2H7DA

Solution structure of the talin f3 domain in complex with a chimeric beta3 integrin-pip kinase peptide
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
101
structure length
101
Chain Sequence
b'PLGSGVSFFLVKEKMKGKNKLVPRLLGITKESVMRVDEKTKEVIQEWSLTNIKRWAASPKSFTLDFGDYQDGYYSVQTTEGEQIAQLIAGYIDIILKKKKS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Talin-1
publication title Structural basis of integrin activation by talin
pubmed doi rcsb
source organism Gallus gallus
molecule tags Structural protein
total genus 14
structure length 101
sequence length 101
ec nomenclature
pdb deposition date 2006-06-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 2h7dA00
4CHMA 4DXAB 4CYEA 1KZGA 1AQCA 3BINA 4F7HA 1OQNA 2I5CA 1P6SA 4NSWA 1TQZA 3KY9A 1V89A 4D0NB 2VRWB 2YRYA 3ZVRA 2EMSA 3BJIA 3DXDA 1TJ6A 4A6FB 2E2XA 1M7RA 2DX1A 3ULCA 5FI0A 3FM8C 4WVFB 1FB8A 2P0DA 4K2PA 2YSZA 4K81A 1SGHA 1UNQA 3SV1A 2GCJA 2QKMA 4GZUA 3FSSA 2MFQA 1DDMA 1EVHA 5CLLB 3ODXA 3AJ4A 5C79A 4YONA 5JHHA 4K17A 5L81A 1XKEA 2J59M 5EFXA 3TCAA 1PLSA 5HE3A 1J19A 2DX5A 2GCLA 4HAYB 2XQNM 1KZ7A 2H7DA 2I1JA 3P7ZA 1UNRA 4EMOA 2D9XA 4KVGB 1EAZA 2YS1A 2EMTA 4F7GA 1AWEA 1U5FA 4ZRKA 3TVVA 1PFJA 2M38A 2RLOA 5J3YA 5CLQB 2BCJA 2KGXB 3KSYA 2R0DA 4HDQA 2RGNB 4A5KA 4TYZA 1NTYA 1W1HA 2EJ8A 5JP4A 1V5MA 5KQ1A 2DTCA 1X11A 3MPXA 3A98B 2ZPYA 3LJUX 2COFA 4MT7A 1K5DB 3MDBC 1WGUA 2W2WA 1WG7A 2KCJA 2UVMA 4Y94A 4GPTB 2UZSA 5DHAB 4BBKA 2N0YA 3A8QA 4HAUB 2LOZA 2J0MA 5KQ4A 2JP2A 4HAZB 2HTHB 4A6HA 3SUZA 3SYXA 2R09A 2QKLA 3U7DA 3V5WA 1BWNA 1LW3A 1MIXA 5D3YA 1WVHA 3ZDTA 2DN6A 2N23A 1ZC3B 4A6KA 1XCGA 3M1IB 3D8DA 1H4RA 5J3QA 1H10A 5D3WA 1J0WA 5D3VA 1X86A 4IAPA 1FGYA 2H7EA 2ADZA 2OTXA 2COAA 2K00A 1U5EA 1WGQA 4WJ7A 1U5GA 3DXEA 2D9VA 2P0HA 4GMXB 1MIZB 4KHBB 3PVUA 3VIAA 1DDVA 3O96A 1ZVRA 2PZ1A 2MDXA 1UPQA 1UPRA 1XD4A 4PNKA 2MWNB 2GJYA 1B55A 2NZ8B 4L6EA 3D8EA 4P7IA 1UNPA 1RJ2A 3SO6A 5J3TA 1U5DA 1N3HA 3G9WA 2D11A 1SHCA 3HK0A 2AEHA 2DFKA 3ODWA 3PVLA 1X05A 3HQCA 5C5BB 4F7UP 1OY2A 2V76A 3OANA 4Z2MB 4GN1A 2AL6A 1Y19B 3PEGA 2DHKA 2K2UA 3QIJA 1WJMA 1MK9B 3ULBA 2K2JA 5GOWB 5LOPB 2D9WA 4A6FA 3TO1A 4HB4B 4ZRIA 1DROA 1V61A 2ELAA 1U29A 1V88A 4HAWB 1DDWA 3NSUA 5HE2A 5KCVA 2YS3A 2W2XC 1U27A 3PP2A 3QWMA 5HE1A 1PMSA 1KI1B 5LONB 1LB1A 2FJLA 1RRPB 4EJNA 5HE0A 5DH9B 2DA0A 1W1DA 2DLWA 3WA0A 1FHWA 2P0FA 1QC6A 3HW2B 1Y5OA 2YS5A 4HAVB 2L1CA 1Q67A 3PSCA 2EC1A 1ZC4B 3WYFB 4PQ0A 2D10A 2G35A 2NMBA 4HB3B 1I2HA 1GG3A 2J0JA 2L2IA 4EKUA 5D3XA 3X23A 3PG7A 5DIFB 1M7EA 2D9ZA 1BTKA 1WI1A 1K5GB 3KRXA 2ELBA 5JHGA 1EGXA 2DHIA 2YT1A 3AU4A 2OQBA 2ROVA 2LG1A 2I5FA 1ZM0A 4HHVA 5C16A 2LOXA 4DX90 2Y8GA 4XWXA 1I7AA 4GXBA 1MAIA 2LULA 3CIKA 2W2XD 4HDOA 2COCA 2HE7A 2D4QA 2Z0OA 2Y7BA 2RVBB 5DI9B 3P6AA 3F5RA 2CAYA 3CXBB 4H8SA 4KAXB 1X1GA 3KRWA 4IFSA 2RUKB 2DKQA 4ZRJA 1XX0A 1BTNA 3DXCA 3PVWA 1DBHA 1GC6A 1U2BA 1IRSA 1UEFA 1X1FA 4HB2B 4HATB 2J0KA 2I1KA 2DYNA 3U8ZA 3IVFA 3ODOA 2YT0A 3D8FA 4TKNA 2YVCA 4K2OA 2RSGA 1Z87A 2UZRA 3TW1A 2D9YA 2KUPA 2M14A 4MK0A 4HB0B 1XODA 3QBVB 4KHAA 3VOQA 4NY0A 2DYQA 4GMVA 5JLJB 2CRFA 4Z2NA 2IYBA 1NU2A 4C0AA 3UZTA 2ROZB 2YF0A 1FAOA 2DHJA 4WSFA 5C5BA 1NI2A 2P8VA 1MPHA 2CODA 2LKOA 1W1GA 3RCPA 1WJ1A 1QQGA 2VSZA 3T06A 1V5UA 1NTVA 5DHFB 1TXDA 2RNRB 2Q13A 1DYNA 2DKPA 1GC7A 4IOYX 2IFSA 4MY6A 4DBBA 3PZDA 2Z0QA 5C6RA 3SNHA 1XR0B 1MK7B 3FEHA 3GYOA 3F0WA 2LYDA 3KZ1A 3ML4A 3AU5A 1ISNA 1FGZA 2VKIA 1EF1A 3N7CA 5D27A 1FHOA 2X18A 3GYPA 3A8PA 4YL8A 3TFMA 2CY4A 1FOEA 1P5TA 4HAXB 4DX8A 2Y8FA 2Z0PA 1MKEA 1ZSQA 1OMWA 1BAKA 2MKRA 4CHJA 4B6HA 2D2QA 1E5WA 4KHOA 5FI1A 2GS0A 1FHXA 2CY5A 1V5PA 1P3RA
chains in the Genus database with same CATH superfamily
4CHMA 4CSQA 4DXAB 4CYEA 1KZGA 1AQCA 3BINA 4F7HA 1OQNA 2I5CA 1P6SA 4NSWA 1TQZA 3KY9A 1V89A 4D0NB 2VRWB 2YRYA 3ZVRA 2EMSA 3BJIA 3DXDA 1TJ6A 4A6FB 2E2XA 1M7RA 2DX1A 3ULCA 5FI0A 3FM8C 4WVFB 1FB8A 2P0DA 4K2PA 2YSZA 4K81A 1SGHA 1UNQA 3SV1A 2GCJA 2QKMA 4GZUA 3FSSA 2MFQA 1DDMA 1EVHA 5CLLB 3ODXA 3AJ4A 5C79A 4YONA 5JHHA 4K17A 5L81A 1XKEA 2J59M 5EFXA 3TCAA 1PLSA 5HE3A 1J19A 2DX5A 2GCLA 4HAYB 2XQNM 3NWDA 1KZ7A 2H7DA 2I1JA 3P7ZA 1UNRA 4EMOA 2D9XA 4KVGB 1EAZA 2YS1A 2EMTA 4F7GA 1AWEA 1U5FA 5M4YB 5I2SA 4ZRKA 3TVVA 1PFJA 2M38A 2RLOA 5J3YA 5CLQB 2BCJA 2KGXB 3KSYA 2R0DA 4HDQA 3NWAA 2RGNB 4A5KA 4GNKB 4TYZA 4OT1A 1NTYA 1W1HA 2EJ8A 4QJ3B 1V5MA 5JP4A 3NW8A 5KQ1A 2DTCA 1X11A 3MPXA 3A98B 2ZPYA 3LJUX 2COFA 4MT7A 1K5DB 3MDBC 1WGUA 2W2WA 1WG7A 2KCJA 2UVMA 4Y94A 4GPTB 2UZSA 5DHAB 4BBKA 2N0YA 3A8QA 4HAUB 2LOZA 2J0MA 4QJ4B 5KQ4A 2JP2A 4HAZB 2HTHB 4A6HA 3SUZA 3SYXA 2R09A 2QKLA 3U7DA 3V5WA 1BWNA 1LW3A 1MIXA 5D3YA 1WVHA 3ZDTA 3HSAA 2DN6A 2N23A 1ZC3B 4A6KA 1XCGA 3M1IB 3D8DA 1H4RA 5J3QA 1H10A 5D3WA 4OSNA 1J0WA 5D3VA 1X86A 4IAPA 1FGYA 2H7EA 2ADZA 2OTXA 2COAA 2K00A 1U5EA 1WGQA 4WJ7A 1U5GA 3DXEA 2D9VA 2P0HA 4GMXB 1MIZB 4KHBB 3PVUA 3VIAA 1DDVA 3O96A 2RRFA 1ZVRA 2PZ1A 2MDXA 1UPQA 1UPRA 1XD4A 4PNKA 2MWNB 2GJYA 1B55A 2NZ8B 4L6EA 3D8EA 4P7IA 1UNPA 1RJ2A 3SO6A 5J3TA 1U5DA 1N3HA 2K8EA 3G9WA 2D11A 1SHCA 3HK0A 2AEHA 2DFKA 2Z13A 3ODWA 3PVLA 1X05A 3HQCA 5C5BB 4F7UP 1OY2A 2V76A 3OANA 4Z2MB 4GN1A 2AL6A 4KHBA 1Y19B 3PEGA 1ZYIA 2DHKA 2K2UA 3QIJA 1WJMA 1MK9B 3ULBA 2K2JA 5GOWB 5LOPB 2D9WA 1MI1A 4A6FA 3TO1A 4HB4B 4ZRIA 2KIGA 1DROA 1V61A 2ELAA 1U29A 1V88A 4HAWB 1DDWA 3NSUA 5HE2A 5KCVA 2YS3A 2W2XC 1U27A 3PP2A 3QWMA 5HE1A 1PMSA 1KI1B 5LONB 1LB1A 2FJLA 1RRPB 4EJNA 3A58A 5HE0A 5DH9B 2DA0A 1W1DA 2DLWA 3WA0A 1FHWA 4D6WA 2KIEA 2P0FA 1QC6A 3HW2B 1Y5OA 2YS5A 4HAVB 2L1CA 1Q67A 3PSCA 2EC1A 1ZC4B 3WYFB 4PQ0A 2D10A 2G35A 2NMBA 4HB3B 5LG4B 1I2HA 1GG3A 2J0JA 2L2IA 4EKUA 5D3XA 2Z4DA 3X23A 3PG7A 5DIFB 1M7EA 2D9ZA 1BTKA 1WI1A 2GUMA 1K5GB 2FJUB 3B77A 3KRXA 2ELBA 2ZKMX 5JHGA 2DHIA 1EGXA 2YT1A 3AU4A 2K49A 2OQBA 2ROVA 2LG1A 2I5FA 5I2MA 1ZM0A 2KR0A 4HHVA 2Z59A 5C16A 2LOXA 4DX90 2Y8GA 4XWXA 4HSIA 1I7AA 4GXBA 1MAIA 2LULA 3CIKA 1T77A 2W2XD 4HDOA 2COCA 2HE7A 2D4QA 2Z0OA 2Y7BA 2RVBB 5DI9B 4QJ5B 3U12A 3P6AA 3F5RA 2CAYA 3CXBB 4H8SA 4KAXB 1X1GA 3KRWA 4IFSA 2RUKB 2DKQA 4ZRJA 1XX0A 1BTNA 3DXCA 3PVWA 1DBHA 1GC6A 1U2BA 1IRSA 1UEFA 1X1FA 2R2YA 4HB2B 4HATB 2J0KA 2I1KA 2DYNA 3U8ZA 3IVFA 3ODOA 2YT0A 3D8FA 3FVCA 4TKNA 4L1RA 2YVCA 4K2OA 2RSGA 1Z87A 2UZRA 3TW1A 2D9YA 2KUPA 5IRSA 2M14A 4MK0A 4HB0B 1XODA 3QBVB 4KHAA 3VOQA 4NY0A 2DYQA 4GMVA 4DIXA 2YT2A 5JLJB 2CRFA 4Z2NA 2IYBA 1NU2A 4C0AA 3UZTA 2KUQA 2ROZB 2YF0A 1FAOA 2DHJA 4WSFA 5C5BA 1NI2A 2P8VA 3OHMB 1MPHA 2CODA 2LKOA 1W1GA 3RCPA 1WJ1A 1QQGA 2VSZA 3T06A 1V5UA 1NTVA 5DHFB 1TXDA 2RNRB 2Q13A 1DYNA 2DKPA 2Z14A 1GC7A 4IOYX 2IFSA 4MY6A 4DBBA 3PZDA 2Z0QA 5C6RA 3SNHA 3DCXA 1XR0B 3NWFA 4QXAB 1MK7B 3FEHA 3GYOA 3F0WA 2LYDA 3KZ1A 3ML4A 3AU5A 1ISNA 1FGZA 2VKIA 1EF1A 3N7CA 5D27A 1FHOA 2X18A 3GYPA 3A8PA 4YL8A 3TFMA 2NBVA 2CY4A 1FOEA 1P5TA 4HAXB 4DX8A 2Y8FA 2Z0PA 1MKEA 3HIEA 1ZSQA 1OMWA 1BAKA 2MKRA 4CHJA 4B6HA 2D2QA 1E5WA 4KHOA 5FI1A 2GS0A 1FHXA 4GOUA 2CY5A 1V5PA 1P3RA
chains in the Genus database with same CATH topology
4CHMA 4DXAB 4CYEA 1KZGA 1AQCA 3BINA 4F7HA 1OQNA 2I5CA 1P6SA 4NSWA 1TQZA 3KY9A 1V89A 4D0NB 2VRWB 2YRYA 3ZVRA 2EMSA 3BJIA 3DXDA 1TJ6A 4A6FB 2E2XA 1M7RA 2DX1A 3ULCA 5FI0A 3FM8C 4WVFB 1FB8A 2P0DA 4K2PA 2YSZA 4K81A 1SGHA 1UNQA 3SV1A 2GCJA 2QKMA 4GZUA 3FSSA 2MFQA 1DDMA 1EVHA 5CLLB 3ODXA 3AJ4A 5C79A 4YONA 5JHHA 4K17A 5L81A 1XKEA 2J59M 5EFXA 3TCAA 1PLSA 5HE3A 1J19A 2DX5A 2GCLA 4HAYB 2XQNM 1KZ7A 2H7DA 2I1JA 3P7ZA 1UNRA 4EMOA 2D9XA 4KVGB 1EAZA 2YS1A 2EMTA 4F7GA 1AWEA 1U5FA 4ZRKA 3TVVA 1PFJA 2M38A 2RLOA 5J3YA 5CLQB 2BCJA 2KGXB 3KSYA 2R0DA 4HDQA 2RGNB 4A5KA 4TYZA 1NTYA 1W1HA 2EJ8A 5JP4A 1V5MA 5KQ1A 2DTCA 1X11A 3MPXA 3A98B 2ZPYA 3LJUX 2COFA 4MT7A 1K5DB 3MDBC 1WGUA 2W2WA 1WG7A 2KCJA 2UVMA 4Y94A 4GPTB 2UZSA 5DHAB 4BBKA 2N0YA 3A8QA 4HAUB 2LOZA 2J0MA 5KQ4A 2JP2A 4HAZB 2HTHB 4A6HA 3SUZA 3SYXA 2R09A 2QKLA 3U7DA 3V5WA 1BWNA 1LW3A 1MIXA 5D3YA 1WVHA 3ZDTA 2DN6A 2N23A 1ZC3B 4A6KA 1XCGA 3M1IB 3D8DA 1H4RA 5J3QA 1H10A 5D3WA 1J0WA 5D3VA 1X86A 4IAPA 1FGYA 2H7EA 2ADZA 2OTXA 2COAA 2K00A 1U5EA 1WGQA 4WJ7A 1U5GA 3DXEA 2D9VA 2P0HA 4GMXB 1MIZB 4KHBB 3PVUA 3VIAA 1DDVA 3O96A 1ZVRA 2PZ1A 2MDXA 1UPQA 1UPRA 1XD4A 4PNKA 2MWNB 2GJYA 1B55A 2NZ8B 4L6EA 3D8EA 4P7IA 1UNPA 1RJ2A 3SO6A 5J3TA 1U5DA 1N3HA 3G9WA 2D11A 1SHCA 3HK0A 2AEHA 2DFKA 3ODWA 3PVLA 1X05A 3HQCA 5C5BB 4F7UP 1OY2A 2V76A 3OANA 4Z2MB 4GN1A 2AL6A 1Y19B 3PEGA 2DHKA 2K2UA 3QIJA 1WJMA 1MK9B 3ULBA 2K2JA 5GOWB 5LOPB 2D9WA 4A6FA 3TO1A 4HB4B 4ZRIA 1DROA 1V61A 2ELAA 1U29A 1V88A 4HAWB 1DDWA 3NSUA 5HE2A 5KCVA 2YS3A 2W2XC 1U27A 3PP2A 3QWMA 5HE1A 1PMSA 1KI1B 5LONB 1LB1A 2FJLA 1RRPB 4EJNA 5HE0A 5DH9B 2DA0A 1W1DA 2DLWA 3WA0A 1FHWA 2P0FA 1QC6A 3HW2B 1Y5OA 2YS5A 4HAVB 2L1CA 1Q67A 3PSCA 2EC1A 1ZC4B 3WYFB 4PQ0A 2D10A 2G35A 2NMBA 4HB3B 1I2HA 1GG3A 2J0JA 2L2IA 4EKUA 5D3XA 3X23A 3PG7A 5DIFB 1M7EA 2D9ZA 1BTKA 1WI1A 1K5GB 3KRXA 2ELBA 5JHGA 1EGXA 2DHIA 2YT1A 3AU4A 2OQBA 2ROVA 2LG1A 2I5FA 1ZM0A 4HHVA 5C16A 2LOXA 4DX90 2Y8GA 4XWXA 1I7AA 4GXBA 1MAIA 2LULA 3CIKA 2W2XD 4HDOA 2COCA 2HE7A 2D4QA 2Z0OA 2Y7BA 2RVBB 5DI9B 3P6AA 3F5RA 2CAYA 3CXBB 4H8SA 4KAXB 1X1GA 3KRWA 4IFSA 2RUKB 2DKQA 4ZRJA 1XX0A 1BTNA 3DXCA 3PVWA 1DBHA 1GC6A 1U2BA 1IRSA 1UEFA 1X1FA 4HB2B 4HATB 2J0KA 2I1KA 2DYNA 3U8ZA 3IVFA 3ODOA 2YT0A 3D8FA 4TKNA 2YVCA 4K2OA 2RSGA 1Z87A 2UZRA 3TW1A 2D9YA 2KUPA 2M14A 4MK0A 4HB0B 1XODA 3QBVB 4KHAA 3VOQA 4NY0A 2DYQA 4GMVA 5JLJB 2CRFA 4Z2NA 2IYBA 1NU2A 4C0AA 3UZTA 2ROZB 2YF0A 1FAOA 2DHJA 4WSFA 5C5BA 1NI2A 2P8VA 1MPHA 2CODA 2LKOA 1W1GA 3RCPA 1WJ1A 1QQGA 2VSZA 3T06A 1V5UA 1NTVA 5DHFB 1TXDA 2RNRB 2Q13A 1DYNA 2DKPA 1GC7A 4IOYX 2IFSA 4MY6A 4DBBA 3PZDA 2Z0QA 5C6RA 3SNHA 1XR0B 1MK7B 3FEHA 3GYOA 3F0WA 2LYDA 3KZ1A 3ML4A 3AU5A 1ISNA 1FGZA 2VKIA 1EF1A 3N7CA 5D27A 1FHOA 2X18A 3GYPA 3A8PA 4YL8A 3TFMA 2CY4A 1FOEA 1P5TA 4HAXB 4DX8A 2Y8FA 2Z0PA 1MKEA 1ZSQA 1OMWA 1BAKA 2MKRA 4CHJA 4B6HA 2D2QA 1E5WA 4KHOA 5FI1A 2GS0A 1FHXA 2CY5A 1V5PA 1P3RA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4CHM A;  4DXA B;  4CYE A;  1KZG A;  1AQC A;  3BIN A;  4F7H A;  1OQN A;  2I5C A;  1P6S A;  4NSW A;  1TQZ A;  3KY9 A;  1V89 A;  4D0N B;  2VRW B;  2YRY A;  3ZVR A;  2EMS A;  3BJI A;  3DXD A;  1TJ6 A;  4A6F B;  2E2X A;  1M7R A;  2DX1 A;  3ULC A;  5FI0 A;  3FM8 C;  4WVF B;  1FB8 A;  2P0D A;  4K2P A;  2YSZ A;  4K81 A;  1SGH A;  1UNQ A;  3SV1 A;  2GCJ A;  2QKM A;  4GZU A;  3FSS A;  2MFQ A;  1DDM A;  1EVH A;  5CLL B;  3ODX A;  3AJ4 A;  5C79 A;  4YON A;  5JHH A;  4K17 A;  5L81 A;  1XKE A;  2J59 M;  5EFX A;  3TCA A;  1PLS A;  5HE3 A;  1J19 A;  2DX5 A;  2GCL A;  4HAY B;  2XQN M;  1KZ7 A;  2H7D A;  2I1J A;  3P7Z A;  1UNR A;  4EMO A;  2D9X A;  4KVG B;  1EAZ A;  2YS1 A;  2EMT A;  4F7G A;  1AWE A;  1U5F A;  4ZRK A;  3TVV A;  1PFJ A;  2M38 A;  2RLO A;  5J3Y A;  5CLQ B;  2BCJ A;  2KGX B;  3KSY A;  2R0D A;  4HDQ A;  2RGN B;  4A5K A;  4TYZ A;  1NTY A;  1W1H A;  2EJ8 A;  5JP4 A;  1V5M A;  5KQ1 A;  2DTC A;  1X11 A;  3MPX A;  3A98 B;  2ZPY A;  3LJU X;  2COF A;  4MT7 A;  1K5D B;  3MDB C;  1WGU A;  2W2W A;  1WG7 A;  2KCJ A;  2UVM A;  4Y94 A;  4GPT B;  2UZS A;  5DHA B;  4BBK A;  2N0Y A;  3A8Q A;  4HAU B;  2LOZ A;  2J0M A;  5KQ4 A;  2JP2 A;  4HAZ B;  2HTH B;  4A6H A;  3SUZ A;  3SYX A;  2R09 A;  2QKL A;  3U7D A;  3V5W A;  1BWN A;  1LW3 A;  1MIX A;  5D3Y A;  1WVH A;  3ZDT A;  2DN6 A;  2N23 A;  1ZC3 B;  4A6K A;  1XCG A;  3M1I B;  3D8D A;  1H4R A;  5J3Q A;  1H10 A;  5D3W A;  1J0W A;  5D3V A;  1X86 A;  4IAP A;  1FGY A;  2H7E A;  2ADZ A;  2OTX A;  2COA A;  2K00 A;  1U5E A;  1WGQ A;  4WJ7 A;  1U5G A;  3DXE A;  2D9V A;  2P0H A;  4GMX B;  1MIZ B;  4KHB B;  3PVU A;  3VIA A;  1DDV A;  3O96 A;  1ZVR A;  2PZ1 A;  2MDX A;  1UPQ A;  1UPR A;  1XD4 A;  4PNK A;  2MWN B;  2GJY A;  1B55 A;  2NZ8 B;  4L6E A;  3D8E A;  4P7I A;  1UNP A;  1RJ2 A;  3SO6 A;  5J3T A;  1U5D A;  1N3H A;  3G9W A;  2D11 A;  1SHC A;  3HK0 A;  2AEH A;  2DFK A;  3ODW A;  3PVL A;  1X05 A;  3HQC A;  5C5B B;  4F7U P;  1OY2 A;  2V76 A;  3OAN A;  4Z2M B;  4GN1 A;  2AL6 A;  1Y19 B;  3PEG A;  2DHK A;  2K2U A;  3QIJ A;  1WJM A;  1MK9 B;  3ULB A;  2K2J A;  5GOW B;  5LOP B;  2D9W A;  4A6F A;  3TO1 A;  4HB4 B;  4ZRI A;  1DRO A;  1V61 A;  2ELA A;  1U29 A;  1V88 A;  4HAW B;  1DDW A;  3NSU A;  5HE2 A;  5KCV A;  2YS3 A;  2W2X C;  1U27 A;  3PP2 A;  3QWM A;  5HE1 A;  1PMS A;  1KI1 B;  5LON B;  1LB1 A;  2FJL A;  1RRP B;  4EJN A;  5HE0 A;  5DH9 B;  2DA0 A;  1W1D A;  2DLW A;  3WA0 A;  1FHW A;  2P0F A;  1QC6 A;  3HW2 B;  1Y5O A;  2YS5 A;  4HAV B;  2L1C A;  1Q67 A;  3PSC A;  2EC1 A;  1ZC4 B;  3WYF B;  4PQ0 A;  2D10 A;  2G35 A;  2NMB A;  4HB3 B;  1I2H A;  1GG3 A;  2J0J A;  2L2I A;  4EKU A;  5D3X A;  3X23 A;  3PG7 A;  5DIF B;  1M7E A;  2D9Z A;  1BTK A;  1WI1 A;  1K5G B;  3KRX A;  2ELB A;  5JHG A;  1EGX A;  2DHI A;  2YT1 A;  3AU4 A;  2OQB A;  2ROV A;  2LG1 A;  2I5F A;  1ZM0 A;  4HHV A;  5C16 A;  2LOX A;  4DX9 0;  2Y8G A;  4XWX A;  1I7A A;  4GXB A;  1MAI A;  2LUL A;  3CIK A;  2W2X D;  4HDO A;  2COC A;  2HE7 A;  2D4Q A;  2Z0O A;  2Y7B A;  2RVB B;  5DI9 B;  3P6A A;  3F5R A;  2CAY A;  3CXB B;  4H8S A;  4KAX B;  1X1G A;  3KRW A;  4IFS A;  2RUK B;  2DKQ A;  4ZRJ A;  1XX0 A;  1BTN A;  3DXC A;  3PVW A;  1DBH A;  1GC6 A;  1U2B A;  1IRS A;  1UEF A;  1X1F A;  4HB2 B;  4HAT B;  2J0K A;  2I1K A;  2DYN A;  3U8Z A;  3IVF A;  3ODO A;  2YT0 A;  3D8F A;  4TKN A;  2YVC A;  4K2O A;  2RSG A;  1Z87 A;  2UZR A;  3TW1 A;  2D9Y A;  2KUP A;  2M14 A;  4MK0 A;  4HB0 B;  1XOD A;  3QBV B;  4KHA A;  3VOQ A;  4NY0 A;  2DYQ A;  4GMV A;  5JLJ B;  2CRF A;  4Z2N A;  2IYB A;  1NU2 A;  4C0A A;  3UZT A;  2ROZ B;  2YF0 A;  1FAO A;  2DHJ A;  4WSF A;  5C5B A;  1NI2 A;  2P8V A;  1MPH A;  2COD A;  2LKO A;  1W1G A;  3RCP A;  1WJ1 A;  1QQG A;  2VSZ A;  3T06 A;  1V5U A;  1NTV A;  5DHF B;  1TXD A;  2RNR B;  2Q13 A;  1DYN A;  2DKP A;  1GC7 A;  4IOY X;  2IFS A;  4MY6 A;  4DBB A;  3PZD A;  2Z0Q A;  5C6R A;  3SNH A;  1XR0 B;  1MK7 B;  3FEH A;  3GYO A;  3F0W A;  2LYD A;  3KZ1 A;  3ML4 A;  3AU5 A;  1ISN A;  1FGZ A;  2VKI A;  1EF1 A;  3N7C A;  5D27 A;  1FHO A;  2X18 A;  3GYP A;  3A8P A;  4YL8 A;  3TFM A;  2CY4 A;  1FOE A;  1P5T A;  4HAX B;  4DX8 A;  2Y8F A;  2Z0P A;  1MKE A;  1ZSQ A;  1OMW A;  1BAK A;  2MKR A;  4CHJ A;  4B6H A;  2D2Q A;  1E5W A;  4KHO A;  5FI1 A;  2GS0 A;  1FHX A;  2CY5 A;  1V5P A;  1P3R A; 
#chains in the Genus database with same CATH topology
 4CHM A;  4CSQ A;  4DXA B;  4CYE A;  1KZG A;  1AQC A;  3BIN A;  4F7H A;  1OQN A;  2I5C A;  1P6S A;  4NSW A;  1TQZ A;  3KY9 A;  1V89 A;  4D0N B;  2VRW B;  2YRY A;  3ZVR A;  2EMS A;  3BJI A;  3DXD A;  1TJ6 A;  4A6F B;  2E2X A;  1M7R A;  2DX1 A;  3ULC A;  5FI0 A;  3FM8 C;  4WVF B;  1FB8 A;  2P0D A;  4K2P A;  2YSZ A;  4K81 A;  1SGH A;  1UNQ A;  3SV1 A;  2GCJ A;  2QKM A;  4GZU A;  3FSS A;  2MFQ A;  1DDM A;  1EVH A;  5CLL B;  3ODX A;  3AJ4 A;  5C79 A;  4YON A;  5JHH A;  4K17 A;  5L81 A;  1XKE A;  2J59 M;  5EFX A;  3TCA A;  1PLS A;  5HE3 A;  1J19 A;  2DX5 A;  2GCL A;  4HAY B;  2XQN M;  3NWD A;  1KZ7 A;  2H7D A;  2I1J A;  3P7Z A;  1UNR A;  4EMO A;  2D9X A;  4KVG B;  1EAZ A;  2YS1 A;  2EMT A;  4F7G A;  1AWE A;  1U5F A;  5M4Y B;  5I2S A;  4ZRK A;  3TVV A;  1PFJ A;  2M38 A;  2RLO A;  5J3Y A;  5CLQ B;  2BCJ A;  2KGX B;  3KSY A;  2R0D A;  4HDQ A;  3NWA A;  2RGN B;  4A5K A;  4GNK B;  4TYZ A;  4OT1 A;  1NTY A;  1W1H A;  2EJ8 A;  4QJ3 B;  1V5M A;  5JP4 A;  3NW8 A;  5KQ1 A;  2DTC A;  1X11 A;  3MPX A;  3A98 B;  2ZPY A;  3LJU X;  2COF A;  4MT7 A;  1K5D B;  3MDB C;  1WGU A;  2W2W A;  1WG7 A;  2KCJ A;  2UVM A;  4Y94 A;  4GPT B;  2UZS A;  5DHA B;  4BBK A;  2N0Y A;  3A8Q A;  4HAU B;  2LOZ A;  2J0M A;  4QJ4 B;  5KQ4 A;  2JP2 A;  4HAZ B;  2HTH B;  4A6H A;  3SUZ A;  3SYX A;  2R09 A;  2QKL A;  3U7D A;  3V5W A;  1BWN A;  1LW3 A;  1MIX A;  5D3Y A;  1WVH A;  3ZDT A;  3HSA A;  2DN6 A;  2N23 A;  1ZC3 B;  4A6K A;  1XCG A;  3M1I B;  3D8D A;  1H4R A;  5J3Q A;  1H10 A;  5D3W A;  4OSN A;  1J0W A;  5D3V A;  1X86 A;  4IAP A;  1FGY A;  2H7E A;  2ADZ A;  2OTX A;  2COA A;  2K00 A;  1U5E A;  1WGQ A;  4WJ7 A;  1U5G A;  3DXE A;  2D9V A;  2P0H A;  4GMX B;  1MIZ B;  4KHB B;  3PVU A;  3VIA A;  1DDV A;  3O96 A;  2RRF A;  1ZVR A;  2PZ1 A;  2MDX A;  1UPQ A;  1UPR A;  1XD4 A;  4PNK A;  2MWN B;  2GJY A;  1B55 A;  2NZ8 B;  4L6E A;  3D8E A;  4P7I A;  1UNP A;  1RJ2 A;  3SO6 A;  5J3T A;  1U5D A;  1N3H A;  2K8E A;  3G9W A;  2D11 A;  1SHC A;  3HK0 A;  2AEH A;  2DFK A;  2Z13 A;  3ODW A;  3PVL A;  1X05 A;  3HQC A;  5C5B B;  4F7U P;  1OY2 A;  2V76 A;  3OAN A;  4Z2M B;  4GN1 A;  2AL6 A;  4KHB A;  1Y19 B;  3PEG A;  1ZYI A;  2DHK A;  2K2U A;  3QIJ A;  1WJM A;  1MK9 B;  3ULB A;  2K2J A;  5GOW B;  5LOP B;  2D9W A;  1MI1 A;  4A6F A;  3TO1 A;  4HB4 B;  4ZRI A;  2KIG A;  1DRO A;  1V61 A;  2ELA A;  1U29 A;  1V88 A;  4HAW B;  1DDW A;  3NSU A;  5HE2 A;  5KCV A;  2YS3 A;  2W2X C;  1U27 A;  3PP2 A;  3QWM A;  5HE1 A;  1PMS A;  1KI1 B;  5LON B;  1LB1 A;  2FJL A;  1RRP B;  4EJN A;  3A58 A;  5HE0 A;  5DH9 B;  2DA0 A;  1W1D A;  2DLW A;  3WA0 A;  1FHW A;  4D6W A;  2KIE A;  2P0F A;  1QC6 A;  3HW2 B;  1Y5O A;  2YS5 A;  4HAV B;  2L1C A;  1Q67 A;  3PSC A;  2EC1 A;  1ZC4 B;  3WYF B;  4PQ0 A;  2D10 A;  2G35 A;  2NMB A;  4HB3 B;  5LG4 B;  1I2H A;  1GG3 A;  2J0J A;  2L2I A;  4EKU A;  5D3X A;  2Z4D A;  3X23 A;  3PG7 A;  5DIF B;  1M7E A;  2D9Z A;  1BTK A;  1WI1 A;  2GUM A;  1K5G B;  2FJU B;  3B77 A;  3KRX A;  2ELB A;  2ZKM X;  5JHG A;  2DHI A;  1EGX A;  2YT1 A;  3AU4 A;  2K49 A;  2OQB A;  2ROV A;  2LG1 A;  2I5F A;  5I2M A;  1ZM0 A;  2KR0 A;  4HHV A;  2Z59 A;  5C16 A;  2LOX A;  4DX9 0;  2Y8G A;  4XWX A;  4HSI A;  1I7A A;  4GXB A;  1MAI A;  2LUL A;  3CIK A;  1T77 A;  2W2X D;  4HDO A;  2COC A;  2HE7 A;  2D4Q A;  2Z0O A;  2Y7B A;  2RVB B;  5DI9 B;  4QJ5 B;  3U12 A;  3P6A A;  3F5R A;  2CAY A;  3CXB B;  4H8S A;  4KAX B;  1X1G A;  3KRW A;  4IFS A;  2RUK B;  2DKQ A;  4ZRJ A;  1XX0 A;  1BTN A;  3DXC A;  3PVW A;  1DBH A;  1GC6 A;  1U2B A;  1IRS A;  1UEF A;  1X1F A;  2R2Y A;  4HB2 B;  4HAT B;  2J0K A;  2I1K A;  2DYN A;  3U8Z A;  3IVF A;  3ODO A;  2YT0 A;  3D8F A;  3FVC A;  4TKN A;  4L1R A;  2YVC A;  4K2O A;  2RSG A;  1Z87 A;  2UZR A;  3TW1 A;  2D9Y A;  2KUP A;  5IRS A;  2M14 A;  4MK0 A;  4HB0 B;  1XOD A;  3QBV B;  4KHA A;  3VOQ A;  4NY0 A;  2DYQ A;  4GMV A;  4DIX A;  2YT2 A;  5JLJ B;  2CRF A;  4Z2N A;  2IYB A;  1NU2 A;  4C0A A;  3UZT A;  2KUQ A;  2ROZ B;  2YF0 A;  1FAO A;  2DHJ A;  4WSF A;  5C5B A;  1NI2 A;  2P8V A;  3OHM B;  1MPH A;  2COD A;  2LKO A;  1W1G A;  3RCP A;  1WJ1 A;  1QQG A;  2VSZ A;  3T06 A;  1V5U A;  1NTV A;  5DHF B;  1TXD A;  2RNR B;  2Q13 A;  1DYN A;  2DKP A;  2Z14 A;  1GC7 A;  4IOY X;  2IFS A;  4MY6 A;  4DBB A;  3PZD A;  2Z0Q A;  5C6R A;  3SNH A;  3DCX A;  1XR0 B;  3NWF A;  4QXA B;  1MK7 B;  3FEH A;  3GYO A;  3F0W A;  2LYD A;  3KZ1 A;  3ML4 A;  3AU5 A;  1ISN A;  1FGZ A;  2VKI A;  1EF1 A;  3N7C A;  5D27 A;  1FHO A;  2X18 A;  3GYP A;  3A8P A;  4YL8 A;  3TFM A;  2NBV A;  2CY4 A;  1FOE A;  1P5T A;  4HAX B;  4DX8 A;  2Y8F A;  2Z0P A;  1MKE A;  3HIE A;  1ZSQ A;  1OMW A;  1BAK A;  2MKR A;  4CHJ A;  4B6H A;  2D2Q A;  1E5W A;  4KHO A;  5FI1 A;  2GS0 A;  1FHX A;  4GOU A;  2CY5 A;  1V5P A;  1P3R A; 
#chains in the Genus database with same CATH homology
 4CHM A;  4DXA B;  4CYE A;  1KZG A;  1AQC A;  3BIN A;  4F7H A;  1OQN A;  2I5C A;  1P6S A;  4NSW A;  1TQZ A;  3KY9 A;  1V89 A;  4D0N B;  2VRW B;  2YRY A;  3ZVR A;  2EMS A;  3BJI A;  3DXD A;  1TJ6 A;  4A6F B;  2E2X A;  1M7R A;  2DX1 A;  3ULC A;  5FI0 A;  3FM8 C;  4WVF B;  1FB8 A;  2P0D A;  4K2P A;  2YSZ A;  4K81 A;  1SGH A;  1UNQ A;  3SV1 A;  2GCJ A;  2QKM A;  4GZU A;  3FSS A;  2MFQ A;  1DDM A;  1EVH A;  5CLL B;  3ODX A;  3AJ4 A;  5C79 A;  4YON A;  5JHH A;  4K17 A;  5L81 A;  1XKE A;  2J59 M;  5EFX A;  3TCA A;  1PLS A;  5HE3 A;  1J19 A;  2DX5 A;  2GCL A;  4HAY B;  2XQN M;  1KZ7 A;  2H7D A;  2I1J A;  3P7Z A;  1UNR A;  4EMO A;  2D9X A;  4KVG B;  1EAZ A;  2YS1 A;  2EMT A;  4F7G A;  1AWE A;  1U5F A;  4ZRK A;  3TVV A;  1PFJ A;  2M38 A;  2RLO A;  5J3Y A;  5CLQ B;  2BCJ A;  2KGX B;  3KSY A;  2R0D A;  4HDQ A;  2RGN B;  4A5K A;  4TYZ A;  1NTY A;  1W1H A;  2EJ8 A;  5JP4 A;  1V5M A;  5KQ1 A;  2DTC A;  1X11 A;  3MPX A;  3A98 B;  2ZPY A;  3LJU X;  2COF A;  4MT7 A;  1K5D B;  3MDB C;  1WGU A;  2W2W A;  1WG7 A;  2KCJ A;  2UVM A;  4Y94 A;  4GPT B;  2UZS A;  5DHA B;  4BBK A;  2N0Y A;  3A8Q A;  4HAU B;  2LOZ A;  2J0M A;  5KQ4 A;  2JP2 A;  4HAZ B;  2HTH B;  4A6H A;  3SUZ A;  3SYX A;  2R09 A;  2QKL A;  3U7D A;  3V5W A;  1BWN A;  1LW3 A;  1MIX A;  5D3Y A;  1WVH A;  3ZDT A;  2DN6 A;  2N23 A;  1ZC3 B;  4A6K A;  1XCG A;  3M1I B;  3D8D A;  1H4R A;  5J3Q A;  1H10 A;  5D3W A;  1J0W A;  5D3V A;  1X86 A;  4IAP A;  1FGY A;  2H7E A;  2ADZ A;  2OTX A;  2COA A;  2K00 A;  1U5E A;  1WGQ A;  4WJ7 A;  1U5G A;  3DXE A;  2D9V A;  2P0H A;  4GMX B;  1MIZ B;  4KHB B;  3PVU A;  3VIA A;  1DDV A;  3O96 A;  1ZVR A;  2PZ1 A;  2MDX A;  1UPQ A;  1UPR A;  1XD4 A;  4PNK A;  2MWN B;  2GJY A;  1B55 A;  2NZ8 B;  4L6E A;  3D8E A;  4P7I A;  1UNP A;  1RJ2 A;  3SO6 A;  5J3T A;  1U5D A;  1N3H A;  3G9W A;  2D11 A;  1SHC A;  3HK0 A;  2AEH A;  2DFK A;  3ODW A;  3PVL A;  1X05 A;  3HQC A;  5C5B B;  4F7U P;  1OY2 A;  2V76 A;  3OAN A;  4Z2M B;  4GN1 A;  2AL6 A;  1Y19 B;  3PEG A;  2DHK A;  2K2U A;  3QIJ A;  1WJM A;  1MK9 B;  3ULB A;  2K2J A;  5GOW B;  5LOP B;  2D9W A;  4A6F A;  3TO1 A;  4HB4 B;  4ZRI A;  1DRO A;  1V61 A;  2ELA A;  1U29 A;  1V88 A;  4HAW B;  1DDW A;  3NSU A;  5HE2 A;  5KCV A;  2YS3 A;  2W2X C;  1U27 A;  3PP2 A;  3QWM A;  5HE1 A;  1PMS A;  1KI1 B;  5LON B;  1LB1 A;  2FJL A;  1RRP B;  4EJN A;  5HE0 A;  5DH9 B;  2DA0 A;  1W1D A;  2DLW A;  3WA0 A;  1FHW A;  2P0F A;  1QC6 A;  3HW2 B;  1Y5O A;  2YS5 A;  4HAV B;  2L1C A;  1Q67 A;  3PSC A;  2EC1 A;  1ZC4 B;  3WYF B;  4PQ0 A;  2D10 A;  2G35 A;  2NMB A;  4HB3 B;  1I2H A;  1GG3 A;  2J0J A;  2L2I A;  4EKU A;  5D3X A;  3X23 A;  3PG7 A;  5DIF B;  1M7E A;  2D9Z A;  1BTK A;  1WI1 A;  1K5G B;  3KRX A;  2ELB A;  5JHG A;  1EGX A;  2DHI A;  2YT1 A;  3AU4 A;  2OQB A;  2ROV A;  2LG1 A;  2I5F A;  1ZM0 A;  4HHV A;  5C16 A;  2LOX A;  4DX9 0;  2Y8G A;  4XWX A;  1I7A A;  4GXB A;  1MAI A;  2LUL A;  3CIK A;  2W2X D;  4HDO A;  2COC A;  2HE7 A;  2D4Q A;  2Z0O A;  2Y7B A;  2RVB B;  5DI9 B;  3P6A A;  3F5R A;  2CAY A;  3CXB B;  4H8S A;  4KAX B;  1X1G A;  3KRW A;  4IFS A;  2RUK B;  2DKQ A;  4ZRJ A;  1XX0 A;  1BTN A;  3DXC A;  3PVW A;  1DBH A;  1GC6 A;  1U2B A;  1IRS A;  1UEF A;  1X1F A;  4HB2 B;  4HAT B;  2J0K A;  2I1K A;  2DYN A;  3U8Z A;  3IVF A;  3ODO A;  2YT0 A;  3D8F A;  4TKN A;  2YVC A;  4K2O A;  2RSG A;  1Z87 A;  2UZR A;  3TW1 A;  2D9Y A;  2KUP A;  2M14 A;  4MK0 A;  4HB0 B;  1XOD A;  3QBV B;  4KHA A;  3VOQ A;  4NY0 A;  2DYQ A;  4GMV A;  5JLJ B;  2CRF A;  4Z2N A;  2IYB A;  1NU2 A;  4C0A A;  3UZT A;  2ROZ B;  2YF0 A;  1FAO A;  2DHJ A;  4WSF A;  5C5B A;  1NI2 A;  2P8V A;  1MPH A;  2COD A;  2LKO A;  1W1G A;  3RCP A;  1WJ1 A;  1QQG A;  2VSZ A;  3T06 A;  1V5U A;  1NTV A;  5DHF B;  1TXD A;  2RNR B;  2Q13 A;  1DYN A;  2DKP A;  1GC7 A;  4IOY X;  2IFS A;  4MY6 A;  4DBB A;  3PZD A;  2Z0Q A;  5C6R A;  3SNH A;  1XR0 B;  1MK7 B;  3FEH A;  3GYO A;  3F0W A;  2LYD A;  3KZ1 A;  3ML4 A;  3AU5 A;  1ISN A;  1FGZ A;  2VKI A;  1EF1 A;  3N7C A;  5D27 A;  1FHO A;  2X18 A;  3GYP A;  3A8P A;  4YL8 A;  3TFM A;  2CY4 A;  1FOE A;  1P5T A;  4HAX B;  4DX8 A;  2Y8F A;  2Z0P A;  1MKE A;  1ZSQ A;  1OMW A;  1BAK A;  2MKR A;  4CHJ A;  4B6H A;  2D2Q A;  1E5W A;  4KHO A;  5FI1 A;  2GS0 A;  1FHX A;  2CY5 A;  1V5P A;  1P3R A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...