2H75A

Crystal structure of thioredoxin mutant d13e in hexagonal (p61) space group
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
107
structure length
107
Chain Sequence
DKIIHLTDDSFETDVLKADGAILVDFWAEWCGPCKMIAPILDEIADEYQGKLTVAKLNIDQNPGTAPKYGIRGIPTLLLFKNGEVAATKVGALSKGQLKEFLDANLA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Thioredoxin
publication title Crystal Structure of Thioredoxin Mutant D13E in Hexagonal (p61) Space Group
rcsb
source organism Escherichia coli
molecule tags Electron transport
total genus 29
structure length 107
sequence length 107
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-06-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00085 Thioredoxin Thioredoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 2h75A00
2H1DA 4H86A 4Q5RA 4V2LA 3GURA 10GSA 1YF1A 4K8MA 4O5RA 5G31A 1AXDA 1WPIA 3CBUA 2ES7A 5D9VA 3KH9A 2RIIA 4D73B 2PMTA 2H0IA 3APQA 3QDNA 2M80A 1A23A 4JR4A 4AJ8A 1V57A 4GXZA 2OBIA 1PSQA 2VCTA 2B3SA 2VL3A 2CX3A 2HYXA 5IOXA 2YJHA 4ZB6A 5ECNB 1K3YA 2ALBA 2Z9SA 3GTUB 2WJUA 2LSTA 2I1UA 4XCSA 2M46A 1M99A 2VD1A 1GTBA 3PH9A 4WBRD 1F3AA 4ZBBA 5EPFA 3HJMA 3DKSA 2VCQA 5C04A 1RQMA 4EUYA 5DALB 1AQWA 4KE3A 3FW2A 2AB6A 1OC8A 2YWOA 5JCGA 4EL1A 2I4AA 3QD9A 5HFIA 2FD3A 1YZXA 1OC3A 2H19A 1B9YC 2GS3A 2H6XA 2DIYA 3M0FA 1FW1A 3EINA 4HUAA 2CT6A 5DVBA 4HOJA 1HQOA 5IMCA 3HY2A 1U87A 4GQCA 1GP1A 2BTOT 1O6JA 3AY8A 3RPPA 1VGLA 2JZSA 1VF1A 2CVKA 2O85A 4ML1A 4POKA 2L4CA 5IO2A 5IMFA 1SK1A 4TR3A 2WZ9A 3NZNA 1GH2A 1TRWA 1HYUA 4I2UA 5AN1A 3FYGA 3Q18A 2C3QA 1XW6A 1KNGA 1U3IA 1FB6A 2CZ3A 2BJXA 4TR1B 2L5LA 3UMAA 2L59A 5J41A 4ISDA 1GUKA 3VI7A 1JZRA 3HXSA 3HKRA 3TUEA 1ERVA 1U3AA 2B7JA 3DD3A 2YZUA 4AF2A 5IQYA 3ZREA 2GQMA 3M9JA 1WE0A 1YEPA 4MDCA 5DAKA 3CYNA 4IKHA 4WBJA 5FWGA 4WETA 3ZFLA 2A2RA 4PGTA 3Q6OA 4WEYA 2FY6A 2B6MA 4K1FA 1TXXA 1MTCA 4HS1A 2OE3A 1K0NA 2EIQA 3E3EA 1SENA 1H4OA 18GSA 5KN1A 1XWBA 1J0FA 2VUPA 1M2BA 3GH6A 2LQQA 5FHIA 1Z3EA 4KW6A 4ECBA 1VF2A 1EZKA 2KOKA 3L78A 2PWJA 1PMTA 5GSTA 1X5CA 2IJYA 2LEGA 4N0VA 2IFQB 1NSWA 1Q98A 4IQ1A 4F03A 5F07A 1AC1A 2DJ1A 4MH2A 4L5LA 3D21A 1DUGA 1QMVA 2GZZA 3DMLA 3IRAA 5GSSA 3GYKA 2YN1A 2NPBA 3HA9A 1WMJA 1GTUA 5A4UA 5IMAA 2PERA 4YH2A 2WGRA 3QAGA 3QPMA 5ECRB 3QR6A 3ERGA 4IS0A 4V1Ag 2OACA 1O81A 4O7HA 2R5GA 2RUFA 4PQHA 2H75A 4ZL8A 2FLSA 4L0WA 5IIZA 3HYPA 1BEDA 1HNAA 1B8XA 3KD0A 2ZNMA 1RW1A 1JLWA 4FIWA 12GSA 4G9HA 3TB2A 2KUCA 4JZQA 3LORA 2CQ9A 1CQGA 4MH3A 3D0ZA 4KUNA 2LNTA 3APOA 4FYBA 5CYYA 2XPDA 1TRVA 4XRDA 3TKSE 3TJJA 4MLYA 4K0GA 4TXOA 5LNKe 3C7MA 3U5RE 2OJLA 4GSTA 4IELA 1THXA 2K8VA 3VWUA 1Z6NA 4JE1A 3EMPA 4ECJA 4HDEA 4POMA 4ULXA 2HNLA 5DCGA 2YJ7A 3CMIA 2YOIA 3CRUA 4KAEA 1E6BA 2L6CA 11GSA 3EWLA 2EC4A 2LUSA 1EV9A 3C1RA 1BAYA 3E9JB 3GKKA 4K6XA 2V6OA 3GTUA 2H30A 1U6TA 2V32A 1OKTA 1R4WA 1OKDA 1QQ2A 5KN3A 3HD5A 1B48A 1YKCA 3I69A 2F8AA 4I6XA 1I5GA 1LBKA 4XIHA 5B6NA 3HJPA 3W6GA 1NM3A 5JCUA 3VWWA 3KIJA 2OBKA 1C72A 4FYUA 4HJMA 1SKWB 3VWVA 3E0UA 2ON5A 5DALA 5D9XA 4ZB8A 1M9BA 3NOFA 5CRDA 4I2TA 8GSSA 4KSOA 2VCZA 4MZCA 2OA7A 2V1MA 3R2QA 3FZ9A 4Z7XA 1V2AA 4LL1B 3SBCA 2ON7A 1MD3A 5E4WA 3KZQA 2RUEA 2YNXA 3HDCA 1XW5A 17GSA 1PD21 3UVTA 1O73A 2B1KA 1XWKA 1N8JA 1HNCA 3ZFBA 1YQ1A 3F3QA 3I9V2 2HZEA 4BL7A 3N5OA 4MF5A 2IMKA 3MWHA 3UVHA 4GWRA 1M7TA 3CSJA 4TN8A 3GUSA 2TRXA 3ZVJD 5JCWA 5L71A 5A4VA 5ABRA 5IM9A 3GL5A 1ZCPA 3IR4A 3ED3A 1XPVA 1FVKA 1Z9HA 2D2ZA 3DEXA 3GKXA 4IQAA 1Y6EA 3HZ8A 3H8QA 3TKRA 3F8UA 3GX8A 3TOUA 5ELGA 1R7HA 1TDIA 2GQLA 4XRAA 4TR4A 1A0RP 4XS4B 1GL8A 2HSYA 4HZ2A 2OKAA 3PR8A 3P8WA 4EVMA 3IHQA 1WJKA 3FZ5A 4QQ7A 2GDRA 2N5AA 4V2NA 4ECCA 2KP2A 4GTUA 3TCOA 4KCAA 4OO4A 3QMXA 4P3YB 3EC3A 1BG5A 3F6DA 3EU4A 2RM6A 3WT2A 1QFNA 3US3A 1XVQA 3IAM2 3EVIA 3V1WA 2HFDA 1G7EA 4YQMA 1ML6A 4RQXA 2QKEA 4TW5A 3U6VA 3H4KA 4XTSA 2O8VB 1EEMA 2GVPA 4PUAA 3Q19A 1LU4A 3F6FA 3DYRA 1FO5A 4PXOA 6GSTA 3GV1A 3GFKA 3QFAC 4KDUA 3BJ5A 4Q5QA 3KEBA 4TRXA 3GSSA 3TDGA 2IIYA 1XWGA 1SU9A 4IVFA 1T1VA 2X8GA 1X0RA 1UA5A 1K0DA 1GUHA 2F3MA 4YAPA 2VO4A 1ZZYA 1K0CA 16GSA 3KMNA 2REMA 5ECQB 1TKDB 4NMUA 5DQSA 2IMEA 4E8HA 2IN3A 4XS6A 2X8HA 1ZYQB 3DIEA 4BA7A 1SK2A 3HVSA 1SJ6A 4RQRA 3GX0A 2CVBA 4EO3A 1M0UA 4PQIA 2GSQA 3J7Yb 2GSSA 3TJFA 4JR6A 3TKQA 3LQ7A 4KH7A 1TK0B 5FT3A 2MZCA 3F9UA 3UJ1A 3LXZA 4IP6A 4HU9A 1NHOA 2LS5A 2LQOA 5CNWA 2R2JA 2PVQA 1GULA 4MPFA 2HI7A 4O92A 1X5DA 4OFMA 2X8CA 4WR4A 4K7IA 4BVYA 3HVVA 1LJRA 3O76A 2VL9A 3VPTA 6GSWA 4L5OA 2R3XA 4Q5NA 2H01A 2DBCA 1YDKA 3VK9A 2E7PA 4O32A 3H1NA 1A2MA 1F9MA 5ECKB 1OC9B 1YKAA 3TJKA 5DCHA 2TIRA 3P90A 4DVCA 5IMVA 1GSQA 2FWHA 1V40A 1K0AA 3M8NA 2LV3A 1PX6A 4MA9A 6GSYA 1F37A 5GZZB 5ECMB 5HFGA 1G6WA 2JADA 3ERWA 2G0FA 3DVWA 19GSA 2I3YA 5ID2B 3D22A 2R4VA 4F2IA 2AUVA 2JU5A 2IMDA 4MJEA 5D73A 4ZXGA 1E2YA 2XC2A 1JZDA 1T00A 3KGKA 3TRPA 4K7OA 1KBNA 2IMFA 3FEUA 3UBKA 3D4MA 1TW9A 5HFKA 3P7XA 5D9TA 4GRFA 4ZB9A 5J3RA 1OYJA 2P0GA 2PVOC 2XBIA 1K0OA 5DJLA 3WGEA 1DSBA 5B6MA 4ACSA 4G10A 2VD0A 1A8YA 5AIXA 4EC0A 3F4SA 1CQHA 2F51A 4KB3A 1MDKA 2MMAA 6GSSA 3QCPA 2H6YA 3LFLA 5H5QA 3L9SA 4NV2A 5ECOB 2DMMA 2K9FA 4J56E 3MDKA 5A4WA 3ZIVA 1FOVA 1V58A 1GTIA 4FH8A 1FHEA 5INYA 3FHKA 1SK0A 1OE8A 5KEJA 2L57A 1PL1A 4NV5A 1XFLA 4NHWA 4KDXA 1A8LA 1MEKA 2P5QA 1ZYEA 4K7NA 4OMVA 3IDVA 4TOPA 1USBA 3W8SA 2L4QA 4HU7A 4AGSA 2HRFA 2E2GA 1WRYA 2HSHA 1SJIA 2C0EA 3UOMA 2LKUA 1WIKA 1XOAA 1AUCA 5B7CA 1T4ZA 2AAWA 1FVJA 1SKRB 1Z7RA 5ECLB 2DJ2A 2DJ0A 2RM5A 3M1GA 1QGVA 4X1UA 3LG6A 1R5AA 4XS4A 4GCIA 1TRUA 1TK8B 2LJAA 3NIVA 4J57E 20GSA 1UVZA 3GNJA 5D9WA 4OWYA 4G2EA 1Q4JA 4KNDA 5DJMA 1GUMA 4F0BA 2H72A 2O87A 5F0GA 3ZZXA 4N30A 1EOHA 1EWXA 4FYCA 4PURA 2MBTA 3EMXA 2H1GA 7GSSA 2C0DA 4JU5A 3RHBA 3BCIA 5J4UA 1TK5B 2O7KA 3TGZA 1Z7PA 3ISOA 3ZL5A 5CRGA 2VOCA 1MDIA 2EIRA 3L0HA 3I6AA 3W8JA 3GKNA 1V98A 4KA0A 3QFBC 2JL4A 5ELAA 1IYIA 1T7PB 5G5EA 4IN0A 1SL1B 2LNSA 2VL2A 4F9ZA 1GNWA 2OE0A 3F0IA 4YAVA 1A0FA 2KHPA 2PBJA 1T8EB 2X64A 5F05A 3CSIA 1THOA 3HCZA 3TOTA 1EP7A 4ECIA 1GSSA 2HXKA 4BPYA 4D73A 5ECPB 1TJDA 2MMNA 2LTKA 1TU7A 3EE2A 2LJKA 5B8BA 1OVNA 3ZMLA 2YANA 5HR1A 5LD0A 6GSVA 5IPHA 3M3MA 2DIZA 3GKMA 1RK4A 1BX9A 4EDZA 5D96A 1ST9A 2GGTA 1MDJA 1ZMAA 2VCWA 1TTZA 2H71A 2H66A 3FR9A 2TRCP 2EIOA 1K3OA 4WF5A 4DSQA 2LRTA 2R6KA 5CP1A 2CX4A 2C1YA 3PGTA 3GL3A 1XWCA 3RHCA 3A5WA 3ZIJA 3C73A 2DMLA 2OADA 3L4NA 4DEJA 3D6IA 5B8AA 5D93A 1GNEA 3TRXA 2I81A 1OC9A 4WXTA 1GLQA 4TVEA 1A2JA 3LGCA 1SD9A 9GSSA 1EGOA 4TXVA 3QAWA 4GLTA 1TRSA 2FCHA 2FA4A 3TKSC 2XHFA 2PPTA 2XPEA 5DBQA 1BJXA 4AJ7A 5ID2A 4EE0A 1F3BA 1Y25A 5CREA 5DAKB 4NWYA 1BQ7A 1S3DA 2C0GA 4ZL9A 1K0MA 4E8EA 4CHSA 2P5RA 2BMXA 2JSYA 4N0ZA 1KTEA 1GSUA 2C3TA 2K8SA 3MAKA 4EDYA 2JSZA 3RDWA 2IPAA 5EY6A 2PU9C 2DJJA 1O7UA 3D5JA 5GAND 1O8XA 3GA4A 2KLXA 4TR1A 4F0CA 2JZRA 5C00A 2CV4A 3L9UA 2FWGA 4IGJA 1XVWA 2B5XA 3A2VA 1AIUA 2N5BA 4EXJA 2AV4A 1XIYA 3A3TA 3ME7A 2K6VA 4JBBA 4CDOA 2YP6A 2B7KA 1PL2A 4KSMA 2F8FA 3A2WA 1QK8A 4ML6A 1FAAA 3TJGA 2B5YA 1R5PA 5IPGA 2B5EA 3FK8A 1K0BA 5A5KA 2NBSA 4MCUA 1SYRA 4KDYA 3C8EA 5H5SA 2NVLA 1A2LA 5HR0A 3GMFA 4ID0A 2GSTA 2VL2C 2KP1A 2GT6A 2GLRA 3RBTA 2F9SA 3C71A 4K2DA 2IFQA 3DXBA 1SD8A 1AQXA 1YEXA 1PQNA 3ZITA 1WWJA 5ECSA 2LRCA 4N10A 2H73A 2H0HA 4JRRA 2V2GA 1X9WB 3IBHA 2N5FA 2PGTA 3FZ4A 1OAZA 4ZL7A 4TKYA 4POBA 3IC4A 4IHUA 4NHZA 3KCMA 5GAPD 5COHA 3KXOA 1IYHA 4POLA 4KCEA 3RPNA 4L8EA 1XWAA 1J08A 1T4YA 4RUVA 2MBSA 5G5FA 1WP0A 3LJRA 3CXGA 2QC7A 2NDOA 4BWSA 4WKWA 4WR5A 3FRCA 1PGTA 4RI6A 3G7IA 3VPQA 4I5QA 3IK9A 5LCZA 5J9CA 3KJYA 1X9SB 4LLRA 3DGQA 3VI5A 2OE1A 4DSSB 3I43A 1ZGNA 4EKZA 1GTAA 2FUG2 5JWOB 1O8WA 3IAS2 4IW9A 5IMZA 1EP8A 1DE1A 4N11A 1KEBA 4MK3A 2VLVA 3LXTA 2L5OA 1X5EA 3IPZA 3IK7A 3KTLA 5KN0A 2PUKC 1J9BA 2H76A 5DDLA 2CZ2A 2QGVA 1TI3A 1B4QA 2DJ3A 3APSA 2HZFA 6GSXA 2QSIA 4GSNA 2VM1A 1PX7A 4GQFA 3HZ4A 1ZL9A 4HJ2A 1HD2A 2VCVA 1YJ6A 3GN3A 1ABAA 1VRSD 2MYGA 1PN9A 1G6YA 4BWQA 1SKSB 4MPGA 4OCEA 3ZLPA 5H5RA 1WOUA 1XXUA 4NPBA 4LMWA 2HRNA 4X0XA 2HZEB 4ZBDA 1ON4A 2GZPA 1W4VA 4CW9A 3BCKA 4HQZA 1SYXA 4I8BA 3P2AA 4OFTA 3F4RA 1JFUA 3IA1A 1YF0A 3KM6A 3KH7A 2H0GA 2YZHA 4I97A 4DSRA 5KN2A 3UL3A 2A4VA 2C3NA 4OFNA 3WYWA 1G7OA 5CRHA 4MMMA 1R26A 3DVXA 3F3RA 3KP8A 1QUWA 2L6DA 2IWTA 1SL2B 1Z6MA 1M9AA 4MJCA 2WCIA 3GSTA 5AISA 1PKZA 2VCXA 1AW9A 3TKSA 1T3BA 4MF7A 5JWQB 4TR0A 5JWRB 3K8NA 2HT9A 2H6ZA 3WD6A 3OR5A 3F4TA 4MF6A 3KTBA 2ZUPA 4J2FA 4HQSA 2GT5A 1F2EA 3F63A 3D4TA 4LMVA 4F82A 1URMA 1GSEA 3HJOA 1M2DA 2J23A 3HVXA 2GSRA 2FNOA 5ENUA 4XS1A 1EGRA 1GSDA 3M9KA 2XBQA 5DQYA 4V1Ap 2O89A 3ZMKA 2LRNA 4WF4A 3UBLA 4JEDA 2WULA 5D8IA 1YY7A 1H75A 1ZOFA 2VLUA 4EF0A 4GF0A 2JZTA 3FR3A 13GSA 3UARA 4FO5A 1N2AA 3G7YA 4HZ4A 2GQKA 4K0NA 4HI7A 4BVXA 3BOAA 4IP1A 3H93A 3CRTA 3GH9A 5HR2A 5F06A 1XCCA 3UEMA 4KGIA 22GSA 3S9FA 2M72A 2IL3A 2E2MA 2WFCA 4OD7A 2WS2A 4V2MA 3CSHA 3UAPA 3IE3A 4XHMA 1O85A 5IOWA 2WDUA 1ERUA 1AQVA 5CAXA 1B9XC 2C8UA 6GSUA 4QL7A 4MZBA 2C80A 4LL4B 4MP4A 3VURA 4MJAA 2FWEA 2JACA 1EV4A 5J9BA 1XBSA 3DWVA 2H70A 5F8BA 3FR6A 3LYPA 4IJIA 3G7JA 2C4JA 4YQVA 4L0UA 1JZWA 3LYKA 4OCFA 1FB0A 2V41A 1XOBA 3RAZA 1NW2A 5EL8A 2YV7A 3EURA 1FG4A 2DLXA 3H79A 1GRXA 1GSFA 3N9JA 3FKFA 3WT1A 5G1LA 3A2XA 2VM2A 2YV9A 3IV4A 2IMIA 2CAQA 2YWIA 1PKWA 2MMZA 3GRXA 1NHYA 3KP9A 5EVOA 3TRQA 3BBYA 5AGYA 2C0FA 2RLIA 4MZWA 4DSSA 2FGXA 5J5NA 1DE2A 1S3AA 5G30A 2GZYA 3C1SA 2DSAA 3GIXA 2MMOA 2VAFA 5E59A 4AJ6A 1GWCA 3CTGA 1PA3A 4RI7A 1TI1A 2V6KA 1W89A 3FZAA 2H1BA 1Z5YE 3HHVA 5HQPA 2FHEA 3IXRA 3ME8A 3ZTLA 5CO3A 4KX4A 1VF4A 3J7Yk 2YWMA 1XW9A 4QL9A 2CVDA 3WGXA 1GLPA 4G19A 3LSZA 4K9ZA 3ZVJA 2HE3A 2PN8A 2NTOA 2LJRA 5AIVA 1TOFA 3LEFA 2HLSA 3VFIA 2DJKA 5G2ZA 2FWFA 3G9BA 1ERTA 1SJZA 1OE7A 5HR3A 1JHBA 2AJQB 4ZIJA 3DRNA 1K3LA 3PINA 4YQUA 3KMOA 1PRXA 3ERFA 1GSYA 4NAXA 4MJBA 4NXIA 4HEA2 1TU8A 3L9VA 4PQ1A 3ZYWA 2E0QA 1ACVA 3VLNA 2YWNA 3GHAA 1B4PA 3VWXA 4PNFA 3O6TA 2WB9A 4X43A 3JCML 2DC5A 1ILOA 3CTFA 5IO0A 2P31A 1X9MB 2VLTA 3IOSA 2J9HA 2G2QA 1BYEA 1AAZA 5IMDA 2AYTA 1JZOA 4IBPA 2A2SA 1A24A 1ERWA 1JLVA 4ZBAA 3ZRDA 1VF3A 2X99A 2B1LA 4ILFA 1V9WA 3TKPA 1QXHA 3LWAA 3QAVA 2WRTA 4MABA 5ECHB 1F6MC 3QOUA 3SWLA 2CA8A 4LA1A 3MNGA 3TJBA 1DBYA 1MD4A 4IJ3A 4ZILA 2GTUA 2H8LA 2I9HA 14GSA 2AHEA 3UIWA 1SL0B 2H1AA 4OO5A 2CAIA 1S3CA 2FA8A 1G0TA 2YPMA 3EYTA 4GSSA 4PUFC 1TP9A 1HNBA 5ECIB 4PNGA 2R37A 2VIMA 4Q5FA 3FY7A 5G1KA 1EEJA 2K18A 2H74A 2YCDA 2ZCTA 1UC7A 3O3TA 3BD2A 4PX1A 1U88A 1I9DA 1M2AA 3Q74A 3WGDA 1EOGA 1UN2A 1XZOA 3EU3A 3MSZA 5CRWA 4TXOB
chains in the Genus database with same CATH superfamily
4CY8A 2H1DA 4H86A 4Q5RA 4V2LA 3GURA 10GSA 3HVNA 1YF1A 4K8MA 4O5RA 5G31A 1AXDA 1WPIA 3CBUA 2ES7A 5D9VA 3KH9A 2RIIA 4D73B 2PMTA 2H0IA 3APQA 3QDNA 2M80A 1A23A 4JR4A 4AJ8A 1V57A 4GXZA 2OBIA 1PSQA 2VCTA 2B3SA 2VL3A 2CX3A 2HYXA 5IOXA 2YJHA 4ZB6A 5ECNB 1K3YA 1M3JA 2ALBA 2Z9SA 3GTUB 2WJUA 2LSTA 2I1UA 4XCSA 2M46A 1M99A 2VD1A 1GTBA 3PH9A 4WBRD 4A5PA 1F3AA 4ZBBA 1M3IA 5EPFA 3HJMA 3DKSA 2VCQA 5C04A 1RQMA 2HRKA 4EUYA 5DALB 1AQWA 4KE3A 3FW2A 2AB6A 1OC8A 2YWOA 5JCGA 4EL1A 2I4AA 3QD9A 5HFIA 2FD3A 1YZXA 1OC3A 2H19A 3CQFA 3FMWA 1B9YC 2GS3A 2H6XA 2DIYA 3M0FA 1FW1A 3EINA 4HUAA 2CT6A 5DVBA 4HOJA 1HQOA 5IMCA 3HY2A 1U87A 4GQCA 4BL7B 1GP1A 2BTOT 1O6JA 3AY8A 3RPPA 1VGLA 2JZSA 1VF1A 2CVKA 2QA1A 2O85A 4ML1A 4POKA 2L4CA 5IO2A 5IMFA 1SK1A 4TR3A 2WZ9A 3NZNA 1GH2A 1TRWA 1HYUA 4I2UA 5AN1A 3FYGA 3Q18A 2C3QA 1XW6A 1KNGA 1U3IA 4O5QA 1FB6A 2CZ3A 2BJXA 4TR1B 2L5LA 3UMAA 2L59A 5J41A 4ISDA 1GUKA 3VI7A 1JZRA 2UZ8A 3HXSA 3HKRA 3TUEA 1ERVA 1U3AA 2B7JA 3DD3A 2YZUA 4AF2A 5IQYA 3ZREA 2GQMA 3M9JA 1WE0A 1YEPA 4MDCA 5DAKA 3CYNA 4IKHA 4WBJA 5FWGA 4WETA 3ZFLA 2A2RA 4PGTA 3Q6OA 4WEYA 2FY6A 2B6MA 4K1FA 1TXXA 1MTCA 4HS1A 2OE3A 1K0NA 2DKIA 2EIQA 3E3EA 4CY6A 1SENA 1H4OA 18GSA 5KN1A 1XWBA 1J0FA 2VUPA 1M2BA 3GH6A 2LQQA 5FHIA 1Z3EA 4KW6A 4ECBA 1VF2A 1EZKA 2KOKA 3L78A 2PWJA 1PMTA 5GSTA 1X5CA 2IJYA 2LEGA 4N0VA 1XG8A 2IFQB 1NSWA 1Q98A 4IQ1A 4F03A 5F07A 1AC1A 2DJ1A 4MH2A 4L5LA 3D21A 1DUGA 1QMVA 2GZZA 3DMLA 3IRAA 5GSSA 3GYKA 2YN1A 2NPBA 3HA9A 1WMJA 1GTUA 5A4UA 5IMAA 2PERA 4YH2A 2WGRA 3QAGA 3QPMA 5ECRB 3QR6A 3ERGA 4IS0A 4V1Ag 2OACA 1O81A 4O7HA 2R5GA 2RUFA 4PQHA 2H75A 4ZL8A 2FLSA 4L0WA 5IIZA 3HYPA 1BEDA 1HNAA 1B8XA 3KD0A 2ZNMA 1RW1A 1JLWA 3EPTA 4FIWA 12GSA 4G9HA 3TB2A 2KUCA 4JZQA 3LORA 2CQ9A 1CQGA 4MH3A 3D0ZA 4KUNA 2LNTA 3APOA 4FYBA 5CYYA 2XPDA 1TRVA 4XRDA 3TKSE 3TJJA 4MLYA 4K0GA 4TXOA 5LNKe 3C7MA 3U5RE 2OJLA 4GSTA 4IELA 1THXA 2K8VA 3VWUA 1Z6NA 4Z2TA 4JE1A 3EMPA 4ECJA 4HDEA 4POMA 4ULXA 2HNLA 5DCGA 2YJ7A 3CMIA 2YOIA 3CRUA 4KAEA 1E6BA 2L6CA 11GSA 3EWLA 2EC4A 2LUSA 1EV9A 3C1RA 4ICYA 1BAYA 3E9JB 3GKKA 4K6XA 2V6OA 3GTUA 2H30A 1U6TA 2V32A 1OKTA 1R4WA 1OKDA 1QQ2A 5KN3A 3HD5A 1B48A 1YKCA 3I69A 2F8AA 4I6XA 1I5GA 1LBKA 4XIHA 5B6NA 3HJPA 3W6GA 1NM3A 5JCUA 3VWWA 3KIJA 2OBKA 1C72A 4FYUA 4HJMA 1SKWB 3VWVA 3E0UA 2ON5A 5DALA 5D9XA 4ZB8A 1M9BA 3NOFA 5CRDA 4MNNA 4I2TA 8GSSA 4KSOA 2VCZA 4MZCA 2OA7A 2V1MA 3R2QA 3FZ9A 4Z7XA 1V2AA 4LL1B 3SBCA 2ON7A 1MD3A 5E4WA 3KZQA 2RUEA 2YNXA 3HDCA 1XW5A 17GSA 1PD21 3UVTA 1O73A 2B1KA 1XWKA 1N8JA 1HNCA 3ZFBA 1YQ1A 3F3QA 3I9V2 2HZEA 4BL7A 3N5OA 4MF5A 2IMKA 3MWHA 4G0KA 3UVHA 4GWRA 1M7TA 3CSJA 4TN8A 3GUSA 2TRXA 3ZVJD 5JCWA 5L71A 5A4VA 5ABRA 5IM9A 3GL5A 1ZCPA 3IR4A 3ED3A 1XPVA 1FVKA 1Z9HA 2D2ZA 3DEXA 3GKXA 4IQAA 1Y6EA 3HZ8A 3H8QA 3TKRA 3F8UA 3GX8A 3TOUA 5ELGA 1R7HA 1TDIA 2GQLA 4XRAA 4TR4A 1A0RP 4XS4B 1GL8A 2HSYA 4HZ2A 2OKAA 3PR8A 3P8WA 4EVMA 3IHQA 1WJKA 3FZ5A 4QQ7A 2GDRA 2N5AA 4V2NA 4ECCA 2KP2A 4GTUA 3TCOA 4KCAA 4OO4A 3QMXA 4P3YB 3EC3A 1BG5A 3F6DA 3EU4A 2RM6A 3WT2A 1QFNA 3US3A 1XVQA 3IAM2 3EVIA 3V1WA 2HFDA 1G7EA 4YQMA 1ML6A 4USSA 4RQXA 2QKEA 4TW5A 3U6VA 3H4KA 3LW9A 4XTSA 2O8VB 1EEMA 2GVPA 4PUAA 3Q19A 1LU4A 3F6FA 3DYRA 1FO5A 4PXOA 6GSTA 3GV1A 3GFKA 3QFAC 4KDUA 3BJ5A 4Q5QA 3IC8A 3KEBA 4TRXA 3GSSA 3TDGA 2IIYA 1XWGA 1SU9A 4IVFA 1T1VA 2X8GA 1X0RA 1UA5A 1K0DA 1GUHA 2F3MA 4YAPA 2VO4A 1ZZYA 1K0CA 16GSA 3KMNA 2REMA 5ECQB 1TKDB 4YKFA 4NMUA 5DQSA 2IMEA 4E8HA 2IN3A 4XS6A 2X8HA 1ZYQB 3DIEA 4BA7A 1SK2A 3HVSA 1SJ6A 4RQRA 3GX0A 2CVBA 4EO3A 3A5IA 4YKGA 1M0UA 4PQIA 2GSQA 3J7Yb 2GSSA 3TJFA 4JR6A 3TKQA 3LQ7A 4KH7A 1TK0B 5FT3A 2MZCA 3F9UA 3UJ1A 3LXZA 4IP6A 4HU9A 1NHOA 2LS5A 2LQOA 5CNWA 2R2JA 2PVQA 1GULA 4MPFA 2HI7A 4O92A 1X5DA 4OFMA 2X8CA 4WR4A 4K7IA 4BVYA 5BRTA 3HVVA 1LJRA 3O76A 2VL9A 3VPTA 6GSWA 4L5OA 2R3XA 4Q5NA 2H01A 2DBCA 1YDKA 3VK9A 2E7PA 4O32A 3H1NA 1A2MA 1F9MA 5ECKB 1OC9B 4K5RA 1YKAA 3TJKA 5DCHA 2TIRA 3P90A 4DVCA 5IMVA 1GSQA 2FWHA 1V40A 1K0AA 3M8NA 2LV3A 1PX6A 4MA9A 6GSYA 1F37A 5GZZB 5ECMB 5HFGA 1G6WA 2JADA 1PN0A 3ERWA 2R0GA 2G0FA 3DVWA 19GSA 2I3YA 5ID2B 3MYDA 3D22A 2R4VA 4F2IA 2AUVA 2JU5A 2IMDA 4MJEA 5D73A 4ZXGA 1E2YA 2XC2A 4K5SA 1JZDA 1T00A 3KGKA 3TRPA 4K7OA 1KBNA 2IMFA 3FEUA 3UBKA 3D4MA 1TW9A 5HFKA 3P7XA 5D9TA 4GRFA 4ZB9A 5J3RA 1OYJA 2P0GA 2PVOC 2XBIA 1K0OA 5DJLA 3WGEA 1DSBA 5B6MA 4ACSA 4G10A 2VD0A 1A8YA 5AIXA 4EC0A 2A2PA 3F4SA 1CQHA 2F51A 4KB3A 1MDKA 2MMAA 6GSSA 3QCPA 2H6YA 3LFLA 5H5QA 3L9SA 4NV2A 5ECOB 2DMMA 2K9FA 4J56E 3MDKA 5A4WA 3ZIVA 1FOVA 1V58A 1GTIA 4FH8A 1FHEA 5INYA 3FHKA 1SK0A 1OE8A 5KEJA 2L57A 1PL1A 4NV5A 1XFLA 4NHWA 4KDXA 1A8LA 1MEKA 2P5QA 1ZYEA 1ZYPA 4K7NA 4OMVA 3IDVA 4TOPA 1USBA 3W8SA 2L4QA 4HU7A 4AGSA 2HRFA 2E2GA 1WRYA 2HSHA 1SJIA 2C0EA 3UOMA 2LKUA 1WIKA 1XOAA 1AUCA 5B7CA 1T4ZA 2AAWA 1FVJA 1SKRB 1Z7RA 5ECLB 2DJ2A 2DJ0A 2RM5A 4HSCX 3M1GA 1QGVA 4X1UA 3LG6A 1R5AA 4XS4A 4GCIA 1TRUA 1TK8B 2LJAA 3NIVA 4J57E 20GSA 1UVZA 3GNJA 5D9WA 4OWYA 4G2EA 1Q4JA 4KNDA 5DJMA 1GUMA 4F0BA 2H72A 2O87A 5F0GA 3ZZXA 4N30A 1EOHA 1EWXA 4FYCA 4PURA 2MBTA 3EMXA 2H1GA 7GSSA 2C0DA 4JU5A 3RHBA 3BCIA 5J4UA 1TK5B 2O7KA 3TGZA 1Z7PA 3ISOA 3ZL5A 5CRGA 2VOCA 1MDIA 2EIRA 3L0HA 3I6AA 3W8JA 3GKNA 1V98A 4KA0A 3QFBC 2JL4A 5ELAA 1IYIA 5KOXA 1T7PB 5G5EA 4IN0A 1SL1B 2LNSA 2VL2A 4F9ZA 1GNWA 2OE0A 3F0IA 4YAVA 1A0FA 2KHPA 2PBJA 1T8EB 2X64A 5F05A 3CSIA 1THOA 3HCZA 3TOTA 1EP7A 4ECIA 1GSSA 2HXKA 4BPYA 4EIPA 3IHGA 4D73A 5ECPB 1TJDA 2MMNA 2LTKA 1TU7A 3EE2A 2LJKA 5B8BA 1OVNA 3ZMLA 2YANA 5HR1A 5LD0A 6GSVA 5IPHA 3M3MA 2DIZA 3GKMA 1RK4A 1BX9A 4EDZA 5D96A 1ST9A 2GGTA 1MDJA 1ZMAA 2VCWA 1TTZA 2H71A 2H66A 3FR9A 2TRCP 2EIOA 1K3OA 4WF5A 4DSQA 2LRTA 2R6KA 5CP1A 2CX4A 2C1YA 3PGTA 3GL3A 5KOWA 1XWCA 3RHCA 3A5WA 3ZIJA 3C73A 2DMLA 2OADA 3L4NA 4DEJA 3D6IA 5B8AA 5D93A 1GNEA 3TRXA 2I81A 1OC9A 4WXTA 1GLQA 4TVEA 1A2JA 3LGCA 1SD9A 9GSSA 1EGOA 4TXVA 3QAWA 4GLTA 1TRSA 2FCHA 2FA4A 3TKSC 2XHFA 2PPTA 2XPEA 5DBQA 1BJXA 4AJ7A 5ID2A 4EE0A 1F3BA 1Y25A 5CREA 5DAKB 4NWYA 4G0LA 1BQ7A 1S3DA 2C0GA 4ZL9A 1K0MA 4E8EA 4CHSA 2P5RA 2BMXA 2JSYA 4N0ZA 1KTEA 1GSUA 2C3TA 2K8SA 3MAKA 4EDYA 2JSZA 3RDWA 2IPAA 5EY6A 2PU9C 2DJJA 1O7UA 3D5JA 5GAND 1O8XA 3GA4A 2KLXA 4TR1A 4F0CA 2JZRA 5C00A 4K2XA 2CV4A 3L9UA 2FWGA 4IGJA 1XVWA 2B5XA 3A2VA 1AIUA 2N5BA 4EXJA 2AV4A 1XIYA 3A3TA 3ME7A 2K6VA 4JBBA 4CDOA 2YP6A 2B7KA 1PL2A 4KSMA 2F8FA 3A2WA 1QK8A 4ML6A 4BVXB 1FAAA 3TJGA 2B5YA 1R5PA 5IPGA 2B5EA 3FK8A 1K0BA 5A5KA 2NBSA 4MCUA 1SYRA 2X49A 4KDYA 5BMUA 3C8EA 5H5SA 2NVLA 1A2LA 5HR0A 3GMFA 4ID0A 2GSTA 2VL2C 2KP1A 2GT6A 2GLRA 3RBTA 2F9SA 3C71A 4K2DA 2IFQA 3DXBA 1SD8A 1AQXA 1YEXA 1PQNA 3ZITA 1WWJA 5ECSA 2LRCA 4N10A 2H73A 2H0HA 4JRRA 2V2GA 1X9WB 3IBHA 2N5FA 2PGTA 3FZ4A 1OAZA 4ZL7A 4TKYA 4POBA 3IC4A 4IHUA 4NHZA 3KCMA 5GAPD 5COHA 3KXOA 1IYHA 4POLA 4KCEA 3RPNA 4L8EA 1XWAA 1J08A 1T4YA 4RUVA 2MBSA 5G5FA 1WP0A 3LJRA 3CXGA 2QC7A 2NDOA 4BWSA 4WKWA 4WR5A 4G0IA 3FRCA 1PGTA 4RI6A 3G7IA 3VPQA 4I5QA 2HSMA 3IK9A 5LCZA 5J9CA 3KJYA 1X9SB 4LLRA 3DGQA 3VI5A 2OE1A 4DSSB 3I43A 1ZGNA 4EKZA 2R0CA 1GTAA 2FUG2 5JWOB 1O8WA 3IAS2 4IW9A 5IMZA 1EP8A 1DE1A 4N11A 1KEBA 4MK3A 2VLVA 3LXTA 2L5OA 1X5EA 3IPZA 3IK7A 3KTLA 5KN0A 2PUKC 1J9BA 2H76A 5DDLA 2CZ2A 2QGVA 1TI3A 1B4QA 2DJ3A 3APSA 2HZFA 6GSXA 2QSIA 4GSNA 2VM1A 1PX7A 4GQFA 3HZ4A 1ZL9A 4HJ2A 1HD2A 2VCVA 1YJ6A 3GN3A 1ABAA 1VRSD 2MYGA 1ZYNA 1PN9A 1G6YA 4KF9A 4BWQA 1SKSB 4MPGA 4EIQA 4OCEA 3ZLPA 5H5RA 1WOUA 1XXUA 4NPBA 4LMWA 2HRNA 1S3RA 2HZEB 4X0XA 4ZBDA 1ON4A 2GZPA 1W4VA 4CW9A 3BCKA 4HQZA 1SYXA 4I8BA 3P2AA 4OFTA 3F4RA 1JFUA 3IA1A 1YF0A 4PTSA 3KM6A 3KH7A 2H0GA 2YZHA 4I97A 4DSRA 5KN2A 3UL3A 2A4VA 2C3NA 4OFNA 3WYWA 1G7OA 5CRHA 4MMMA 1R26A 3DVXA 3F3RA 3KP8A 1QUWA 2L6DA 2IWTA 1SL2B 1Z6MA 1M9AA 4MJCA 2WCIA 3GSTA 5AISA 1PKZA 2VCXA 1AW9A 3TKSA 1T3BA 4MF7A 5JWQB 4TR0A 5JWRB 3K8NA 2HT9A 2H6ZA 3WD6A 3OR5A 3F4TA 4MF6A 3KTBA 2ZUPA 4J2FA 3PPUA 4HQSA 2GT5A 1F2EA 3F63A 3D4TA 4LMVA 4F82A 1URMA 1GSEA 3HJOA 1M2DA 2J23A 3HVXA 2GSRA 2FNOA 5ENUA 4XS1A 1EGRA 1GSDA 3M9KA 2XBQA 5DQYA 3MIXA 4V1Ap 2O89A 3ZMKA 2LRNA 4WF4A 3UBLA 4JEDA 2WULA 5D8IA 4FQUA 1YY7A 1H75A 2A4HA 1ZOFA 2VLUA 4EF0A 4GF0A 2JZTA 3FR3A 13GSA 3UARA 4FO5A 1N2AA 3G7YA 4HZ4A 2GQKA 4K0NA 4HI7A 4BVXA 3BOAA 4IP1A 3H93A 3CRTA 3GH9A 5HR2A 5F06A 1XCCA 3UEMA 4KGIA 22GSA 3S9FA 2M72A 2IL3A 2E2MA 2WFCA 4OD7A 2WS2A 4V2MA 3CSHA 3UAPA 3IE3A 4XHMA 2X4AA 1O85A 5IOWA 2WDUA 1ERUA 1AQVA 5CAXA 1B9XC 2C8UA 6GSUA 4QL7A 4MZBA 2C80A 4LL4B 4MP4A 3VURA 4MJAA 2FWEA 2JACA 1EV4A 5J9BA 1XBSA 3DWVA 2H70A 5F8BA 2DKHA 3FR6A 3LYPA 4IJIA 3G7JA 2C4JA 4YQVA 4L0UA 1JZWA 4BVYB 3LYKA 4X4JA 4OCFA 1FB0A 2V41A 1XOBA 3RAZA 1NW2A 4O5UA 5EL8A 2YV7A 3EURA 1FG4A 2DLXA 3H79A 1GRXA 1GSFA 3N9JA 3FKFA 3WT1A 5G1LA 3A2XA 2VM2A 2YV9A 3IV4A 2IMIA 2CAQA 2YWIA 1PKWA 2MMZA 3GRXA 1NHYA 3KP9A 5EVOA 3TRQA 4BIKA 3BBYA 5AGYA 2C0FA 2RLIA 4MZWA 4DSSA 2FGXA 5J5NA 1DE2A 1S3AA 5G30A 2GZYA 3C1SA 2DSAA 2QA2A 3GIXA 2MMOA 2VAFA 5E59A 4AJ6A 1GWCA 3CTGA 1PA3A 4RI7A 1TI1A 2V6KA 1W89A 1FOHA 3FZAA 2H1BA 1Z5YE 3HHVA 5HQPA 2FHEA 3IXRA 3ME8A 3ZTLA 5CO3A 4KX4A 1VF4A 3J7Yk 2YWMA 1XW9A 4QL9A 2CVDA 3WGXA 1GLPA 4G19A 3LSZA 4K9ZA 3ZVJA 2HE3A 2PN8A 2NTOA 2LJRA 5AIVA 1TOFA 3LEFA 2HLSA 3VFIA 2DJKA 5G2ZA 2FWFA 3G9BA 1ERTA 1SJZA 1OE7A 5HR3A 1JHBA 2AJQB 4ZIJA 3DRNA 1K3LA 3PINA 4YQUA 3KMOA 1PRXA 3ERFA 1GSYA 4NAXA 4MJBA 4NXIA 4HEA2 1TU8A 3L9VA 4PQ1A 3ZYWA 2E0QA 1ACVA 3VLNA 2YWNA 3GHAA 1B4PA 3VWXA 4PNFA 3O6TA 2WB9A 4X43A 3JCML 4Z2RA 2DC5A 1ILOA 3CTFA 5IO0A 2P31A 1X9MB 2VLTA 1PFOA 2J9HA 3IOSA 2G2QA 1BYEA 1AAZA 5IMDA 2AYTA 1JZOA 4IBPA 2A2SA 1A24A 1ERWA 1JLVA 4ZBAA 3ZRDA 1VF3A 2X99A 2B1LA 4ILFA 3R3EA 1V9WA 3TKPA 1QXHA 3LWAA 3QAVA 2WRTA 4MABA 5ECHB 1F6MC 3QOUA 3SWLA 2CA8A 4LA1A 3MNGA 3TJBA 1DBYA 1MD4A 4IJ3A 4ZILA 2GTUA 2H8LA 2I9HA 14GSA 2AHEA 3UIWA 1SL0B 2H1AA 4OO5A 2CAIA 1S3CA 2FA8A 1G0TA 2YPMA 3EYTA 4GSSA 4PUFC 1TP9A 1HNBA 2HRAA 5ECIB 4PNGA 2R37A 2VIMA 4Q5FA 3FY7A 5G1KA 2R0PA 1EEJA 2K18A 2H74A 2YCDA 2ZCTA 1UC7A 3O3TA 4Z2UA 3BD2A 4PX1A 1U88A 1I9DA 1M2AA 3Q74A 3WGDA 1EOGA 1UN2A 1XZOA 3EU3A 3MSZA 5CRWA 4TXOB
chains in the Genus database with same CATH topology
4CY8A 2H1DA 4H86A 4Q5RA 4V2LA 3GURA 10GSA 1YF1A 4K8MA 4O5RA 5G31A 1AXDA 1WPIA 3CBUA 2ES7A 5D9VA 3KH9A 2RIIA 4D73B 2PMTA 2H0IA 3APQA 3QDNA 2M80A 1A23A 4JR4A 4AJ8A 1V57A 4GXZA 2OBIA 1PSQA 2VCTA 2B3SA 2VL3A 2CX3A 2HYXA 5IOXA 2YJHA 4ZB6A 5ECNB 1K3YA 2ALBA 2Z9SA 3GTUB 2WJUA 2LSTA 2I1UA 4XCSA 2M46A 1M99A 2VD1A 1GTBA 3PH9A 4WBRD 4A5PA 1F3AA 4ZBBA 5EPFA 3HJMA 3DKSA 2VCQA 5C04A 1RQMA 2HRKA 4EUYA 5DALB 1AQWA 4KE3A 3FW2A 2AB6A 1OC8A 2YWOA 5JCGA 4EL1A 2I4AA 3QD9A 5HFIA 2FD3A 1YZXA 1OC3A 2H19A 3FMWA 1B9YC 2GS3A 2H6XA 2DIYA 3M0FA 1FW1A 3EINA 4HUAA 2CT6A 5DVBA 4HOJA 1HQOA 5IMCA 3HY2A 1U87A 4GQCA 4BL7B 1GP1A 2BTOT 1O6JA 3AY8A 3RPPA 1VGLA 2JZSA 1VF1A 2CVKA 2QA1A 2O85A 4ML1A 4POKA 2L4CA 5IO2A 5IMFA 1SK1A 4TR3A 2WZ9A 3NZNA 1GH2A 1TRWA 1HYUA 4I2UA 5AN1A 3FYGA 3Q18A 2C3QA 1XW6A 1KNGA 1U3IA 4O5QA 1FB6A 2CZ3A 2BJXA 4TR1B 2L5LA 3UMAA 2L59A 5J41A 4ISDA 1GUKA 3VI7A 1JZRA 2UZ8A 3HXSA 3HKRA 3TUEA 1ERVA 1U3AA 2B7JA 3DD3A 2YZUA 4AF2A 5IQYA 3ZREA 2GQMA 3M9JA 1WE0A 1YEPA 4MDCA 5DAKA 3CYNA 4IKHA 4WBJA 5FWGA 4WETA 3ZFLA 2A2RA 4PGTA 3Q6OA 4WEYA 2FY6A 2B6MA 4K1FA 1TXXA 1MTCA 4HS1A 2OE3A 1K0NA 2DKIA 2EIQA 3E3EA 4CY6A 1SENA 1H4OA 18GSA 5KN1A 1XWBA 1J0FA 2VUPA 1M2BA 3GH6A 2LQQA 5FHIA 1Z3EA 4KW6A 4ECBA 1VF2A 1EZKA 2KOKA 3L78A 2PWJA 1PMTA 5GSTA 1X5CA 2IJYA 2LEGA 4N0VA 2IFQB 1NSWA 1Q98A 4IQ1A 4F03A 5F07A 1AC1A 2DJ1A 4MH2A 4L5LA 3D21A 1DUGA 1QMVA 2GZZA 3DMLA 3IRAA 5GSSA 3GYKA 2YN1A 2NPBA 3HA9A 1WMJA 1GTUA 5A4UA 5IMAA 2PERA 4YH2A 2WGRA 3QAGA 3QPMA 5ECRB 3QR6A 3ERGA 4IS0A 4V1Ag 2OACA 1O81A 4O7HA 2R5GA 2RUFA 4PQHA 2H75A 4ZL8A 2FLSA 4L0WA 5IIZA 3HYPA 1BEDA 1HNAA 1B8XA 3KD0A 2ZNMA 1RW1A 1JLWA 3EPTA 4FIWA 12GSA 4G9HA 3TB2A 2KUCA 4JZQA 3LORA 2CQ9A 1CQGA 4MH3A 3D0ZA 4KUNA 2LNTA 3APOA 4FYBA 5CYYA 2XPDA 1TRVA 4XRDA 3TKSE 3TJJA 4MLYA 4K0GA 4TXOA 5LNKe 3C7MA 3U5RE 2OJLA 4GSTA 4IELA 1THXA 2K8VA 3VWUA 1Z6NA 4Z2TA 4JE1A 3EMPA 4ECJA 4HDEA 4POMA 4ULXA 2HNLA 5DCGA 2YJ7A 3CMIA 2YOIA 3CRUA 4KAEA 1E6BA 2L6CA 11GSA 3EWLA 2EC4A 2LUSA 1EV9A 3C1RA 4ICYA 1BAYA 3E9JB 3GKKA 4K6XA 2V6OA 3GTUA 2H30A 1U6TA 2V32A 1OKTA 1R4WA 1OKDA 1QQ2A 5KN3A 3HD5A 1B48A 1YKCA 3I69A 2F8AA 4I6XA 1I5GA 1LBKA 4XIHA 5B6NA 3HJPA 3W6GA 1NM3A 5JCUA 3VWWA 3KIJA 2OBKA 1C72A 4FYUA 4HJMA 1SKWB 3VWVA 3E0UA 2ON5A 5DALA 5D9XA 4ZB8A 1M9BA 3NOFA 5CRDA 4MNNA 4I2TA 8GSSA 4KSOA 2VCZA 4MZCA 2OA7A 2V1MA 3R2QA 3FZ9A 4Z7XA 1V2AA 4LL1B 3SBCA 2ON7A 1MD3A 5E4WA 3KZQA 2RUEA 2YNXA 3HDCA 1XW5A 17GSA 1PD21 3UVTA 1O73A 2B1KA 1XWKA 1N8JA 1HNCA 3ZFBA 1YQ1A 3F3QA 3I9V2 2HZEA 4BL7A 3N5OA 4MF5A 2IMKA 3MWHA 4G0KA 3UVHA 4GWRA 1M7TA 3CSJA 4TN8A 3GUSA 2TRXA 3ZVJD 5JCWA 5L71A 5A4VA 5ABRA 5IM9A 3GL5A 1ZCPA 3IR4A 3ED3A 1XPVA 1FVKA 1Z9HA 2D2ZA 3DEXA 3GKXA 4IQAA 1Y6EA 3HZ8A 3H8QA 3TKRA 3F8UA 3GX8A 3TOUA 5ELGA 1R7HA 1TDIA 2GQLA 4XRAA 4TR4A 1A0RP 4XS4B 1GL8A 2HSYA 4HZ2A 2OKAA 3PR8A 3P8WA 4EVMA 3IHQA 1WJKA 3FZ5A 4QQ7A 2GDRA 2N5AA 4V2NA 4ECCA 2KP2A 4GTUA 3TCOA 4KCAA 4OO4A 3QMXA 4P3YB 3EC3A 1BG5A 3F6DA 3EU4A 2RM6A 3WT2A 1QFNA 3US3A 1XVQA 3IAM2 3EVIA 3V1WA 2HFDA 1G7EA 4YQMA 1ML6A 4USSA 4RQXA 2QKEA 4TW5A 3U6VA 3H4KA 3LW9A 4XTSA 2O8VB 1EEMA 2GVPA 4PUAA 3Q19A 1LU4A 3F6FA 3DYRA 1FO5A 4PXOA 6GSTA 3GV1A 3GFKA 3QFAC 4KDUA 3BJ5A 4Q5QA 3IC8A 3KEBA 4TRXA 3GSSA 3TDGA 2IIYA 1XWGA 1SU9A 4IVFA 1T1VA 2X8GA 1X0RA 1UA5A 1K0DA 1GUHA 2F3MA 4YAPA 2VO4A 1ZZYA 1K0CA 16GSA 3KMNA 2REMA 5ECQB 1TKDB 4YKFA 4NMUA 5DQSA 2IMEA 4E8HA 2IN3A 4XS6A 2X8HA 1ZYQB 3DIEA 4BA7A 1SK2A 3HVSA 1SJ6A 4RQRA 3GX0A 2CVBA 4EO3A 3A5IA 4YKGA 1M0UA 4PQIA 2GSQA 3J7Yb 2GSSA 3TJFA 4JR6A 3TKQA 3LQ7A 4KH7A 1TK0B 5FT3A 2MZCA 3F9UA 3UJ1A 3LXZA 4IP6A 4HU9A 1NHOA 2LS5A 2LQOA 5CNWA 2R2JA 2PVQA 1GULA 4MPFA 2HI7A 4O92A 1X5DA 4OFMA 2X8CA 4WR4A 4K7IA 4BVYA 5BRTA 3HVVA 1LJRA 3O76A 2VL9A 3VPTA 6GSWA 4L5OA 2R3XA 4Q5NA 2H01A 2DBCA 1YDKA 3VK9A 2E7PA 4O32A 3H1NA 1A2MA 1F9MA 5ECKB 1OC9B 4K5RA 1YKAA 3TJKA 5DCHA 2TIRA 3P90A 4DVCA 5IMVA 1GSQA 2FWHA 1V40A 1K0AA 3M8NA 2LV3A 1PX6A 4MA9A 6GSYA 1F37A 5GZZB 5ECMB 5HFGA 1G6WA 2JADA 1PN0A 3ERWA 2R0GA 2G0FA 3DVWA 19GSA 2I3YA 5ID2B 3MYDA 3D22A 2R4VA 4F2IA 2AUVA 2JU5A 2IMDA 4MJEA 5D73A 4ZXGA 1E2YA 2XC2A 4K5SA 1JZDA 1T00A 3KGKA 3TRPA 4K7OA 1KBNA 2IMFA 3FEUA 3UBKA 3D4MA 1TW9A 5HFKA 3P7XA 5D9TA 4GRFA 4ZB9A 5J3RA 1OYJA 2P0GA 2PVOC 2XBIA 1K0OA 5DJLA 3WGEA 1DSBA 5B6MA 4ACSA 4G10A 2VD0A 1A8YA 5AIXA 4EC0A 2A2PA 3F4SA 1CQHA 2F51A 4KB3A 1MDKA 2MMAA 6GSSA 3QCPA 2H6YA 3LFLA 5H5QA 3L9SA 4NV2A 5ECOB 2DMMA 2K9FA 4J56E 3MDKA 5A4WA 3ZIVA 1FOVA 1V58A 1GTIA 4FH8A 1FHEA 5INYA 3FHKA 1SK0A 1OE8A 5KEJA 2L57A 1PL1A 4NV5A 1XFLA 4NHWA 4KDXA 1A8LA 1MEKA 2P5QA 1ZYEA 1ZYPA 4K7NA 4OMVA 3IDVA 4TOPA 1USBA 3W8SA 2L4QA 4HU7A 4AGSA 2HRFA 2E2GA 1WRYA 2HSHA 1SJIA 2C0EA 3UOMA 2LKUA 1WIKA 1XOAA 1AUCA 5B7CA 1T4ZA 2AAWA 1FVJA 1SKRB 1Z7RA 5ECLB 2DJ2A 2DJ0A 2RM5A 3M1GA 1QGVA 4X1UA 3LG6A 1R5AA 4XS4A 4GCIA 1TRUA 1TK8B 2LJAA 3NIVA 4J57E 20GSA 1UVZA 3GNJA 5D9WA 4OWYA 4G2EA 1Q4JA 4KNDA 5DJMA 1GUMA 4F0BA 2H72A 2O87A 5F0GA 3ZZXA 4N30A 1EOHA 1EWXA 4FYCA 4PURA 2MBTA 3EMXA 2H1GA 7GSSA 2C0DA 4JU5A 3RHBA 3BCIA 5J4UA 1TK5B 2O7KA 3TGZA 1Z7PA 3ISOA 3ZL5A 5CRGA 2VOCA 1MDIA 2EIRA 3L0HA 3I6AA 3W8JA 3GKNA 1V98A 4KA0A 3QFBC 2JL4A 5ELAA 1IYIA 5KOXA 1T7PB 5G5EA 4IN0A 1SL1B 2LNSA 2VL2A 4F9ZA 1GNWA 2OE0A 3F0IA 4YAVA 1A0FA 2KHPA 2PBJA 1T8EB 2X64A 5F05A 3CSIA 1THOA 3HCZA 3TOTA 1EP7A 4ECIA 1GSSA 2HXKA 4BPYA 4EIPA 3IHGA 4D73A 5ECPB 1TJDA 2MMNA 2LTKA 1TU7A 3EE2A 2LJKA 5B8BA 1OVNA 3ZMLA 2YANA 5HR1A 5LD0A 6GSVA 5IPHA 3M3MA 2DIZA 3GKMA 1RK4A 1BX9A 4EDZA 5D96A 1ST9A 2GGTA 1MDJA 1ZMAA 2VCWA 1TTZA 2H71A 2H66A 3FR9A 2TRCP 2EIOA 1K3OA 4WF5A 4DSQA 2LRTA 2R6KA 5CP1A 2CX4A 2C1YA 3PGTA 3GL3A 5KOWA 1XWCA 3RHCA 3A5WA 3ZIJA 3C73A 2DMLA 2OADA 3L4NA 4DEJA 3D6IA 5B8AA 5D93A 1GNEA 3TRXA 2I81A 1OC9A 4WXTA 1GLQA 4TVEA 1A2JA 3LGCA 1SD9A 9GSSA 1EGOA 4TXVA 3QAWA 4GLTA 1TRSA 2FCHA 2FA4A 3TKSC 2XHFA 2PPTA 2XPEA 5DBQA 1BJXA 4AJ7A 5ID2A 4EE0A 1F3BA 1Y25A 5CREA 5DAKB 4NWYA 4G0LA 1BQ7A 1S3DA 2C0GA 4ZL9A 1K0MA 4E8EA 4CHSA 2P5RA 2BMXA 2JSYA 4N0ZA 1KTEA 1GSUA 2C3TA 2K8SA 3MAKA 4EDYA 2JSZA 3RDWA 2IPAA 5EY6A 2PU9C 2DJJA 1O7UA 3D5JA 5GAND 1O8XA 3GA4A 2KLXA 4TR1A 4F0CA 2JZRA 5C00A 4K2XA 2CV4A 3L9UA 2FWGA 4IGJA 1XVWA 2B5XA 3A2VA 1AIUA 2N5BA 4EXJA 2AV4A 1XIYA 3A3TA 3ME7A 2K6VA 4JBBA 4CDOA 2YP6A 2B7KA 1PL2A 4KSMA 2F8FA 3A2WA 1QK8A 4ML6A 4BVXB 1FAAA 3TJGA 2B5YA 1R5PA 5IPGA 2B5EA 3FK8A 1K0BA 5A5KA 2NBSA 4MCUA 1SYRA 2X49A 4KDYA 5BMUA 3C8EA 5H5SA 2NVLA 1A2LA 5HR0A 3GMFA 4ID0A 2GSTA 2VL2C 2KP1A 2GT6A 2GLRA 3RBTA 2F9SA 3C71A 4K2DA 2IFQA 3DXBA 1SD8A 1AQXA 1YEXA 1PQNA 3ZITA 1WWJA 5ECSA 2LRCA 4N10A 2H73A 2H0HA 4JRRA 2V2GA 1X9WB 3IBHA 2N5FA 2PGTA 3FZ4A 1OAZA 4ZL7A 4TKYA 4POBA 3IC4A 4IHUA 4NHZA 3KCMA 5GAPD 5COHA 3KXOA 1IYHA 4POLA 4KCEA 3RPNA 4L8EA 1XWAA 1J08A 1T4YA 4RUVA 2MBSA 5G5FA 1WP0A 3LJRA 3CXGA 2QC7A 2NDOA 4BWSA 4WKWA 4WR5A 4G0IA 3FRCA 1PGTA 4RI6A 3G7IA 3VPQA 4I5QA 2HSMA 3IK9A 5LCZA 5J9CA 3KJYA 1X9SB 4LLRA 3DGQA 3VI5A 2OE1A 4DSSB 3I43A 1ZGNA 4EKZA 2R0CA 1GTAA 2FUG2 5JWOB 1O8WA 3IAS2 4IW9A 5IMZA 1EP8A 1DE1A 4N11A 1KEBA 4MK3A 2VLVA 3LXTA 2L5OA 1X5EA 3IPZA 3IK7A 3KTLA 5KN0A 2PUKC 1J9BA 2H76A 5DDLA 2CZ2A 2QGVA 1TI3A 1B4QA 2DJ3A 3APSA 2HZFA 6GSXA 2QSIA 4GSNA 2VM1A 1PX7A 4GQFA 3HZ4A 1ZL9A 4HJ2A 1HD2A 2VCVA 1YJ6A 3GN3A 1ABAA 1VRSD 2MYGA 1ZYNA 1PN9A 1G6YA 4KF9A 4BWQA 1SKSB 4MPGA 4EIQA 4OCEA 3ZLPA 5H5RA 1WOUA 1XXUA 4NPBA 4LMWA 2HRNA 4X0XA 2HZEB 4ZBDA 1ON4A 2GZPA 1W4VA 4CW9A 3BCKA 4HQZA 1SYXA 4I8BA 3P2AA 4OFTA 3F4RA 1JFUA 3IA1A 1YF0A 4PTSA 3KM6A 3KH7A 2H0GA 2YZHA 4I97A 4DSRA 5KN2A 3UL3A 2A4VA 2C3NA 4OFNA 3WYWA 1G7OA 5CRHA 4MMMA 1R26A 3DVXA 3F3RA 3KP8A 1QUWA 2L6DA 2IWTA 1SL2B 1Z6MA 1M9AA 4MJCA 2WCIA 3GSTA 5AISA 1PKZA 2VCXA 1AW9A 3TKSA 1T3BA 4MF7A 5JWQB 4TR0A 5JWRB 3K8NA 2HT9A 2H6ZA 3WD6A 3OR5A 3F4TA 4MF6A 3KTBA 2ZUPA 4J2FA 3PPUA 4HQSA 2GT5A 1F2EA 3F63A 3D4TA 4LMVA 4F82A 1URMA 1GSEA 3HJOA 1M2DA 2J23A 3HVXA 2GSRA 2FNOA 5ENUA 4XS1A 1EGRA 1GSDA 3M9KA 2XBQA 5DQYA 3MIXA 4V1Ap 2O89A 3ZMKA 2LRNA 4WF4A 3UBLA 4JEDA 2WULA 5D8IA 4FQUA 1YY7A 1H75A 2A4HA 1ZOFA 2VLUA 4EF0A 4GF0A 2JZTA 3FR3A 13GSA 3UARA 4FO5A 1N2AA 3G7YA 4HZ4A 2GQKA 4K0NA 4HI7A 4BVXA 3BOAA 4IP1A 3H93A 3CRTA 3GH9A 5HR2A 5F06A 1XCCA 3UEMA 4KGIA 22GSA 3S9FA 2M72A 2IL3A 2E2MA 2WFCA 4OD7A 2WS2A 4V2MA 3CSHA 3UAPA 3IE3A 4XHMA 2X4AA 1O85A 5IOWA 2WDUA 1ERUA 1AQVA 5CAXA 1B9XC 2C8UA 6GSUA 4QL7A 4MZBA 2C80A 4LL4B 4MP4A 3VURA 4MJAA 2FWEA 2JACA 1EV4A 5J9BA 1XBSA 3DWVA 2H70A 5F8BA 2DKHA 3FR6A 3LYPA 4IJIA 3G7JA 2C4JA 4YQVA 4L0UA 1JZWA 4BVYB 3LYKA 4X4JA 4OCFA 1FB0A 2V41A 1XOBA 3RAZA 1NW2A 4O5UA 5EL8A 2YV7A 3EURA 1FG4A 2DLXA 3H79A 1GRXA 1GSFA 3N9JA 3FKFA 3WT1A 5G1LA 3A2XA 2VM2A 2YV9A 3IV4A 2IMIA 2CAQA 2YWIA 1PKWA 2MMZA 3GRXA 1NHYA 3KP9A 5EVOA 3TRQA 3BBYA 5AGYA 2C0FA 2RLIA 4MZWA 4DSSA 2FGXA 5J5NA 1DE2A 1S3AA 5G30A 2GZYA 3C1SA 2DSAA 2QA2A 3GIXA 2MMOA 2VAFA 5E59A 4AJ6A 1GWCA 3CTGA 1PA3A 4RI7A 1TI1A 2V6KA 1W89A 1FOHA 3FZAA 2H1BA 1Z5YE 3HHVA 5HQPA 2FHEA 3IXRA 3ME8A 3ZTLA 5CO3A 4KX4A 1VF4A 3J7Yk 2YWMA 1XW9A 4QL9A 2CVDA 3WGXA 1GLPA 4G19A 3LSZA 4K9ZA 3ZVJA 2HE3A 2PN8A 2NTOA 2LJRA 5AIVA 1TOFA 3LEFA 2HLSA 3VFIA 2DJKA 5G2ZA 2FWFA 3G9BA 1ERTA 1SJZA 1OE7A 5HR3A 1JHBA 2AJQB 4ZIJA 3DRNA 1K3LA 3PINA 4YQUA 3KMOA 1PRXA 3ERFA 1GSYA 4NAXA 4MJBA 4NXIA 4HEA2 1TU8A 3L9VA 4PQ1A 3ZYWA 2E0QA 1ACVA 3VLNA 2YWNA 3GHAA 1B4PA 3VWXA 4PNFA 3O6TA 2WB9A 4X43A 3JCML 4Z2RA 2DC5A 1ILOA 3CTFA 5IO0A 2P31A 1X9MB 2VLTA 3IOSA 2J9HA 2G2QA 1BYEA 1AAZA 5IMDA 2AYTA 1JZOA 4IBPA 2A2SA 1A24A 1ERWA 1JLVA 4ZBAA 3ZRDA 1VF3A 2X99A 2B1LA 4ILFA 3R3EA 1V9WA 3TKPA 1QXHA 3LWAA 3QAVA 2WRTA 4MABA 5ECHB 1F6MC 3QOUA 3SWLA 2CA8A 4LA1A 3MNGA 3TJBA 1DBYA 1MD4A 4IJ3A 4ZILA 2GTUA 2H8LA 2I9HA 14GSA 2AHEA 3UIWA 1SL0B 2H1AA 4OO5A 2CAIA 1S3CA 2FA8A 1G0TA 2YPMA 3EYTA 4GSSA 4PUFC 1TP9A 1HNBA 2HRAA 5ECIB 4PNGA 2R37A 2VIMA 4Q5FA 3FY7A 5G1KA 2R0PA 1EEJA 2K18A 2H74A 2YCDA 2ZCTA 1UC7A 3O3TA 4Z2UA 3BD2A 4PX1A 1U88A 1I9DA 1M2AA 3Q74A 3WGDA 1EOGA 1UN2A 1XZOA 3EU3A 3MSZA 5CRWA 4TXOB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2H1D A;  4H86 A;  4Q5R A;  4V2L A;  3GUR A;  10GS A;  1YF1 A;  4K8M A;  4O5R A;  5G31 A;  1AXD A;  1WPI A;  3CBU A;  2ES7 A;  5D9V A;  3KH9 A;  2RII A;  4D73 B;  2PMT A;  2H0I A;  3APQ A;  3QDN A;  2M80 A;  1A23 A;  4JR4 A;  4AJ8 A;  1V57 A;  4GXZ A;  2OBI A;  1PSQ A;  2VCT A;  2B3S A;  2VL3 A;  2CX3 A;  2HYX A;  5IOX A;  2YJH A;  4ZB6 A;  5ECN B;  1K3Y A;  2ALB A;  2Z9S A;  3GTU B;  2WJU A;  2LST A;  2I1U A;  4XCS A;  2M46 A;  1M99 A;  2VD1 A;  1GTB A;  3PH9 A;  4WBR D;  1F3A A;  4ZBB A;  5EPF A;  3HJM A;  3DKS A;  2VCQ A;  5C04 A;  1RQM A;  4EUY A;  5DAL B;  1AQW A;  4KE3 A;  3FW2 A;  2AB6 A;  1OC8 A;  2YWO A;  5JCG A;  4EL1 A;  2I4A A;  3QD9 A;  5HFI A;  2FD3 A;  1YZX A;  1OC3 A;  2H19 A;  1B9Y C;  2GS3 A;  2H6X A;  2DIY A;  3M0F A;  1FW1 A;  3EIN A;  4HUA A;  2CT6 A;  5DVB A;  4HOJ A;  1HQO A;  5IMC A;  3HY2 A;  1U87 A;  4GQC A;  1GP1 A;  2BTO T;  1O6J A;  3AY8 A;  3RPP A;  1VGL A;  2JZS A;  1VF1 A;  2CVK A;  2O85 A;  4ML1 A;  4POK A;  2L4C A;  5IO2 A;  5IMF A;  1SK1 A;  4TR3 A;  2WZ9 A;  3NZN A;  1GH2 A;  1TRW A;  1HYU A;  4I2U A;  5AN1 A;  3FYG A;  3Q18 A;  2C3Q A;  1XW6 A;  1KNG A;  1U3I A;  1FB6 A;  2CZ3 A;  2BJX A;  4TR1 B;  2L5L A;  3UMA A;  2L59 A;  5J41 A;  4ISD A;  1GUK A;  3VI7 A;  1JZR A;  3HXS A;  3HKR A;  3TUE A;  1ERV A;  1U3A A;  2B7J A;  3DD3 A;  2YZU A;  4AF2 A;  5IQY A;  3ZRE A;  2GQM A;  3M9J A;  1WE0 A;  1YEP A;  4MDC A;  5DAK A;  3CYN A;  4IKH A;  4WBJ A;  5FWG A;  4WET A;  3ZFL A;  2A2R A;  4PGT A;  3Q6O A;  4WEY A;  2FY6 A;  2B6M A;  4K1F A;  1TXX A;  1MTC A;  4HS1 A;  2OE3 A;  1K0N A;  2EIQ A;  3E3E A;  1SEN A;  1H4O A;  18GS A;  5KN1 A;  1XWB A;  1J0F A;  2VUP A;  1M2B A;  3GH6 A;  2LQQ A;  5FHI A;  1Z3E A;  4KW6 A;  4ECB A;  1VF2 A;  1EZK A;  2KOK A;  3L78 A;  2PWJ A;  1PMT A;  5GST A;  1X5C A;  2IJY A;  2LEG A;  4N0V A;  2IFQ B;  1NSW A;  1Q98 A;  4IQ1 A;  4F03 A;  5F07 A;  1AC1 A;  2DJ1 A;  4MH2 A;  4L5L A;  3D21 A;  1DUG A;  1QMV A;  2GZZ A;  3DML A;  3IRA A;  5GSS A;  3GYK A;  2YN1 A;  2NPB A;  3HA9 A;  1WMJ A;  1GTU A;  5A4U A;  5IMA A;  2PER A;  4YH2 A;  2WGR A;  3QAG A;  3QPM A;  5ECR B;  3QR6 A;  3ERG A;  4IS0 A;  4V1A g;  2OAC A;  1O81 A;  4O7H A;  2R5G A;  2RUF A;  4PQH A;  2H75 A;  4ZL8 A;  2FLS A;  4L0W A;  5IIZ A;  3HYP A;  1BED A;  1HNA A;  1B8X A;  3KD0 A;  2ZNM A;  1RW1 A;  1JLW A;  4FIW A;  12GS A;  4G9H A;  3TB2 A;  2KUC A;  4JZQ A;  3LOR A;  2CQ9 A;  1CQG A;  4MH3 A;  3D0Z A;  4KUN A;  2LNT A;  3APO A;  4FYB A;  5CYY A;  2XPD A;  1TRV A;  4XRD A;  3TKS E;  3TJJ A;  4MLY A;  4K0G A;  4TXO A;  5LNK e;  3C7M A;  3U5R E;  2OJL A;  4GST A;  4IEL A;  1THX A;  2K8V A;  3VWU A;  1Z6N A;  4JE1 A;  3EMP A;  4ECJ A;  4HDE A;  4POM A;  4ULX A;  2HNL A;  5DCG A;  2YJ7 A;  3CMI A;  2YOI A;  3CRU A;  4KAE A;  1E6B A;  2L6C A;  11GS A;  3EWL A;  2EC4 A;  2LUS A;  1EV9 A;  3C1R A;  1BAY A;  3E9J B;  3GKK A;  4K6X A;  2V6O A;  3GTU A;  2H30 A;  1U6T A;  2V32 A;  1OKT A;  1R4W A;  1OKD A;  1QQ2 A;  5KN3 A;  3HD5 A;  1B48 A;  1YKC A;  3I69 A;  2F8A A;  4I6X A;  1I5G A;  1LBK A;  4XIH A;  5B6N A;  3HJP A;  3W6G A;  1NM3 A;  5JCU A;  3VWW A;  3KIJ A;  2OBK A;  1C72 A;  4FYU A;  4HJM A;  1SKW B;  3VWV A;  3E0U A;  2ON5 A;  5DAL A;  5D9X A;  4ZB8 A;  1M9B A;  3NOF A;  5CRD A;  4I2T A;  8GSS A;  4KSO A;  2VCZ A;  4MZC A;  2OA7 A;  2V1M A;  3R2Q A;  3FZ9 A;  4Z7X A;  1V2A A;  4LL1 B;  3SBC A;  2ON7 A;  1MD3 A;  5E4W A;  3KZQ A;  2RUE A;  2YNX A;  3HDC A;  1XW5 A;  17GS A;  1PD2 1;  3UVT A;  1O73 A;  2B1K A;  1XWK A;  1N8J A;  1HNC A;  3ZFB A;  1YQ1 A;  3F3Q A;  3I9V 2;  2HZE A;  4BL7 A;  3N5O A;  4MF5 A;  2IMK A;  3MWH A;  3UVH A;  4GWR A;  1M7T A;  3CSJ A;  4TN8 A;  3GUS A;  2TRX A;  3ZVJ D;  5JCW A;  5L71 A;  5A4V A;  5ABR A;  5IM9 A;  3GL5 A;  1ZCP A;  3IR4 A;  3ED3 A;  1XPV A;  1FVK A;  1Z9H A;  2D2Z A;  3DEX A;  3GKX A;  4IQA A;  1Y6E A;  3HZ8 A;  3H8Q A;  3TKR A;  3F8U A;  3GX8 A;  3TOU A;  5ELG A;  1R7H A;  1TDI A;  2GQL A;  4XRA A;  4TR4 A;  1A0R P;  4XS4 B;  1GL8 A;  2HSY A;  4HZ2 A;  2OKA A;  3PR8 A;  3P8W A;  4EVM A;  3IHQ A;  1WJK A;  3FZ5 A;  4QQ7 A;  2GDR A;  2N5A A;  4V2N A;  4ECC A;  2KP2 A;  4GTU A;  3TCO A;  4KCA A;  4OO4 A;  3QMX A;  4P3Y B;  3EC3 A;  1BG5 A;  3F6D A;  3EU4 A;  2RM6 A;  3WT2 A;  1QFN A;  3US3 A;  1XVQ A;  3IAM 2;  3EVI A;  3V1W A;  2HFD A;  1G7E A;  4YQM A;  1ML6 A;  4RQX A;  2QKE A;  4TW5 A;  3U6V A;  3H4K A;  4XTS A;  2O8V B;  1EEM A;  2GVP A;  4PUA A;  3Q19 A;  1LU4 A;  3F6F A;  3DYR A;  1FO5 A;  4PXO A;  6GST A;  3GV1 A;  3GFK A;  3QFA C;  4KDU A;  3BJ5 A;  4Q5Q A;  3KEB A;  4TRX A;  3GSS A;  3TDG A;  2IIY A;  1XWG A;  1SU9 A;  4IVF A;  1T1V A;  2X8G A;  1X0R A;  1UA5 A;  1K0D A;  1GUH A;  2F3M A;  4YAP A;  2VO4 A;  1ZZY A;  1K0C A;  16GS A;  3KMN A;  2REM A;  5ECQ B;  1TKD B;  4NMU A;  5DQS A;  2IME A;  4E8H A;  2IN3 A;  4XS6 A;  2X8H A;  1ZYQ B;  3DIE A;  4BA7 A;  1SK2 A;  3HVS A;  1SJ6 A;  4RQR A;  3GX0 A;  2CVB A;  4EO3 A;  1M0U A;  4PQI A;  2GSQ A;  3J7Y b;  2GSS A;  3TJF A;  4JR6 A;  3TKQ A;  3LQ7 A;  4KH7 A;  1TK0 B;  5FT3 A;  2MZC A;  3F9U A;  3UJ1 A;  3LXZ A;  4IP6 A;  4HU9 A;  1NHO A;  2LS5 A;  2LQO A;  5CNW A;  2R2J A;  2PVQ A;  1GUL A;  4MPF A;  2HI7 A;  4O92 A;  1X5D A;  4OFM A;  2X8C A;  4WR4 A;  4K7I A;  4BVY A;  3HVV A;  1LJR A;  3O76 A;  2VL9 A;  3VPT A;  6GSW A;  4L5O A;  2R3X A;  4Q5N A;  2H01 A;  2DBC A;  1YDK A;  3VK9 A;  2E7P A;  4O32 A;  3H1N A;  1A2M A;  1F9M A;  5ECK B;  1OC9 B;  1YKA A;  3TJK A;  5DCH A;  2TIR A;  3P90 A;  4DVC A;  5IMV A;  1GSQ A;  2FWH A;  1V40 A;  1K0A A;  3M8N A;  2LV3 A;  1PX6 A;  4MA9 A;  6GSY A;  1F37 A;  5GZZ B;  5ECM B;  5HFG A;  1G6W A;  2JAD A;  3ERW A;  2G0F A;  3DVW A;  19GS A;  2I3Y A;  5ID2 B;  3D22 A;  2R4V A;  4F2I A;  2AUV A;  2JU5 A;  2IMD A;  4MJE A;  5D73 A;  4ZXG A;  1E2Y A;  2XC2 A;  1JZD A;  1T00 A;  3KGK A;  3TRP A;  4K7O A;  1KBN A;  2IMF A;  3FEU A;  3UBK A;  3D4M A;  1TW9 A;  5HFK A;  3P7X A;  5D9T A;  4GRF A;  4ZB9 A;  5J3R A;  1OYJ A;  2P0G A;  2PVO C;  2XBI A;  1K0O A;  5DJL A;  3WGE A;  1DSB A;  5B6M A;  4ACS A;  4G10 A;  2VD0 A;  1A8Y A;  5AIX A;  4EC0 A;  3F4S A;  1CQH A;  2F51 A;  4KB3 A;  1MDK A;  2MMA A;  6GSS A;  3QCP A;  2H6Y A;  3LFL A;  5H5Q A;  3L9S A;  4NV2 A;  5ECO B;  2DMM A;  2K9F A;  4J56 E;  3MDK A;  5A4W A;  3ZIV A;  1FOV A;  1V58 A;  1GTI A;  4FH8 A;  1FHE A;  5INY A;  3FHK A;  1SK0 A;  1OE8 A;  5KEJ A;  2L57 A;  1PL1 A;  4NV5 A;  1XFL A;  4NHW A;  4KDX A;  1A8L A;  1MEK A;  2P5Q A;  1ZYE A;  4K7N A;  4OMV A;  3IDV A;  4TOP A;  1USB A;  3W8S A;  2L4Q A;  4HU7 A;  4AGS A;  2HRF A;  2E2G A;  1WRY A;  2HSH A;  1SJI A;  2C0E A;  3UOM A;  2LKU A;  1WIK A;  1XOA A;  1AUC A;  5B7C A;  1T4Z A;  2AAW A;  1FVJ A;  1SKR B;  1Z7R A;  5ECL B;  2DJ2 A;  2DJ0 A;  2RM5 A;  3M1G A;  1QGV A;  4X1U A;  3LG6 A;  1R5A A;  4XS4 A;  4GCI A;  1TRU A;  1TK8 B;  2LJA A;  3NIV A;  4J57 E;  20GS A;  1UVZ A;  3GNJ A;  5D9W A;  4OWY A;  4G2E A;  1Q4J A;  4KND A;  5DJM A;  1GUM A;  4F0B A;  2H72 A;  2O87 A;  5F0G A;  3ZZX A;  4N30 A;  1EOH A;  1EWX A;  4FYC A;  4PUR A;  2MBT A;  3EMX A;  2H1G A;  7GSS A;  2C0D A;  4JU5 A;  3RHB A;  3BCI A;  5J4U A;  1TK5 B;  2O7K A;  3TGZ A;  1Z7P A;  3ISO A;  3ZL5 A;  5CRG A;  2VOC A;  1MDI A;  2EIR A;  3L0H A;  3I6A A;  3W8J A;  3GKN A;  1V98 A;  4KA0 A;  3QFB C;  2JL4 A;  5ELA A;  1IYI A;  1T7P B;  5G5E A;  4IN0 A;  1SL1 B;  2LNS A;  2VL2 A;  4F9Z A;  1GNW A;  2OE0 A;  3F0I A;  4YAV A;  1A0F A;  2KHP A;  2PBJ A;  1T8E B;  2X64 A;  5F05 A;  3CSI A;  1THO A;  3HCZ A;  3TOT A;  1EP7 A;  4ECI A;  1GSS A;  2HXK A;  4BPY A;  4D73 A;  5ECP B;  1TJD A;  2MMN A;  2LTK A;  1TU7 A;  3EE2 A;  2LJK A;  5B8B A;  1OVN A;  3ZML A;  2YAN A;  5HR1 A;  5LD0 A;  6GSV A;  5IPH A;  3M3M A;  2DIZ A;  3GKM A;  1RK4 A;  1BX9 A;  4EDZ A;  5D96 A;  1ST9 A;  2GGT A;  1MDJ A;  1ZMA A;  2VCW A;  1TTZ A;  2H71 A;  2H66 A;  3FR9 A;  2TRC P;  2EIO A;  1K3O A;  4WF5 A;  4DSQ A;  2LRT A;  2R6K A;  5CP1 A;  2CX4 A;  2C1Y A;  3PGT A;  3GL3 A;  1XWC A;  3RHC A;  3A5W A;  3ZIJ A;  3C73 A;  2DML A;  2OAD A;  3L4N A;  4DEJ A;  3D6I A;  5B8A A;  5D93 A;  1GNE A;  3TRX A;  2I81 A;  1OC9 A;  4WXT A;  1GLQ A;  4TVE A;  1A2J A;  3LGC A;  1SD9 A;  9GSS A;  1EGO A;  4TXV A;  3QAW A;  4GLT A;  1TRS A;  2FCH A;  2FA4 A;  3TKS C;  2XHF A;  2PPT A;  2XPE A;  5DBQ A;  1BJX A;  4AJ7 A;  5ID2 A;  4EE0 A;  1F3B A;  1Y25 A;  5CRE A;  5DAK B;  4NWY A;  1BQ7 A;  1S3D A;  2C0G A;  4ZL9 A;  1K0M A;  4E8E A;  4CHS A;  2P5R A;  2BMX A;  2JSY A;  4N0Z A;  1KTE A;  1GSU A;  2C3T A;  2K8S A;  3MAK A;  4EDY A;  2JSZ A;  3RDW A;  2IPA A;  5EY6 A;  2PU9 C;  2DJJ A;  1O7U A;  3D5J A;  5GAN D;  1O8X A;  3GA4 A;  2KLX A;  4TR1 A;  4F0C A;  2JZR A;  5C00 A;  2CV4 A;  3L9U A;  2FWG A;  4IGJ A;  1XVW A;  2B5X A;  3A2V A;  1AIU A;  2N5B A;  4EXJ A;  2AV4 A;  1XIY A;  3A3T A;  3ME7 A;  2K6V A;  4JBB A;  4CDO A;  2YP6 A;  2B7K A;  1PL2 A;  4KSM A;  2F8F A;  3A2W A;  1QK8 A;  4ML6 A;  1FAA A;  3TJG A;  2B5Y A;  1R5P A;  5IPG A;  2B5E A;  3FK8 A;  1K0B A;  5A5K A;  2NBS A;  4MCU A;  1SYR A;  4KDY A;  3C8E A;  5H5S A;  2NVL A;  1A2L A;  5HR0 A;  3GMF A;  4ID0 A;  2GST A;  2VL2 C;  2KP1 A;  2GT6 A;  2GLR A;  3RBT A;  2F9S A;  3C71 A;  4K2D A;  2IFQ A;  3DXB A;  1SD8 A;  1AQX A;  1YEX A;  1PQN A;  3ZIT A;  1WWJ A;  5ECS A;  2LRC A;  4N10 A;  2H73 A;  2H0H A;  4JRR A;  2V2G A;  1X9W B;  3IBH A;  2N5F A;  2PGT A;  3FZ4 A;  1OAZ A;  4ZL7 A;  4TKY A;  4POB A;  3IC4 A;  4IHU A;  4NHZ A;  3KCM A;  5GAP D;  5COH A;  3KXO A;  1IYH A;  4POL A;  4KCE A;  3RPN A;  4L8E A;  1XWA A;  1J08 A;  1T4Y A;  4RUV A;  2MBS A;  5G5F A;  1WP0 A;  3LJR A;  3CXG A;  2QC7 A;  2NDO A;  4BWS A;  4WKW A;  4WR5 A;  3FRC A;  1PGT A;  4RI6 A;  3G7I A;  3VPQ A;  4I5Q A;  3IK9 A;  5LCZ A;  5J9C A;  3KJY A;  1X9S B;  4LLR A;  3DGQ A;  3VI5 A;  2OE1 A;  4DSS B;  3I43 A;  1ZGN A;  4EKZ A;  1GTA A;  2FUG 2;  5JWO B;  1O8W A;  3IAS 2;  4IW9 A;  5IMZ A;  1EP8 A;  1DE1 A;  4N11 A;  1KEB A;  4MK3 A;  2VLV A;  3LXT A;  2L5O A;  1X5E A;  3IPZ A;  3IK7 A;  3KTL A;  5KN0 A;  2PUK C;  1J9B A;  2H76 A;  5DDL A;  2CZ2 A;  2QGV A;  1TI3 A;  1B4Q A;  2DJ3 A;  3APS A;  2HZF A;  6GSX A;  2QSI A;  4GSN A;  2VM1 A;  1PX7 A;  4GQF A;  3HZ4 A;  1ZL9 A;  4HJ2 A;  1HD2 A;  2VCV A;  1YJ6 A;  3GN3 A;  1ABA A;  1VRS D;  2MYG A;  1PN9 A;  1G6Y A;  4BWQ A;  1SKS B;  4MPG A;  4OCE A;  3ZLP A;  5H5R A;  1WOU A;  1XXU A;  4NPB A;  4LMW A;  2HRN A;  4X0X A;  2HZE B;  4ZBD A;  1ON4 A;  2GZP A;  1W4V A;  4CW9 A;  3BCK A;  4HQZ A;  1SYX A;  4I8B A;  3P2A A;  4OFT A;  3F4R A;  1JFU A;  3IA1 A;  1YF0 A;  3KM6 A;  3KH7 A;  2H0G A;  2YZH A;  4I97 A;  4DSR A;  5KN2 A;  3UL3 A;  2A4V A;  2C3N A;  4OFN A;  3WYW A;  1G7O A;  5CRH A;  4MMM A;  1R26 A;  3DVX A;  3F3R A;  3KP8 A;  1QUW A;  2L6D A;  2IWT A;  1SL2 B;  1Z6M A;  1M9A A;  4MJC A;  2WCI A;  3GST A;  5AIS A;  1PKZ A;  2VCX A;  1AW9 A;  3TKS A;  1T3B A;  4MF7 A;  5JWQ B;  4TR0 A;  5JWR B;  3K8N A;  2HT9 A;  2H6Z A;  3WD6 A;  3OR5 A;  3F4T A;  4MF6 A;  3KTB A;  2ZUP A;  4J2F A;  4HQS A;  2GT5 A;  1F2E A;  3F63 A;  3D4T A;  4LMV A;  4F82 A;  1URM A;  1GSE A;  3HJO A;  1M2D A;  2J23 A;  3HVX A;  2GSR A;  2FNO A;  5ENU A;  4XS1 A;  1EGR A;  1GSD A;  3M9K A;  2XBQ A;  5DQY A;  4V1A p;  2O89 A;  3ZMK A;  2LRN A;  4WF4 A;  3UBL A;  4JED A;  2WUL A;  5D8I A;  1YY7 A;  1H75 A;  1ZOF A;  2VLU A;  4EF0 A;  4GF0 A;  2JZT A;  3FR3 A;  13GS A;  3UAR A;  4FO5 A;  1N2A A;  3G7Y A;  4HZ4 A;  2GQK A;  4K0N A;  4HI7 A;  4BVX A;  3BOA A;  4IP1 A;  3H93 A;  3CRT A;  3GH9 A;  5HR2 A;  5F06 A;  1XCC A;  3UEM A;  4KGI A;  22GS A;  3S9F A;  2M72 A;  2IL3 A;  2E2M A;  2WFC A;  4OD7 A;  2WS2 A;  4V2M A;  3CSH A;  3UAP A;  3IE3 A;  4XHM A;  1O85 A;  5IOW A;  2WDU A;  1ERU A;  1AQV A;  5CAX A;  1B9X C;  2C8U A;  6GSU A;  4QL7 A;  4MZB A;  2C80 A;  4LL4 B;  4MP4 A;  3VUR A;  4MJA A;  2FWE A;  2JAC A;  1EV4 A;  5J9B A;  1XBS A;  3DWV A;  2H70 A;  5F8B A;  3FR6 A;  3LYP A;  4IJI A;  3G7J A;  2C4J A;  4YQV A;  4L0U A;  1JZW A;  3LYK A;  4OCF A;  1FB0 A;  2V41 A;  1XOB A;  3RAZ A;  1NW2 A;  5EL8 A;  2YV7 A;  3EUR A;  1FG4 A;  2DLX A;  3H79 A;  1GRX A;  1GSF A;  3N9J A;  3FKF A;  3WT1 A;  5G1L A;  3A2X A;  2VM2 A;  2YV9 A;  3IV4 A;  2IMI A;  2CAQ A;  2YWI A;  1PKW A;  2MMZ A;  3GRX A;  1NHY A;  3KP9 A;  5EVO A;  3TRQ A;  3BBY A;  5AGY A;  2C0F A;  2RLI A;  4MZW A;  4DSS A;  2FGX A;  5J5N A;  1DE2 A;  1S3A A;  5G30 A;  2GZY A;  3C1S A;  2DSA A;  3GIX A;  2MMO A;  2VAF A;  5E59 A;  4AJ6 A;  1GWC A;  3CTG A;  1PA3 A;  4RI7 A;  1TI1 A;  2V6K A;  1W89 A;  3FZA A;  2H1B A;  1Z5Y E;  3HHV A;  5HQP A;  2FHE A;  3IXR A;  3ME8 A;  3ZTL A;  5CO3 A;  4KX4 A;  1VF4 A;  3J7Y k;  2YWM A;  1XW9 A;  4QL9 A;  2CVD A;  3WGX A;  1GLP A;  4G19 A;  3LSZ A;  4K9Z A;  3ZVJ A;  2HE3 A;  2PN8 A;  2NTO A;  2LJR A;  5AIV A;  1TOF A;  3LEF A;  2HLS A;  3VFI A;  2DJK A;  5G2Z A;  2FWF A;  3G9B A;  1ERT A;  1SJZ A;  1OE7 A;  5HR3 A;  1JHB A;  2AJQ B;  4ZIJ A;  3DRN A;  1K3L A;  3PIN A;  4YQU A;  3KMO A;  1PRX A;  3ERF A;  1GSY A;  4NAX A;  4MJB A;  4NXI A;  4HEA 2;  1TU8 A;  3L9V A;  4PQ1 A;  3ZYW A;  2E0Q A;  1ACV A;  3VLN A;  2YWN A;  3GHA A;  1B4P A;  3VWX A;  4PNF A;  3O6T A;  2WB9 A;  4X43 A;  3JCM L;  2DC5 A;  1ILO A;  3CTF A;  5IO0 A;  2P31 A;  1X9M B;  2VLT A;  3IOS A;  2J9H A;  2G2Q A;  1BYE A;  1AAZ A;  5IMD A;  2AYT A;  1JZO A;  4IBP A;  2A2S A;  1A24 A;  1ERW A;  1JLV A;  4ZBA A;  3ZRD A;  1VF3 A;  2X99 A;  2B1L A;  4ILF A;  1V9W A;  3TKP A;  1QXH A;  3LWA A;  3QAV A;  2WRT A;  4MAB A;  5ECH B;  1F6M C;  3QOU A;  3SWL A;  2CA8 A;  4LA1 A;  3MNG A;  3TJB A;  1DBY A;  1MD4 A;  4IJ3 A;  4ZIL A;  2GTU A;  2H8L A;  2I9H A;  14GS A;  2AHE A;  3UIW A;  1SL0 B;  2H1A A;  4OO5 A;  2CAI A;  1S3C A;  2FA8 A;  1G0T A;  2YPM A;  3EYT A;  4GSS A;  4PUF C;  1TP9 A;  1HNB A;  5ECI B;  4PNG A;  2R37 A;  2VIM A;  4Q5F A;  3FY7 A;  5G1K A;  1EEJ A;  2K18 A;  2H74 A;  2YCD A;  2ZCT A;  1UC7 A;  3O3T A;  3BD2 A;  4PX1 A;  1U88 A;  1I9D A;  1M2A A;  3Q74 A;  3WGD A;  1EOG A;  1UN2 A;  1XZO A;  3EU3 A;  3MSZ A;  5CRW A;  4TXO B; 
#chains in the Genus database with same CATH topology
 4CY8 A;  2H1D A;  4H86 A;  4Q5R A;  4V2L A;  3GUR A;  10GS A;  3HVN A;  1YF1 A;  4K8M A;  4O5R A;  5G31 A;  1AXD A;  1WPI A;  3CBU A;  2ES7 A;  5D9V A;  3KH9 A;  2RII A;  4D73 B;  2PMT A;  2H0I A;  3APQ A;  3QDN A;  2M80 A;  1A23 A;  4JR4 A;  4AJ8 A;  1V57 A;  4GXZ A;  2OBI A;  1PSQ A;  2VCT A;  2B3S A;  2VL3 A;  2CX3 A;  2HYX A;  5IOX A;  2YJH A;  4ZB6 A;  5ECN B;  1K3Y A;  1M3J A;  2ALB A;  2Z9S A;  3GTU B;  2WJU A;  2LST A;  2I1U A;  4XCS A;  2M46 A;  1M99 A;  2VD1 A;  1GTB A;  3PH9 A;  4WBR D;  4A5P A;  1F3A A;  4ZBB A;  1M3I A;  5EPF A;  3HJM A;  3DKS A;  2VCQ A;  5C04 A;  1RQM A;  2HRK A;  4EUY A;  5DAL B;  1AQW A;  4KE3 A;  3FW2 A;  2AB6 A;  1OC8 A;  2YWO A;  5JCG A;  4EL1 A;  2I4A A;  3QD9 A;  5HFI A;  2FD3 A;  1YZX A;  1OC3 A;  2H19 A;  3CQF A;  3FMW A;  1B9Y C;  2GS3 A;  2H6X A;  2DIY A;  3M0F A;  1FW1 A;  3EIN A;  4HUA A;  2CT6 A;  5DVB A;  4HOJ A;  1HQO A;  5IMC A;  3HY2 A;  1U87 A;  4GQC A;  4BL7 B;  1GP1 A;  2BTO T;  1O6J A;  3AY8 A;  3RPP A;  1VGL A;  2JZS A;  1VF1 A;  2CVK A;  2QA1 A;  2O85 A;  4ML1 A;  4POK A;  2L4C A;  5IO2 A;  5IMF A;  1SK1 A;  4TR3 A;  2WZ9 A;  3NZN A;  1GH2 A;  1TRW A;  1HYU A;  4I2U A;  5AN1 A;  3FYG A;  3Q18 A;  2C3Q A;  1XW6 A;  1KNG A;  1U3I A;  4O5Q A;  1FB6 A;  2CZ3 A;  2BJX A;  4TR1 B;  2L5L A;  3UMA A;  2L59 A;  5J41 A;  4ISD A;  1GUK A;  3VI7 A;  1JZR A;  2UZ8 A;  3HXS A;  3HKR A;  3TUE A;  1ERV A;  1U3A A;  2B7J A;  3DD3 A;  2YZU A;  4AF2 A;  5IQY A;  3ZRE A;  2GQM A;  3M9J A;  1WE0 A;  1YEP A;  4MDC A;  5DAK A;  3CYN A;  4IKH A;  4WBJ A;  5FWG A;  4WET A;  3ZFL A;  2A2R A;  4PGT A;  3Q6O A;  4WEY A;  2FY6 A;  2B6M A;  4K1F A;  1TXX A;  1MTC A;  4HS1 A;  2OE3 A;  1K0N A;  2DKI A;  2EIQ A;  3E3E A;  4CY6 A;  1SEN A;  1H4O A;  18GS A;  5KN1 A;  1XWB A;  1J0F A;  2VUP A;  1M2B A;  3GH6 A;  2LQQ A;  5FHI A;  1Z3E A;  4KW6 A;  4ECB A;  1VF2 A;  1EZK A;  2KOK A;  3L78 A;  2PWJ A;  1PMT A;  5GST A;  1X5C A;  2IJY A;  2LEG A;  4N0V A;  1XG8 A;  2IFQ B;  1NSW A;  1Q98 A;  4IQ1 A;  4F03 A;  5F07 A;  1AC1 A;  2DJ1 A;  4MH2 A;  4L5L A;  3D21 A;  1DUG A;  1QMV A;  2GZZ A;  3DML A;  3IRA A;  5GSS A;  3GYK A;  2YN1 A;  2NPB A;  3HA9 A;  1WMJ A;  1GTU A;  5A4U A;  5IMA A;  2PER A;  4YH2 A;  2WGR A;  3QAG A;  3QPM A;  5ECR B;  3QR6 A;  3ERG A;  4IS0 A;  4V1A g;  2OAC A;  1O81 A;  4O7H A;  2R5G A;  2RUF A;  4PQH A;  2H75 A;  4ZL8 A;  2FLS A;  4L0W A;  5IIZ A;  3HYP A;  1BED A;  1HNA A;  1B8X A;  3KD0 A;  2ZNM A;  1RW1 A;  1JLW A;  3EPT A;  4FIW A;  12GS A;  4G9H A;  3TB2 A;  2KUC A;  4JZQ A;  3LOR A;  2CQ9 A;  1CQG A;  4MH3 A;  3D0Z A;  4KUN A;  2LNT A;  3APO A;  4FYB A;  5CYY A;  2XPD A;  1TRV A;  4XRD A;  3TKS E;  3TJJ A;  4MLY A;  4K0G A;  4TXO A;  5LNK e;  3C7M A;  3U5R E;  2OJL A;  4GST A;  4IEL A;  1THX A;  2K8V A;  3VWU A;  1Z6N A;  4Z2T A;  4JE1 A;  3EMP A;  4ECJ A;  4HDE A;  4POM A;  4ULX A;  2HNL A;  5DCG A;  2YJ7 A;  3CMI A;  2YOI A;  3CRU A;  4KAE A;  1E6B A;  2L6C A;  11GS A;  3EWL A;  2EC4 A;  2LUS A;  1EV9 A;  3C1R A;  4ICY A;  1BAY A;  3E9J B;  3GKK A;  4K6X A;  2V6O A;  3GTU A;  2H30 A;  1U6T A;  2V32 A;  1OKT A;  1R4W A;  1OKD A;  1QQ2 A;  5KN3 A;  3HD5 A;  1B48 A;  1YKC A;  3I69 A;  2F8A A;  4I6X A;  1I5G A;  1LBK A;  4XIH A;  5B6N A;  3HJP A;  3W6G A;  1NM3 A;  5JCU A;  3VWW A;  3KIJ A;  2OBK A;  1C72 A;  4FYU A;  4HJM A;  1SKW B;  3VWV A;  3E0U A;  2ON5 A;  5DAL A;  5D9X A;  4ZB8 A;  1M9B A;  3NOF A;  5CRD A;  4MNN A;  4I2T A;  8GSS A;  4KSO A;  2VCZ A;  4MZC A;  2OA7 A;  2V1M A;  3R2Q A;  3FZ9 A;  4Z7X A;  1V2A A;  4LL1 B;  3SBC A;  2ON7 A;  1MD3 A;  5E4W A;  3KZQ A;  2RUE A;  2YNX A;  3HDC A;  1XW5 A;  17GS A;  1PD2 1;  3UVT A;  1O73 A;  2B1K A;  1XWK A;  1N8J A;  1HNC A;  3ZFB A;  1YQ1 A;  3F3Q A;  3I9V 2;  2HZE A;  4BL7 A;  3N5O A;  4MF5 A;  2IMK A;  3MWH A;  4G0K A;  3UVH A;  4GWR A;  1M7T A;  3CSJ A;  4TN8 A;  3GUS A;  2TRX A;  3ZVJ D;  5JCW A;  5L71 A;  5A4V A;  5ABR A;  5IM9 A;  3GL5 A;  1ZCP A;  3IR4 A;  3ED3 A;  1XPV A;  1FVK A;  1Z9H A;  2D2Z A;  3DEX A;  3GKX A;  4IQA A;  1Y6E A;  3HZ8 A;  3H8Q A;  3TKR A;  3F8U A;  3GX8 A;  3TOU A;  5ELG A;  1R7H A;  1TDI A;  2GQL A;  4XRA A;  4TR4 A;  1A0R P;  4XS4 B;  1GL8 A;  2HSY A;  4HZ2 A;  2OKA A;  3PR8 A;  3P8W A;  4EVM A;  3IHQ A;  1WJK A;  3FZ5 A;  4QQ7 A;  2GDR A;  2N5A A;  4V2N A;  4ECC A;  2KP2 A;  4GTU A;  3TCO A;  4KCA A;  4OO4 A;  3QMX A;  4P3Y B;  3EC3 A;  1BG5 A;  3F6D A;  3EU4 A;  2RM6 A;  3WT2 A;  1QFN A;  3US3 A;  1XVQ A;  3IAM 2;  3EVI A;  3V1W A;  2HFD A;  1G7E A;  4YQM A;  1ML6 A;  4USS A;  4RQX A;  2QKE A;  4TW5 A;  3U6V A;  3H4K A;  3LW9 A;  4XTS A;  2O8V B;  1EEM A;  2GVP A;  4PUA A;  3Q19 A;  1LU4 A;  3F6F A;  3DYR A;  1FO5 A;  4PXO A;  6GST A;  3GV1 A;  3GFK A;  3QFA C;  4KDU A;  3BJ5 A;  4Q5Q A;  3IC8 A;  3KEB A;  4TRX A;  3GSS A;  3TDG A;  2IIY A;  1XWG A;  1SU9 A;  4IVF A;  1T1V A;  2X8G A;  1X0R A;  1UA5 A;  1K0D A;  1GUH A;  2F3M A;  4YAP A;  2VO4 A;  1ZZY A;  1K0C A;  16GS A;  3KMN A;  2REM A;  5ECQ B;  1TKD B;  4YKF A;  4NMU A;  5DQS A;  2IME A;  4E8H A;  2IN3 A;  4XS6 A;  2X8H A;  1ZYQ B;  3DIE A;  4BA7 A;  1SK2 A;  3HVS A;  1SJ6 A;  4RQR A;  3GX0 A;  2CVB A;  4EO3 A;  3A5I A;  4YKG A;  1M0U A;  4PQI A;  2GSQ A;  3J7Y b;  2GSS A;  3TJF A;  4JR6 A;  3TKQ A;  3LQ7 A;  4KH7 A;  1TK0 B;  5FT3 A;  2MZC A;  3F9U A;  3UJ1 A;  3LXZ A;  4IP6 A;  4HU9 A;  1NHO A;  2LS5 A;  2LQO A;  5CNW A;  2R2J A;  2PVQ A;  1GUL A;  4MPF A;  2HI7 A;  4O92 A;  1X5D A;  4OFM A;  2X8C A;  4WR4 A;  4K7I A;  4BVY A;  5BRT A;  3HVV A;  1LJR A;  3O76 A;  2VL9 A;  3VPT A;  6GSW A;  4L5O A;  2R3X A;  4Q5N A;  2H01 A;  2DBC A;  1YDK A;  3VK9 A;  2E7P A;  4O32 A;  3H1N A;  1A2M A;  1F9M A;  5ECK B;  1OC9 B;  4K5R A;  1YKA A;  3TJK A;  5DCH A;  2TIR A;  3P90 A;  4DVC A;  5IMV A;  1GSQ A;  2FWH A;  1V40 A;  1K0A A;  3M8N A;  2LV3 A;  1PX6 A;  4MA9 A;  6GSY A;  1F37 A;  5GZZ B;  5ECM B;  5HFG A;  1G6W A;  2JAD A;  1PN0 A;  3ERW A;  2R0G A;  2G0F A;  3DVW A;  19GS A;  2I3Y A;  5ID2 B;  3MYD A;  3D22 A;  2R4V A;  4F2I A;  2AUV A;  2JU5 A;  2IMD A;  4MJE A;  5D73 A;  4ZXG A;  1E2Y A;  2XC2 A;  4K5S A;  1JZD A;  1T00 A;  3KGK A;  3TRP A;  4K7O A;  1KBN A;  2IMF A;  3FEU A;  3UBK A;  3D4M A;  1TW9 A;  5HFK A;  3P7X A;  5D9T A;  4GRF A;  4ZB9 A;  5J3R A;  1OYJ A;  2P0G A;  2PVO C;  2XBI A;  1K0O A;  5DJL A;  3WGE A;  1DSB A;  5B6M A;  4ACS A;  4G10 A;  2VD0 A;  1A8Y A;  5AIX A;  4EC0 A;  2A2P A;  3F4S A;  1CQH A;  2F51 A;  4KB3 A;  1MDK A;  2MMA A;  6GSS A;  3QCP A;  2H6Y A;  3LFL A;  5H5Q A;  3L9S A;  4NV2 A;  5ECO B;  2DMM A;  2K9F A;  4J56 E;  3MDK A;  5A4W A;  3ZIV A;  1FOV A;  1V58 A;  1GTI A;  4FH8 A;  1FHE A;  5INY A;  3FHK A;  1SK0 A;  1OE8 A;  5KEJ A;  2L57 A;  1PL1 A;  4NV5 A;  1XFL A;  4NHW A;  4KDX A;  1A8L A;  1MEK A;  2P5Q A;  1ZYE A;  1ZYP A;  4K7N A;  4OMV A;  3IDV A;  4TOP A;  1USB A;  3W8S A;  2L4Q A;  4HU7 A;  4AGS A;  2HRF A;  2E2G A;  1WRY A;  2HSH A;  1SJI A;  2C0E A;  3UOM A;  2LKU A;  1WIK A;  1XOA A;  1AUC A;  5B7C A;  1T4Z A;  2AAW A;  1FVJ A;  1SKR B;  1Z7R A;  5ECL B;  2DJ2 A;  2DJ0 A;  2RM5 A;  4HSC X;  3M1G A;  1QGV A;  4X1U A;  3LG6 A;  1R5A A;  4XS4 A;  4GCI A;  1TRU A;  1TK8 B;  2LJA A;  3NIV A;  4J57 E;  20GS A;  1UVZ A;  3GNJ A;  5D9W A;  4OWY A;  4G2E A;  1Q4J A;  4KND A;  5DJM A;  1GUM A;  4F0B A;  2H72 A;  2O87 A;  5F0G A;  3ZZX A;  4N30 A;  1EOH A;  1EWX A;  4FYC A;  4PUR A;  2MBT A;  3EMX A;  2H1G A;  7GSS A;  2C0D A;  4JU5 A;  3RHB A;  3BCI A;  5J4U A;  1TK5 B;  2O7K A;  3TGZ A;  1Z7P A;  3ISO A;  3ZL5 A;  5CRG A;  2VOC A;  1MDI A;  2EIR A;  3L0H A;  3I6A A;  3W8J A;  3GKN A;  1V98 A;  4KA0 A;  3QFB C;  2JL4 A;  5ELA A;  1IYI A;  5KOX A;  1T7P B;  5G5E A;  4IN0 A;  1SL1 B;  2LNS A;  2VL2 A;  4F9Z A;  1GNW A;  2OE0 A;  3F0I A;  4YAV A;  1A0F A;  2KHP A;  2PBJ A;  1T8E B;  2X64 A;  5F05 A;  3CSI A;  1THO A;  3HCZ A;  3TOT A;  1EP7 A;  4ECI A;  1GSS A;  2HXK A;  4BPY A;  4EIP A;  3IHG A;  4D73 A;  5ECP B;  1TJD A;  2MMN A;  2LTK A;  1TU7 A;  3EE2 A;  2LJK A;  5B8B A;  1OVN A;  3ZML A;  2YAN A;  5HR1 A;  5LD0 A;  6GSV A;  5IPH A;  3M3M A;  2DIZ A;  3GKM A;  1RK4 A;  1BX9 A;  4EDZ A;  5D96 A;  1ST9 A;  2GGT A;  1MDJ A;  1ZMA A;  2VCW A;  1TTZ A;  2H71 A;  2H66 A;  3FR9 A;  2TRC P;  2EIO A;  1K3O A;  4WF5 A;  4DSQ A;  2LRT A;  2R6K A;  5CP1 A;  2CX4 A;  2C1Y A;  3PGT A;  3GL3 A;  5KOW A;  1XWC A;  3RHC A;  3A5W A;  3ZIJ A;  3C73 A;  2DML A;  2OAD A;  3L4N A;  4DEJ A;  3D6I A;  5B8A A;  5D93 A;  1GNE A;  3TRX A;  2I81 A;  1OC9 A;  4WXT A;  1GLQ A;  4TVE A;  1A2J A;  3LGC A;  1SD9 A;  9GSS A;  1EGO A;  4TXV A;  3QAW A;  4GLT A;  1TRS A;  2FCH A;  2FA4 A;  3TKS C;  2XHF A;  2PPT A;  2XPE A;  5DBQ A;  1BJX A;  4AJ7 A;  5ID2 A;  4EE0 A;  1F3B A;  1Y25 A;  5CRE A;  5DAK B;  4NWY A;  4G0L A;  1BQ7 A;  1S3D A;  2C0G A;  4ZL9 A;  1K0M A;  4E8E A;  4CHS A;  2P5R A;  2BMX A;  2JSY A;  4N0Z A;  1KTE A;  1GSU A;  2C3T A;  2K8S A;  3MAK A;  4EDY A;  2JSZ A;  3RDW A;  2IPA A;  5EY6 A;  2PU9 C;  2DJJ A;  1O7U A;  3D5J A;  5GAN D;  1O8X A;  3GA4 A;  2KLX A;  4TR1 A;  4F0C A;  2JZR A;  5C00 A;  4K2X A;  2CV4 A;  3L9U A;  2FWG A;  4IGJ A;  1XVW A;  2B5X A;  3A2V A;  1AIU A;  2N5B A;  4EXJ A;  2AV4 A;  1XIY A;  3A3T A;  3ME7 A;  2K6V A;  4JBB A;  4CDO A;  2YP6 A;  2B7K A;  1PL2 A;  4KSM A;  2F8F A;  3A2W A;  1QK8 A;  4ML6 A;  4BVX B;  1FAA A;  3TJG A;  2B5Y A;  1R5P A;  5IPG A;  2B5E A;  3FK8 A;  1K0B A;  5A5K A;  2NBS A;  4MCU A;  1SYR A;  2X49 A;  4KDY A;  5BMU A;  3C8E A;  5H5S A;  2NVL A;  1A2L A;  5HR0 A;  3GMF A;  4ID0 A;  2GST A;  2VL2 C;  2KP1 A;  2GT6 A;  2GLR A;  3RBT A;  2F9S A;  3C71 A;  4K2D A;  2IFQ A;  3DXB A;  1SD8 A;  1AQX A;  1YEX A;  1PQN A;  3ZIT A;  1WWJ A;  5ECS A;  2LRC A;  4N10 A;  2H73 A;  2H0H A;  4JRR A;  2V2G A;  1X9W B;  3IBH A;  2N5F A;  2PGT A;  3FZ4 A;  1OAZ A;  4ZL7 A;  4TKY A;  4POB A;  3IC4 A;  4IHU A;  4NHZ A;  3KCM A;  5GAP D;  5COH A;  3KXO A;  1IYH A;  4POL A;  4KCE A;  3RPN A;  4L8E A;  1XWA A;  1J08 A;  1T4Y A;  4RUV A;  2MBS A;  5G5F A;  1WP0 A;  3LJR A;  3CXG A;  2QC7 A;  2NDO A;  4BWS A;  4WKW A;  4WR5 A;  4G0I A;  3FRC A;  1PGT A;  4RI6 A;  3G7I A;  3VPQ A;  4I5Q A;  2HSM A;  3IK9 A;  5LCZ A;  5J9C A;  3KJY A;  1X9S B;  4LLR A;  3DGQ A;  3VI5 A;  2OE1 A;  4DSS B;  3I43 A;  1ZGN A;  4EKZ A;  2R0C A;  1GTA A;  2FUG 2;  5JWO B;  1O8W A;  3IAS 2;  4IW9 A;  5IMZ A;  1EP8 A;  1DE1 A;  4N11 A;  1KEB A;  4MK3 A;  2VLV A;  3LXT A;  2L5O A;  1X5E A;  3IPZ A;  3IK7 A;  3KTL A;  5KN0 A;  2PUK C;  1J9B A;  2H76 A;  5DDL A;  2CZ2 A;  2QGV A;  1TI3 A;  1B4Q A;  2DJ3 A;  3APS A;  2HZF A;  6GSX A;  2QSI A;  4GSN A;  2VM1 A;  1PX7 A;  4GQF A;  3HZ4 A;  1ZL9 A;  4HJ2 A;  1HD2 A;  2VCV A;  1YJ6 A;  3GN3 A;  1ABA A;  1VRS D;  2MYG A;  1ZYN A;  1PN9 A;  1G6Y A;  4KF9 A;  4BWQ A;  1SKS B;  4MPG A;  4EIQ A;  4OCE A;  3ZLP A;  5H5R A;  1WOU A;  1XXU A;  4NPB A;  4LMW A;  2HRN A;  1S3R A;  2HZE B;  4X0X A;  4ZBD A;  1ON4 A;  2GZP A;  1W4V A;  4CW9 A;  3BCK A;  4HQZ A;  1SYX A;  4I8B A;  3P2A A;  4OFT A;  3F4R A;  1JFU A;  3IA1 A;  1YF0 A;  4PTS A;  3KM6 A;  3KH7 A;  2H0G A;  2YZH A;  4I97 A;  4DSR A;  5KN2 A;  3UL3 A;  2A4V A;  2C3N A;  4OFN A;  3WYW A;  1G7O A;  5CRH A;  4MMM A;  1R26 A;  3DVX A;  3F3R A;  3KP8 A;  1QUW A;  2L6D A;  2IWT A;  1SL2 B;  1Z6M A;  1M9A A;  4MJC A;  2WCI A;  3GST A;  5AIS A;  1PKZ A;  2VCX A;  1AW9 A;  3TKS A;  1T3B A;  4MF7 A;  5JWQ B;  4TR0 A;  5JWR B;  3K8N A;  2HT9 A;  2H6Z A;  3WD6 A;  3OR5 A;  3F4T A;  4MF6 A;  3KTB A;  2ZUP A;  4J2F A;  3PPU A;  4HQS A;  2GT5 A;  1F2E A;  3F63 A;  3D4T A;  4LMV A;  4F82 A;  1URM A;  1GSE A;  3HJO A;  1M2D A;  2J23 A;  3HVX A;  2GSR A;  2FNO A;  5ENU A;  4XS1 A;  1EGR A;  1GSD A;  3M9K A;  2XBQ A;  5DQY A;  3MIX A;  4V1A p;  2O89 A;  3ZMK A;  2LRN A;  4WF4 A;  3UBL A;  4JED A;  2WUL A;  5D8I A;  4FQU A;  1YY7 A;  1H75 A;  2A4H A;  1ZOF A;  2VLU A;  4EF0 A;  4GF0 A;  2JZT A;  3FR3 A;  13GS A;  3UAR A;  4FO5 A;  1N2A A;  3G7Y A;  4HZ4 A;  2GQK A;  4K0N A;  4HI7 A;  4BVX A;  3BOA A;  4IP1 A;  3H93 A;  3CRT A;  3GH9 A;  5HR2 A;  5F06 A;  1XCC A;  3UEM A;  4KGI A;  22GS A;  3S9F A;  2M72 A;  2IL3 A;  2E2M A;  2WFC A;  4OD7 A;  2WS2 A;  4V2M A;  3CSH A;  3UAP A;  3IE3 A;  4XHM A;  2X4A A;  1O85 A;  5IOW A;  2WDU A;  1ERU A;  1AQV A;  5CAX A;  1B9X C;  2C8U A;  6GSU A;  4QL7 A;  4MZB A;  2C80 A;  4LL4 B;  4MP4 A;  3VUR A;  4MJA A;  2FWE A;  2JAC A;  1EV4 A;  5J9B A;  1XBS A;  3DWV A;  2H70 A;  5F8B A;  2DKH A;  3FR6 A;  3LYP A;  4IJI A;  3G7J A;  2C4J A;  4YQV A;  4L0U A;  1JZW A;  4BVY B;  3LYK A;  4X4J A;  4OCF A;  1FB0 A;  2V41 A;  1XOB A;  3RAZ A;  1NW2 A;  4O5U A;  5EL8 A;  2YV7 A;  3EUR A;  1FG4 A;  2DLX A;  3H79 A;  1GRX A;  1GSF A;  3N9J A;  3FKF A;  3WT1 A;  5G1L A;  3A2X A;  2VM2 A;  2YV9 A;  3IV4 A;  2IMI A;  2CAQ A;  2YWI A;  1PKW A;  2MMZ A;  3GRX A;  1NHY A;  3KP9 A;  5EVO A;  3TRQ A;  4BIK A;  3BBY A;  5AGY A;  2C0F A;  2RLI A;  4MZW A;  4DSS A;  2FGX A;  5J5N A;  1DE2 A;  1S3A A;  5G30 A;  2GZY A;  3C1S A;  2DSA A;  2QA2 A;  3GIX A;  2MMO A;  2VAF A;  5E59 A;  4AJ6 A;  1GWC A;  3CTG A;  1PA3 A;  4RI7 A;  1TI1 A;  2V6K A;  1W89 A;  1FOH A;  3FZA A;  2H1B A;  1Z5Y E;  3HHV A;  5HQP A;  2FHE A;  3IXR A;  3ME8 A;  3ZTL A;  5CO3 A;  4KX4 A;  1VF4 A;  3J7Y k;  2YWM A;  1XW9 A;  4QL9 A;  2CVD A;  3WGX A;  1GLP A;  4G19 A;  3LSZ A;  4K9Z A;  3ZVJ A;  2HE3 A;  2PN8 A;  2NTO A;  2LJR A;  5AIV A;  1TOF A;  3LEF A;  2HLS A;  3VFI A;  2DJK A;  5G2Z A;  2FWF A;  3G9B A;  1ERT A;  1SJZ A;  1OE7 A;  5HR3 A;  1JHB A;  2AJQ B;  4ZIJ A;  3DRN A;  1K3L A;  3PIN A;  4YQU A;  3KMO A;  1PRX A;  3ERF A;  1GSY A;  4NAX A;  4MJB A;  4NXI A;  4HEA 2;  1TU8 A;  3L9V A;  4PQ1 A;  3ZYW A;  2E0Q A;  1ACV A;  3VLN A;  2YWN A;  3GHA A;  1B4P A;  3VWX A;  4PNF A;  3O6T A;  2WB9 A;  4X43 A;  3JCM L;  4Z2R A;  2DC5 A;  1ILO A;  3CTF A;  5IO0 A;  2P31 A;  1X9M B;  2VLT A;  1PFO A;  2J9H A;  3IOS A;  2G2Q A;  1BYE A;  1AAZ A;  5IMD A;  2AYT A;  1JZO A;  4IBP A;  2A2S A;  1A24 A;  1ERW A;  1JLV A;  4ZBA A;  3ZRD A;  1VF3 A;  2X99 A;  2B1L A;  4ILF A;  3R3E A;  1V9W A;  3TKP A;  1QXH A;  3LWA A;  3QAV A;  2WRT A;  4MAB A;  5ECH B;  1F6M C;  3QOU A;  3SWL A;  2CA8 A;  4LA1 A;  3MNG A;  3TJB A;  1DBY A;  1MD4 A;  4IJ3 A;  4ZIL A;  2GTU A;  2H8L A;  2I9H A;  14GS A;  2AHE A;  3UIW A;  1SL0 B;  2H1A A;  4OO5 A;  2CAI A;  1S3C A;  2FA8 A;  1G0T A;  2YPM A;  3EYT A;  4GSS A;  4PUF C;  1TP9 A;  1HNB A;  2HRA A;  5ECI B;  4PNG A;  2R37 A;  2VIM A;  4Q5F A;  3FY7 A;  5G1K A;  2R0P A;  1EEJ A;  2K18 A;  2H74 A;  2YCD A;  2ZCT A;  1UC7 A;  3O3T A;  4Z2U A;  3BD2 A;  4PX1 A;  1U88 A;  1I9D A;  1M2A A;  3Q74 A;  3WGD A;  1EOG A;  1UN2 A;  1XZO A;  3EU3 A;  3MSZ A;  5CRW A;  4TXO B; 
#chains in the Genus database with same CATH homology
 4CY8 A;  2H1D A;  4H86 A;  4Q5R A;  4V2L A;  3GUR A;  10GS A;  1YF1 A;  4K8M A;  4O5R A;  5G31 A;  1AXD A;  1WPI A;  3CBU A;  2ES7 A;  5D9V A;  3KH9 A;  2RII A;  4D73 B;  2PMT A;  2H0I A;  3APQ A;  3QDN A;  2M80 A;  1A23 A;  4JR4 A;  4AJ8 A;  1V57 A;  4GXZ A;  2OBI A;  1PSQ A;  2VCT A;  2B3S A;  2VL3 A;  2CX3 A;  2HYX A;  5IOX A;  2YJH A;  4ZB6 A;  5ECN B;  1K3Y A;  2ALB A;  2Z9S A;  3GTU B;  2WJU A;  2LST A;  2I1U A;  4XCS A;  2M46 A;  1M99 A;  2VD1 A;  1GTB A;  3PH9 A;  4WBR D;  4A5P A;  1F3A A;  4ZBB A;  5EPF A;  3HJM A;  3DKS A;  2VCQ A;  5C04 A;  1RQM A;  2HRK A;  4EUY A;  5DAL B;  1AQW A;  4KE3 A;  3FW2 A;  2AB6 A;  1OC8 A;  2YWO A;  5JCG A;  4EL1 A;  2I4A A;  3QD9 A;  5HFI A;  2FD3 A;  1YZX A;  1OC3 A;  2H19 A;  3FMW A;  1B9Y C;  2GS3 A;  2H6X A;  2DIY A;  3M0F A;  1FW1 A;  3EIN A;  4HUA A;  2CT6 A;  5DVB A;  4HOJ A;  1HQO A;  5IMC A;  3HY2 A;  1U87 A;  4GQC A;  4BL7 B;  1GP1 A;  2BTO T;  1O6J A;  3AY8 A;  3RPP A;  1VGL A;  2JZS A;  1VF1 A;  2CVK A;  2QA1 A;  2O85 A;  4ML1 A;  4POK A;  2L4C A;  5IO2 A;  5IMF A;  1SK1 A;  4TR3 A;  2WZ9 A;  3NZN A;  1GH2 A;  1TRW A;  1HYU A;  4I2U A;  5AN1 A;  3FYG A;  3Q18 A;  2C3Q A;  1XW6 A;  1KNG A;  1U3I A;  4O5Q A;  1FB6 A;  2CZ3 A;  2BJX A;  4TR1 B;  2L5L A;  3UMA A;  2L59 A;  5J41 A;  4ISD A;  1GUK A;  3VI7 A;  1JZR A;  2UZ8 A;  3HXS A;  3HKR A;  3TUE A;  1ERV A;  1U3A A;  2B7J A;  3DD3 A;  2YZU A;  4AF2 A;  5IQY A;  3ZRE A;  2GQM A;  3M9J A;  1WE0 A;  1YEP A;  4MDC A;  5DAK A;  3CYN A;  4IKH A;  4WBJ A;  5FWG A;  4WET A;  3ZFL A;  2A2R A;  4PGT A;  3Q6O A;  4WEY A;  2FY6 A;  2B6M A;  4K1F A;  1TXX A;  1MTC A;  4HS1 A;  2OE3 A;  1K0N A;  2DKI A;  2EIQ A;  3E3E A;  4CY6 A;  1SEN A;  1H4O A;  18GS A;  5KN1 A;  1XWB A;  1J0F A;  2VUP A;  1M2B A;  3GH6 A;  2LQQ A;  5FHI A;  1Z3E A;  4KW6 A;  4ECB A;  1VF2 A;  1EZK A;  2KOK A;  3L78 A;  2PWJ A;  1PMT A;  5GST A;  1X5C A;  2IJY A;  2LEG A;  4N0V A;  2IFQ B;  1NSW A;  1Q98 A;  4IQ1 A;  4F03 A;  5F07 A;  1AC1 A;  2DJ1 A;  4MH2 A;  4L5L A;  3D21 A;  1DUG A;  1QMV A;  2GZZ A;  3DML A;  3IRA A;  5GSS A;  3GYK A;  2YN1 A;  2NPB A;  3HA9 A;  1WMJ A;  1GTU A;  5A4U A;  5IMA A;  2PER A;  4YH2 A;  2WGR A;  3QAG A;  3QPM A;  5ECR B;  3QR6 A;  3ERG A;  4IS0 A;  4V1A g;  2OAC A;  1O81 A;  4O7H A;  2R5G A;  2RUF A;  4PQH A;  2H75 A;  4ZL8 A;  2FLS A;  4L0W A;  5IIZ A;  3HYP A;  1BED A;  1HNA A;  1B8X A;  3KD0 A;  2ZNM A;  1RW1 A;  1JLW A;  3EPT A;  4FIW A;  12GS A;  4G9H A;  3TB2 A;  2KUC A;  4JZQ A;  3LOR A;  2CQ9 A;  1CQG A;  4MH3 A;  3D0Z A;  4KUN A;  2LNT A;  3APO A;  4FYB A;  5CYY A;  2XPD A;  1TRV A;  4XRD A;  3TKS E;  3TJJ A;  4MLY A;  4K0G A;  4TXO A;  5LNK e;  3C7M A;  3U5R E;  2OJL A;  4GST A;  4IEL A;  1THX A;  2K8V A;  3VWU A;  1Z6N A;  4Z2T A;  4JE1 A;  3EMP A;  4ECJ A;  4HDE A;  4POM A;  4ULX A;  2HNL A;  5DCG A;  2YJ7 A;  3CMI A;  2YOI A;  3CRU A;  4KAE A;  1E6B A;  2L6C A;  11GS A;  3EWL A;  2EC4 A;  2LUS A;  1EV9 A;  3C1R A;  4ICY A;  1BAY A;  3E9J B;  3GKK A;  4K6X A;  2V6O A;  3GTU A;  2H30 A;  1U6T A;  2V32 A;  1OKT A;  1R4W A;  1OKD A;  1QQ2 A;  5KN3 A;  3HD5 A;  1B48 A;  1YKC A;  3I69 A;  2F8A A;  4I6X A;  1I5G A;  1LBK A;  4XIH A;  5B6N A;  3HJP A;  3W6G A;  1NM3 A;  5JCU A;  3VWW A;  3KIJ A;  2OBK A;  1C72 A;  4FYU A;  4HJM A;  1SKW B;  3VWV A;  3E0U A;  2ON5 A;  5DAL A;  5D9X A;  4ZB8 A;  1M9B A;  3NOF A;  5CRD A;  4MNN A;  4I2T A;  8GSS A;  4KSO A;  2VCZ A;  4MZC A;  2OA7 A;  2V1M A;  3R2Q A;  3FZ9 A;  4Z7X A;  1V2A A;  4LL1 B;  3SBC A;  2ON7 A;  1MD3 A;  5E4W A;  3KZQ A;  2RUE A;  2YNX A;  3HDC A;  1XW5 A;  17GS A;  1PD2 1;  3UVT A;  1O73 A;  2B1K A;  1XWK A;  1N8J A;  1HNC A;  3ZFB A;  1YQ1 A;  3F3Q A;  3I9V 2;  2HZE A;  4BL7 A;  3N5O A;  4MF5 A;  2IMK A;  3MWH A;  4G0K A;  3UVH A;  4GWR A;  1M7T A;  3CSJ A;  4TN8 A;  3GUS A;  2TRX A;  3ZVJ D;  5JCW A;  5L71 A;  5A4V A;  5ABR A;  5IM9 A;  3GL5 A;  1ZCP A;  3IR4 A;  3ED3 A;  1XPV A;  1FVK A;  1Z9H A;  2D2Z A;  3DEX A;  3GKX A;  4IQA A;  1Y6E A;  3HZ8 A;  3H8Q A;  3TKR A;  3F8U A;  3GX8 A;  3TOU A;  5ELG A;  1R7H A;  1TDI A;  2GQL A;  4XRA A;  4TR4 A;  1A0R P;  4XS4 B;  1GL8 A;  2HSY A;  4HZ2 A;  2OKA A;  3PR8 A;  3P8W A;  4EVM A;  3IHQ A;  1WJK A;  3FZ5 A;  4QQ7 A;  2GDR A;  2N5A A;  4V2N A;  4ECC A;  2KP2 A;  4GTU A;  3TCO A;  4KCA A;  4OO4 A;  3QMX A;  4P3Y B;  3EC3 A;  1BG5 A;  3F6D A;  3EU4 A;  2RM6 A;  3WT2 A;  1QFN A;  3US3 A;  1XVQ A;  3IAM 2;  3EVI A;  3V1W A;  2HFD A;  1G7E A;  4YQM A;  1ML6 A;  4USS A;  4RQX A;  2QKE A;  4TW5 A;  3U6V A;  3H4K A;  3LW9 A;  4XTS A;  2O8V B;  1EEM A;  2GVP A;  4PUA A;  3Q19 A;  1LU4 A;  3F6F A;  3DYR A;  1FO5 A;  4PXO A;  6GST A;  3GV1 A;  3GFK A;  3QFA C;  4KDU A;  3BJ5 A;  4Q5Q A;  3IC8 A;  3KEB A;  4TRX A;  3GSS A;  3TDG A;  2IIY A;  1XWG A;  1SU9 A;  4IVF A;  1T1V A;  2X8G A;  1X0R A;  1UA5 A;  1K0D A;  1GUH A;  2F3M A;  4YAP A;  2VO4 A;  1ZZY A;  1K0C A;  16GS A;  3KMN A;  2REM A;  5ECQ B;  1TKD B;  4YKF A;  4NMU A;  5DQS A;  2IME A;  4E8H A;  2IN3 A;  4XS6 A;  2X8H A;  1ZYQ B;  3DIE A;  4BA7 A;  1SK2 A;  3HVS A;  1SJ6 A;  4RQR A;  3GX0 A;  2CVB A;  4EO3 A;  3A5I A;  4YKG A;  1M0U A;  4PQI A;  2GSQ A;  3J7Y b;  2GSS A;  3TJF A;  4JR6 A;  3TKQ A;  3LQ7 A;  4KH7 A;  1TK0 B;  5FT3 A;  2MZC A;  3F9U A;  3UJ1 A;  3LXZ A;  4IP6 A;  4HU9 A;  1NHO A;  2LS5 A;  2LQO A;  5CNW A;  2R2J A;  2PVQ A;  1GUL A;  4MPF A;  2HI7 A;  4O92 A;  1X5D A;  4OFM A;  2X8C A;  4WR4 A;  4K7I A;  4BVY A;  5BRT A;  3HVV A;  1LJR A;  3O76 A;  2VL9 A;  3VPT A;  6GSW A;  4L5O A;  2R3X A;  4Q5N A;  2H01 A;  2DBC A;  1YDK A;  3VK9 A;  2E7P A;  4O32 A;  3H1N A;  1A2M A;  1F9M A;  5ECK B;  1OC9 B;  4K5R A;  1YKA A;  3TJK A;  5DCH A;  2TIR A;  3P90 A;  4DVC A;  5IMV A;  1GSQ A;  2FWH A;  1V40 A;  1K0A A;  3M8N A;  2LV3 A;  1PX6 A;  4MA9 A;  6GSY A;  1F37 A;  5GZZ B;  5ECM B;  5HFG A;  1G6W A;  2JAD A;  1PN0 A;  3ERW A;  2R0G A;  2G0F A;  3DVW A;  19GS A;  2I3Y A;  5ID2 B;  3MYD A;  3D22 A;  2R4V A;  4F2I A;  2AUV A;  2JU5 A;  2IMD A;  4MJE A;  5D73 A;  4ZXG A;  1E2Y A;  2XC2 A;  4K5S A;  1JZD A;  1T00 A;  3KGK A;  3TRP A;  4K7O A;  1KBN A;  2IMF A;  3FEU A;  3UBK A;  3D4M A;  1TW9 A;  5HFK A;  3P7X A;  5D9T A;  4GRF A;  4ZB9 A;  5J3R A;  1OYJ A;  2P0G A;  2PVO C;  2XBI A;  1K0O A;  5DJL A;  3WGE A;  1DSB A;  5B6M A;  4ACS A;  4G10 A;  2VD0 A;  1A8Y A;  5AIX A;  4EC0 A;  2A2P A;  3F4S A;  1CQH A;  2F51 A;  4KB3 A;  1MDK A;  2MMA A;  6GSS A;  3QCP A;  2H6Y A;  3LFL A;  5H5Q A;  3L9S A;  4NV2 A;  5ECO B;  2DMM A;  2K9F A;  4J56 E;  3MDK A;  5A4W A;  3ZIV A;  1FOV A;  1V58 A;  1GTI A;  4FH8 A;  1FHE A;  5INY A;  3FHK A;  1SK0 A;  1OE8 A;  5KEJ A;  2L57 A;  1PL1 A;  4NV5 A;  1XFL A;  4NHW A;  4KDX A;  1A8L A;  1MEK A;  2P5Q A;  1ZYE A;  1ZYP A;  4K7N A;  4OMV A;  3IDV A;  4TOP A;  1USB A;  3W8S A;  2L4Q A;  4HU7 A;  4AGS A;  2HRF A;  2E2G A;  1WRY A;  2HSH A;  1SJI A;  2C0E A;  3UOM A;  2LKU A;  1WIK A;  1XOA A;  1AUC A;  5B7C A;  1T4Z A;  2AAW A;  1FVJ A;  1SKR B;  1Z7R A;  5ECL B;  2DJ2 A;  2DJ0 A;  2RM5 A;  3M1G A;  1QGV A;  4X1U A;  3LG6 A;  1R5A A;  4XS4 A;  4GCI A;  1TRU A;  1TK8 B;  2LJA A;  3NIV A;  4J57 E;  20GS A;  1UVZ A;  3GNJ A;  5D9W A;  4OWY A;  4G2E A;  1Q4J A;  4KND A;  5DJM A;  1GUM A;  4F0B A;  2H72 A;  2O87 A;  5F0G A;  3ZZX A;  4N30 A;  1EOH A;  1EWX A;  4FYC A;  4PUR A;  2MBT A;  3EMX A;  2H1G A;  7GSS A;  2C0D A;  4JU5 A;  3RHB A;  3BCI A;  5J4U A;  1TK5 B;  2O7K A;  3TGZ A;  1Z7P A;  3ISO A;  3ZL5 A;  5CRG A;  2VOC A;  1MDI A;  2EIR A;  3L0H A;  3I6A A;  3W8J A;  3GKN A;  1V98 A;  4KA0 A;  3QFB C;  2JL4 A;  5ELA A;  1IYI A;  5KOX A;  1T7P B;  5G5E A;  4IN0 A;  1SL1 B;  2LNS A;  2VL2 A;  4F9Z A;  1GNW A;  2OE0 A;  3F0I A;  4YAV A;  1A0F A;  2KHP A;  2PBJ A;  1T8E B;  2X64 A;  5F05 A;  3CSI A;  1THO A;  3HCZ A;  3TOT A;  1EP7 A;  4ECI A;  1GSS A;  2HXK A;  4BPY A;  4EIP A;  3IHG A;  4D73 A;  5ECP B;  1TJD A;  2MMN A;  2LTK A;  1TU7 A;  3EE2 A;  2LJK A;  5B8B A;  1OVN A;  3ZML A;  2YAN A;  5HR1 A;  5LD0 A;  6GSV A;  5IPH A;  3M3M A;  2DIZ A;  3GKM A;  1RK4 A;  1BX9 A;  4EDZ A;  5D96 A;  1ST9 A;  2GGT A;  1MDJ A;  1ZMA A;  2VCW A;  1TTZ A;  2H71 A;  2H66 A;  3FR9 A;  2TRC P;  2EIO A;  1K3O A;  4WF5 A;  4DSQ A;  2LRT A;  2R6K A;  5CP1 A;  2CX4 A;  2C1Y A;  3PGT A;  3GL3 A;  5KOW A;  1XWC A;  3RHC A;  3A5W A;  3ZIJ A;  3C73 A;  2DML A;  2OAD A;  3L4N A;  4DEJ A;  3D6I A;  5B8A A;  5D93 A;  1GNE A;  3TRX A;  2I81 A;  1OC9 A;  4WXT A;  1GLQ A;  4TVE A;  1A2J A;  3LGC A;  1SD9 A;  9GSS A;  1EGO A;  4TXV A;  3QAW A;  4GLT A;  1TRS A;  2FCH A;  2FA4 A;  3TKS C;  2XHF A;  2PPT A;  2XPE A;  5DBQ A;  1BJX A;  4AJ7 A;  5ID2 A;  4EE0 A;  1F3B A;  1Y25 A;  5CRE A;  5DAK B;  4NWY A;  4G0L A;  1BQ7 A;  1S3D A;  2C0G A;  4ZL9 A;  1K0M A;  4E8E A;  4CHS A;  2P5R A;  2BMX A;  2JSY A;  4N0Z A;  1KTE A;  1GSU A;  2C3T A;  2K8S A;  3MAK A;  4EDY A;  2JSZ A;  3RDW A;  2IPA A;  5EY6 A;  2PU9 C;  2DJJ A;  1O7U A;  3D5J A;  5GAN D;  1O8X A;  3GA4 A;  2KLX A;  4TR1 A;  4F0C A;  2JZR A;  5C00 A;  4K2X A;  2CV4 A;  3L9U A;  2FWG A;  4IGJ A;  1XVW A;  2B5X A;  3A2V A;  1AIU A;  2N5B A;  4EXJ A;  2AV4 A;  1XIY A;  3A3T A;  3ME7 A;  2K6V A;  4JBB A;  4CDO A;  2YP6 A;  2B7K A;  1PL2 A;  4KSM A;  2F8F A;  3A2W A;  1QK8 A;  4ML6 A;  4BVX B;  1FAA A;  3TJG A;  2B5Y A;  1R5P A;  5IPG A;  2B5E A;  3FK8 A;  1K0B A;  5A5K A;  2NBS A;  4MCU A;  1SYR A;  2X49 A;  4KDY A;  5BMU A;  3C8E A;  5H5S A;  2NVL A;  1A2L A;  5HR0 A;  3GMF A;  4ID0 A;  2GST A;  2VL2 C;  2KP1 A;  2GT6 A;  2GLR A;  3RBT A;  2F9S A;  3C71 A;  4K2D A;  2IFQ A;  3DXB A;  1SD8 A;  1AQX A;  1YEX A;  1PQN A;  3ZIT A;  1WWJ A;  5ECS A;  2LRC A;  4N10 A;  2H73 A;  2H0H A;  4JRR A;  2V2G A;  1X9W B;  3IBH A;  2N5F A;  2PGT A;  3FZ4 A;  1OAZ A;  4ZL7 A;  4TKY A;  4POB A;  3IC4 A;  4IHU A;  4NHZ A;  3KCM A;  5GAP D;  5COH A;  3KXO A;  1IYH A;  4POL A;  4KCE A;  3RPN A;  4L8E A;  1XWA A;  1J08 A;  1T4Y A;  4RUV A;  2MBS A;  5G5F A;  1WP0 A;  3LJR A;  3CXG A;  2QC7 A;  2NDO A;  4BWS A;  4WKW A;  4WR5 A;  4G0I A;  3FRC A;  1PGT A;  4RI6 A;  3G7I A;  3VPQ A;  4I5Q A;  2HSM A;  3IK9 A;  5LCZ A;  5J9C A;  3KJY A;  1X9S B;  4LLR A;  3DGQ A;  3VI5 A;  2OE1 A;  4DSS B;  3I43 A;  1ZGN A;  4EKZ A;  2R0C A;  1GTA A;  2FUG 2;  5JWO B;  1O8W A;  3IAS 2;  4IW9 A;  5IMZ A;  1EP8 A;  1DE1 A;  4N11 A;  1KEB A;  4MK3 A;  2VLV A;  3LXT A;  2L5O A;  1X5E A;  3IPZ A;  3IK7 A;  3KTL A;  5KN0 A;  2PUK C;  1J9B A;  2H76 A;  5DDL A;  2CZ2 A;  2QGV A;  1TI3 A;  1B4Q A;  2DJ3 A;  3APS A;  2HZF A;  6GSX A;  2QSI A;  4GSN A;  2VM1 A;  1PX7 A;  4GQF A;  3HZ4 A;  1ZL9 A;  4HJ2 A;  1HD2 A;  2VCV A;  1YJ6 A;  3GN3 A;  1ABA A;  1VRS D;  2MYG A;  1ZYN A;  1PN9 A;  1G6Y A;  4KF9 A;  4BWQ A;  1SKS B;  4MPG A;  4EIQ A;  4OCE A;  3ZLP A;  5H5R A;  1WOU A;  1XXU A;  4NPB A;  4LMW A;  2HRN A;  4X0X A;  2HZE B;  4ZBD A;  1ON4 A;  2GZP A;  1W4V A;  4CW9 A;  3BCK A;  4HQZ A;  1SYX A;  4I8B A;  3P2A A;  4OFT A;  3F4R A;  1JFU A;  3IA1 A;  1YF0 A;  4PTS A;  3KM6 A;  3KH7 A;  2H0G A;  2YZH A;  4I97 A;  4DSR A;  5KN2 A;  3UL3 A;  2A4V A;  2C3N A;  4OFN A;  3WYW A;  1G7O A;  5CRH A;  4MMM A;  1R26 A;  3DVX A;  3F3R A;  3KP8 A;  1QUW A;  2L6D A;  2IWT A;  1SL2 B;  1Z6M A;  1M9A A;  4MJC A;  2WCI A;  3GST A;  5AIS A;  1PKZ A;  2VCX A;  1AW9 A;  3TKS A;  1T3B A;  4MF7 A;  5JWQ B;  4TR0 A;  5JWR B;  3K8N A;  2HT9 A;  2H6Z A;  3WD6 A;  3OR5 A;  3F4T A;  4MF6 A;  3KTB A;  2ZUP A;  4J2F A;  3PPU A;  4HQS A;  2GT5 A;  1F2E A;  3F63 A;  3D4T A;  4LMV A;  4F82 A;  1URM A;  1GSE A;  3HJO A;  1M2D A;  2J23 A;  3HVX A;  2GSR A;  2FNO A;  5ENU A;  4XS1 A;  1EGR A;  1GSD A;  3M9K A;  2XBQ A;  5DQY A;  3MIX A;  4V1A p;  2O89 A;  3ZMK A;  2LRN A;  4WF4 A;  3UBL A;  4JED A;  2WUL A;  5D8I A;  4FQU A;  1YY7 A;  1H75 A;  2A4H A;  1ZOF A;  2VLU A;  4EF0 A;  4GF0 A;  2JZT A;  3FR3 A;  13GS A;  3UAR A;  4FO5 A;  1N2A A;  3G7Y A;  4HZ4 A;  2GQK A;  4K0N A;  4HI7 A;  4BVX A;  3BOA A;  4IP1 A;  3H93 A;  3CRT A;  3GH9 A;  5HR2 A;  5F06 A;  1XCC A;  3UEM A;  4KGI A;  22GS A;  3S9F A;  2M72 A;  2IL3 A;  2E2M A;  2WFC A;  4OD7 A;  2WS2 A;  4V2M A;  3CSH A;  3UAP A;  3IE3 A;  4XHM A;  2X4A A;  1O85 A;  5IOW A;  2WDU A;  1ERU A;  1AQV A;  5CAX A;  1B9X C;  2C8U A;  6GSU A;  4QL7 A;  4MZB A;  2C80 A;  4LL4 B;  4MP4 A;  3VUR A;  4MJA A;  2FWE A;  2JAC A;  1EV4 A;  5J9B A;  1XBS A;  3DWV A;  2H70 A;  5F8B A;  2DKH A;  3FR6 A;  3LYP A;  4IJI A;  3G7J A;  2C4J A;  4YQV A;  4L0U A;  1JZW A;  4BVY B;  3LYK A;  4X4J A;  4OCF A;  1FB0 A;  2V41 A;  1XOB A;  3RAZ A;  1NW2 A;  4O5U A;  5EL8 A;  2YV7 A;  3EUR A;  1FG4 A;  2DLX A;  3H79 A;  1GRX A;  1GSF A;  3N9J A;  3FKF A;  3WT1 A;  5G1L A;  3A2X A;  2VM2 A;  2YV9 A;  3IV4 A;  2IMI A;  2CAQ A;  2YWI A;  1PKW A;  2MMZ A;  3GRX A;  1NHY A;  3KP9 A;  5EVO A;  3TRQ A;  3BBY A;  5AGY A;  2C0F A;  2RLI A;  4MZW A;  4DSS A;  2FGX A;  5J5N A;  1DE2 A;  1S3A A;  5G30 A;  2GZY A;  3C1S A;  2DSA A;  2QA2 A;  3GIX A;  2MMO A;  2VAF A;  5E59 A;  4AJ6 A;  1GWC A;  3CTG A;  1PA3 A;  4RI7 A;  1TI1 A;  2V6K A;  1W89 A;  1FOH A;  3FZA A;  2H1B A;  1Z5Y E;  3HHV A;  5HQP A;  2FHE A;  3IXR A;  3ME8 A;  3ZTL A;  5CO3 A;  4KX4 A;  1VF4 A;  3J7Y k;  2YWM A;  1XW9 A;  4QL9 A;  2CVD A;  3WGX A;  1GLP A;  4G19 A;  3LSZ A;  4K9Z A;  3ZVJ A;  2HE3 A;  2PN8 A;  2NTO A;  2LJR A;  5AIV A;  1TOF A;  3LEF A;  2HLS A;  3VFI A;  2DJK A;  5G2Z A;  2FWF A;  3G9B A;  1ERT A;  1SJZ A;  1OE7 A;  5HR3 A;  1JHB A;  2AJQ B;  4ZIJ A;  3DRN A;  1K3L A;  3PIN A;  4YQU A;  3KMO A;  1PRX A;  3ERF A;  1GSY A;  4NAX A;  4MJB A;  4NXI A;  4HEA 2;  1TU8 A;  3L9V A;  4PQ1 A;  3ZYW A;  2E0Q A;  1ACV A;  3VLN A;  2YWN A;  3GHA A;  1B4P A;  3VWX A;  4PNF A;  3O6T A;  2WB9 A;  4X43 A;  3JCM L;  4Z2R A;  2DC5 A;  1ILO A;  3CTF A;  5IO0 A;  2P31 A;  1X9M B;  2VLT A;  3IOS A;  2J9H A;  2G2Q A;  1BYE A;  1AAZ A;  5IMD A;  2AYT A;  1JZO A;  4IBP A;  2A2S A;  1A24 A;  1ERW A;  1JLV A;  4ZBA A;  3ZRD A;  1VF3 A;  2X99 A;  2B1L A;  4ILF A;  3R3E A;  1V9W A;  3TKP A;  1QXH A;  3LWA A;  3QAV A;  2WRT A;  4MAB A;  5ECH B;  1F6M C;  3QOU A;  3SWL A;  2CA8 A;  4LA1 A;  3MNG A;  3TJB A;  1DBY A;  1MD4 A;  4IJ3 A;  4ZIL A;  2GTU A;  2H8L A;  2I9H A;  14GS A;  2AHE A;  3UIW A;  1SL0 B;  2H1A A;  4OO5 A;  2CAI A;  1S3C A;  2FA8 A;  1G0T A;  2YPM A;  3EYT A;  4GSS A;  4PUF C;  1TP9 A;  1HNB A;  2HRA A;  5ECI B;  4PNG A;  2R37 A;  2VIM A;  4Q5F A;  3FY7 A;  5G1K A;  2R0P A;  1EEJ A;  2K18 A;  2H74 A;  2YCD A;  2ZCT A;  1UC7 A;  3O3T A;  4Z2U A;  3BD2 A;  4PX1 A;  1U88 A;  1I9D A;  1M2A A;  3Q74 A;  3WGD A;  1EOG A;  1UN2 A;  1XZO A;  3EU3 A;  3MSZ A;  5CRW A;  4TXO B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...