2H7DA

Solution structure of the talin f3 domain in complex with a chimeric beta3 integrin-pip kinase peptide
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
101
structure length
101
Chain Sequence
PLGSGVSFFLVKEKMKGKNKLVPRLLGITKESVMRVDEKTKEVIQEWSLTNIKRWAASPKSFTLDFGDYQDGYYSVQTTEGEQIAQLIAGYIDIILKKKKS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Talin-1
publication title Structural basis of integrin activation by talin
pubmed doi rcsb
source organism Gallus gallus
molecule tags Structural protein
total genus 14
structure length 101
sequence length 101
ec nomenclature
pdb deposition date 2006-06-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 2h7dA00
1H4RA 4TKNA 3VOQA 2Y7BA 3A8QA 3M1IB 1DYNA 2EMTA 2KCJA 4HB2B 2MDXA 2D9WA 2UZRA 4XWXA 3QBVB 2LOXA 2GS0A 2RSGA 1DDWA 2P0FA 3ULBA 2RGNB 2COCA 3X23A 2N0YA 5DI9B 3HW2B 4A6HA 1UNPA 4K81A 4HHVA 4HAUB 4DX8A 1WGQA 3TW1A 1DBHA 1GG3A 2CAYA 2DTCA 2YF0A 4NSWA 2FJLA 4HAYB 3FM8C 1FB8A 3PG7A 2KGXB 2P0HA 5D3WA 3UZTA 3TFMA 5LOPB 2RLOA 3KSYA 4P7IA 1ZC4B 5CLLB 5C5BA 2LOZA 4Y94A 2L2IA 2ROVA 1U5GA 2K2JA 1W1DA 1SGHA 2OTXA 5JHHA 2UVMA 4PNKA 3AU5A 4CYEA 1BTKA 3FEHA 1BWNA 5JHGA 1N3HA 4MT7A 1EAZA 3PVUA 2D11A 2XQNM 5FI0A 1RJ2A 2DN6A 3RCPA 1DDMA 2KUPA 3TO1A 2CY4A 3DXDA 4NY0A 1FGZA 2GCJA 2I5FA 1FAOA 4HAWB 2QKLA 4F7GA 3KRXA 5JLJB 1MK7B 4Z2NA 5D3YA 2ADZA 4ZRJA 1WJ1A 5C16A 4C0AA 2J0MA 3DXEA 2ELBA 1K5GB 3SO6A 1EVHA 1U5FA 2LYDA 2K2UA 1J19A 1BTNA 3PVLA 2DYNA 4F7UP 2RUKB 1X1FA 3LJUX 1MKEA 4MK0A 2GCLA 4HATB 1EF1A 3ODOA 5LONB 5DHFB 1QQGA 5GOWB 1J0WA 3A98B 2COFA 3AU4A 1XCGA 1KZGA 3MDBC 2CRFA 5C6RA 5J3QA 3T06A 1PMSA 2G35A 1U5EA 1IRSA 3PSCA 4HB0B 2OQBA 3WA0A 1GC6A 1P5TA 2PZ1A 1WVHA 2MFQA 2RNRB 1NU2A 3VIAA 5KCVA 2YS1A 3KZ1A 2NZ8B 1UNRA 3GYPA 3CIKA 5J3YA 3QWMA 3KRWA 3HK0A 4GPTB 1U29A 1RRPB 1XX0A 2D9VA 3FSSA 5KQ1A 1EGXA 1ZC3B 3ODXA 2DLWA 4DXAB 1UNQA 2P0DA 2DHJA 2D2QA 3D8FA 1WG7A 2ELAA 2UZSA 4KHOA 1QC6A 1H10A 2YS3A 4K2OA 1V61A 1PLSA 1K5DB 2GJYA 3BINA 2EC1A 2YT0A 4TYZA 4WSFA 5HE3A 5DHAB 4EMOA 1XD4A 2M38A 5D27A 4IFSA 2YSZA 3TVVA 1DDVA 4BBKA 2EMSA 1XODA 5JP4A 1KI1B 1FHWA 3TCAA 4A6FA 3CXBB 1NTYA 5D3VA 1X1GA 1XR0B 3WYFB 2I1KA 2RVBB 1FHXA 4H8SA 1Y5OA 2D10A 2MKRA 4ZRIA 3U7DA 2LKOA 1V89A 2V76A 3N7CA 4YONA 4GXBA 4CHJA 1P3RA 1NI2A 1Z87A 2Q13A 3BJIA 4EJNA 3NSUA 2D4QA 2X18A 2I1JA 4K2PA 5CLQB 2IYBA 2J59M 2J0KA 3HQCA 5FI1A 2DKPA 1UPRA 2D9XA 4D0NB 1OQNA 1DROA 1SHCA 2DX1A 2YRYA 2N23A 3U8ZA 1MIZB 4L6EA 2W2XC 3A8PA 3DXCA 4WJ7A 5HE0A 5KQ4A 1X86A 2Z0PA 4IAPA 1V5PA 2CODA 1P6SA 1WGUA 2D9ZA 4A6KA 2R09A 3OANA 2W2XD 3P7ZA 1TQZA 2COAA 4A5KA 1ZSQA 3ML4A 1MPHA 4KHAA 4YL8A 2Y8FA 2Z0OA 1Y19B 1Q67A 1AWEA 1XKEA 3G9WA 4KAXB 2YVCA 2H7DA 1ISNA 4WVFB 3PP2A 4HAXB 2DX5A 4F7HA 2ROZB 4DBBA 3SYXA 1FHOA 1B55A 5C79A 2H7EA 1MK9B 1I2HA 3P6AA 2DA0A 2HTHB 1PFJA 2P8VA 2J0JA 2K00A 1M7EA 1TXDA 1U27A 4HDOA 3ZDTA 3KY9A 1X11A 3ODWA 5C5BB 1V5UA 2QKMA 4GMVA 2IFSA 5EFXA 2LG1A 4ZRKA 4GN1A 1ZM0A 1TJ6A 2VRWB 2ZPYA 2DHIA 3QIJA 4HB3B 2HE7A 2DFKA 4B6HA 2DKQA 4MY6A 4A6FB 5DIFB 1ZVRA 2L1CA 4Z2MB 2CY5A 4IOYX 1OY2A 1LB1A 2Y8GA 3MPXA 2NMBA 2JP2A 2M14A 1MIXA 4K17A 3D8EA 3F5RA 2EJ8A 3PZDA 1X05A 1NTVA 3GYOA 1AQCA 4HDQA 3PVWA 4GMXB 2YS5A 3V5WA 2DHKA 2YT1A 1V88A 1I7AA 1W1HA 4HAZB 2DYQA 2W2WA 3ZVRA 2VSZA 1MAIA 1U2BA 2D9YA 1FOEA 5HE1A 5J3TA 3F0WA 3SV1A 4CHMA 1LW3A 3PEGA 3IVFA 5L81A 1GC7A 2LULA 2BCJA 4HB4B 5D3XA 2E2XA 3SNHA 1WI1A 2AL6A 4KVGB 1E5WA 4HAVB 1WJMA 1U5DA 1FGYA 5HE2A 1UPQA 2MWNB 3D8DA 1UEFA 4KHBB 4DX90 1M7RA 1OMWA 4EKUA 2VKIA 3AJ4A 2R0DA 2Z0QA 4GZUA 4PQ0A 2AEHA 3SUZA 1BAKA 2I5CA 1V5MA 1W1GA 3ULCA 1KZ7A 5DH9B 3O96A
chains in the Genus database with same CATH superfamily
1H4RA 4TKNA 3VOQA 2Y7BA 3A8QA 3M1IB 1DYNA 2EMTA 2KCJA 4HB2B 3NWAA 2MDXA 2D9WA 2UZRA 4XWXA 3QBVB 2LOXA 2GS0A 3OHMB 2RSGA 1DDWA 2P0FA 3ULBA 2RGNB 2COCA 3X23A 2N0YA 3DCXA 5DI9B 3HW2B 4A6HA 1UNPA 4K81A 4HHVA 4QJ4B 4QXAB 4D6WA 4HAUB 4DX8A 1WGQA 3TW1A 1DBHA 1GG3A 2CAYA 2DTCA 2YF0A 4NSWA 2FJLA 4HAYB 3FM8C 1FB8A 3PG7A 2KGXB 2P0HA 5D3WA 3UZTA 3TFMA 5LOPB 2RLOA 3KSYA 4P7IA 1ZC4B 5CLLB 5C5BA 2LOZA 4Y94A 2L2IA 2ROVA 1U5GA 2K2JA 1W1DA 1SGHA 2OTXA 5JHHA 2UVMA 4PNKA 3AU5A 2Z4DA 4CYEA 1BTKA 3FEHA 1BWNA 5JHGA 1N3HA 4MT7A 1EAZA 3PVUA 2D11A 2XQNM 5FI0A 1RJ2A 2DN6A 3A58A 3RCPA 1DDMA 2KUPA 3TO1A 2CY4A 3DXDA 4NY0A 1FGZA 2GCJA 2I5FA 1FAOA 4HAWB 2QKLA 4F7GA 5IRSA 3KRXA 5JLJB 1MK7B 4Z2NA 5D3YA 2ADZA 4ZRJA 1WJ1A 5C16A 4C0AA 2J0MA 3DXEA 2ELBA 1K5GB 3SO6A 1EVHA 1U5FA 2LYDA 2K2UA 1J19A 1BTNA 3PVLA 2DYNA 4F7UP 2RUKB 1X1FA 3NWDA 3LJUX 1MKEA 4MK0A 2GCLA 4HATB 2Z59A 1EF1A 3ODOA 4GOUA 5LONB 5DHFB 1QQGA 5GOWB 1J0WA 2RRFA 3A98B 2COFA 3AU4A 1XCGA 1KZGA 3MDBC 2CRFA 5C6RA 5J3QA 3T06A 1PMSA 2G35A 1U5EA 1IRSA 3PSCA 4HB0B 2OQBA 4OT1A 3WA0A 1GC6A 1P5TA 2PZ1A 1WVHA 2MFQA 2RNRB 1NU2A 3VIAA 5KCVA 2YS1A 3KZ1A 2NZ8B 1UNRA 3GYPA 4OSNA 4QJ3B 3CIKA 5J3YA 3QWMA 3KRWA 3HK0A 4GPTB 1U29A 3HSAA 1RRPB 1XX0A 2D9VA 3FSSA 5KQ1A 1EGXA 1ZC3B 3ODXA 2DLWA 4DXAB 1UNQA 2P0DA 2DHJA 2D2QA 3D8FA 1WG7A 2ELAA 2UZSA 4KHOA 1QC6A 1H10A 2YS3A 4K2OA 1V61A 1PLSA 2KR0A 1K5DB 2GJYA 3BINA 2EC1A 2YT0A 4TYZA 4WSFA 5HE3A 5DHAB 4EMOA 1XD4A 2M38A 5D27A 4IFSA 2YSZA 3TVVA 1DDVA 4BBKA 2EMSA 1XODA 5JP4A 1KI1B 1FHWA 3TCAA 4A6FA 3CXBB 1NTYA 5I2MA 5D3VA 1X1GA 1XR0B 3WYFB 2I1KA 2RVBB 1FHXA 4H8SA 1Y5OA 2D10A 2MKRA 4ZRIA 3U7DA 2LKOA 1V89A 1ZYIA 2V76A 3N7CA 4YONA 4GXBA 2KIEA 4CHJA 2ZKMX 2KUQA 1P3RA 1NI2A 1Z87A 2Q13A 3BJIA 4GNKB 4EJNA 3NSUA 2D4QA 2X18A 2I1JA 4K2PA 3U12A 1MI1A 5CLQB 2IYBA 2J59M 2J0KA 3HQCA 5FI1A 2DKPA 2K49A 5M4YB 2K8EA 1UPRA 2D9XA 4D0NB 1OQNA 1DROA 1SHCA 2DX1A 2YRYA 2N23A 3U8ZA 1MIZB 4L6EA 2W2XC 3A8PA 3DXCA 4WJ7A 5HE0A 5KQ4A 1X86A 2Z0PA 1T77A 4IAPA 1V5PA 2CODA 5I2SA 1P6SA 1WGUA 2D9ZA 4A6KA 4HSIA 2R09A 2W2XD 3OANA 3P7ZA 1TQZA 2COAA 4A5KA 1ZSQA 3ML4A 1MPHA 4KHAA 4YL8A 2Y8FA 2YT2A 2Z0OA 1Y19B 1Q67A 1AWEA 1XKEA 3G9WA 4KAXB 2YVCA 2H7DA 1ISNA 4WVFB 3PP2A 4HAXB 2DX5A 4F7HA 2ROZB 4DBBA 3SYXA 1FHOA 1B55A 5C79A 2H7EA 4KHBA 1MK9B 1I2HA 3P6AA 2Z14A 2DA0A 2HTHB 1PFJA 2P8VA 2J0JA 2K00A 1M7EA 1TXDA 1U27A 4HDOA 3ZDTA 3KY9A 1X11A 3ODWA 2R2YA 1V5UA 5C5BB 2QKMA 4GMVA 2IFSA 5EFXA 2LG1A 4ZRKA 4GN1A 1ZM0A 1TJ6A 2VRWB 2ZPYA 2DHIA 3QIJA 4HB3B 2HE7A 2DFKA 4B6HA 2DKQA 4MY6A 4A6FB 5DIFB 1ZVRA 2L1CA 4Z2MB 2CY5A 4IOYX 1OY2A 4L1RA 5LG4B 1LB1A 2Y8GA 4DIXA 2NBVA 3MPXA 2NMBA 2JP2A 2M14A 1MIXA 4K17A 3D8EA 3F5RA 2EJ8A 3PZDA 1X05A 4QJ5B 1NTVA 3GYOA 1AQCA 4HDQA 3PVWA 4GMXB 2YS5A 3B77A 3V5WA 2DHKA 2YT1A 1V88A 1I7AA 2FJUB 1W1HA 4HAZB 2DYQA 3FVCA 2W2WA 3ZVRA 2VSZA 1MAIA 2KIGA 1U2BA 2D9YA 3HIEA 1FOEA 5HE1A 5J3TA 3F0WA 3SV1A 4CHMA 1LW3A 2GUMA 3PEGA 3IVFA 5L81A 4CSQA 1GC7A 2LULA 2BCJA 3NWFA 4HB4B 5D3XA 2E2XA 3SNHA 1WI1A 2AL6A 4KVGB 1E5WA 4HAVB 1WJMA 1U5DA 1FGYA 5HE2A 1UPQA 2MWNB 3D8DA 1UEFA 4KHBB 4DX90 2Z13A 1M7RA 1OMWA 4EKUA 2VKIA 3NW8A 3AJ4A 2R0DA 2Z0QA 4GZUA 4PQ0A 2AEHA 3SUZA 1BAKA 2I5CA 1V5MA 1W1GA 3ULCA 1KZ7A 5DH9B 3O96A
chains in the Genus database with same CATH topology
1H4RA 4TKNA 3VOQA 2Y7BA 3A8QA 3M1IB 1DYNA 2EMTA 2KCJA 4HB2B 2MDXA 2D9WA 2UZRA 4XWXA 3QBVB 2LOXA 2GS0A 2RSGA 1DDWA 2P0FA 3ULBA 2RGNB 2COCA 3X23A 2N0YA 5DI9B 3HW2B 4A6HA 1UNPA 4K81A 4HHVA 4HAUB 4DX8A 1WGQA 3TW1A 1DBHA 1GG3A 2CAYA 2DTCA 2YF0A 4NSWA 2FJLA 4HAYB 3FM8C 1FB8A 3PG7A 2KGXB 2P0HA 5D3WA 3UZTA 3TFMA 5LOPB 2RLOA 3KSYA 4P7IA 1ZC4B 5CLLB 5C5BA 2LOZA 4Y94A 2L2IA 2ROVA 1U5GA 2K2JA 1W1DA 1SGHA 2OTXA 5JHHA 2UVMA 4PNKA 3AU5A 4CYEA 1BTKA 3FEHA 1BWNA 5JHGA 1N3HA 4MT7A 1EAZA 3PVUA 2D11A 2XQNM 5FI0A 1RJ2A 2DN6A 3RCPA 1DDMA 2KUPA 3TO1A 2CY4A 3DXDA 4NY0A 1FGZA 2GCJA 2I5FA 1FAOA 4HAWB 2QKLA 4F7GA 3KRXA 5JLJB 1MK7B 4Z2NA 5D3YA 2ADZA 4ZRJA 1WJ1A 5C16A 4C0AA 2J0MA 3DXEA 2ELBA 1K5GB 3SO6A 1EVHA 1U5FA 2LYDA 2K2UA 1J19A 1BTNA 3PVLA 2DYNA 4F7UP 2RUKB 1X1FA 3LJUX 1MKEA 4MK0A 2GCLA 4HATB 1EF1A 3ODOA 5LONB 5DHFB 1QQGA 5GOWB 1J0WA 3A98B 2COFA 3AU4A 1XCGA 1KZGA 3MDBC 2CRFA 5C6RA 5J3QA 3T06A 1PMSA 2G35A 1U5EA 1IRSA 3PSCA 4HB0B 2OQBA 3WA0A 1GC6A 1P5TA 2PZ1A 1WVHA 2MFQA 2RNRB 1NU2A 3VIAA 5KCVA 2YS1A 3KZ1A 2NZ8B 1UNRA 3GYPA 3CIKA 5J3YA 3QWMA 3KRWA 3HK0A 4GPTB 1U29A 1RRPB 1XX0A 2D9VA 3FSSA 5KQ1A 1EGXA 1ZC3B 3ODXA 2DLWA 4DXAB 1UNQA 2P0DA 2DHJA 2D2QA 3D8FA 1WG7A 2ELAA 2UZSA 4KHOA 1QC6A 1H10A 2YS3A 4K2OA 1V61A 1PLSA 1K5DB 2GJYA 3BINA 2EC1A 2YT0A 4TYZA 4WSFA 5HE3A 5DHAB 4EMOA 1XD4A 2M38A 5D27A 4IFSA 2YSZA 3TVVA 1DDVA 4BBKA 2EMSA 1XODA 5JP4A 1KI1B 1FHWA 3TCAA 4A6FA 3CXBB 1NTYA 5D3VA 1X1GA 1XR0B 3WYFB 2I1KA 2RVBB 1FHXA 4H8SA 1Y5OA 2D10A 2MKRA 4ZRIA 3U7DA 2LKOA 1V89A 2V76A 3N7CA 4YONA 4GXBA 4CHJA 1P3RA 1NI2A 1Z87A 2Q13A 3BJIA 4EJNA 3NSUA 2D4QA 2X18A 2I1JA 4K2PA 5CLQB 2IYBA 2J59M 2J0KA 3HQCA 5FI1A 2DKPA 1UPRA 2D9XA 4D0NB 1OQNA 1DROA 1SHCA 2DX1A 2YRYA 2N23A 3U8ZA 1MIZB 4L6EA 2W2XC 3A8PA 3DXCA 4WJ7A 5HE0A 5KQ4A 1X86A 2Z0PA 4IAPA 1V5PA 2CODA 1P6SA 1WGUA 2D9ZA 4A6KA 2R09A 3OANA 2W2XD 3P7ZA 1TQZA 2COAA 4A5KA 1ZSQA 3ML4A 1MPHA 4KHAA 4YL8A 2Y8FA 2Z0OA 1Y19B 1Q67A 1AWEA 1XKEA 3G9WA 4KAXB 2YVCA 2H7DA 1ISNA 4WVFB 3PP2A 4HAXB 2DX5A 4F7HA 2ROZB 4DBBA 3SYXA 1FHOA 1B55A 5C79A 2H7EA 1MK9B 1I2HA 3P6AA 2DA0A 2HTHB 1PFJA 2P8VA 2J0JA 2K00A 1M7EA 1TXDA 1U27A 4HDOA 3ZDTA 3KY9A 1X11A 3ODWA 5C5BB 1V5UA 2QKMA 4GMVA 2IFSA 5EFXA 2LG1A 4ZRKA 4GN1A 1ZM0A 1TJ6A 2VRWB 2ZPYA 2DHIA 3QIJA 4HB3B 2HE7A 2DFKA 4B6HA 2DKQA 4MY6A 4A6FB 5DIFB 1ZVRA 2L1CA 4Z2MB 2CY5A 4IOYX 1OY2A 1LB1A 2Y8GA 3MPXA 2NMBA 2JP2A 2M14A 1MIXA 4K17A 3D8EA 3F5RA 2EJ8A 3PZDA 1X05A 1NTVA 3GYOA 1AQCA 4HDQA 3PVWA 4GMXB 2YS5A 3V5WA 2DHKA 2YT1A 1V88A 1I7AA 1W1HA 4HAZB 2DYQA 2W2WA 3ZVRA 2VSZA 1MAIA 1U2BA 2D9YA 1FOEA 5HE1A 5J3TA 3F0WA 3SV1A 4CHMA 1LW3A 3PEGA 3IVFA 5L81A 1GC7A 2LULA 2BCJA 4HB4B 5D3XA 2E2XA 3SNHA 1WI1A 2AL6A 4KVGB 1E5WA 4HAVB 1WJMA 1U5DA 1FGYA 5HE2A 1UPQA 2MWNB 3D8DA 1UEFA 4KHBB 4DX90 1M7RA 1OMWA 4EKUA 2VKIA 3AJ4A 2R0DA 2Z0QA 4GZUA 4PQ0A 2AEHA 3SUZA 1BAKA 2I5CA 1V5MA 1W1GA 3ULCA 1KZ7A 5DH9B 3O96A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1H4R A;  4TKN A;  3VOQ A;  2Y7B A;  3A8Q A;  3M1I B;  1DYN A;  2EMT A;  2KCJ A;  4HB2 B;  2MDX A;  2D9W A;  2UZR A;  4XWX A;  3QBV B;  2LOX A;  2GS0 A;  2RSG A;  1DDW A;  2P0F A;  3ULB A;  2RGN B;  2COC A;  3X23 A;  2N0Y A;  5DI9 B;  3HW2 B;  4A6H A;  1UNP A;  4K81 A;  4HHV A;  4HAU B;  4DX8 A;  1WGQ A;  3TW1 A;  1DBH A;  1GG3 A;  2CAY A;  2DTC A;  2YF0 A;  4NSW A;  2FJL A;  4HAY B;  3FM8 C;  1FB8 A;  3PG7 A;  2KGX B;  2P0H A;  5D3W A;  3UZT A;  3TFM A;  5LOP B;  2RLO A;  3KSY A;  4P7I A;  1ZC4 B;  5CLL B;  5C5B A;  2LOZ A;  4Y94 A;  2L2I A;  2ROV A;  1U5G A;  2K2J A;  1W1D A;  1SGH A;  2OTX A;  5JHH A;  2UVM A;  4PNK A;  3AU5 A;  4CYE A;  1BTK A;  3FEH A;  1BWN A;  5JHG A;  1N3H A;  4MT7 A;  1EAZ A;  3PVU A;  2D11 A;  2XQN M;  5FI0 A;  1RJ2 A;  2DN6 A;  3RCP A;  1DDM A;  2KUP A;  3TO1 A;  2CY4 A;  3DXD A;  4NY0 A;  1FGZ A;  2GCJ A;  2I5F A;  1FAO A;  4HAW B;  2QKL A;  4F7G A;  3KRX A;  5JLJ B;  1MK7 B;  4Z2N A;  5D3Y A;  2ADZ A;  4ZRJ A;  1WJ1 A;  5C16 A;  4C0A A;  2J0M A;  3DXE A;  2ELB A;  1K5G B;  3SO6 A;  1EVH A;  1U5F A;  2LYD A;  2K2U A;  1J19 A;  1BTN A;  3PVL A;  2DYN A;  4F7U P;  2RUK B;  1X1F A;  3LJU X;  1MKE A;  4MK0 A;  2GCL A;  4HAT B;  1EF1 A;  3ODO A;  5LON B;  5DHF B;  1QQG A;  5GOW B;  1J0W A;  3A98 B;  2COF A;  3AU4 A;  1XCG A;  1KZG A;  3MDB C;  2CRF A;  5C6R A;  5J3Q A;  3T06 A;  1PMS A;  2G35 A;  1U5E A;  1IRS A;  3PSC A;  4HB0 B;  2OQB A;  3WA0 A;  1GC6 A;  1P5T A;  2PZ1 A;  1WVH A;  2MFQ A;  2RNR B;  1NU2 A;  3VIA A;  5KCV A;  2YS1 A;  3KZ1 A;  2NZ8 B;  1UNR A;  3GYP A;  3CIK A;  5J3Y A;  3QWM A;  3KRW A;  3HK0 A;  4GPT B;  1U29 A;  1RRP B;  1XX0 A;  2D9V A;  3FSS A;  5KQ1 A;  1EGX A;  1ZC3 B;  3ODX A;  2DLW A;  4DXA B;  1UNQ A;  2P0D A;  2DHJ A;  2D2Q A;  3D8F A;  1WG7 A;  2ELA A;  2UZS A;  4KHO A;  1QC6 A;  1H10 A;  2YS3 A;  4K2O A;  1V61 A;  1PLS A;  1K5D B;  2GJY A;  3BIN A;  2EC1 A;  2YT0 A;  4TYZ A;  4WSF A;  5HE3 A;  5DHA B;  4EMO A;  1XD4 A;  2M38 A;  5D27 A;  4IFS A;  2YSZ A;  3TVV A;  1DDV A;  4BBK A;  2EMS A;  1XOD A;  5JP4 A;  1KI1 B;  1FHW A;  3TCA A;  4A6F A;  3CXB B;  1NTY A;  5D3V A;  1X1G A;  1XR0 B;  3WYF B;  2I1K A;  2RVB B;  1FHX A;  4H8S A;  1Y5O A;  2D10 A;  2MKR A;  4ZRI A;  3U7D A;  2LKO A;  1V89 A;  2V76 A;  3N7C A;  4YON A;  4GXB A;  4CHJ A;  1P3R A;  1NI2 A;  1Z87 A;  2Q13 A;  3BJI A;  4EJN A;  3NSU A;  2D4Q A;  2X18 A;  2I1J A;  4K2P A;  5CLQ B;  2IYB A;  2J59 M;  2J0K A;  3HQC A;  5FI1 A;  2DKP A;  1UPR A;  2D9X A;  4D0N B;  1OQN A;  1DRO A;  1SHC A;  2DX1 A;  2YRY A;  2N23 A;  3U8Z A;  1MIZ B;  4L6E A;  2W2X C;  3A8P A;  3DXC A;  4WJ7 A;  5HE0 A;  5KQ4 A;  1X86 A;  2Z0P A;  4IAP A;  1V5P A;  2COD A;  1P6S A;  1WGU A;  2D9Z A;  4A6K A;  2R09 A;  3OAN A;  2W2X D;  3P7Z A;  1TQZ A;  2COA A;  4A5K A;  1ZSQ A;  3ML4 A;  1MPH A;  4KHA A;  4YL8 A;  2Y8F A;  2Z0O A;  1Y19 B;  1Q67 A;  1AWE A;  1XKE A;  3G9W A;  4KAX B;  2YVC A;  2H7D A;  1ISN A;  4WVF B;  3PP2 A;  4HAX B;  2DX5 A;  4F7H A;  2ROZ B;  4DBB A;  3SYX A;  1FHO A;  1B55 A;  5C79 A;  2H7E A;  1MK9 B;  1I2H A;  3P6A A;  2DA0 A;  2HTH B;  1PFJ A;  2P8V A;  2J0J A;  2K00 A;  1M7E A;  1TXD A;  1U27 A;  4HDO A;  3ZDT A;  3KY9 A;  1X11 A;  3ODW A;  5C5B B;  1V5U A;  2QKM A;  4GMV A;  2IFS A;  5EFX A;  2LG1 A;  4ZRK A;  4GN1 A;  1ZM0 A;  1TJ6 A;  2VRW B;  2ZPY A;  2DHI A;  3QIJ A;  4HB3 B;  2HE7 A;  2DFK A;  4B6H A;  2DKQ A;  4MY6 A;  4A6F B;  5DIF B;  1ZVR A;  2L1C A;  4Z2M B;  2CY5 A;  4IOY X;  1OY2 A;  1LB1 A;  2Y8G A;  3MPX A;  2NMB A;  2JP2 A;  2M14 A;  1MIX A;  4K17 A;  3D8E A;  3F5R A;  2EJ8 A;  3PZD A;  1X05 A;  1NTV A;  3GYO A;  1AQC A;  4HDQ A;  3PVW A;  4GMX B;  2YS5 A;  3V5W A;  2DHK A;  2YT1 A;  1V88 A;  1I7A A;  1W1H A;  4HAZ B;  2DYQ A;  2W2W A;  3ZVR A;  2VSZ A;  1MAI A;  1U2B A;  2D9Y A;  1FOE A;  5HE1 A;  5J3T A;  3F0W A;  3SV1 A;  4CHM A;  1LW3 A;  3PEG A;  3IVF A;  5L81 A;  1GC7 A;  2LUL A;  2BCJ A;  4HB4 B;  5D3X A;  2E2X A;  3SNH A;  1WI1 A;  2AL6 A;  4KVG B;  1E5W A;  4HAV B;  1WJM A;  1U5D A;  1FGY A;  5HE2 A;  1UPQ A;  2MWN B;  3D8D A;  1UEF A;  4KHB B;  4DX9 0;  1M7R A;  1OMW A;  4EKU A;  2VKI A;  3AJ4 A;  2R0D A;  2Z0Q A;  4GZU A;  4PQ0 A;  2AEH A;  3SUZ A;  1BAK A;  2I5C A;  1V5M A;  1W1G A;  3ULC A;  1KZ7 A;  5DH9 B;  3O96 A; 
#chains in the Genus database with same CATH topology
 1H4R A;  4TKN A;  3VOQ A;  2Y7B A;  3A8Q A;  3M1I B;  1DYN A;  2EMT A;  2KCJ A;  4HB2 B;  3NWA A;  2MDX A;  2D9W A;  2UZR A;  4XWX A;  3QBV B;  2LOX A;  2GS0 A;  3OHM B;  2RSG A;  1DDW A;  2P0F A;  3ULB A;  2RGN B;  2COC A;  3X23 A;  2N0Y A;  3DCX A;  5DI9 B;  3HW2 B;  4A6H A;  1UNP A;  4K81 A;  4HHV A;  4QJ4 B;  4QXA B;  4D6W A;  4HAU B;  4DX8 A;  1WGQ A;  3TW1 A;  1DBH A;  1GG3 A;  2CAY A;  2DTC A;  2YF0 A;  4NSW A;  2FJL A;  4HAY B;  3FM8 C;  1FB8 A;  3PG7 A;  2KGX B;  2P0H A;  5D3W A;  3UZT A;  3TFM A;  5LOP B;  2RLO A;  3KSY A;  4P7I A;  1ZC4 B;  5CLL B;  5C5B A;  2LOZ A;  4Y94 A;  2L2I A;  2ROV A;  1U5G A;  2K2J A;  1W1D A;  1SGH A;  2OTX A;  5JHH A;  2UVM A;  4PNK A;  3AU5 A;  2Z4D A;  4CYE A;  1BTK A;  3FEH A;  1BWN A;  5JHG A;  1N3H A;  4MT7 A;  1EAZ A;  3PVU A;  2D11 A;  2XQN M;  5FI0 A;  1RJ2 A;  2DN6 A;  3A58 A;  3RCP A;  1DDM A;  2KUP A;  3TO1 A;  2CY4 A;  3DXD A;  4NY0 A;  1FGZ A;  2GCJ A;  2I5F A;  1FAO A;  4HAW B;  2QKL A;  4F7G A;  5IRS A;  3KRX A;  5JLJ B;  1MK7 B;  4Z2N A;  5D3Y A;  2ADZ A;  4ZRJ A;  1WJ1 A;  5C16 A;  4C0A A;  2J0M A;  3DXE A;  2ELB A;  1K5G B;  3SO6 A;  1EVH A;  1U5F A;  2LYD A;  2K2U A;  1J19 A;  1BTN A;  3PVL A;  2DYN A;  4F7U P;  2RUK B;  1X1F A;  3NWD A;  3LJU X;  1MKE A;  4MK0 A;  2GCL A;  4HAT B;  2Z59 A;  1EF1 A;  3ODO A;  4GOU A;  5LON B;  5DHF B;  1QQG A;  5GOW B;  1J0W A;  2RRF A;  3A98 B;  2COF A;  3AU4 A;  1XCG A;  1KZG A;  3MDB C;  2CRF A;  5C6R A;  5J3Q A;  3T06 A;  1PMS A;  2G35 A;  1U5E A;  1IRS A;  3PSC A;  4HB0 B;  2OQB A;  4OT1 A;  3WA0 A;  1GC6 A;  1P5T A;  2PZ1 A;  1WVH A;  2MFQ A;  2RNR B;  1NU2 A;  3VIA A;  5KCV A;  2YS1 A;  3KZ1 A;  2NZ8 B;  1UNR A;  3GYP A;  4OSN A;  4QJ3 B;  3CIK A;  5J3Y A;  3QWM A;  3KRW A;  3HK0 A;  4GPT B;  1U29 A;  3HSA A;  1RRP B;  1XX0 A;  2D9V A;  3FSS A;  5KQ1 A;  1EGX A;  1ZC3 B;  3ODX A;  2DLW A;  4DXA B;  1UNQ A;  2P0D A;  2DHJ A;  2D2Q A;  3D8F A;  1WG7 A;  2ELA A;  2UZS A;  4KHO A;  1QC6 A;  1H10 A;  2YS3 A;  4K2O A;  1V61 A;  1PLS A;  2KR0 A;  1K5D B;  2GJY A;  3BIN A;  2EC1 A;  2YT0 A;  4TYZ A;  4WSF A;  5HE3 A;  5DHA B;  4EMO A;  1XD4 A;  2M38 A;  5D27 A;  4IFS A;  2YSZ A;  3TVV A;  1DDV A;  4BBK A;  2EMS A;  1XOD A;  5JP4 A;  1KI1 B;  1FHW A;  3TCA A;  4A6F A;  3CXB B;  1NTY A;  5I2M A;  5D3V A;  1X1G A;  1XR0 B;  3WYF B;  2I1K A;  2RVB B;  1FHX A;  4H8S A;  1Y5O A;  2D10 A;  2MKR A;  4ZRI A;  3U7D A;  2LKO A;  1V89 A;  1ZYI A;  2V76 A;  3N7C A;  4YON A;  4GXB A;  2KIE A;  4CHJ A;  2ZKM X;  2KUQ A;  1P3R A;  1NI2 A;  1Z87 A;  2Q13 A;  3BJI A;  4GNK B;  4EJN A;  3NSU A;  2D4Q A;  2X18 A;  2I1J A;  4K2P A;  3U12 A;  1MI1 A;  5CLQ B;  2IYB A;  2J59 M;  2J0K A;  3HQC A;  5FI1 A;  2DKP A;  2K49 A;  5M4Y B;  2K8E A;  1UPR A;  2D9X A;  4D0N B;  1OQN A;  1DRO A;  1SHC A;  2DX1 A;  2YRY A;  2N23 A;  3U8Z A;  1MIZ B;  4L6E A;  2W2X C;  3A8P A;  3DXC A;  4WJ7 A;  5HE0 A;  5KQ4 A;  1X86 A;  2Z0P A;  1T77 A;  4IAP A;  1V5P A;  2COD A;  5I2S A;  1P6S A;  1WGU A;  2D9Z A;  4A6K A;  4HSI A;  2R09 A;  2W2X D;  3OAN A;  3P7Z A;  1TQZ A;  2COA A;  4A5K A;  1ZSQ A;  3ML4 A;  1MPH A;  4KHA A;  4YL8 A;  2Y8F A;  2YT2 A;  2Z0O A;  1Y19 B;  1Q67 A;  1AWE A;  1XKE A;  3G9W A;  4KAX B;  2YVC A;  2H7D A;  1ISN A;  4WVF B;  3PP2 A;  4HAX B;  2DX5 A;  4F7H A;  2ROZ B;  4DBB A;  3SYX A;  1FHO A;  1B55 A;  5C79 A;  2H7E A;  4KHB A;  1MK9 B;  1I2H A;  3P6A A;  2Z14 A;  2DA0 A;  2HTH B;  1PFJ A;  2P8V A;  2J0J A;  2K00 A;  1M7E A;  1TXD A;  1U27 A;  4HDO A;  3ZDT A;  3KY9 A;  1X11 A;  3ODW A;  2R2Y A;  1V5U A;  5C5B B;  2QKM A;  4GMV A;  2IFS A;  5EFX A;  2LG1 A;  4ZRK A;  4GN1 A;  1ZM0 A;  1TJ6 A;  2VRW B;  2ZPY A;  2DHI A;  3QIJ A;  4HB3 B;  2HE7 A;  2DFK A;  4B6H A;  2DKQ A;  4MY6 A;  4A6F B;  5DIF B;  1ZVR A;  2L1C A;  4Z2M B;  2CY5 A;  4IOY X;  1OY2 A;  4L1R A;  5LG4 B;  1LB1 A;  2Y8G A;  4DIX A;  2NBV A;  3MPX A;  2NMB A;  2JP2 A;  2M14 A;  1MIX A;  4K17 A;  3D8E A;  3F5R A;  2EJ8 A;  3PZD A;  1X05 A;  4QJ5 B;  1NTV A;  3GYO A;  1AQC A;  4HDQ A;  3PVW A;  4GMX B;  2YS5 A;  3B77 A;  3V5W A;  2DHK A;  2YT1 A;  1V88 A;  1I7A A;  2FJU B;  1W1H A;  4HAZ B;  2DYQ A;  3FVC A;  2W2W A;  3ZVR A;  2VSZ A;  1MAI A;  2KIG A;  1U2B A;  2D9Y A;  3HIE A;  1FOE A;  5HE1 A;  5J3T A;  3F0W A;  3SV1 A;  4CHM A;  1LW3 A;  2GUM A;  3PEG A;  3IVF A;  5L81 A;  4CSQ A;  1GC7 A;  2LUL A;  2BCJ A;  3NWF A;  4HB4 B;  5D3X A;  2E2X A;  3SNH A;  1WI1 A;  2AL6 A;  4KVG B;  1E5W A;  4HAV B;  1WJM A;  1U5D A;  1FGY A;  5HE2 A;  1UPQ A;  2MWN B;  3D8D A;  1UEF A;  4KHB B;  4DX9 0;  2Z13 A;  1M7R A;  1OMW A;  4EKU A;  2VKI A;  3NW8 A;  3AJ4 A;  2R0D A;  2Z0Q A;  4GZU A;  4PQ0 A;  2AEH A;  3SUZ A;  1BAK A;  2I5C A;  1V5M A;  1W1G A;  3ULC A;  1KZ7 A;  5DH9 B;  3O96 A; 
#chains in the Genus database with same CATH homology
 1H4R A;  4TKN A;  3VOQ A;  2Y7B A;  3A8Q A;  3M1I B;  1DYN A;  2EMT A;  2KCJ A;  4HB2 B;  2MDX A;  2D9W A;  2UZR A;  4XWX A;  3QBV B;  2LOX A;  2GS0 A;  2RSG A;  1DDW A;  2P0F A;  3ULB A;  2RGN B;  2COC A;  3X23 A;  2N0Y A;  5DI9 B;  3HW2 B;  4A6H A;  1UNP A;  4K81 A;  4HHV A;  4HAU B;  4DX8 A;  1WGQ A;  3TW1 A;  1DBH A;  1GG3 A;  2CAY A;  2DTC A;  2YF0 A;  4NSW A;  2FJL A;  4HAY B;  3FM8 C;  1FB8 A;  3PG7 A;  2KGX B;  2P0H A;  5D3W A;  3UZT A;  3TFM A;  5LOP B;  2RLO A;  3KSY A;  4P7I A;  1ZC4 B;  5CLL B;  5C5B A;  2LOZ A;  4Y94 A;  2L2I A;  2ROV A;  1U5G A;  2K2J A;  1W1D A;  1SGH A;  2OTX A;  5JHH A;  2UVM A;  4PNK A;  3AU5 A;  4CYE A;  1BTK A;  3FEH A;  1BWN A;  5JHG A;  1N3H A;  4MT7 A;  1EAZ A;  3PVU A;  2D11 A;  2XQN M;  5FI0 A;  1RJ2 A;  2DN6 A;  3RCP A;  1DDM A;  2KUP A;  3TO1 A;  2CY4 A;  3DXD A;  4NY0 A;  1FGZ A;  2GCJ A;  2I5F A;  1FAO A;  4HAW B;  2QKL A;  4F7G A;  3KRX A;  5JLJ B;  1MK7 B;  4Z2N A;  5D3Y A;  2ADZ A;  4ZRJ A;  1WJ1 A;  5C16 A;  4C0A A;  2J0M A;  3DXE A;  2ELB A;  1K5G B;  3SO6 A;  1EVH A;  1U5F A;  2LYD A;  2K2U A;  1J19 A;  1BTN A;  3PVL A;  2DYN A;  4F7U P;  2RUK B;  1X1F A;  3LJU X;  1MKE A;  4MK0 A;  2GCL A;  4HAT B;  1EF1 A;  3ODO A;  5LON B;  5DHF B;  1QQG A;  5GOW B;  1J0W A;  3A98 B;  2COF A;  3AU4 A;  1XCG A;  1KZG A;  3MDB C;  2CRF A;  5C6R A;  5J3Q A;  3T06 A;  1PMS A;  2G35 A;  1U5E A;  1IRS A;  3PSC A;  4HB0 B;  2OQB A;  3WA0 A;  1GC6 A;  1P5T A;  2PZ1 A;  1WVH A;  2MFQ A;  2RNR B;  1NU2 A;  3VIA A;  5KCV A;  2YS1 A;  3KZ1 A;  2NZ8 B;  1UNR A;  3GYP A;  3CIK A;  5J3Y A;  3QWM A;  3KRW A;  3HK0 A;  4GPT B;  1U29 A;  1RRP B;  1XX0 A;  2D9V A;  3FSS A;  5KQ1 A;  1EGX A;  1ZC3 B;  3ODX A;  2DLW A;  4DXA B;  1UNQ A;  2P0D A;  2DHJ A;  2D2Q A;  3D8F A;  1WG7 A;  2ELA A;  2UZS A;  4KHO A;  1QC6 A;  1H10 A;  2YS3 A;  4K2O A;  1V61 A;  1PLS A;  1K5D B;  2GJY A;  3BIN A;  2EC1 A;  2YT0 A;  4TYZ A;  4WSF A;  5HE3 A;  5DHA B;  4EMO A;  1XD4 A;  2M38 A;  5D27 A;  4IFS A;  2YSZ A;  3TVV A;  1DDV A;  4BBK A;  2EMS A;  1XOD A;  5JP4 A;  1KI1 B;  1FHW A;  3TCA A;  4A6F A;  3CXB B;  1NTY A;  5D3V A;  1X1G A;  1XR0 B;  3WYF B;  2I1K A;  2RVB B;  1FHX A;  4H8S A;  1Y5O A;  2D10 A;  2MKR A;  4ZRI A;  3U7D A;  2LKO A;  1V89 A;  2V76 A;  3N7C A;  4YON A;  4GXB A;  4CHJ A;  1P3R A;  1NI2 A;  1Z87 A;  2Q13 A;  3BJI A;  4EJN A;  3NSU A;  2D4Q A;  2X18 A;  2I1J A;  4K2P A;  5CLQ B;  2IYB A;  2J59 M;  2J0K A;  3HQC A;  5FI1 A;  2DKP A;  1UPR A;  2D9X A;  4D0N B;  1OQN A;  1DRO A;  1SHC A;  2DX1 A;  2YRY A;  2N23 A;  3U8Z A;  1MIZ B;  4L6E A;  2W2X C;  3A8P A;  3DXC A;  4WJ7 A;  5HE0 A;  5KQ4 A;  1X86 A;  2Z0P A;  4IAP A;  1V5P A;  2COD A;  1P6S A;  1WGU A;  2D9Z A;  4A6K A;  2R09 A;  3OAN A;  2W2X D;  3P7Z A;  1TQZ A;  2COA A;  4A5K A;  1ZSQ A;  3ML4 A;  1MPH A;  4KHA A;  4YL8 A;  2Y8F A;  2Z0O A;  1Y19 B;  1Q67 A;  1AWE A;  1XKE A;  3G9W A;  4KAX B;  2YVC A;  2H7D A;  1ISN A;  4WVF B;  3PP2 A;  4HAX B;  2DX5 A;  4F7H A;  2ROZ B;  4DBB A;  3SYX A;  1FHO A;  1B55 A;  5C79 A;  2H7E A;  1MK9 B;  1I2H A;  3P6A A;  2DA0 A;  2HTH B;  1PFJ A;  2P8V A;  2J0J A;  2K00 A;  1M7E A;  1TXD A;  1U27 A;  4HDO A;  3ZDT A;  3KY9 A;  1X11 A;  3ODW A;  5C5B B;  1V5U A;  2QKM A;  4GMV A;  2IFS A;  5EFX A;  2LG1 A;  4ZRK A;  4GN1 A;  1ZM0 A;  1TJ6 A;  2VRW B;  2ZPY A;  2DHI A;  3QIJ A;  4HB3 B;  2HE7 A;  2DFK A;  4B6H A;  2DKQ A;  4MY6 A;  4A6F B;  5DIF B;  1ZVR A;  2L1C A;  4Z2M B;  2CY5 A;  4IOY X;  1OY2 A;  1LB1 A;  2Y8G A;  3MPX A;  2NMB A;  2JP2 A;  2M14 A;  1MIX A;  4K17 A;  3D8E A;  3F5R A;  2EJ8 A;  3PZD A;  1X05 A;  1NTV A;  3GYO A;  1AQC A;  4HDQ A;  3PVW A;  4GMX B;  2YS5 A;  3V5W A;  2DHK A;  2YT1 A;  1V88 A;  1I7A A;  1W1H A;  4HAZ B;  2DYQ A;  2W2W A;  3ZVR A;  2VSZ A;  1MAI A;  1U2B A;  2D9Y A;  1FOE A;  5HE1 A;  5J3T A;  3F0W A;  3SV1 A;  4CHM A;  1LW3 A;  3PEG A;  3IVF A;  5L81 A;  1GC7 A;  2LUL A;  2BCJ A;  4HB4 B;  5D3X A;  2E2X A;  3SNH A;  1WI1 A;  2AL6 A;  4KVG B;  1E5W A;  4HAV B;  1WJM A;  1U5D A;  1FGY A;  5HE2 A;  1UPQ A;  2MWN B;  3D8D A;  1UEF A;  4KHB B;  4DX9 0;  1M7R A;  1OMW A;  4EKU A;  2VKI A;  3AJ4 A;  2R0D A;  2Z0Q A;  4GZU A;  4PQ0 A;  2AEH A;  3SUZ A;  1BAK A;  2I5C A;  1V5M A;  1W1G A;  3ULC A;  1KZ7 A;  5DH9 B;  3O96 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...