2H7DA

Solution structure of the talin f3 domain in complex with a chimeric beta3 integrin-pip kinase peptide
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
101
structure length
101
Chain Sequence
PLGSGVSFFLVKEKMKGKNKLVPRLLGITKESVMRVDEKTKEVIQEWSLTNIKRWAASPKSFTLDFGDYQDGYYSVQTTEGEQIAQLIAGYIDIILKKKKS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural basis of integrin activation by talin
pubmed doi rcsb
source organism Gallus gallus
molecule tags Structural protein
molecule keywords Talin-1
total genus 14
structure length 101
sequence length 101
ec nomenclature
pdb deposition date 2006-06-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 2h7dA00
2DA0A 5LOPB 3WA0A 2DX1A 2L2IA 1WGQA 1FB8A 2Q13A 1P6SA 2E2XA 2FJLA 5HE2A 2D9XA 1EF1A 2D9WA 2J59M 4A6KA 4Y94A 1RRPB 2DHKA 2EMSA 2KUPA 1AQCA 1N3HA 2MDXA 2Z0PA 2COAA 2KGXB 2JP2A 1EAZA 3U7DA 1WJMA 1BAKA 5CLLB 3ODWA 3N7CA 2DHIA 1U5FA 5LONB 1PMSA 1E5WA 3SUZA 5C6RA 3U8ZA 3ODOA 1B55A 2EJ8A 4HB3B 4NSWA 2DKQA 1OQNA 2IFSA 1FGZA 5L81A 4TKNA 2DFKA 1TJ6A 3KZ1A 1UNRA 3A8PA 2CY5A 2DHJA 2YRYA 1DDWA 4A5KA 5HE1A 3F0WA 4A6FB 3PP2A 3PZDA 4HAYB 3AU5A 4WJ7A 2Y7BA 4EMOA 2CODA 4GXBA 2I1JA 2W2XC 3DXDA 1H10A 4K81A 1DYNA 3LJUX 3ML4A 1X11A 1Z87A 5FI1A 3HW2B 1XR0B 2I1KA 1KI1B 2AL6A 2H7EA 3VOQA 2BCJA 2K2JA 1ZC3B 2D2QA 1NTYA 2DLWA 2LYDA 2P8VA 1AWEA 1V5PA 5C5BB 1MKEA 2MFQA 3ZDTA 5JLJB 5KCVA 2N0YA 2J0KA 4GN1A 5HE0A 4K2PA 1RJ2A 2LOZA 3OANA 1BTNA 4KVGB 4EKUA 1J0WA 3DXCA 2ELBA 4KHBB 4HHVA 2PZ1A 1FHOA 2Y8FA 4ZRKA 3SYXA 1OMWA 3GYPA 3KRWA 4GZUA 1XX0A 1MAIA 1XODA 4DX8A 3D8DA 1NU2A 3A8QA 2MWNB 2I5CA 2DN6A 2NMBA 1MK7B 1X05A 5GOWB 2J0MA 5DH9B 4A6HA 2ZPYA 5D3YA 1V89A 2H7DA 3BJIA 1V88A 1W1HA 1U2BA 2HE7A 3VIAA 1MPHA 4GMXB 4CHJA 1UPRA 4WSFA 1ZM0A 3O96A 4DX90 1WI1A 4H8SA 2XQNM 1WG7A 2M38A 4ZRIA 1GC6A 5KQ1A 1QC6A 4K2OA 1ZVRA 2DTCA 4DXAB 5KQ4A 5C16A 1DROA 1K5GB 1PLSA 3TCAA 2Z0QA 1MK9B 2COFA 2YT1A 3TFMA 5J3TA 1FOEA 3NSUA 1DDVA 1U29A 2GCLA 3D8FA 3WYFB 4F7GA 2AEHA 2D10A 3RCPA 4HDQA 1NTVA 1UPQA 2D9YA 2NZ8B 1I7AA 1M7RA 4F7HA 2VKIA 2YT0A 1X86A 2RGNB 3FEHA 4BBKA 2ROZB 4L6EA 5JHHA 2YS1A 3KY9A 3AU4A 2GS0A 3PVLA 3V5WA 1UNQA 1W1DA 1UNPA 1TQZA 2D4QA 2DX5A 1P3RA 1GC7A 1V61A 1WJ1A 2DYQA 3KSYA 3M1IB 3QBVB 3ODXA 4KAXB 5JP4A 2RVBB 4HB2B 3MDBC 2RLOA 4GMVA 4HDOA 5C5BA 1UEFA 4K17A 4F7UP 1MIXA 1ZSQA 1Y19B 1V5MA 4WVFB 1U5EA 3CXBB 3F5RA 3FM8C 1PFJA 3KRXA 2ADZA 5J3QA 1WGUA 4KHOA 3TO1A 2OQBA 4ZRJA 2K00A 3PEGA 5D3WA 2LOXA 1FHXA 3ZVRA 4Z2MB 1MIZB 2N23A 5FI0A 2UZRA 4HB4B 3GYOA 1FAOA 5CLQB 4HAUB 3FSSA 3HQCA 2D11A 2X18A 1H4RA 4P7IA 2CY4A 4A6FA 3PSCA 5DI9B 2EMTA 4HATB 1BWNA 1DDMA 3PVUA 2KCJA 1QQGA 2HTHB 1WVHA 3CIKA 2G35A 2GCJA 3ULCA 2DKPA 1XKEA 1GG3A 5D3VA 4HAXB 2UZSA 3TW1A 4D0NB 3DXEA 4HAWB 4IAPA 1KZGA 2YS5A 1DBHA 3D8EA 2L1CA 1M7EA 4PNKA 2RSGA 4CYEA 1X1GA 3HK0A 3QWMA 1I2HA 2IYBA 1V5UA 4MT7A 2V76A 1U5DA 1XCGA 1ZC4B 2J0JA 2P0FA 2YF0A 4B6HA 3A98B 2R09A 1LW3A 2DYNA 3SNHA 5EFXA 5J3YA 3QIJA 3TVVA 2D9VA 2UVMA 2D9ZA 1SHCA 3P7ZA 4GPTB 3IVFA 4NY0A 4HAVB 2LKOA 5DHFB 2EC1A 2Y8GA 1XD4A 2CAYA 4IFSA 4YONA 4PQ0A 4MK0A 3ULBA 1ISNA 2M14A 1EVHA 1EGXA 2VSZA 4Z2NA 3AJ4A 1W1GA 5DIFB 2YVCA 2P0DA 1U5GA 2MKRA 2Z0OA 3PVWA 1SGHA 2ROVA 5JHGA 3T06A 4HB0B 2OTXA 3SO6A 5C79A 2W2XD 1KZ7A 2QKMA 1K5DB 1X1FA 5D27A 5D3XA 1Y5OA 4MY6A 4TYZA 3X23A 2I5FA 2ELAA 1BTKA 3P6AA 2K2UA 2R0DA 1FHWA 1J19A 3PG7A 3G9WA 1IRSA 4C0AA 1U27A 2COCA 4XWXA 4EJNA 2YSZA 1P5TA 3MPXA 2RNRB 2VRWB 2CRFA 1OY2A 5HE3A 2YS3A 1Q67A 4KHAA 1TXDA 4HAZB 3UZTA 2QKLA 3BINA 2GJYA 1FGYA 2P0HA 2RUKB 1NI2A 4YL8A 5DHAB 1LB1A 4DBBA 4CHMA 2LG1A 2W2WA 3SV1A 2LULA 4IOYX
chains in the Genus database with same CATH superfamily
2DA0A 5LOPB 3NW8A 3OHMB 3WA0A 2DX1A 2L2IA 1WGQA 1FB8A 2Q13A 1P6SA 2E2XA 2FJLA 5HE2A 2D9XA 1EF1A 2D9WA 2RRFA 2J59M 4A6KA 4CSQA 4Y94A 3HIEA 1RRPB 2DHKA 2EMSA 2KUPA 1AQCA 1N3HA 2MDXA 2Z0PA 2COAA 2KGXB 2JP2A 1EAZA 3U7DA 1WJMA 1BAKA 5CLLB 3ODWA 3N7CA 2DHIA 1U5FA 3FVCA 1PMSA 5LONB 1E5WA 3SUZA 5C6RA 3U8ZA 3ODOA 1B55A 2EJ8A 4HB3B 4NSWA 2DKQA 1OQNA 2IFSA 1FGZA 5L81A 4QJ5B 4TKNA 3HSAA 2DFKA 1TJ6A 3KZ1A 1UNRA 3A8PA 2CY5A 2DHJA 2YRYA 1DDWA 4A5KA 5HE1A 2K8EA 3F0WA 4A6FB 3PP2A 3PZDA 4HAYB 3AU5A 4WJ7A 2Y7BA 4EMOA 2CODA 2I1JA 2W2XC 3DXDA 4GXBA 1H10A 4HSIA 4K81A 1DYNA 3LJUX 5I2SA 3ML4A 1X11A 1Z87A 5FI1A 3HW2B 1XR0B 2I1KA 1KI1B 2AL6A 2H7EA 3VOQA 2BCJA 5M4YB 2K2JA 1ZC3B 2D2QA 5I2MA 1NTYA 2DLWA 2LYDA 4GOUA 2P8VA 2NBVA 1AWEA 1V5PA 5C5BB 1MKEA 2Z14A 2MFQA 3ZDTA 5JLJB 5KCVA 2N0YA 2J0KA 4GN1A 5HE0A 4K2PA 1RJ2A 2LOZA 3OANA 1BTNA 4KVGB 4EKUA 1J0WA 3DXCA 4QJ4B 2ELBA 4KHBB 4HHVA 2PZ1A 1FHOA 2Y8FA 4D6WA 4ZRKA 3SYXA 1OMWA 3GYPA 3KRWA 4GZUA 1XX0A 1MAIA 1XODA 1ZYIA 4DX8A 3D8DA 1NU2A 3A8QA 2MWNB 2I5CA 2DN6A 4QXAB 2NMBA 1MK7B 1X05A 5GOWB 2J0MA 5DH9B 4A6HA 2ZPYA 5D3YA 1V89A 2H7DA 3BJIA 1V88A 1W1HA 1U2BA 2HE7A 3VIAA 1MPHA 4GMXB 4CHJA 1UPRA 4WSFA 1ZM0A 3O96A 4DX90 1WI1A 4H8SA 2XQNM 1MI1A 1WG7A 2M38A 4ZRIA 1GC6A 5KQ1A 1QC6A 1ZVRA 2DTCA 4K2OA 4DXAB 5KQ4A 5C16A 2KIGA 1DROA 1K5GB 2KR0A 1PLSA 3TCAA 2Z0QA 1MK9B 2COFA 2YT1A 3TFMA 5J3TA 1FOEA 3NSUA 1DDVA 1U29A 2GCLA 3D8FA 3WYFB 4F7GA 2AEHA 2D10A 2Z59A 4KHBA 3NWDA 3RCPA 4HDQA 1NTVA 1UPQA 2Z13A 2D9YA 2NZ8B 1I7AA 1M7RA 4OT1A 4F7HA 2VKIA 2YT0A 1X86A 2RGNB 3FEHA 2ZKMX 4BBKA 2ROZB 4L6EA 5JHHA 2YS1A 3KY9A 3AU4A 2GS0A 3PVLA 3V5WA 1UNQA 1W1DA 1UNPA 1TQZA 2D4QA 2DX5A 2KUQA 3U12A 1P3RA 4QJ3B 1GC7A 1V61A 1WJ1A 2DYQA 3KSYA 3M1IB 3QBVB 3ODXA 4KAXB 5JP4A 2RVBB 4HB2B 3MDBC 2RLOA 4GMVA 4HDOA 5C5BA 3A58A 1UEFA 5IRSA 4K17A 4F7UP 1MIXA 1ZSQA 1Y19B 1V5MA 4WVFB 1U5EA 3CXBB 3F5RA 3FM8C 1PFJA 3KRXA 2ADZA 5J3QA 1WGUA 4KHOA 3TO1A 2OQBA 4ZRJA 2K00A 3PEGA 5D3WA 2LOXA 1FHXA 3ZVRA 4Z2MB 1MIZB 2N23A 5FI0A 2UZRA 4HB4B 2Z4DA 3GYOA 1FAOA 5CLQB 4HAUB 3FSSA 3HQCA 2D11A 2X18A 1H4RA 4P7IA 2CY4A 4A6FA 3PSCA 5DI9B 2EMTA 4HATB 1BWNA 1DDMA 3PVUA 2KCJA 1QQGA 2HTHB 1WVHA 3CIKA 2R2YA 2G35A 2GCJA 3ULCA 2DKPA 1XKEA 1GG3A 5D3VA 4HAXB 2UZSA 3TW1A 4D0NB 3DXEA 4HAWB 4IAPA 1KZGA 2YS5A 4GNKB 1DBHA 3D8EA 2L1CA 1M7EA 4PNKA 2RSGA 4CYEA 1X1GA 3HK0A 3QWMA 1I2HA 2IYBA 1V5UA 4MT7A 2V76A 1U5DA 1XCGA 1ZC4B 2J0JA 2P0FA 2YF0A 4B6HA 2KIEA 3A98B 2R09A 1LW3A 2DYNA 3SNHA 5EFXA 4OSNA 5J3YA 3QIJA 3TVVA 2D9VA 2UVMA 2D9ZA 1SHCA 3P7ZA 4GPTB 3IVFA 4NY0A 4HAVB 2LKOA 5DHFB 2EC1A 2Y8GA 1XD4A 2CAYA 4IFSA 4YONA 2K49A 4PQ0A 4MK0A 4L1RA 3ULBA 1ISNA 2M14A 1EVHA 5LG4B 1EGXA 2VSZA 4Z2NA 3AJ4A 1W1GA 5DIFB 2YVCA 2P0DA 1U5GA 2MKRA 2Z0OA 3PVWA 2FJUB 1SGHA 3DCXA 4DIXA 2ROVA 5JHGA 3T06A 4HB0B 2OTXA 3SO6A 5C79A 2W2XD 1KZ7A 2QKMA 1K5DB 1X1FA 5D27A 5D3XA 2GUMA 1Y5OA 4MY6A 4TYZA 3X23A 2I5FA 2ELAA 1BTKA 3P6AA 2K2UA 2R0DA 1FHWA 1J19A 3PG7A 3G9WA 1IRSA 4C0AA 1U27A 2COCA 4XWXA 4EJNA 2YSZA 1T77A 1P5TA 3MPXA 2RNRB 3B77A 2VRWB 2CRFA 3NWAA 1OY2A 5HE3A 2YS3A 1Q67A 4KHAA 1TXDA 4HAZB 3UZTA 2QKLA 3BINA 2GJYA 1FGYA 2P0HA 3NWFA 2RUKB 1NI2A 4YL8A 5DHAB 1LB1A 2YT2A 4DBBA 4CHMA 2LG1A 2W2WA 3SV1A 2LULA 4IOYX
chains in the Genus database with same CATH topology
2DA0A 5LOPB 3WA0A 2DX1A 2L2IA 1WGQA 1FB8A 2Q13A 1P6SA 2E2XA 2FJLA 5HE2A 2D9XA 1EF1A 2D9WA 2J59M 4A6KA 4Y94A 1RRPB 2DHKA 2EMSA 2KUPA 1AQCA 1N3HA 2MDXA 2Z0PA 2COAA 2KGXB 2JP2A 1EAZA 3U7DA 1WJMA 1BAKA 5CLLB 3ODWA 3N7CA 2DHIA 1U5FA 5LONB 1PMSA 1E5WA 3SUZA 5C6RA 3U8ZA 3ODOA 1B55A 2EJ8A 4HB3B 4NSWA 2DKQA 1OQNA 2IFSA 1FGZA 5L81A 4TKNA 2DFKA 1TJ6A 3KZ1A 1UNRA 3A8PA 2CY5A 2DHJA 2YRYA 1DDWA 4A5KA 5HE1A 3F0WA 4A6FB 3PP2A 3PZDA 4HAYB 3AU5A 4WJ7A 2Y7BA 4EMOA 2CODA 4GXBA 2I1JA 2W2XC 3DXDA 1H10A 4K81A 1DYNA 3LJUX 3ML4A 1X11A 1Z87A 5FI1A 3HW2B 1XR0B 2I1KA 1KI1B 2AL6A 2H7EA 3VOQA 2BCJA 2K2JA 1ZC3B 2D2QA 1NTYA 2DLWA 2LYDA 2P8VA 1AWEA 1V5PA 5C5BB 1MKEA 2MFQA 3ZDTA 5JLJB 5KCVA 2N0YA 2J0KA 4GN1A 5HE0A 4K2PA 1RJ2A 2LOZA 3OANA 1BTNA 4KVGB 4EKUA 1J0WA 3DXCA 2ELBA 4KHBB 4HHVA 2PZ1A 1FHOA 2Y8FA 4ZRKA 3SYXA 1OMWA 3GYPA 3KRWA 4GZUA 1XX0A 1MAIA 1XODA 4DX8A 3D8DA 1NU2A 3A8QA 2MWNB 2I5CA 2DN6A 2NMBA 1MK7B 1X05A 5GOWB 2J0MA 5DH9B 4A6HA 2ZPYA 5D3YA 1V89A 2H7DA 3BJIA 1V88A 1W1HA 1U2BA 2HE7A 3VIAA 1MPHA 4GMXB 4CHJA 1UPRA 4WSFA 1ZM0A 3O96A 4DX90 1WI1A 4H8SA 2XQNM 1WG7A 2M38A 4ZRIA 1GC6A 5KQ1A 1QC6A 4K2OA 1ZVRA 2DTCA 4DXAB 5KQ4A 5C16A 1DROA 1K5GB 1PLSA 3TCAA 2Z0QA 1MK9B 2COFA 2YT1A 3TFMA 5J3TA 1FOEA 3NSUA 1DDVA 1U29A 2GCLA 3D8FA 3WYFB 4F7GA 2AEHA 2D10A 3RCPA 4HDQA 1NTVA 1UPQA 2D9YA 2NZ8B 1I7AA 1M7RA 4F7HA 2VKIA 2YT0A 1X86A 2RGNB 3FEHA 4BBKA 2ROZB 4L6EA 5JHHA 2YS1A 3KY9A 3AU4A 2GS0A 3PVLA 3V5WA 1UNQA 1W1DA 1UNPA 1TQZA 2D4QA 2DX5A 1P3RA 1GC7A 1V61A 1WJ1A 2DYQA 3KSYA 3M1IB 3QBVB 3ODXA 4KAXB 5JP4A 2RVBB 4HB2B 3MDBC 2RLOA 4GMVA 4HDOA 5C5BA 1UEFA 4K17A 4F7UP 1MIXA 1ZSQA 1Y19B 1V5MA 4WVFB 1U5EA 3CXBB 3F5RA 3FM8C 1PFJA 3KRXA 2ADZA 5J3QA 1WGUA 4KHOA 3TO1A 2OQBA 4ZRJA 2K00A 3PEGA 5D3WA 2LOXA 1FHXA 3ZVRA 4Z2MB 1MIZB 2N23A 5FI0A 2UZRA 4HB4B 3GYOA 1FAOA 5CLQB 4HAUB 3FSSA 3HQCA 2D11A 2X18A 1H4RA 4P7IA 2CY4A 4A6FA 3PSCA 5DI9B 2EMTA 4HATB 1BWNA 1DDMA 3PVUA 2KCJA 1QQGA 2HTHB 1WVHA 3CIKA 2G35A 2GCJA 3ULCA 2DKPA 1XKEA 1GG3A 5D3VA 4HAXB 2UZSA 3TW1A 4D0NB 3DXEA 4HAWB 4IAPA 1KZGA 2YS5A 1DBHA 3D8EA 2L1CA 1M7EA 4PNKA 2RSGA 4CYEA 1X1GA 3HK0A 3QWMA 1I2HA 2IYBA 1V5UA 4MT7A 2V76A 1U5DA 1XCGA 1ZC4B 2J0JA 2P0FA 2YF0A 4B6HA 3A98B 2R09A 1LW3A 2DYNA 3SNHA 5EFXA 5J3YA 3QIJA 3TVVA 2D9VA 2UVMA 2D9ZA 1SHCA 3P7ZA 4GPTB 3IVFA 4NY0A 4HAVB 2LKOA 5DHFB 2EC1A 2Y8GA 1XD4A 2CAYA 4IFSA 4YONA 4PQ0A 4MK0A 3ULBA 1ISNA 2M14A 1EVHA 1EGXA 2VSZA 4Z2NA 3AJ4A 1W1GA 5DIFB 2YVCA 2P0DA 1U5GA 2MKRA 2Z0OA 3PVWA 1SGHA 2ROVA 5JHGA 3T06A 4HB0B 2OTXA 3SO6A 5C79A 2W2XD 1KZ7A 2QKMA 1K5DB 1X1FA 5D27A 5D3XA 1Y5OA 4MY6A 4TYZA 3X23A 2I5FA 2ELAA 1BTKA 3P6AA 2K2UA 2R0DA 1FHWA 1J19A 3PG7A 3G9WA 1IRSA 4C0AA 1U27A 2COCA 4XWXA 4EJNA 2YSZA 1P5TA 3MPXA 2RNRB 2VRWB 2CRFA 1OY2A 5HE3A 2YS3A 1Q67A 4KHAA 1TXDA 4HAZB 3UZTA 2QKLA 3BINA 2GJYA 1FGYA 2P0HA 2RUKB 1NI2A 4YL8A 5DHAB 1LB1A 4DBBA 4CHMA 2LG1A 2W2WA 3SV1A 2LULA 4IOYX
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2DA0 A;  5LOP B;  3WA0 A;  2DX1 A;  2L2I A;  1WGQ A;  1FB8 A;  2Q13 A;  1P6S A;  2E2X A;  2FJL A;  5HE2 A;  2D9X A;  1EF1 A;  2D9W A;  2J59 M;  4A6K A;  4Y94 A;  1RRP B;  2DHK A;  2EMS A;  2KUP A;  1AQC A;  1N3H A;  2MDX A;  2Z0P A;  2COA A;  2KGX B;  2JP2 A;  1EAZ A;  3U7D A;  1WJM A;  1BAK A;  5CLL B;  3ODW A;  3N7C A;  2DHI A;  1U5F A;  5LON B;  1PMS A;  1E5W A;  3SUZ A;  5C6R A;  3U8Z A;  3ODO A;  1B55 A;  2EJ8 A;  4HB3 B;  4NSW A;  2DKQ A;  1OQN A;  2IFS A;  1FGZ A;  5L81 A;  4TKN A;  2DFK A;  1TJ6 A;  3KZ1 A;  1UNR A;  3A8P A;  2CY5 A;  2DHJ A;  2YRY A;  1DDW A;  4A5K A;  5HE1 A;  3F0W A;  4A6F B;  3PP2 A;  3PZD A;  4HAY B;  3AU5 A;  4WJ7 A;  2Y7B A;  4EMO A;  2COD A;  4GXB A;  2I1J A;  2W2X C;  3DXD A;  1H10 A;  4K81 A;  1DYN A;  3LJU X;  3ML4 A;  1X11 A;  1Z87 A;  5FI1 A;  3HW2 B;  1XR0 B;  2I1K A;  1KI1 B;  2AL6 A;  2H7E A;  3VOQ A;  2BCJ A;  2K2J A;  1ZC3 B;  2D2Q A;  1NTY A;  2DLW A;  2LYD A;  2P8V A;  1AWE A;  1V5P A;  5C5B B;  1MKE A;  2MFQ A;  3ZDT A;  5JLJ B;  5KCV A;  2N0Y A;  2J0K A;  4GN1 A;  5HE0 A;  4K2P A;  1RJ2 A;  2LOZ A;  3OAN A;  1BTN A;  4KVG B;  4EKU A;  1J0W A;  3DXC A;  2ELB A;  4KHB B;  4HHV A;  2PZ1 A;  1FHO A;  2Y8F A;  4ZRK A;  3SYX A;  1OMW A;  3GYP A;  3KRW A;  4GZU A;  1XX0 A;  1MAI A;  1XOD A;  4DX8 A;  3D8D A;  1NU2 A;  3A8Q A;  2MWN B;  2I5C A;  2DN6 A;  2NMB A;  1MK7 B;  1X05 A;  5GOW B;  2J0M A;  5DH9 B;  4A6H A;  2ZPY A;  5D3Y A;  1V89 A;  2H7D A;  3BJI A;  1V88 A;  1W1H A;  1U2B A;  2HE7 A;  3VIA A;  1MPH A;  4GMX B;  4CHJ A;  1UPR A;  4WSF A;  1ZM0 A;  3O96 A;  4DX9 0;  1WI1 A;  4H8S A;  2XQN M;  1WG7 A;  2M38 A;  4ZRI A;  1GC6 A;  5KQ1 A;  1QC6 A;  4K2O A;  1ZVR A;  2DTC A;  4DXA B;  5KQ4 A;  5C16 A;  1DRO A;  1K5G B;  1PLS A;  3TCA A;  2Z0Q A;  1MK9 B;  2COF A;  2YT1 A;  3TFM A;  5J3T A;  1FOE A;  3NSU A;  1DDV A;  1U29 A;  2GCL A;  3D8F A;  3WYF B;  4F7G A;  2AEH A;  2D10 A;  3RCP A;  4HDQ A;  1NTV A;  1UPQ A;  2D9Y A;  2NZ8 B;  1I7A A;  1M7R A;  4F7H A;  2VKI A;  2YT0 A;  1X86 A;  2RGN B;  3FEH A;  4BBK A;  2ROZ B;  4L6E A;  5JHH A;  2YS1 A;  3KY9 A;  3AU4 A;  2GS0 A;  3PVL A;  3V5W A;  1UNQ A;  1W1D A;  1UNP A;  1TQZ A;  2D4Q A;  2DX5 A;  1P3R A;  1GC7 A;  1V61 A;  1WJ1 A;  2DYQ A;  3KSY A;  3M1I B;  3QBV B;  3ODX A;  4KAX B;  5JP4 A;  2RVB B;  4HB2 B;  3MDB C;  2RLO A;  4GMV A;  4HDO A;  5C5B A;  1UEF A;  4K17 A;  4F7U P;  1MIX A;  1ZSQ A;  1Y19 B;  1V5M A;  4WVF B;  1U5E A;  3CXB B;  3F5R A;  3FM8 C;  1PFJ A;  3KRX A;  2ADZ A;  5J3Q A;  1WGU A;  4KHO A;  3TO1 A;  2OQB A;  4ZRJ A;  2K00 A;  3PEG A;  5D3W A;  2LOX A;  1FHX A;  3ZVR A;  4Z2M B;  1MIZ B;  2N23 A;  5FI0 A;  2UZR A;  4HB4 B;  3GYO A;  1FAO A;  5CLQ B;  4HAU B;  3FSS A;  3HQC A;  2D11 A;  2X18 A;  1H4R A;  4P7I A;  2CY4 A;  4A6F A;  3PSC A;  5DI9 B;  2EMT A;  4HAT B;  1BWN A;  1DDM A;  3PVU A;  2KCJ A;  1QQG A;  2HTH B;  1WVH A;  3CIK A;  2G35 A;  2GCJ A;  3ULC A;  2DKP A;  1XKE A;  1GG3 A;  5D3V A;  4HAX B;  2UZS A;  3TW1 A;  4D0N B;  3DXE A;  4HAW B;  4IAP A;  1KZG A;  2YS5 A;  1DBH A;  3D8E A;  2L1C A;  1M7E A;  4PNK A;  2RSG A;  4CYE A;  1X1G A;  3HK0 A;  3QWM A;  1I2H A;  2IYB A;  1V5U A;  4MT7 A;  2V76 A;  1U5D A;  1XCG A;  1ZC4 B;  2J0J A;  2P0F A;  2YF0 A;  4B6H A;  3A98 B;  2R09 A;  1LW3 A;  2DYN A;  3SNH A;  5EFX A;  5J3Y A;  3QIJ A;  3TVV A;  2D9V A;  2UVM A;  2D9Z A;  1SHC A;  3P7Z A;  4GPT B;  3IVF A;  4NY0 A;  4HAV B;  2LKO A;  5DHF B;  2EC1 A;  2Y8G A;  1XD4 A;  2CAY A;  4IFS A;  4YON A;  4PQ0 A;  4MK0 A;  3ULB A;  1ISN A;  2M14 A;  1EVH A;  1EGX A;  2VSZ A;  4Z2N A;  3AJ4 A;  1W1G A;  5DIF B;  2YVC A;  2P0D A;  1U5G A;  2MKR A;  2Z0O A;  3PVW A;  1SGH A;  2ROV A;  5JHG A;  3T06 A;  4HB0 B;  2OTX A;  3SO6 A;  5C79 A;  2W2X D;  1KZ7 A;  2QKM A;  1K5D B;  1X1F A;  5D27 A;  5D3X A;  1Y5O A;  4MY6 A;  4TYZ A;  3X23 A;  2I5F A;  2ELA A;  1BTK A;  3P6A A;  2K2U A;  2R0D A;  1FHW A;  1J19 A;  3PG7 A;  3G9W A;  1IRS A;  4C0A A;  1U27 A;  2COC A;  4XWX A;  4EJN A;  2YSZ A;  1P5T A;  3MPX A;  2RNR B;  2VRW B;  2CRF A;  1OY2 A;  5HE3 A;  2YS3 A;  1Q67 A;  4KHA A;  1TXD A;  4HAZ B;  3UZT A;  2QKL A;  3BIN A;  2GJY A;  1FGY A;  2P0H A;  2RUK B;  1NI2 A;  4YL8 A;  5DHA B;  1LB1 A;  4DBB A;  4CHM A;  2LG1 A;  2W2W A;  3SV1 A;  2LUL A;  4IOY X; 
#chains in the Genus database with same CATH topology
 2DA0 A;  5LOP B;  3NW8 A;  3OHM B;  3WA0 A;  2DX1 A;  2L2I A;  1WGQ A;  1FB8 A;  2Q13 A;  1P6S A;  2E2X A;  2FJL A;  5HE2 A;  2D9X A;  1EF1 A;  2D9W A;  2RRF A;  2J59 M;  4A6K A;  4CSQ A;  4Y94 A;  3HIE A;  1RRP B;  2DHK A;  2EMS A;  2KUP A;  1AQC A;  1N3H A;  2MDX A;  2Z0P A;  2COA A;  2KGX B;  2JP2 A;  1EAZ A;  3U7D A;  1WJM A;  1BAK A;  5CLL B;  3ODW A;  3N7C A;  2DHI A;  1U5F A;  3FVC A;  1PMS A;  5LON B;  1E5W A;  3SUZ A;  5C6R A;  3U8Z A;  3ODO A;  1B55 A;  2EJ8 A;  4HB3 B;  4NSW A;  2DKQ A;  1OQN A;  2IFS A;  1FGZ A;  5L81 A;  4QJ5 B;  4TKN A;  3HSA A;  2DFK A;  1TJ6 A;  3KZ1 A;  1UNR A;  3A8P A;  2CY5 A;  2DHJ A;  2YRY A;  1DDW A;  4A5K A;  5HE1 A;  2K8E A;  3F0W A;  4A6F B;  3PP2 A;  3PZD A;  4HAY B;  3AU5 A;  4WJ7 A;  2Y7B A;  4EMO A;  2COD A;  2I1J A;  2W2X C;  3DXD A;  4GXB A;  1H10 A;  4HSI A;  4K81 A;  1DYN A;  3LJU X;  5I2S A;  3ML4 A;  1X11 A;  1Z87 A;  5FI1 A;  3HW2 B;  1XR0 B;  2I1K A;  1KI1 B;  2AL6 A;  2H7E A;  3VOQ A;  2BCJ A;  5M4Y B;  2K2J A;  1ZC3 B;  2D2Q A;  5I2M A;  1NTY A;  2DLW A;  2LYD A;  4GOU A;  2P8V A;  2NBV A;  1AWE A;  1V5P A;  5C5B B;  1MKE A;  2Z14 A;  2MFQ A;  3ZDT A;  5JLJ B;  5KCV A;  2N0Y A;  2J0K A;  4GN1 A;  5HE0 A;  4K2P A;  1RJ2 A;  2LOZ A;  3OAN A;  1BTN A;  4KVG B;  4EKU A;  1J0W A;  3DXC A;  4QJ4 B;  2ELB A;  4KHB B;  4HHV A;  2PZ1 A;  1FHO A;  2Y8F A;  4D6W A;  4ZRK A;  3SYX A;  1OMW A;  3GYP A;  3KRW A;  4GZU A;  1XX0 A;  1MAI A;  1XOD A;  1ZYI A;  4DX8 A;  3D8D A;  1NU2 A;  3A8Q A;  2MWN B;  2I5C A;  2DN6 A;  4QXA B;  2NMB A;  1MK7 B;  1X05 A;  5GOW B;  2J0M A;  5DH9 B;  4A6H A;  2ZPY A;  5D3Y A;  1V89 A;  2H7D A;  3BJI A;  1V88 A;  1W1H A;  1U2B A;  2HE7 A;  3VIA A;  1MPH A;  4GMX B;  4CHJ A;  1UPR A;  4WSF A;  1ZM0 A;  3O96 A;  4DX9 0;  1WI1 A;  4H8S A;  2XQN M;  1MI1 A;  1WG7 A;  2M38 A;  4ZRI A;  1GC6 A;  5KQ1 A;  1QC6 A;  1ZVR A;  2DTC A;  4K2O A;  4DXA B;  5KQ4 A;  5C16 A;  2KIG A;  1DRO A;  1K5G B;  2KR0 A;  1PLS A;  3TCA A;  2Z0Q A;  1MK9 B;  2COF A;  2YT1 A;  3TFM A;  5J3T A;  1FOE A;  3NSU A;  1DDV A;  1U29 A;  2GCL A;  3D8F A;  3WYF B;  4F7G A;  2AEH A;  2D10 A;  2Z59 A;  4KHB A;  3NWD A;  3RCP A;  4HDQ A;  1NTV A;  1UPQ A;  2Z13 A;  2D9Y A;  2NZ8 B;  1I7A A;  1M7R A;  4OT1 A;  4F7H A;  2VKI A;  2YT0 A;  1X86 A;  2RGN B;  3FEH A;  2ZKM X;  4BBK A;  2ROZ B;  4L6E A;  5JHH A;  2YS1 A;  3KY9 A;  3AU4 A;  2GS0 A;  3PVL A;  3V5W A;  1UNQ A;  1W1D A;  1UNP A;  1TQZ A;  2D4Q A;  2DX5 A;  2KUQ A;  3U12 A;  1P3R A;  4QJ3 B;  1GC7 A;  1V61 A;  1WJ1 A;  2DYQ A;  3KSY A;  3M1I B;  3QBV B;  3ODX A;  4KAX B;  5JP4 A;  2RVB B;  4HB2 B;  3MDB C;  2RLO A;  4GMV A;  4HDO A;  5C5B A;  3A58 A;  1UEF A;  5IRS A;  4K17 A;  4F7U P;  1MIX A;  1ZSQ A;  1Y19 B;  1V5M A;  4WVF B;  1U5E A;  3CXB B;  3F5R A;  3FM8 C;  1PFJ A;  3KRX A;  2ADZ A;  5J3Q A;  1WGU A;  4KHO A;  3TO1 A;  2OQB A;  4ZRJ A;  2K00 A;  3PEG A;  5D3W A;  2LOX A;  1FHX A;  3ZVR A;  4Z2M B;  1MIZ B;  2N23 A;  5FI0 A;  2UZR A;  4HB4 B;  2Z4D A;  3GYO A;  1FAO A;  5CLQ B;  4HAU B;  3FSS A;  3HQC A;  2D11 A;  2X18 A;  1H4R A;  4P7I A;  2CY4 A;  4A6F A;  3PSC A;  5DI9 B;  2EMT A;  4HAT B;  1BWN A;  1DDM A;  3PVU A;  2KCJ A;  1QQG A;  2HTH B;  1WVH A;  3CIK A;  2R2Y A;  2G35 A;  2GCJ A;  3ULC A;  2DKP A;  1XKE A;  1GG3 A;  5D3V A;  4HAX B;  2UZS A;  3TW1 A;  4D0N B;  3DXE A;  4HAW B;  4IAP A;  1KZG A;  2YS5 A;  4GNK B;  1DBH A;  3D8E A;  2L1C A;  1M7E A;  4PNK A;  2RSG A;  4CYE A;  1X1G A;  3HK0 A;  3QWM A;  1I2H A;  2IYB A;  1V5U A;  4MT7 A;  2V76 A;  1U5D A;  1XCG A;  1ZC4 B;  2J0J A;  2P0F A;  2YF0 A;  4B6H A;  2KIE A;  3A98 B;  2R09 A;  1LW3 A;  2DYN A;  3SNH A;  5EFX A;  4OSN A;  5J3Y A;  3QIJ A;  3TVV A;  2D9V A;  2UVM A;  2D9Z A;  1SHC A;  3P7Z A;  4GPT B;  3IVF A;  4NY0 A;  4HAV B;  2LKO A;  5DHF B;  2EC1 A;  2Y8G A;  1XD4 A;  2CAY A;  4IFS A;  4YON A;  2K49 A;  4PQ0 A;  4MK0 A;  4L1R A;  3ULB A;  1ISN A;  2M14 A;  1EVH A;  5LG4 B;  1EGX A;  2VSZ A;  4Z2N A;  3AJ4 A;  1W1G A;  5DIF B;  2YVC A;  2P0D A;  1U5G A;  2MKR A;  2Z0O A;  3PVW A;  2FJU B;  1SGH A;  3DCX A;  4DIX A;  2ROV A;  5JHG A;  3T06 A;  4HB0 B;  2OTX A;  3SO6 A;  5C79 A;  2W2X D;  1KZ7 A;  2QKM A;  1K5D B;  1X1F A;  5D27 A;  5D3X A;  2GUM A;  1Y5O A;  4MY6 A;  4TYZ A;  3X23 A;  2I5F A;  2ELA A;  1BTK A;  3P6A A;  2K2U A;  2R0D A;  1FHW A;  1J19 A;  3PG7 A;  3G9W A;  1IRS A;  4C0A A;  1U27 A;  2COC A;  4XWX A;  4EJN A;  2YSZ A;  1T77 A;  1P5T A;  3MPX A;  2RNR B;  3B77 A;  2VRW B;  2CRF A;  3NWA A;  1OY2 A;  5HE3 A;  2YS3 A;  1Q67 A;  4KHA A;  1TXD A;  4HAZ B;  3UZT A;  2QKL A;  3BIN A;  2GJY A;  1FGY A;  2P0H A;  3NWF A;  2RUK B;  1NI2 A;  4YL8 A;  5DHA B;  1LB1 A;  2YT2 A;  4DBB A;  4CHM A;  2LG1 A;  2W2W A;  3SV1 A;  2LUL A;  4IOY X; 
#chains in the Genus database with same CATH homology
 2DA0 A;  5LOP B;  3WA0 A;  2DX1 A;  2L2I A;  1WGQ A;  1FB8 A;  2Q13 A;  1P6S A;  2E2X A;  2FJL A;  5HE2 A;  2D9X A;  1EF1 A;  2D9W A;  2J59 M;  4A6K A;  4Y94 A;  1RRP B;  2DHK A;  2EMS A;  2KUP A;  1AQC A;  1N3H A;  2MDX A;  2Z0P A;  2COA A;  2KGX B;  2JP2 A;  1EAZ A;  3U7D A;  1WJM A;  1BAK A;  5CLL B;  3ODW A;  3N7C A;  2DHI A;  1U5F A;  5LON B;  1PMS A;  1E5W A;  3SUZ A;  5C6R A;  3U8Z A;  3ODO A;  1B55 A;  2EJ8 A;  4HB3 B;  4NSW A;  2DKQ A;  1OQN A;  2IFS A;  1FGZ A;  5L81 A;  4TKN A;  2DFK A;  1TJ6 A;  3KZ1 A;  1UNR A;  3A8P A;  2CY5 A;  2DHJ A;  2YRY A;  1DDW A;  4A5K A;  5HE1 A;  3F0W A;  4A6F B;  3PP2 A;  3PZD A;  4HAY B;  3AU5 A;  4WJ7 A;  2Y7B A;  4EMO A;  2COD A;  4GXB A;  2I1J A;  2W2X C;  3DXD A;  1H10 A;  4K81 A;  1DYN A;  3LJU X;  3ML4 A;  1X11 A;  1Z87 A;  5FI1 A;  3HW2 B;  1XR0 B;  2I1K A;  1KI1 B;  2AL6 A;  2H7E A;  3VOQ A;  2BCJ A;  2K2J A;  1ZC3 B;  2D2Q A;  1NTY A;  2DLW A;  2LYD A;  2P8V A;  1AWE A;  1V5P A;  5C5B B;  1MKE A;  2MFQ A;  3ZDT A;  5JLJ B;  5KCV A;  2N0Y A;  2J0K A;  4GN1 A;  5HE0 A;  4K2P A;  1RJ2 A;  2LOZ A;  3OAN A;  1BTN A;  4KVG B;  4EKU A;  1J0W A;  3DXC A;  2ELB A;  4KHB B;  4HHV A;  2PZ1 A;  1FHO A;  2Y8F A;  4ZRK A;  3SYX A;  1OMW A;  3GYP A;  3KRW A;  4GZU A;  1XX0 A;  1MAI A;  1XOD A;  4DX8 A;  3D8D A;  1NU2 A;  3A8Q A;  2MWN B;  2I5C A;  2DN6 A;  2NMB A;  1MK7 B;  1X05 A;  5GOW B;  2J0M A;  5DH9 B;  4A6H A;  2ZPY A;  5D3Y A;  1V89 A;  2H7D A;  3BJI A;  1V88 A;  1W1H A;  1U2B A;  2HE7 A;  3VIA A;  1MPH A;  4GMX B;  4CHJ A;  1UPR A;  4WSF A;  1ZM0 A;  3O96 A;  4DX9 0;  1WI1 A;  4H8S A;  2XQN M;  1WG7 A;  2M38 A;  4ZRI A;  1GC6 A;  5KQ1 A;  1QC6 A;  4K2O A;  1ZVR A;  2DTC A;  4DXA B;  5KQ4 A;  5C16 A;  1DRO A;  1K5G B;  1PLS A;  3TCA A;  2Z0Q A;  1MK9 B;  2COF A;  2YT1 A;  3TFM A;  5J3T A;  1FOE A;  3NSU A;  1DDV A;  1U29 A;  2GCL A;  3D8F A;  3WYF B;  4F7G A;  2AEH A;  2D10 A;  3RCP A;  4HDQ A;  1NTV A;  1UPQ A;  2D9Y A;  2NZ8 B;  1I7A A;  1M7R A;  4F7H A;  2VKI A;  2YT0 A;  1X86 A;  2RGN B;  3FEH A;  4BBK A;  2ROZ B;  4L6E A;  5JHH A;  2YS1 A;  3KY9 A;  3AU4 A;  2GS0 A;  3PVL A;  3V5W A;  1UNQ A;  1W1D A;  1UNP A;  1TQZ A;  2D4Q A;  2DX5 A;  1P3R A;  1GC7 A;  1V61 A;  1WJ1 A;  2DYQ A;  3KSY A;  3M1I B;  3QBV B;  3ODX A;  4KAX B;  5JP4 A;  2RVB B;  4HB2 B;  3MDB C;  2RLO A;  4GMV A;  4HDO A;  5C5B A;  1UEF A;  4K17 A;  4F7U P;  1MIX A;  1ZSQ A;  1Y19 B;  1V5M A;  4WVF B;  1U5E A;  3CXB B;  3F5R A;  3FM8 C;  1PFJ A;  3KRX A;  2ADZ A;  5J3Q A;  1WGU A;  4KHO A;  3TO1 A;  2OQB A;  4ZRJ A;  2K00 A;  3PEG A;  5D3W A;  2LOX A;  1FHX A;  3ZVR A;  4Z2M B;  1MIZ B;  2N23 A;  5FI0 A;  2UZR A;  4HB4 B;  3GYO A;  1FAO A;  5CLQ B;  4HAU B;  3FSS A;  3HQC A;  2D11 A;  2X18 A;  1H4R A;  4P7I A;  2CY4 A;  4A6F A;  3PSC A;  5DI9 B;  2EMT A;  4HAT B;  1BWN A;  1DDM A;  3PVU A;  2KCJ A;  1QQG A;  2HTH B;  1WVH A;  3CIK A;  2G35 A;  2GCJ A;  3ULC A;  2DKP A;  1XKE A;  1GG3 A;  5D3V A;  4HAX B;  2UZS A;  3TW1 A;  4D0N B;  3DXE A;  4HAW B;  4IAP A;  1KZG A;  2YS5 A;  1DBH A;  3D8E A;  2L1C A;  1M7E A;  4PNK A;  2RSG A;  4CYE A;  1X1G A;  3HK0 A;  3QWM A;  1I2H A;  2IYB A;  1V5U A;  4MT7 A;  2V76 A;  1U5D A;  1XCG A;  1ZC4 B;  2J0J A;  2P0F A;  2YF0 A;  4B6H A;  3A98 B;  2R09 A;  1LW3 A;  2DYN A;  3SNH A;  5EFX A;  5J3Y A;  3QIJ A;  3TVV A;  2D9V A;  2UVM A;  2D9Z A;  1SHC A;  3P7Z A;  4GPT B;  3IVF A;  4NY0 A;  4HAV B;  2LKO A;  5DHF B;  2EC1 A;  2Y8G A;  1XD4 A;  2CAY A;  4IFS A;  4YON A;  4PQ0 A;  4MK0 A;  3ULB A;  1ISN A;  2M14 A;  1EVH A;  1EGX A;  2VSZ A;  4Z2N A;  3AJ4 A;  1W1G A;  5DIF B;  2YVC A;  2P0D A;  1U5G A;  2MKR A;  2Z0O A;  3PVW A;  1SGH A;  2ROV A;  5JHG A;  3T06 A;  4HB0 B;  2OTX A;  3SO6 A;  5C79 A;  2W2X D;  1KZ7 A;  2QKM A;  1K5D B;  1X1F A;  5D27 A;  5D3X A;  1Y5O A;  4MY6 A;  4TYZ A;  3X23 A;  2I5F A;  2ELA A;  1BTK A;  3P6A A;  2K2U A;  2R0D A;  1FHW A;  1J19 A;  3PG7 A;  3G9W A;  1IRS A;  4C0A A;  1U27 A;  2COC A;  4XWX A;  4EJN A;  2YSZ A;  1P5T A;  3MPX A;  2RNR B;  2VRW B;  2CRF A;  1OY2 A;  5HE3 A;  2YS3 A;  1Q67 A;  4KHA A;  1TXD A;  4HAZ B;  3UZT A;  2QKL A;  3BIN A;  2GJY A;  1FGY A;  2P0H A;  2RUK B;  1NI2 A;  4YL8 A;  5DHA B;  1LB1 A;  4DBB A;  4CHM A;  2LG1 A;  2W2W A;  3SV1 A;  2LUL A;  4IOY X; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...