2H7FX

Structure of variola topoisomerase covalently bound to dna
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
314
structure length
313
Chain Sequence
MRALFYKDGKLFTDNNFLNPVSDNNPAYEVLQHVKIPTHLTDVVVYGQTWEEALTRLIFVGSDSKGRRQYFYGKMHVQNRNAKRDRIFVRVYNVMKRINSFINKNIKKSSTDSNYQLAVFMLMETMFFIRFGKMKYLKENETVGLLTLKNKHIEISPDKIVIKFVGKDKVSHEFVVHKSNRLYKPLLKLTDDSSPEEFLFNKLSERKVYESIKQFGIRIKDLRTYGVNYTFLYNFWTNVKSISPLPSPKKLIALTIKQTAEVVGHTPSISKRAMATTILEMVKDKNFLDVVSKTTFDEFLSIVVDHVKSSTDG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for specificity in the poxvirus topoisomerase.
pubmed doi rcsb
source organism Variola virus
molecule tags Isomerase/dna
molecule keywords 5'-D(*TP*TP*GP*TP*CP*GP*CP*CP*CP*TP*T)-3'
total genus 97
structure length 313
sequence length 314
ec nomenclature ec 5.99.1.2: Transferred entry: 5.6.2.2.
pdb deposition date 2006-06-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
X PF01028 Topoisom_I Eukaryotic DNA topoisomerase I, catalytic core
X PF09266 VirDNA-topo-I_N Viral DNA topoisomerase I, N-terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.66.10 Alpha Beta 2-Layer Sandwich Viral Topoisomerase I DNA topoisomerase I domain 2h7fX01
3.90.15.10 Alpha Beta Alpha-Beta Complex Topoisomerase I; Chain A, domain 3 Topoisomerase I; Chain A, domain 3 2h7fX02
1RRJA 1A35A 1SEUA 1RR8C 1A36A 1LPQA 1VCCA 1R49A 2H7FX 2B9SA 1TL8A 2F4QA 1A31A 1SC7A 1K4SA 1A41A 2H7GX 1T8IA 3M4AA 1NH3A 3IGCA 1EJ9A 1K4TA
chains in the Genus database with same CATH superfamily
1RRJA 1A35A 1SEUA 1RR8C 1A36A 1LPQA 1VCCA 1R49A 2H7FX 2B9SA 1TL8A 2F4QA 1A31A 1SC7A 1K4SA 1A41A 2H7GX 1T8IA 3M4AA 1NH3A 3IGCA 1EJ9A 1K4TA
chains in the Genus database with same CATH topology
1RRJA 1A35A 1SEUA 1RR8C 1A36A 1LPQA 1VCCA 1R49A 2H7FX 2B9SA 1TL8A 2F4QA 1A31A 1SC7A 1K4SA 1A41A 2H7GX 1T8IA 3M4AA 1NH3A 3IGCA 1EJ9A 1K4TA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1RRJ A;  1A35 A;  1SEU A;  1RR8 C;  1A36 A;  1LPQ A;  1VCC A;  1R49 A;  2H7F X;  2B9S A;  1TL8 A;  2F4Q A;  1A31 A;  1SC7 A;  1K4S A;  1A41 A;  2H7G X;  1T8I A;  3M4A A;  1NH3 A;  3IGC A;  1EJ9 A;  1K4T A; 
#chains in the Genus database with same CATH topology
 1RRJ A;  1A35 A;  1SEU A;  1RR8 C;  1A36 A;  1LPQ A;  1VCC A;  1R49 A;  2H7F X;  2B9S A;  1TL8 A;  2F4Q A;  1A31 A;  1SC7 A;  1K4S A;  1A41 A;  2H7G X;  1T8I A;  3M4A A;  1NH3 A;  3IGC A;  1EJ9 A;  1K4T A; 
#chains in the Genus database with same CATH homology
 1RRJ A;  1A35 A;  1SEU A;  1RR8 C;  1A36 A;  1LPQ A;  1VCC A;  1R49 A;  2H7F X;  2B9S A;  1TL8 A;  2F4Q A;  1A31 A;  1SC7 A;  1K4S A;  1A41 A;  2H7G X;  1T8I A;  3M4A A;  1NH3 A;  3IGC A;  1EJ9 A;  1K4T A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...