV A;  5DAL B;  4GWR A;  4TN8 A;  4XRD A;  1SU9 A;  3GKK A;  2ZUP A;  3QCP A;  4XS4 A;  2XBI A;  3TJB A;  2HT9 A;  4G0I A;  4Z2U A;  11GS A;  4WF4 A;  3E3E A;  2WGR A;  2H30 A;  2OA7 A;  3RDW A;  1ST9 A;  1EV4 A;  2QC7 A;  1YJ6 A;  5HFI A;  2NDO A;  4ISD A;  1TU8 A;  3M0F A;  3HVN A;  4TR4 A;  5INY A;  1BX9 A;  9GSS A;  3MIX A;  1GNW A;  4K2X A;  2JL4 A;  5COH A;  1KEB A;  2YP6 A;  5D9X A;  4RI7 A;  4O7H A;  4ZB6 A;  8GSS A;  1H4O A;  4OD7 A;  4MMM A;  1PA3 A;  3D22 A;  3HJP A;  3A2V A;  1S3D A;  3UVT A;  5A4W A;  3ERG A;  4ML1 A;  3BOA A;  4EDY A;  5F8B A;  3LJR A;  1T4Z A;  1K0C A;  4KE3 A;  3MYD A;  2A4H A;  2AV4 A;  4Z7X A;  4IVF A;  3TJJ A;  1JZR A;  5EL8 A;  2JZR A;  1TRU A;  1XWK A;  5ECQ B;  5J9C A;  1V58 A;  1O85 A;  1K3L A;  4F2I A;  2E2G A;  2R37 A;  2O7K A;  2QA1 A;  5CAX A;  2PPT A;  2EIR A;  2WZ9 A;  1OVN A;  4OCE A;  5A5K A;  16GS A;  4EKZ A;  2I9H A;  1PD2 1;  12GS A;  5KN0 A;  2AB6 A;  3VPT A;  3KTB A;  4TVE A;  1A2L A;  4XTS A;  2CT6 A;  1WIK A;  3VLN A;  4GXZ A;  4WR4 A;  2VLV A;  4KSM A;  1SKS B;  1S3C A;  2LRC A;  4EO3 A;  2P5R A;  3GRX A;  1X5D A;  5ECM B;  1N2A A;  1FOH A;  2M72 A;  4A5P A;  3APS A;  3GUR A;  4Q5N A;  1W89 A;  4ZIL A;  2CV4 A;  3PH9 A;  4Z2R A;  3C7M A;  3EMP A;  2OBK A;  1PRX A;  4GST A;  1OC9 A;  4IJ3 A;  4ZL7 A;  1DBY A;  2ZCT A;  3BCK A;  1WJK A;  4IKH A;  1ERW A;  1EP7 A;  1GTI A;  4L5O A;  4I5Q A;  3KH7 A;  1LBK A;  2LQO A;  1XW9 A;  4JZQ A;  1PFO A;  3HKR A;  2DJJ A;  3GIX A;  3EU4 A;  2X99 A;  5F06 A;  2GT6 A;  1ZGN A;  2DML A;  3NZN A;  4CY6 A;  2H8L A;  3ED3 A;  3P90 A;  3UOM A;  1HQO A;  1GTA A;  2YZU A;  2KHP A;  3KXO A;  3OR5 A;  1O6J A;  1ON4 A;  5IMC A;  1OAZ A;  4N0V A;  3WGX A;  1JLW A;  2FCH A;  1TK0 B;  1YZX A;  5E59 A;  4POL A;  2B1L A;  3O6T A;  5DAK A;  1ZZY A;  2L4C A;  4YKG A;  2L6D A;  1V98 A;  1SEN A;  4I6X A;  4RI6 A;  2MMN A;  2RM5 A;  2MBT A;  3A3T A;  3HJO A;  3UAR A;  1B4P A;  2PGT A;  4BVX B;  1HD2 A;  1ABA A;  4XCS A;  2REM A;  1QXH A;  2HFD A;  2LST A;  5DCG A;  4N10 A;  3KM6 A;  4ZIJ A;  1XW6 A;  1B9Y C;  3EU3 A;  3G7Y A;  3TJG A;  3L4N A;  4CHS A;  5G1L A;  3D6I A;  5HR1 A;  1XOA A;  3GYK A;  4YQV A;  1BAY A;  2C1Y A;  2XBQ A;  2IMF A;  1QFN A;  1GSQ A;  4KF9 A;  1JLV A;  1O7U A;  4IN0 A;  5HFG A;  4L5L A;  1F37 A;  4TXO B;  5IMZ A;  4K2D A;  5L71 A;  3ZVJ D;  2B1K A;  2IMD A;  4KAE A;  3CBU A;  1BJX A;  4DSS B;  1AQX A;  2I4A A;  3UVH A;  5FWG A;  4AJ6 A;  3ZFB A;  1CQH A;  4LL1 B;  1ML6 A;  2PMT A;  1TRS A;  2VL3 A;  1XVQ A;  4Z2T A;  1K0D A;  3IOS A;  4K8M A;  4ICY A;  1K3Y A;  2CA8 A;  3EPT A;  1A0F A;  4NHZ A;  4YAP A;  2JSY A;  2GQM A;  3GKM A;  3NOF A;  5IQY A;  4YKF A;  1XW5 A;  2LNT A;  2HNL A;  3BJ5 A;  2MBS A;  2L59 A;  3VI7 A;  6GSU A;  4KGI A;  4F03 A;  5H5R A;  5F0G A;  2LRT A;  2VM2 A;  4WET A;  2MYG A;  3GSS A;  1AC1 A;  4QL7 A;  1J0F A;  3DVX A;  2DIZ A;  3ZMK A;  1G0T A;  4HQZ A;  3DKS A;  4ECC A;  4EIQ A;  1B8X A;  2C4J A;  2F8A A;  3FZA A;  3VWX A;  5ELG A;  1XWC A;  2R3X A;  2IME A;  4ECB A;  5G5E A;  3TRP A;  2L4Q A;  2DJK A;  2YAN A;  4D73 A;  4ID0 A;  3KMO A;  2VL9 A;  1U87 A;  4ECI A;  3LG6 A;  1T3B A;  4GQF A;  1XZO A;  1EZK A;  3APO A;  3WD6 A;  2M46 A;  2BJX A;  4FYB A;  2YWO A;  1TI1 A;  3KJY A;  4MLY A;  2E2M A;  5F05 A;  3M8N A;  2PER A;  1EEM A;  2LJK A;  3PR8 A;  3LEF A;  1QQ2 A;  1A24 A;  4HUA A;  2VCT A;  4L0W A;  3TUE A;  2DJ0 A;  5KN2 A;  3F4T A;  3C71 A;  4TR0 A;  1BYE A;  3CRU A;  2IMK A;  5CNW A;  1Q98 A;  5GAN D;  3GA4 A;  5ECL B;  20GS A;  5D73 A;  2CVK A;  2QGV A;  4LL4 B;  4OMV A;  1XWB A;  1GUH A;  4KUN A;  5FT3 A;  2GTU A;  1J9B A;  4KA0 A;  4CY8 A;  3CTF A;  1THX A;  2G2Q A;  2VUP A;  1M3I A;  5HQP A;  2HZE A;  3GTU B;  4GTU A;  3TKS E;  2H0G A;  1QUW A;  2D2Z A;  3ZYW A;  1HYU A;  5LCZ A;  2H0H A;  1YY7 A;  1MD3 A;  3ERW A;  3UEM A;  5GST A;  1ERV A;  3KP9 A;  1PKW A;  1O8X A;  4EXJ A;  3EUR A;  3IPZ A;  1VF4 A;  3F63 A;  5DAL A;  1TXX A;  5J5N A;  4ZBA A;  2XHF A;  4X43 A;  2J23 A;  2H6Y A;  2IN3 A;  1MDI A;  1PN0 A;  3HVS A;  2YJH A;  1U88 A;  4HEA 2;  4QQ7 A;  1K0B A;  3E0U A;  5AIV A;  1NHY A;  1G6Y A;  2CVB A;  1M9B A;  4HSC X;  5DBQ A;  3KIJ A;  4ULX A;  1M7T A;  3GV1 A;  4JU5 A;  1GSU A;  1X9W B;  2VD0 A;  3CSH A;  1HNA A;  3DRN A;  3CSJ A;  5ECK B;  1GLQ A;  2QA2 A;  2PVO C;  1FO5 A;  4BA7 A;  3EYT A;  1TTZ A;  2QSI A;  5CRD A;  4G0L A;  2X8H A;  3F6F A;  3MAK A;  4OO4 A;  4EVM A;  2PN8 A;  4MF7 A;  1KBN A;  5JWO B;  4YH2 A;  3AY8 A;  4OCF A;  1WMJ A;  1SKR B;  1A8L A;  2OAC A;  2HRN A;  1V40 A;  3EIN A;  2RLI A;  1TU7 A;  3VUR A;  4KX4 A;  2GZP A;  4GRF A;  1PN9 A;  3CMI A;  4JR4 A;  1UVZ A;  3L9V A;  1SJI A;  1V57 A;  4G0K A;  4KND A;  3I69 A;  4WKW A;  2GQL A;  1EV9 A;  4OFT A;  2ON5 A;  3QR6 A;  13GS A;  1URM A;  5ECH B;  1VRS D;  2YV7 A;  5KEJ A;  4PUA A;  3MNG A;  5A4U A;  1ZYN A;  2GST A;  2B5Y A;  4KSO A;  2PBJ A;  1AAZ A;  3W6G A;  1Z6M A;  5ID2 B;  1WP0 A;  3ISO A;  2A2P A;  2YOI A;  4MPF A;  3FR6 A;  3H79 A;  3FR9 A;  2L5O A;  2HYX A;  3HVV A;  5DVB A;  2VCZ A;  4GLT A;  3VWU A;  1FB0 A;  4X0X A;  3IHQ A;  3NIV A;  2RM6 A;  1HNC A;  2ES7 A;  4HDE A;  4I2T A;  4O5U A;  3CYN A;  4DVC A;  1A0R P;  3QOU A;  5B6M A;  3S9F A;  5BRT A;  3QFB C;  2PWJ A;  1YKC A;  1GP1 A;  4IP6 A;  1M2B A;  1F3A A;  2C8U A;  4NPB A;  3KMN A;  4TOP A;  5J4U A;  5ECS A;  2GT5 A;  4MP4 A;  2H0I A;  2YN1 A;  3HHV A;  1M0U A;  3APQ A;  1GL8 A;  3IR4 A;  3EWL A;  4JR6 A;  2X8G A;  2JZT A;  4BL7 B;  4MJB A;  3HDC A;  3BCI A;  2P0G A;  2FA4 A;  3VI5 A;  2B3S A;  3DWV A;  1R5P A;  4IQA A;  1OC3 A;  2CX4 A;  4P3Y B;  5ECO B;  2TIR A;  4JBB A;  3TCO A;  1DUG A;  4OWY A;  6GSS A;  3KH9 A;  1R5A A;  4V2N A;  2ALB A;  4IS0 A;  1F2E A;  3F4S A;  3FKF A;  2H75 A;  4MJC A;  1AW9 A;  3HZ4 A;  2O8V B;  4MJE A;  4GSS A;  2VM1 A;  1YDK A;  5IO2 A;  4EDZ A;  1XFL A;  4K6X A;  2B7J A;  1RW1 A;  3US3 A;  2C0E A;  2RII A;  1GUM A;  3HZ8 A;  3FEU A;  1B48 A;  3HA9 A;  3UMA A;  2YZH A;  1CQG A;  2L6C A;  5IOX A;  1M99 A;  2JSZ A;  2C0G A;  2H01 A;  2VL2 A;  1WWJ A;  2CZ2 A;  2DKI A;  1GSS A;  4KW6 A;  4FYC A;  4YQM A;  2YNX A;  5G2Z A;  2R0P A;  1XCC A;  1EGR A;  5ECN B;  3CRT A;  5DJM A;  4EUY A;  2OJL A;  4TRX A;  4AGS A;  4GQC A;  3TRQ A;  5D9V A;  3P8W A;  4BVX A;  5B6N A;  2BTO T;  3LYK A;  4O5Q A;  1G7E A;  4V2M A;  3LXT A;  2DJ1 A;  3M3M A;  2GVP A;  2MMA A;  2IIY A;  1NHO A;  6GSV A;  4L8E A;  1PKZ A;  1UA5 A;  2A4V A;  5B8B A;  3M9K A;  2HI7 A;  4V1A g;  4Q5R A;  3J7Y k;  2CAQ A;  2YV9 A;  4X1U A;  1F9M A;  2LJA A;  4F9Z A;  2IL3 A;  2R2J A;  4TXO A;  5AGY A;  3TOU A;  3IV4 A;  1S3R A;  4DSS A;  2LTK A;  1IYH A;  1GH2 A;  2MMO A;  3H1N A;  5D8I A;  3KCM A;  1SJ6 A;  3KP8 A;  1RK4 A;  3LOR A;  1XIY A;  2DKH A;  3A5I A;  2C3Q A;  2NPB A;  4LA1 A;  3U6V A;  2Z9S A;  3WT1 A;  2X4A A;  2H1A A;  1PL1 A;  3TDG A;  2FWG A;  4MPG A;  4LMV A;  4WEY A;  3ZZX A;  2I3Y A;  3LGC A;  2JAD A;  1R7H A;  3H93 A;  3GUS A;  2AAW A;  2YCD A;  3QPM A;  5JWR B;  2L57 A;  1GWC A;  2VLT A;  3VFI A;  1EGO A;  3HCZ A;  1GNE A;  2DMM A;  5GZZ B;  4KDU A;  1HNB A;  1TRV A;  1XVW A;  5LNK e;  2LQQ A;  4N0Z A;  3HYP A;  5HR2 A;  4PQH A;  1F3B A;  2IFQ B;  1GSF A;  1M3J A;  4G2E A;  3P7X A;  2FUG 2;  2V1M A;  1EOH A;  3CQF A;  5B8A A;  3QDN A;  4YAV A;  2HSM A;  1YKA A;  6GSX A;  1MDK A;  2VCW A;  1PMT A;  4LLR A;  1E2Y A;  4EC0 A;  3RPP A;  4G19 A;  3ERF A;  3VK9 A;  1ZOF A;  5JCG A;  2HRF A;  3CTG A;  1JFU A;  2OAD A;  1Z7R A;  5EVO A;  1K0O A;  3DXB A;  3IHG A;  4MK3 A;  4PXO A;  4YQU A;  3M9J A;  1PGT A;  1YF0 A;  4TR1 B;  5IMF A;  2OE3 A;  4HJ2 A;  3P2A A;  2LS5 A;  4DSQ A;  2PU9 C;  3EVI A;  1XWA A;  4HI7 A;  5B7C A;  1OE8 A;  2I81 A;  1FG4 A;  1ZYP A;  5KOW A;  5AIS A;  1ILO A;  1SD8 A;  3FW2 A;  1SKW B;  3WGD A;  3W8J A;  1TP9 A;  3IBH A;  4IBP A;  4J56 E;  5ECR B;  1QMV A;  5IO0 A;  4NAX A;  1EP8 A;  1FHE A;  4POM A;  2O89 A;  5KOX A;  1T4Y A;  3FYG A;  1T8E B;  2AJQ B;  3DD3 A;  3KTL A;  3A2X A;  2PUK C;  3GL5 A;  3HXS A;  4HJM A;  1F6M C;  4HU9 A;  2DIY A;  4PNF A;  18GS A;  4G10 A;  3GTU A;  4I2U A;  4ZL9 A;  2F9S A;  4IHU A;  1EEJ A;  3DYR A;  5HFK A;  2OBI A;  2R0G A;  4MCU A;  3CSI A;  3F6D A;  1A23 A;  3QAG A;  5LD0 A;  1M2D A;  2K9F A;  3HJM A;  4KDX A;  5CRE A;  1H75 A;  5EPF A;  2IMI A;  3CXG A;  5ECI B;  4TR3 A;  3UBL A;  1PX7 A;  3GST A;  5AIX A;  1WOU A;  1DSB A;  4RUV A;  1QK8 A;  2H76 A;  4CW9 A;  3H8Q A;  1NSW A;  3HVX A;  2DJ2 A;  2JZS A;  3EC3 A;  2MMZ A;  5DQS A;  2E0Q A;  3FHK A;  1PX6 A;  2IWT A;  4FIW A;  4MJA A;  4LMW A;  4IQ1 A;  1JZW A;  1FVJ A;  2WUL A;  2ZNM A;  3WT2 A;  4BVY B;  1EOG A;  2HSY A;  3W8S A;  2FWF A;  5BMU A;  3KGK A;  2R5G A;  3MSZ A;  3TB2 A;  4PX1 A;  2DSA A;  3UIW A;  2V41 A;  1U6T A;  1VGL A;  2LEG A;  5D93 A;  1YEX A;  3TOT A;  2A2R A;  4E8H A;  1TK8 B;  4V2L A;  2VAF A;  2CAI A;  3LWA A;  4USS A;  4JE1 A;  4TXV A;  1TJD A;  4NXI A;  4AJ8 A;  3IK7 A;  3IDV A;  5C00 A;  4BWQ A;  3F3R A;  1I9D A;  2N5A A;  1Z3E A;  2HRK A;  2QKE A;  1YQ1 A;  6GSW A;  2VO4 A;  2GSR A;  3G7J A;  3TKP A;  2F8F A;  4IGJ A;  2GQK A;  3DGQ A;  2M80 A;  3I43 A;  4POK A;  1ZCP A;  5CO3 A;  5ID2 A;  4L0U A;  2E7P A;  2DC5 A;  3QAV A;  2UZ8 A;  5EY6 A;  1TOF A;  1X9S B;  3TJK A;  3FZ5 A;  2IPA A;  2XPD A;  2R6K A;  3O3T A;  3IK9 A;  1ZL9 A;  1K0N A;  2JAC A;  1SL1 B;  2CX3 A;  2JU5 A;  2FWE A;  4CDO A;  1WE0 A;  3L0H A;  4K5R A;  1SYR A;  2HE3 A;  5IPG A;  2K18 A;  4H86 A;  4EL1 A;  2WB9 A;  1VF1 A;  2H19 A;  3RHC A;  4BWS A;  5DQY A;  2P5Q A;  1AQV A;  6GSY A;  2HSH A;  2CZ3 A;  2OE1 A;  3F0I A;  1EWX A;  2WCI A;  2AHE A;  5JCW A;  1GUK A;  2H6Z A;  4I8B A;  4BL7 A;  1XXU A;  4ZB9 A;  3D4M A;  3Q6O A;  22GS A;  2EIQ A;  4ECJ A;  3RBT A;  4ZL8 A;  3GX8 A;  2XC2 A;  2X49 A;  4ML6 A;  1R4W A;  2H72 A;  4HU7 A;  5J3R A;  1XBS A;  4TKY A;  1G6W A;  2VCQ A;  3FK8 A;  1G7O A;  1WRY A;  4K1F A;  2CVD A;  3TKS A;  2WDU A;  2GSS A;  5KN3 A;  5J9B A;  4PUR A;  3JCM L;  1KNG A;  3HY2 A;  4V1A p;  1S3A A;  3ME7 A;  2KUC A;  2VCV A;  1VF2 A;  1VF3 A;  1T1V A;  2R4V A;  17GS A;  3H4K A;  4IP1 A;  2HXK A;  5AN1 A;  5HR3 A;  2WS2 A;  4E8E A;  3GFK A;  3M1G A;  5KN1 A;  3Q74 A;  3N9J A;  2B6M A;  3UL3 A;  1M2A A;  1GSY A;  1E6B A;  3ZRE A;  4MNN A;  4N30 A;  3FY7 A;  4WBJ A;  2R0C A;  3MDK A;  3VWW A;  2YWN A;  5D96 A;  2GZZ A;  5DJL A;  5IM9 A;  2VLU A;  4I97 A;  4K7N A;  5A4V A;  5D9W A;  2V6O A;  1A8Y A;  2HLS A;  1Y25 A;  4FH8 A;  3PPU A;  2H6X A;  1Y6E A;  5IMV A;  1B9X C;  5IOW A;  1GUL A;  2B7K A;  4OO5 A;  4MF5 A;  5G1K A;  3QD9 A;  1NW2 A;  4JED A;  3ZIJ A;  2V32 A;  2FY6 A;  5JWQ B;  2G0F A;  3IXR A;  1MDJ A;  3TJF A;  3HD5 A;  4MDC A;  4AF2 A;  3KD0 A;  2J9H A;  1O8W A;  1KTE A;  1OKT A;  4XS4 B;  3I6A A;  1MTC A;  1O81 A;  3LFL A;  3Q18 A;  1XOB A;  3IAS 2;  1OC8 A;  1BED A;  3LXZ A;  4BIK A;  2LV3 A;  3V1W A;  3TRX A;  3GX0 A;  2RUE A;  3C1R A;  3SWL A;  2TRX A;  2FNO A;  4KCE A;  4MA9 A;  5IMA A;  1YEP A;  2V2G A;  3ME8 A;  4ZB8 A;  1SYX A;  3DEX A;  2V6K A;  3G7I A;  10GS A;  1PL2 A;  4OFM A;  3LW9 A;  3C1S A;  3TGZ A;  2YWI A;  2OE0 A;  1SL2 B;  5JCU A;  2WRT A;  1V2A A;  4KB3 A;  1X0R A;  1USB A;  2VOC A;  4KH7 A;  4X4J A;  2H70 A;  3KZQ A;  4K7O A;  3ZLP A;  4HOJ A;  1PSQ A;  4PTS A;  1X5E A;  5GAP D;  4NHW A;  4F82 A;  4FO5 A;  2F51 A;  3QAW A;  3RPN A;  2IFQ A;  3ZTL A;  1RQM A;  2C3T A;  3FZ9 A;  1K0A A;  4JRR A;  5IPH A;  3F3Q A;  4PUF C;  4NV2 A;  3UJ1 A;  1O73 A;  4Q5Q A;  1UC7 A;  1FOV A;  3ZRD A;  2DJ3 A;  3ZIT A;  4POB A;  2HRA A;  1OE7 A;  1DE2 A;  3IRA A;  4XIH A;  1Q4J A;  4MH2 A;  3QFA C;  1GRX A;  4N11 A;  1U3A A;  3PGT A;  5G30 A;  1TK5 B;  3GNJ A;  3DIE A;  4DSR A;  4XS6 A;  5F07 A;  4K9Z A;  5G31 A;  2OKA A;  2L5L A;  2GDR A;  2N5F A;  1TI3 A;  2H1D A;  3MWH A;  3U5R E;  4TR1 A;  3D5J A;  4GSN A;  2H71 A;  2FHE A;  1M9A A;  4O32 A;  2K6V A;  5ENU A;  3LYP A;  2RUF A;  2X8C A;  3DVW A;  3GN3 A;  3L78 A;  4QL9 A;  4O92 A;  3QMX A;  3SBC A;  1J08 A;  1IYI A;  1WPI A;  3F9U A;  4OFN A;  2VCX A;  3ZIV A;  1OC9 B;  1K3O A;  1TRW A;  3VWV A;  1ZYQ B;  4KDY A;  2WJU A;  14GS A;  5H5Q A;  1W4V A;  3FMW A;  1U3I A;  2C80 A;  3IE3 A;  2EC4 A;  1UN2 A;  3FZ4 A;  4G9H A;  1OYJ A;  5H5S A;  1X5C A;  2F3M A;  3ZL5 A;  1N8J A;  3RHB A;  1Z6N A;  1AUC A;  2H74 A;  1SL0 B;  2H73 A;  1GLP A;  2LUS A;  2KP1 A;  3UAP A;  4F0C A;  4BPY A;  2GGT A;  3Q19 A;  4Q5F A;  4ZBB A;  3KEB A;  3C73 A;  1SK0 A;  1GTB A;  3GH9 A;  4EIP A;  3F4R A;  4NV5 A;  4K7I A;  4EF0 A;  1Z7P A;  4WF5 A;  4NMU A;  5CRG A;  5CYY A;  5DAK B;  1XWG A;  4IW9 A;  5CRH A;  3DML A;  1V9W A;  1K0M A;  2I1U A;  2KOK A;  2YPM A;  4IEL A;  1AXD A;  2GZY A;  2H66 A;  2LRN A;  2GLR A;  1PQN A;  4XHM A;  4ACS A;  1ZMA A;  4KCA A;  1FB6 A;  3J7Y b;  3D21 A;  3K8N A;  2LJR A;  1LJR A;  4MAB A;  5GSS A;  3LQ7 A;  1R26 A;  4K0G A;  5C04 A;  4PQI A;  2AUV A;  3A5W A;  3EMX A;  5DCH A;  2VIM A;  1JZO A;  1SK2 A;  1LU4 A;  3D4T A;  1XG8 A;  4FQU A;  6GST A;  2B5X A;  4BVY A;  2ON7 A;  4PQ1 A;  3LSZ A;  4ZBD A;  4MZC A;  1YF1 A;  4RQX A;  3TKS C;  1I5G A;  3ZML A;  2LNS A;  2O87 A;  1THO A;  2H1G A;  1Z9H A;  2KP2 A;  3I9V 2;  3N5O A;  2NBS A;  5ELA A;  5DDL A;  2C3N A;  1BG5 A;  5FHI A;  5IIZ A;  1DE1 A;  1TDI A;  3WYW A;  2GSQ A;  2YJ7 A;  3IC8 A;  2KLX A;  1BQ7 A;  2A2S A;  2CQ9 A;  4IJI A;  4F0B A;  2XPE A;  4PNG A;  3R3E A;  1C72 A;  1ZYE A;  4HZ2 A;  3C8E A;  4WXT A;  1B4Q A;  4MZB A;  4HS1 A;  1A2M A;  3EE2 A;  3ZVJ A;  2TRC P;  19GS A;  4J57 E;  2MZC A;  2N5B A;  1ERU A;  3GKX A;  1GSD A;  1X9M B;  3D0Z A;  3VPQ A;  4ILF A;  4PGT A; 
#chains in the Genus database with same CATH homology
 1GSE A;  2NVL A;  2B5E A;  2C0D A;  2IJY A;  3GHA A;  3RAZ A;  2BMX A;  1MD4 A;  2O85 A;  2VD1 A;  3WGE A;  2DLX A;  5ABR A;  1GTU A;  1AIU A;  1FAA A;  3GL3 A;  3L9S A;  1A2J A;  3GMF A;  4XRA A;  2FGX A;  4MF6 A;  4FYU A;  4RQR A;  2C0F A;  4K5S A;  3E9J B;  3O76 A;  1Z5Y E;  3A2W A;  1T7P B;  4D73 B;  2P31 A;  5J41 A;  4HZ4 A;  3IAM 2;  1SD9 A;  1AQW A;  4MH3 A;  3IA1 A;  2VL2 C;  1SJZ A;  4TW5 A;  5ECP B;  2HZF A;  4DEJ A;  3ZFL A;  4WR5 A;  4NWY A;  1FW1 A;  4GCI A;  1MEK A;  1SK1 A;  4MZW A;  5HR0 A;  1NM3 A;  2H1B A;  1TKD B;  1XPV A;  5CP1 A;  7GSS A;  1JHB A;  5E4W A;  3BBY A;  2K8V A;  1T00 A;  2YWM A;  1JZD A;  2GS3 A;  2FA8 A;  2NTO A;  2LKU A;  3TKR A;  4XS1 A;  3F8U A;  4J2F A;  2K8S A;  3IC4 A;  2EIO A;  4HQS A;  3FR3 A;  3BD2 A;  4ZXG A;  2FWH A;  3TKQ A;  2DBC A;  4GF0 A;  4EE0 A;  3G9B A;  4O5R A;  3L9U A;  4AJ7 A;  3GH6 A;  2HZE B;  5D9T A;  3UBK A;  4WBR D;  1ACV A;  3PIN A;  3R2Q A;  2X64 A;  2PVQ A;  1OKD A;  5G5F A;  2FD3 A;  1FVK A;  2FLS A;  2AYT A;  1TW9 A;  4K0N A;  5CRW A;  1ERT A;  5IMD A;  3FRC A;  3GKN A;  2WFC A;  1QGV A;  5DAL B;  4GWR A;  4TN8 A;  4XRD A;  1SU9 A;  3GKK A;  2ZUP A;  3QCP A;  4XS4 A;  2XBI A;  3TJB A;  2HT9 A;  4G0I A;  4Z2U A;  11GS A;  4WF4 A;  3E3E A;  2WGR A;  2H30 A;  2OA7 A;  3RDW A;  1ST9 A;  1EV4 A;  2QC7 A;  1YJ6 A;  5HFI A;  2NDO A;  4ISD A;  1TU8 A;  3M0F A;  4TR4 A;  5INY A;  1BX9 A;  9GSS A;  3MIX A;  1GNW A;  4K2X A;  2JL4 A;  5COH A;  1KEB A;  2YP6 A;  5D9X A;  4RI7 A;  4O7H A;  4ZB6 A;  8GSS A;  1H4O A;  4OD7 A;  4MMM A;  1PA3 A;  3D22 A;  3HJP A;  3A2V A;  1S3D A;  3UVT A;  5A4W A;  3ERG A;  4ML1 A;  3BOA A;  4EDY A;  5F8B A;  3LJR A;  1T4Z A;  1K0C A;  4KE3 A;  3MYD A;  2A4H A;  2AV4 A;  4Z7X A;  4IVF A;  3TJJ A;  1JZR A;  5EL8 A;  2JZR A;  1TRU A;  1XWK A;  5ECQ B;  5J9C A;  1V58 A;  1O85 A;  1K3L A;  4F2I A;  2E2G A;  2R37 A;  2O7K A;  2QA1 A;  5CAX A;  2PPT A;  2EIR A;  2WZ9 A;  1OVN A;  4OCE A;  5A5K A;  16GS A;  4EKZ A;  2I9H A;  1PD2 1;  12GS A;  5KN0 A;  2AB6 A;  3VPT A;  3KTB A;  4TVE A;  1A2L A;  4XTS A;  2CT6 A;  1WIK A;  3VLN A;  4GXZ A;  4WR4 A;  2VLV A;  4KSM A;  1SKS B;  1S3C A;  2LRC A;  4EO3 A;  2P5R A;  3GRX A;  1X5D A;  5ECM B;  1N2A A;  1FOH A;  2M72 A;  4A5P A;  3APS A;  3GUR A;  4Q5N A;  1W89 A;  4ZIL A;  2CV4 A;  3PH9 A;  4Z2R A;  3C7M A;  3EMP A;  2OBK A;  1PRX A;  4GST A;  1OC9 A;  4IJ3 A;  4ZL7 A;  1DBY A;  2ZCT A;  3BCK A;  1WJK A;  4IKH A;  1ERW A;  1EP7 A;  1GTI A;  4L5O A;  4I5Q A;  3KH7 A;  1LBK A;  2LQO A;  1XW9 A;  4JZQ A;  3HKR A;  2DJJ A;  3GIX A;  3EU4 A;  2X99 A;  5F06 A;  2GT6 A;  1ZGN A;  2DML A;  3NZN A;  4CY6 A;  2H8L A;  3ED3 A;  3P90 A;  3UOM A;  1HQO A;  1GTA A;  2YZU A;  2KHP A;  3KXO A;  3OR5 A;  1O6J A;  1ON4 A;  5IMC A;  1OAZ A;  4N0V A;  3WGX A;  1JLW A;  2FCH A;  1TK0 B;  1YZX A;  5E59 A;  4POL A;  2B1L A;  3O6T A;  5DAK A;  1ZZY A;  2L4C A;  4YKG A;  2L6D A;  1V98 A;  1SEN A;  4I6X A;  4RI6 A;  2MMN A;  2RM5 A;  2MBT A;  3A3T A;  3HJO A;  3UAR A;  1B4P A;  2PGT A;  4BVX B;  1HD2 A;  1ABA A;  4XCS A;  2REM A;  1QXH A;  2HFD A;  2LST A;  5DCG A;  4N10 A;  3KM6 A;  4ZIJ A;  1XW6 A;  1B9Y C;  3EU3 A;  3G7Y A;  3TJG A;  3L4N A;  4CHS A;  5G1L A;  3D6I A;  5HR1 A;  1XOA A;  3GYK A;  4YQV A;  1BAY A;  2C1Y A;  2XBQ A;  2IMF A;  1QFN A;  1GSQ A;  4KF9 A;  1JLV A;  1O7U A;  4IN0 A;  5HFG A;  4L5L A;  1F37 A;  4TXO B;  5IMZ A;  4K2D A;  5L71 A;  3ZVJ D;  2B1K A;  2IMD A;  4KAE A;  3CBU A;  1BJX A;  4DSS B;  1AQX A;  2I4A A;  3UVH A;  5FWG A;  4AJ6 A;  3ZFB A;  1CQH A;  4LL1 B;  1ML6 A;  2PMT A;  1TRS A;  2VL3 A;  1XVQ A;  4Z2T A;  1K0D A;  3IOS A;  4K8M A;  4ICY A;  1K3Y A;  2CA8 A;  3EPT A;  1A0F A;  4NHZ A;  4YAP A;  2JSY A;  2GQM A;  3GKM A;  3NOF A;  5IQY A;  4YKF A;  1XW5 A;  2LNT A;  2HNL A;  3BJ5 A;  2MBS A;  2L59 A;  3VI7 A;  6GSU A;  4KGI A;  4F03 A;  5H5R A;  5F0G A;  2LRT A;  2VM2 A;  4WET A;  2MYG A;  3GSS A;  1AC1 A;  4QL7 A;  1J0F A;  3DVX A;  2DIZ A;  3ZMK A;  1G0T A;  4HQZ A;  3DKS A;  4ECC A;  4EIQ A;  1B8X A;  2C4J A;  2F8A A;  3FZA A;  3VWX A;  5ELG A;  1XWC A;  2R3X A;  2IME A;  4ECB A;  5G5E A;  3TRP A;  2L4Q A;  2DJK A;  2YAN A;  4D73 A;  4ID0 A;  3KMO A;  2VL9 A;  1U87 A;  4ECI A;  3LG6 A;  1T3B A;  4GQF A;  1XZO A;  1EZK A;  3APO A;  3WD6 A;  2M46 A;  2BJX A;  4FYB A;  2YWO A;  1TI1 A;  3KJY A;  4MLY A;  2E2M A;  5F05 A;  3M8N A;  2PER A;  1EEM A;  2LJK A;  3PR8 A;  3LEF A;  1QQ2 A;  1A24 A;  4HUA A;  2VCT A;  4L0W A;  3TUE A;  2DJ0 A;  5KN2 A;  3F4T A;  3C71 A;  4TR0 A;  1BYE A;  3CRU A;  2IMK A;  5CNW A;  1Q98 A;  5GAN D;  3GA4 A;  5ECL B;  20GS A;  5D73 A;  2CVK A;  2QGV A;  4LL4 B;  4OMV A;  1XWB A;  1GUH A;  4KUN A;  5FT3 A;  2GTU A;  1J9B A;  4KA0 A;  4CY8 A;  3CTF A;  1THX A;  2G2Q A;  2VUP A;  5HQP A;  2HZE A;  3GTU B;  4GTU A;  3TKS E;  2H0G A;  1QUW A;  2D2Z A;  3ZYW A;  1HYU A;  5LCZ A;  2H0H A;  1YY7 A;  1MD3 A;  3ERW A;  3UEM A;  5GST A;  1ERV A;  3KP9 A;  1PKW A;  1O8X A;  4EXJ A;  3EUR A;  3IPZ A;  1VF4 A;  3F63 A;  5DAL A;  1TXX A;  5J5N A;  4ZBA A;  2XHF A;  4X43 A;  2J23 A;  2H6Y A;  2IN3 A;  1MDI A;  1PN0 A;  3HVS A;  2YJH A;  1U88 A;  4HEA 2;  4QQ7 A;  1K0B A;  3E0U A;  5AIV A;  1NHY A;  1G6Y A;  2CVB A;  1M9B A;  5DBQ A;  3KIJ A;  4ULX A;  1M7T A;  3GV1 A;  4JU5 A;  1GSU A;  1X9W B;  2VD0 A;  3CSH A;  1HNA A;  3DRN A;  3CSJ A;  5ECK B;  1GLQ A;  2QA2 A;  2PVO C;  1FO5 A;  4BA7 A;  3EYT A;  1TTZ A;  2QSI A;  5CRD A;  4G0L A;  2X8H A;  3F6F A;  3MAK A;  4OO4 A;  4EVM A;  2PN8 A;  4MF7 A;  1KBN A;  5JWO B;  4YH2 A;  3AY8 A;  4OCF A;  1WMJ A;  1SKR B;  1A8L A;  2OAC A;  2HRN A;  1V40 A;  3EIN A;  2RLI A;  1TU7 A;  3VUR A;  4KX4 A;  2GZP A;  4GRF A;  1PN9 A;  3CMI A;  4JR4 A;  1UVZ A;  3L9V A;  1SJI A;  1V57 A;  4G0K A;  4KND A;  3I69 A;  4WKW A;  2GQL A;  1EV9 A;  4OFT A;  2ON5 A;  3QR6 A;  13GS A;  1URM A;  5ECH B;  1VRS D;  2YV7 A;  5KEJ A;  4PUA A;  3MNG A;  5A4U A;  1ZYN A;  2GST A;  2B5Y A;  4KSO A;  2PBJ A;  1AAZ A;  3W6G A;  1Z6M A;  5ID2 B;  1WP0 A;  3ISO A;  2A2P A;  2YOI A;  4MPF A;  3FR6 A;  3H79 A;  3FR9 A;  2L5O A;  2HYX A;  3HVV A;  5DVB A;  2VCZ A;  4GLT A;  3VWU A;  1FB0 A;  4X0X A;  3IHQ A;  3NIV A;  2RM6 A;  1HNC A;  2ES7 A;  4HDE A;  4I2T A;  4O5U A;  3CYN A;  4DVC A;  1A0R P;  3QOU A;  5B6M A;  3S9F A;  5BRT A;  3QFB C;  2PWJ A;  1YKC A;  1GP1 A;  4IP6 A;  1M2B A;  1F3A A;  2C8U A;  4NPB A;  3KMN A;  4TOP A;  5J4U A;  5ECS A;  2GT5 A;  4MP4 A;  2H0I A;  2YN1 A;  3HHV A;  1M0U A;  3APQ A;  1GL8 A;  3IR4 A;  3EWL A;  4JR6 A;  2X8G A;  2JZT A;  4BL7 B;  4MJB A;  3HDC A;  3BCI A;  2P0G A;  2FA4 A;  3VI5 A;  2B3S A;  3DWV A;  1R5P A;  4IQA A;  1OC3 A;  2CX4 A;  4P3Y B;  5ECO B;  2TIR A;  4JBB A;  3TCO A;  1DUG A;  4OWY A;  6GSS A;  3KH9 A;  1R5A A;  4V2N A;  2ALB A;  4IS0 A;  1F2E A;  3F4S A;  3FKF A;  2H75 A;  4MJC A;  1AW9 A;  3HZ4 A;  2O8V B;  4MJE A;  4GSS A;  2VM1 A;  1YDK A;  5IO2 A;  4EDZ A;  1XFL A;  4K6X A;  2B7J A;  1RW1 A;  3US3 A;  2C0E A;  2RII A;  1GUM A;  3HZ8 A;  3FEU A;  1B48 A;  3HA9 A;  3UMA A;  2YZH A;  1CQG A;  2L6C A;  5IOX A;  1M99 A;  2JSZ A;  2C0G A;  2H01 A;  2VL2 A;  1WWJ A;  2CZ2 A;  2DKI A;  1GSS A;  4KW6 A;  4FYC A;  4YQM A;  2YNX A;  5G2Z A;  2R0P A;  1XCC A;  1EGR A;  5ECN B;  3CRT A;  5DJM A;  4EUY A;  2OJL A;  4TRX A;  4AGS A;  4GQC A;  3TRQ A;  5D9V A;  3P8W A;  4BVX A;  5B6N A;  2BTO T;  3LYK A;  4O5Q A;  1G7E A;  4V2M A;  3LXT A;  2DJ1 A;  3M3M A;  2GVP A;  2MMA A;  2IIY A;  1NHO A;  6GSV A;  4L8E A;  1PKZ A;  1UA5 A;  2A4V A;  5B8B A;  3M9K A;  2HI7 A;  4V1A g;  4Q5R A;  3J7Y k;  2CAQ A;  2YV9 A;  4X1U A;  1F9M A;  2LJA A;  4F9Z A;  2IL3 A;  2R2J A;  4TXO A;  5AGY A;  3TOU A;  3IV4 A;  4DSS A;  2LTK A;  1IYH A;  1GH2 A;  2MMO A;  3H1N A;  5D8I A;  3KCM A;  1SJ6 A;  3KP8 A;  1RK4 A;  3LOR A;  1XIY A;  2DKH A;  3A5I A;  2C3Q A;  2NPB A;  4LA1 A;  3U6V A;  2Z9S A;  3WT1 A;  2X4A A;  2H1A A;  1PL1 A;  3TDG A;  2FWG A;  4MPG A;  4LMV A;  4WEY A;  3ZZX A;  2I3Y A;  3LGC A;  2JAD A;  1R7H A;  3H93 A;  3GUS A;  2AAW A;  2YCD A;  3QPM A;  5JWR B;  2L57 A;  1GWC A;  2VLT A;  3VFI A;  1EGO A;  3HCZ A;  1GNE A;  2DMM A;  5GZZ B;  4KDU A;  1HNB A;  1TRV A;  1XVW A;  5LNK e;  2LQQ A;  4N0Z A;  3HYP A;  5HR2 A;  4PQH A;  1F3B A;  2IFQ B;  1GSF A;  4G2E A;  3P7X A;  2FUG 2;  2V1M A;  1EOH A;  5B8A A;  3QDN A;  4YAV A;  2HSM A;  1YKA A;  6GSX A;  1MDK A;  2VCW A;  1PMT A;  4LLR A;  1E2Y A;  4EC0 A;  3RPP A;  4G19 A;  3ERF A;  3VK9 A;  1ZOF A;  5JCG A;  2HRF A;  3CTG A;  1JFU A;  2OAD A;  1Z7R A;  5EVO A;  1K0O A;  3DXB A;  3IHG A;  4MK3 A;  4PXO A;  4YQU A;  3M9J A;  1PGT A;  1YF0 A;  4TR1 B;  5IMF A;  2OE3 A;  4HJ2 A;  3P2A A;  2LS5 A;  4DSQ A;  2PU9 C;  3EVI A;  1XWA A;  4HI7 A;  5B7C A;  1OE8 A;  2I81 A;  1FG4 A;  1ZYP A;  5KOW A;  5AIS A;  1ILO A;  1SD8 A;  3FW2 A;  1SKW B;  3WGD A;  3W8J A;  1TP9 A;  3IBH A;  4IBP A;  4J56 E;  5ECR B;  1QMV A;  5IO0 A;  4NAX A;  1EP8 A;  1FHE A;  4POM A;  2O89 A;  5KOX A;  1T4Y A;  3FYG A;  1T8E B;  2AJQ B;  3DD3 A;  3KTL A;  3A2X A;  2PUK C;  3GL5 A;  3HXS A;  4HJM A;  1F6M C;  4HU9 A;  2DIY A;  4PNF A;  18GS A;  4G10 A;  3GTU A;  4I2U A;  4ZL9 A;  2F9S A;  4IHU A;  1EEJ A;  3DYR A;  5HFK A;  2OBI A;  2R0G A;  4MCU A;  3CSI A;  3F6D A;  1A23 A;  3QAG A;  5LD0 A;  1M2D A;  2K9F A;  3HJM A;  4KDX A;  5CRE A;  1H75 A;  5EPF A;  2IMI A;  3CXG A;  5ECI B;  4TR3 A;  3UBL A;  1PX7 A;  3GST A;  5AIX A;  1WOU A;  1DSB A;  4RUV A;  1QK8 A;  2H76 A;  4CW9 A;  3H8Q A;  1NSW A;  3HVX A;  2DJ2 A;  2JZS A;  3EC3 A;  2MMZ A;  5DQS A;  2E0Q A;  3FHK A;  1PX6 A;  2IWT A;  4FIW A;  4MJA A;  4LMW A;  4IQ1 A;  1JZW A;  1FVJ A;  2WUL A;  2ZNM A;  3WT2 A;  4BVY B;  1EOG A;  2HSY A;  3W8S A;  2FWF A;  5BMU A;  3KGK A;  2R5G A;  3MSZ A;  3TB2 A;  4PX1 A;  2DSA A;  3UIW A;  2V41 A;  1U6T A;  1VGL A;  2LEG A;  5D93 A;  1YEX A;  3TOT A;  2A2R A;  4E8H A;  1TK8 B;  4V2L A;  2VAF A;  2CAI A;  3LWA A;  4USS A;  4JE1 A;  4TXV A;  1TJD A;  4NXI A;  4AJ8 A;  3IK7 A;  3IDV A;  5C00 A;  4BWQ A;  3F3R A;  1I9D A;  2N5A A;  1Z3E A;  2HRK A;  2QKE A;  1YQ1 A;  6GSW A;  2VO4 A;  2GSR A;  3G7J A;  3TKP A;  2F8F A;  4IGJ A;  2GQK A;  3DGQ A;  2M80 A;  3I43 A;  4POK A;  1ZCP A;  5CO3 A;  5ID2 A;  4L0U A;  2E7P A;  2DC5 A;  3QAV A;  2UZ8 A;  5EY6 A;  1TOF A;  1X9S B;  3TJK A;  3FZ5 A;  2IPA A;  2XPD A;  2R6K A;  3O3T A;  3IK9 A;  1ZL9 A;  1K0N A;  2JAC A;  1SL1 B;  2CX3 A;  2JU5 A;  2FWE A;  4CDO A;  1WE0 A;  3L0H A;  4K5R A;  1SYR A;  2HE3 A;  5IPG A;  2K18 A;  4H86 A;  4EL1 A;  2WB9 A;  1VF1 A;  2H19 A;  3RHC A;  4BWS A;  5DQY A;  2P5Q A;  1AQV A;  6GSY A;  2HSH A;  2CZ3 A;  2OE1 A;  3F0I A;  1EWX A;  2WCI A;  2AHE A;  5JCW A;  1GUK A;  2H6Z A;  4I8B A;  4BL7 A;  1XXU A;  4ZB9 A;  3D4M A;  3Q6O A;  22GS A;  2EIQ A;  4ECJ A;  3RBT A;  4ZL8 A;  3GX8 A;  2XC2 A;  2X49 A;  4ML6 A;  1R4W A;  2H72 A;  4HU7 A;  5J3R A;  1XBS A;  4TKY A;  1G6W A;  2VCQ A;  3FK8 A;  1G7O A;  1WRY A;  4K1F A;  2CVD A;  3TKS A;  2WDU A;  2GSS A;  5KN3 A;  5J9B A;  4PUR A;  3JCM L;  1KNG A;  3HY2 A;  4V1A p;  1S3A A;  3ME7 A;  2KUC A;  2VCV A;  1VF2 A;  1VF3 A;  1T1V A;  2R4V A;  17GS A;  3H4K A;  4IP1 A;  2HXK A;  5AN1 A;  5HR3 A;  2WS2 A;  4E8E A;  3GFK A;  3M1G A;  5KN1 A;  3Q74 A;  3N9J A;  2B6M A;  3UL3 A;  1M2A A;  1GSY A;  1E6B A;  3ZRE A;  4MNN A;  4N30 A;  3FY7 A;  4WBJ A;  2R0C A;  3MDK A;  3VWW A;  2YWN A;  5D96 A;  2GZZ A;  5DJL A;  5IM9 A;  2VLU A;  4I97 A;  4K7N A;  5A4V A;  5D9W A;  2V6O A;  1A8Y A;  2HLS A;  1Y25 A;  4FH8 A;  3PPU A;  2H6X A;  1Y6E A;  5IMV A;  1B9X C;  5IOW A;  1GUL A;  2B7K A;  4OO5 A;  4MF5 A;  5G1K A;  3QD9 A;  1NW2 A;  4JED A;  3ZIJ A;  2V32 A;  2FY6 A;  5JWQ B;  2G0F A;  3IXR A;  1MDJ A;  3TJF A;  3HD5 A;  4MDC A;  4AF2 A;  3KD0 A;  2J9H A;  1O8W A;  1KTE A;  1OKT A;  4XS4 B;  3I6A A;  1MTC A;  1O81 A;  3LFL A;  3Q18 A;  1XOB A;  3IAS 2;  1OC8 A;  1BED A;  3LXZ A;  2LV3 A;  3V1W A;  3TRX A;  3GX0 A;  2RUE A;  3C1R A;  3SWL A;  2TRX A;  2FNO A;  4KCE A;  4MA9 A;  5IMA A;  1YEP A;  2V2G A;  3ME8 A;  4ZB8 A;  1SYX A;  3DEX A;  2V6K A;  3G7I A;  10GS A;  1PL2 A;  4OFM A;  3LW9 A;  3C1S A;  3TGZ A;  2YWI A;  2OE0 A;  1SL2 B;  5JCU A;  2WRT A;  1V2A A;  4KB3 A;  1X0R A;  1USB A;  2VOC A;  4KH7 A;  4X4J A;  2H70 A;  3KZQ A;  4K7O A;  3ZLP A;  4HOJ A;  1PSQ A;  4PTS A;  1X5E A;  5GAP D;  4NHW A;  4F82 A;  4FO5 A;  2F51 A;  3QAW A;  3RPN A;  2IFQ A;  3ZTL A;  1RQM A;  2C3T A;  3FZ9 A;  1K0A A;  4JRR A;  5IPH A;  3F3Q A;  4PUF C;  4NV2 A;  3UJ1 A;  1O73 A;  4Q5Q A;  1UC7 A;  1FOV A;  3ZRD A;  2DJ3 A;  3ZIT A;  4POB A;  2HRA A;  1OE7 A;  1DE2 A;  3IRA A;  4XIH A;  1Q4J A;  4MH2 A;  3QFA C;  1GRX A;  4N11 A;  1U3A A;  3PGT A;  5G30 A;  1TK5 B;  3GNJ A;  3DIE A;  4DSR A;  4XS6 A;  5F07 A;  4K9Z A;  5G31 A;  2OKA A;  2L5L A;  2GDR A;  2N5F A;  1TI3 A;  2H1D A;  3MWH A;  3U5R E;  4TR1 A;  3D5J A;  4GSN A;  2H71 A;  2FHE A;  1M9A A;  4O32 A;  2K6V A;  5ENU A;  3LYP A;  2RUF A;  2X8C A;  3DVW A;  3GN3 A;  3L78 A;  4QL9 A;  4O92 A;  3QMX A;  3SBC A;  1J08 A;  1IYI A;  1WPI A;  3F9U A;  4OFN A;  2VCX A;  3ZIV A;  1OC9 B;  1K3O A;  1TRW A;  3VWV A;  1ZYQ B;  4KDY A;  2WJU A;  14GS A;  5H5Q A;  1W4V A;  3FMW A;  1U3I A;  2C80 A;  3IE3 A;  2EC4 A;  1UN2 A;  3FZ4 A;  4G9H A;  1OYJ A;  5H5S A;  1X5C A;  2F3M A;  3ZL5 A;  1N8J A;  3RHB A;  1Z6N A;  1AUC A;  2H74 A;  1SL0 B;  2H73 A;  1GLP A;  2LUS A;  2KP1 A;  3UAP A;  4F0C A;  4BPY A;  2GGT A;  3Q19 A;  4Q5F A;  4ZBB A;  3KEB A;  3C73 A;  1SK0 A;  1GTB A;  3GH9 A;  4EIP A;  3F4R A;  4NV5 A;  4K7I A;  4EF0 A;  1Z7P A;  4WF5 A;  4NMU A;  5CRG A;  5CYY A;  5DAK B;  1XWG A;  4IW9 A;  5CRH A;  3DML A;  1V9W A;  1K0M A;  2I1U A;  2KOK A;  2YPM A;  4IEL A;  1AXD A;  2GZY A;  2H66 A;  2LRN A;  2GLR A;  1PQN A;  4XHM A;  4ACS A;  1ZMA A;  4KCA A;  1FB6 A;  3J7Y b;  3D21 A;  3K8N A;  2LJR A;  1LJR A;  4MAB A;  5GSS A;  3LQ7 A;  1R26 A;  4K0G A;  5C04 A;  4PQI A;  2AUV A;  3A5W A;  3EMX A;  5DCH A;  2VIM A;  1JZO A;  1SK2 A;  1LU4 A;  3D4T A;  4FQU A;  6GST A;  2B5X A;  4BVY A;  2ON7 A;  4PQ1 A;  3LSZ A;  4ZBD A;  4MZC A;  1YF1 A;  4RQX A;  3TKS C;  1I5G A;  3ZML A;  2LNS A;  2O87 A;  1THO A;  2H1G A;  1Z9H A;  2KP2 A;  3I9V 2;  3N5O A;  2NBS A;  5ELA A;  5DDL A;  2C3N A;  1BG5 A;  5FHI A;  5IIZ A;  1DE1 A;  1TDI A;  3WYW A;  2GSQ A;  2YJ7 A;  3IC8 A;  2KLX A;  1BQ7 A;  2A2S A;  2CQ9 A;  4IJI A;  4F0B A;  2XPE A;  4PNG A;  3R3E A;  1C72 A;  1ZYE A;  4HZ2 A;  3C8E A;  4WXT A;  1B4Q A;  4MZB A;  4HS1 A;  1A2M A;  3EE2 A;  3ZVJ A;  2TRC P;  19GS A;  4J57 E;  2MZC A;  2N5B A;  1ERU A;  3GKX A;  1GSD A;  1X9M B;  3D0Z A;  3VPQ A;  4ILF A;  4PGT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...