2H7VA

Co-crystal structure of ypka-rac1
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
182
structure length
182
Chain Sequence
b'GSKLMQAIKCVVVGDGAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVMVDGKPVNLGLWDTAGQEDYDRLRPLSYPQTDVSLICFSLVSPASFENVRAKWYPEVRHHCPNTPIILVGTKLDLRDDKDTIEKLKEKKLTPITYPQGLAMAKEIGAVKYLECSALTQRGLKTVFDEAIRAVLC'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Migration-inducing protein 5
publication title Yersinia virulence depends on mimicry of host rho-family nucleotide dissociation inhibitors.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
total genus 58
structure length 182
sequence length 182
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-06-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2h7vA00
1P3JA 1P9WA 3MRSA 1W36C 3W8NA 2D4HA 3MSXA 4Q9IA 5DH9A 3DHWC 3GP8A 3U44A 4PAOA 2ZYVX 1R8QA 5CYPA 5GJCA 4A2WA 4TYWA 2WIAA 1R7RA 3ZS9A 1JNYA 4NPHA 1UKZA 4BZQA 2QN6A 1ZW6A 3ONWA 4Q19A 2HJGA 1E2DA 4B48A 5C18A 4C7OA 2EWWA 1NMZA 3DKVA 2BBSA 5FBRB 5FTNA 4AYXA 2CEAA 2IHBA 3B1YA 1MR3F 3HYTA 3I3SR 4A2QA 1LTQA 4HB2A 1Q0UA 4KSBA 1ZM7A 4H1VA 4HATA 3ZZTA 4RCYA 2XB4A 2VP6A 4LV8B 2D7CA 5JS7A 5KTYA 1DE0A 2RGBA 4LHYA 1SXJE 4HZUB 2QBYA 2AFIE 3BORA 4HAWA 4BUJA 1AZTA 3EZ9A 2W0MA 2E87A 2ZIAA 2RKOA 1JBKA 2YYZA 1E98A 1XTIA 1P2VA 5FBLB 3MJRA 4C0KA 5CIWA 1P75A 3UXMA 2G77B 2NOAA 2QRZA 3QKSA 4DT1A 1OXTA 1NSTA 5FOWA 1T91A 4EPWA 4UJ3A 4A82A 3QPWA 1JEDA 2ZRBA 2BV3A 3LRPA 3KXIA 1G8FA 4Q03A 1GTVA 1VYUA 5CIQA 2J0SA 3U7HB 4RZUA 3PENA 2W58A 4TLCA 3EZ6A 4NCHA 4X8HA 4Q00A 1Q3HA 4TLAA 2DR3A 1DADA 3TR0A 2OCYC 5DYGA 4NCKA 5BYKA 4AKEA 5EJEA 4JJZA 3QVUA 4W5WA 3KX2A 2C9OA 2CJWB 2ODWA 2OFXA 4WOPA 5EXTA 1P72A 2HLDD 3CPEA 5EP2A 1E9FA 3THYB 4LOAA 2O8BB 3QF7A 1X8LA 1AKEA 1E1QA 1GAJA 4ESVA 4P32A 3BFKA 3B9QA 4JYBA 4KYIB 3FVQA 4KBFA 4D4MA 1NN3A 2IEYA 2DWPA 4NP6A 2HCBA 5EP3A 2O0JA 4PSVA 1GNPA 1HY3A 3GFPA 4ESHA 2ONJA 4TLDA 1DVRA 4CZ2A 4K81B 4EKDA 2QTVB 5AK0A 2CHGA 3EG5A 4FD2A 1SKYB 2YVUA 1G64A 4F91B 2IBMA 3THOA 3QENA 2O8FA 5JJKA 5EZ5A 1Z6YA 2CLCX 1XEXB 3AF2A 2C2HA 1E32A 2JASA 5BWMA 4O3MA 2ZSBA 2GWHA 3X1YA 3KB1A 1RW4A 2FSFA 1TQ4A 4BFVA 1MKYA 1US8A 1E0KA 1QHHB 2PBRA 3GMTA 1UDWA 2XNDD 3RRMA 4LHVA 2FZ4A 1OXXK 4EFLA 2HYDA 3VKWA 4DUGD 4GI7A 1E2PA 1CU1A 1G3RA 4QJ3A 3A4MA 1COWD 3SNHA 1FZQA 1YZGA 4LI0A 2HT1A 1VIAA 2EVWX 3Q7PA 5FOUA 3A1UA 5HCNA 5TV2A 4BPBA 1NKSA 2D3WA 3QBTA 2H16A 4OK5A 4IFBA 5IHPA 5EXSA 2IS6A 2BEKA 2ZYTX 3GCGA 3CNNA 5KDLA 1XTKA 1PV4A 1P62B 2FFBA 3L82B 4XJXA 1N0VC 2OCAA 2WJHA 1VG9B 3BK7A 4X8OA 2ZRFA 4QGHA 1F2TA 2PMKA 1KDOA 4ZCMA 4LJYA 3TNFA 1WXQA 3U3JA 4QBHA 5FPKA 2V7QD 1OXSC 2W6IA 3WP0A 1T8UA 1E69A 1OFIA 2DFLA 1NIJA 2RGAA 5FI1B 3ZQ6A 421PA 1Z0JA 2HT6A 3BB3A 4DCUA 3V4FA 3DO6A 4JLDA 4I1SA 1E2EA 3SQXA 1YZUA 2A7QA 4MGYR 4DEYA 2WTUA 1BO6A 1E2HA 3T61A 3ZVLA 3SZRA 4RKEA 3UIEA 4LYHA 4QKQA 2G1KA 2IEZA 2BVNA 2IUSA 2YWFA 1VECA 2GJ8A 3OIUA 2D62A 5DLQC 4Q01A 5E95A 5M04A 2NMVA 4FWTA 3LQRA 3B5JA 3ZJYA 3C16C 2SHKA 3MJHA 4YDHB 3WYAA 2F9LA 4NONA 3VR5A 4Q4LA 1R8SA 2GZHA 2C03A 3ASZA 4URUR 3MWYW 3NC1C 1FMLA 1UBGA 4YONB 1Z07A 3BB1A 4R71A 4G5QA 1CEEA 3FDIA 4GZMA 4HDCA 1JJVA 4Q1EA 3I5XA 2IW3A 2ZYUX 5FFMA 4BASA 4IDQA 1ZNYA 1OYYA 1JQLB 2P5TB 4TL8A 4S35A 2KJQA 1P7CA 2O8DA 1II9A 4ITRC 2VSOA 2OBMA 2E9SA 1QRAA 2ZSAA 1IY2A 4OK6A 1Q21A 2L0XA 4Z8YA 3UANA 3U3MA 1NIPA 3GEHA 1M6NA 1C4OA 3LVQE 1G6OA 1EWRA 1N6LA 4JS0A 1E2NA 4LYJA 2VL7A 2NQ2C 3K09A 2X2FA 2WV9A 2G3YA 1ZD1A 2QMOA 2ZE5A 3CB4A 1Y3AA 4YMVA 1OHHD 2JLYA 2XJ4A 1TUEA 3TBKA 2VP2A 4XWKA 1X1SA 1LVGA 2QG6A 4PTLA 1GVNB 2J0UB 3DZDA 5ELXA 3SJZA 1W46A 3B60A 2J7KA 2RGEA 4X8MA 2BIFA 2JIZA 4AURA 4KFSA 2FH5B 1KK2A 1XD8A 5B30A 3ADBA 1S4QA 4Z1MA 5CB6A 1ZP6A 1G1MA 2HF9A 1Z0IA 3NDBB 1NLFA 2DCUA 1P2UA 5H8WA 3R8FA 1N3BA 4KLNA 3ZZUA 2AN9A 1A82A 2F43B 2ZJ8A 4US1R 3R7WA 2QT1A 2NZ8A 5L3VA 2G9NA 3CKLA 2IA5A 3LY5A 3GLGA 4GDFA 3C7KA 3CX8A 3IBGA 1GKUB 1N2CE 3Q3JB 4I1UA 3AVUA 5FBWB 2Z4SA 4FN5A 2OHFA 5FOSA 1Z6TA 2JLSA 3OF5A 2EW1A 2LKDA 1JECA 3TR5A 4DLRA 4FCWA 1SVWA 5SZIA 5IK2D 3KTAB 4A8JB 1GFIA 1MO4A 1GRQA 2ZREA 2AWNA 1KSHA 3I92A 4P4SA 1AS0A 2EQBA 4QJ5A 4BFYA 1KDTA 3CF6R 2XXAB 2JJ1D 1E0SA 1DTSA 2FSHA 4HB0A 4IXMA 3PEUA 2CHQA 3QJYA 4FINA 4Q1AA 4AYTA 4CF7A 1W5SA 2DWOA 4RY2A 4E03A 3FOZA 2CVHA 1AS2A 5KNDA 4ZI2A 1KK1A 3AKDA 2V1UA 4RZ2A 3SC3A 4FMDB 3H0KA 2VQSA 4CEHA 2BOVA 1XRJA 1G6HA 1ZIOA 5FUYA 3AVVA 2DBYA 1X86B 4PANA 1JB1A 2QTHA 3SYLA 2W2VA 4Q1CA 3MG9A 5DN6D 3PG5A 5FBQB 5DI3B 1JQJC 3LVRE 3AKCA 3CWQA 3PQCA 3GLIB 5LBIA 1DO2A 5FUVA 1RVDA 1NG9A 1PJRA 1FW6A 3DVLA 5AUNB 2NO0A 4MYTA 2W0SA 4W5HA 3GFOA 3SHWA 4DSOA 1LS6A 3NVAA 3UWKA 4LHZA 4CEJB 3EIHA 3TJZA 2ZJBA 4LJ7A 4MYCA 4Z54A 2ZTSA 4KITB 2ZRPA 4M9XA 2ZJAA 3LLMA 1YZLA 3UKDA 4UQOA 4JKYA 4EIWA 2QA5A 2VO1A 3K0CC 4ZCLA 5TARA 2JAQA 1FPMA 3LBNA 4IXNA 1NVVR 1PLJA 3L0PA 4MKIA 3K0EA 1QG4A 1Z6GA 1FP6A 3SU8A 5HPYB 2JATA 1B0UA 4KXFB 4PHGA 2O8CB 3OE7A 2IYUA 4MRRA 2O8EB 2FF7A 2RGCA 1SVLA 1ETUA 1JR3A 4I1OA 3E5HA 3T1TA 4Q47A 1S1CA 3SJCA 2LKCA 1YKSA 1Z22A 3DKPA 1NJFA 5JCZA 2CCJA 2Q3HA 3PEVA 2GEUA 3KKMA 1TEVA 4GT1A 1KJZA 3X1DA 2OZEA 2BEJA 1VG8A 3VNVA 2BMJA 3ND9A 3B7GA 5FOXA 3UG7A 1NN1A 3LWNA 1UDXA 4Q1FA 2YOFA 1A2BA 4NHOA 4BEBA 4DDTA 2JGNA 1X8JA 5CLQA 2BM1A 3I72A 1J8YF 1Q12A 3EA5A 4QC2A 5EE1A 4PZZA 3U3OA 1S9DA 3LXRA 4DLUA 4M2LA 1XTQA 2BKEA 4GNKA 1S1MA 1P2TA 1PLKA 4Q5IA 3RHFA 4JLAA 2CCGA 2ZJZA 2H5EA 3FMOB 5L3SB 3W6OA 3NHAA 4E07A 4WBSA 4XWOA 2EFCB 2VA8A 3EZ2A 4FMBB 4Q4JA 1EG7A 1YU9A 1VCOA 1H8HD 3MWKA 3ZS8A 3C14C 5P21A 4TT3A 2CDNA 4QXAA 1E4YA 1W2GA 1RC8A 4QM6A 2R6FA 1T0HB 1IOZA 4BZXA 2XB2A 4UNSA 2Q0HA 4KVGA 4L9WA 2J5XA 2ZRMA 1LW7A 2C04A 2JLQA 3UG6A 1VHTA 3GJ6A 1EFTA 1UFQA 2IX3A 4HB4A 1KK3A 5HE8A 1CJMA 4US0R 3QKUA 1FX0B 1GOTA 2ZEJA 1UPTA 3BRWD 2J45A 4HAUA 2GBLA 1IHUA 1RRFA 2JJ8A 4DLVA 4DDVA 3VKHA 1DPFA 3LX5A 1R0WA 3R8CA 3EC1A 3B1VA 1JEEA 1ONBA 2WBLC 1T0JB 3MAAC 4RD6A 1ZUHA 2P6UA 2HLDA 4YMUA 1XEWY 2PCJA 4OJQA 4AD8A 1G8GA 2GA8A 3MCAA 2QQ0A 2VP5A 3HDTA 3KB2A 3MGCA 5LD2C 2P67A 2N46A 1OE0A 2VYFA 1CR4A 3F3YA 2NPIA 3I61A 3GQBA 2YKGA 3P32A 2IS2A 3S1AA 1NBMA 2IC5A 4QOSA 1SZPA 4WIAA 1KO4A 4OI4A 3K8YA 3LV8A 3I5YA 4KFRA 2VF7A 1R4AA 3P4YA 1G20E 4LJ9A 5A0FA 4CT5A 1II0A 2FPMA 4F4JA 3EARA 4JT4A 3ADDA 2DFKB 1E2KA 1J99A 1O3YA 3SJBA 1D9ZA 4LPKA 4B75A 4DDUA 2H1LA 3W5JA 2ZVPX 4CEIA 2FN4A 2QSYA 4Z51A 2VP9A 2IUUA 1RRGA 4IOJA 2XNDA 4NMMA 5AJXA 5TVKA 2V6JA 1SULA 3IO5A 5DHFA 5SZHB 4B73A 1OLOA 1D2MA 1DOAA 5JEEA 3FPAA 2F3RA 3P27A 1JI0A 3T34A 4DUGA 4BFZA 4HSEA 4OHXA 4BZPA 4HUTA 1TL7C 1XZPA 1P60A 2D74A 3BH7A 3CX7A 3L8ZA 3O8RA 2O0HA 3FGNA 3QBVA 1COWA 3C5HA 3KZ1E 1SVKA 2RH5A 3T1QA 1NVUQ 3TKLA 5JSZB 2B7CA 1OF1A 1N6PA 2ZRKA 4Q4HB 1II8A 2ZYWX 4B32A 5J4VA 1YZNA 3AVYA 5J4HA 1IJEA 2ZR0A 1KO8A 5FUWA 1FFHA 4Q48A 4AIIA 1UKYA 1Z0DA 2IT1A 5KO2A 2CNWD 2VHTA 3GLFA 4KJZA 3ND8A 3BS4A 4E09A 4FCTA 4RFSB 3E70C 1KI6A 1KMHB 1GRNA 3U4QA 4O25A 1OV4A 2GJ9A 3AP3A 1YQTA 4GSYA 2UKDA 3B85A 4E22A 1IY1A 3G0HA 1HUQA 4V02A 1A7JA 5BYJA 1XD9A 4YMWA 4M1TA 2V7QA 4XVUA 5CITA 1N5LA 3DEFA 4B33A 4BLTA 3VR3A 4B3DA 4AK9A 2GCPA 4XD7D 4ZPXA 4LC0A 1KJWA 1G16A 1P61B 2C8VA 3DOEA 3QKRA 2YNMA 2VHQA 1G7TA 3PITA 1YHNA 3QNUA 3VMFA 2UZIR 2ZRHA 4RCZA 3B6EA 2QY9A 3P4XA 4KFTA 1KKMA 4RJLA 4V0MA 3SOPA 5JEDA 1CULC 2QMHA 2YOGA 3C4JA 4X8LA 4DLWA 3GJ8A 4EPVA 4EJSB 4IDNA 1N6IA 1U99A 2EYUA 3IIKA 4JSYA 5B2ZA 2J46A 5G3YA 3D31A 3MWJA 1Q3TA 5F9FA 2FOLA 1HE1C 3BWDD 2A2ZA 3EPHA 4RD1A 1ZUNB 1NY5A 1SVSA 3PR1A 3D3QA 2N1BA 5DO9A 4XWAA 3LO5A 3EWAA 4Q7LA 1E6CA 4HZUA 5L8VA 2QP4A 1ZNZA 4UXHA 5CK4A 3LNCA 2DFNA 3SQWA 4GL2A 3T15A 3RS7A 5FPSA 1T5IA 3QEOA 3ZD7A 3VX3A 3IEVA 1GRRA 2YWGA 3I8SA 2I1VB 2ZU0C 4PPQA 2ZAOA 3QPUA 4IDOA 4NYJR 2J7PD 3RABA 5JLJA 1KJYA 2ZRJA 1XNJA 4B6FA 2G0NA 1AGPA 2ZUBA 4JLJA 1KOFA 4WZAE 1XJQA 1XTJA 3LW8A 3RANA 1H8ED 1W7AA 3BOSA 3B9PA 4G1UC 2FMXA 3RLFA 3BFVA 4AG5A 4PQYA 4L16A 1OHHA 2A78A 3HU3A 3WHLA 4DVGA 1R2QA 3THYA 4JVNA 1VCNA 4K46A 2O8BA 2AX4A 3F0TA 3OESA 1T6NA 3B1WA 3U3KA 1HURA 4J0QA 3EPKA 3QXSA 3K09C 4EQ6A 3WMEA 2VLIA 1EFRD 1SHKA 1NI3A 2OSBA 2ZU6A 1ZMXA 5IF9A 4KCGA 1RJ9A 2CL7X 1SGWA 4O2RA 4PPFA 4LJ4A 4DWJA 4B71A 4IDHA 5FTLA 4D6PA 2HXSA 2XSZD 1X8KA 1D2EA 1Z08A 2OBLA 1XEXA 3DMDA 3IKJA 4I4LA 4BFTA 5A5GA 5LB4A 2QAGB 1F3OA 1ZU5A 4K8OA 1UEIA 2QGZA 1UKEA 1XP8A 4KYUA 3RYTC 3VTKA 1CLUA 4XH9B 4FMCB 2IXFA 2NZJA 2ZRGA 2IYQA 1KO1A 3K70B 3QG5A 5DIFA 5C1BA 5IK2A 2R8RA 1Q20A 2OLJA 2WHXA 2ZROA 2REOA 1XXHE 8OHMA 3DOFA 5KDOA 3FFBA 4GRAA 1BS1A 4AWXA 1Z63A 1WRBA 1E9DA 2JDIA 1K5DA 4NCNA 4PC2A 2JJ1A 4A9AA 1OYWA 1QHSA 2WWIA 5FL7D 4OHWA 3JZMA 2WOJA 4NCIA 2DHRA 3A1SA 3CONA 3K9NA 4XTRA 4A6XA 5KYKA 3RDPA 5CDFA 2ZSEA 1AS3A 2PZEA 4DIEA 1TUIA 4U7DA 2KBFA 5FOTA 2BMEA 2QQEA 2AFHE 1IXZA 1PUIA 4BLOA 4D26A 3HYRA 4B34A 2ZJOA 3KJEA 1R0XA 2FU5C 1CJTC 1LNZA 3CUEF 4IHQA 3P26A 4M9QA 4C3ZA 4B43A 5DN6A 1QVAA 4A36A 5KDDA 4TMXA 4YDSA 1E94E 4N0EA 5HKKD 2ZRDA 5BW8A 4Y0VA 3E1SA 2F6RA 2WM9B 3FB4A 3TE6A 3SE0A 3CH5A 3QQ5A 2P5SA 3G5UA 4HDOB 4TYNA 2ERYA 3CO5A 5J4YA 4AI6A 2PZGA 1U8AA 4B2IA 2GF0A 1TAGA 1RE0A 4A0HA 2ZITA 3WBJA 1SXJD 4LY6A 2O52A 4L5BA 1OJLA 1MV5A 1JR6A 4BLRA 1NG1A 3AGPA 3AVPA 3FHOA 1CS4C 1M74A 4DLYA 4F7WA 1P73A 3C15C 3C8UA 3WBKA 1XU4A 2QE7D 4Q9JA 2GXQA 1FL9A 3R20A 1TX4B 2PLRA 4C9BA 4QNRA 1XCGB 2QUZA 4S2EA 2GXAA 3MLEA 3AVXA 4DRZA 4TQAA 2F3TA 1VG1A 2ZI4A 5KPDA 4LBYA 5JI3E 1C1YA 2Z43A 4WAUA 2GVZC 1ZNXA 3K9LA 1ZINA 4Q4AB 4ZIRB 3V4RA 1VKJA 4C4PA 1IN6A 2W2TA 1S2MA 2H57A 3H1TA 1XCPA 2Q3FA 3SJAA 2ZETA 1HYQA 2GK6A 4FI3C 3R9WA 2ANCA 3PVSA 2XNSA 2YC4C 1NJGA 1S3SA 2A5DA 3EASA 4UNQA 4DXAA 3IQXA 1KI2A 1Q1BA 2AKYA 1EXMA 5A4JA 1U0LA 2HJVA 2LWIA 2GJSA 1G291 2YHSA 2GCNA 1CR1A 3I32A 2JLUA 4NYMQ 4M0LA 4OI0A 2QAJA 5H70A 1ZD8A 4NYIR 2J0UA 2ZANA 5FR2A 3QG1A 3RC8A 1QBKC 1QHNA 4QGFA 2HUPA 1DS6A 2ZRAA 1NRJB 4ZKEA 1E2IA 4LBVA 2PJZA 4C7OB 3NEJA 1F48A 1GNQA 2BMDA 2OV2A 3SDZA 3WRXC 1LFDB 3L0IB 3NWJA 3X1WA 2ZRCA 4LGMA 1E2GA 2ORVA 3GPLA 4C30A 4DHEA 1DO0A 5AJYA 2WAXA 1G21E 1VYVA 1YR7A 2E1RA 1M2OB 1A1VA 2ZUCA 3AF4A 3I4LA 4JLPA 4MDEA 3AVTA 3I8XA 1H8HA 3TW4A 3NKVA 4LJ6A 2ZE7A 4DJTA 2H17A 1ZVQA 4DDWA 1JALA 4P31A 3PUVA 4V0KA 1U0JA 3HPQA 2XOKD 5KSZA 4WXRA 4DT1B 1XWIA 3TSWA 4PO1A 1DAHA 4PC3A 4PZLA 2HXYA 4FMDF 1G8YA 3KTAA 3AQ4A 1N5JA 2CL6X 2JCSA 1GSIA 1S3GA 2FG5A 3K0FB 5B64A 1DBSA 1KDRA 3IPXA 3JVUA 1TPZA 5KU1A 2XXAA 2A5FA 4JL8A 4D0NA 2FDCA 1U98A 3SYKA 3SBEA 2FE4A 1MOZA 5SZKB 3OZXA 4N0DA 5F3WB 1TQ6A 1UKVY 4PHFA 1X3SA 3QF4A 4BLPA 2IYLD 1XB2A 2FNAA 2GBLC 3B2EA 1CR0A 5D3QA 3RAPR 1AJEA 1Z47A 4BFWA 4D25A 4ARZA 2IF0A 2WSSD 2Z5FA 2MSEB 4IDPA 2OBNA 4M1WA 5LB2A 1U0HC 1GUAA 5FBVB 3EX7C 1ZUIA 2W6JD 521PA 4QM7A 1QG2A 2QENA 5DI3A 3CNLA 4CIDA 1LS1A 4QNMA 3UMRA 3GLIA 2V9PA 1SXJC 4QBFA 5AUPB 4ZDWA 2WJVA 2FWRA 5E7JA 3TIFA 1VHLA 1VCIA 3LFUA 3MD0A 2FX3A 4A1FA 3WRYC 1MO6A 2KWIA 2P65A 4ZDIA 1NP6A 2JLZA 1SQ5A 1US8B 3VR4A 5JBQA 1UADA 2IWHA 4NCJA 1HE8B 4PZYA 4IVRA 3THXA 3DM9B 5F2EA 1WMSA 2CVFA 5BN3A 1TEXA 1TU4A 1KHTA 3KKPA 3IIJA 3PUXA 3I73A 1MABB 1A2KC 3QXHA 4QFMA 4JVMA 1V5WA 4QGAA 2WWFA 3BB4A 1OIWA 2VPPA 4IVQA 1FP7A 4URYR 1U94A 2C9YA 5H1YA 3WYGA 5JS8A 5J5CA 5TMPA 2P2LA 4R9UC 3FHTA 2O8CA 1NMYA 2FSIA 3CRQA 2Z4RA 3KUCA 4KAXA 2IXEA 4PHTA 2CNWA 5K8IA 4GZLA 4A0RA 1P9NA 2Y8EA 2R65A 2HF8A 3BC1A 1W1WA 1F2TB 4LYFA 2WVJA 3NBZC 1EFCA 2RGDA 3CBQA 3HR8A 4TWZA 3D6TB 1GITA 1ZC3A 3VKGA 4Q9KA 1FQKA 2RAPA 3DM5A 5GJWC 1E79D 1E0AA 4RZ3A 5KHOC 1WBDA 2ZRIA 2Q6TA 2P6RA 4MYHA 2IS1A 1JAIA 3TW8B 1KSJA 2ZVQX 4XD7A 3AGQA 1M7HA 2C5LA 4V03A 1CKEA 4BLQA 1G8HA 1UM8A 2JLRA 4L8GA 3K53A 3M4YA 1T8TA 5UKDA 1G3QA 4MKHA 5JHHB 1J2JA 2J87A 2QMUA 4OQLA 2NTYC 4TMVA 5GVRA 5TB5A 1K5GA 3L8YA 2DWQA 2G88A 3U2QA 1F2UA 5L3SA 3QPVA 1Z2CA 1Q44A 1M34E 1KZGB 1N6RA 3VR1A 2EFEB 1BKDR 3KJHA 1Z0FA 2WPDD 2ZR9A 5EUQB 1WDTA 1Z3IX 2GZAA 2WKPA 2Q9AA 1EX6A 4KBGA 5K8TA 4IOKA 3RWMB 3ZVNA 4MUAA 4M1SA 3IIMA 4H9GA 5H68A 2O8DB 4WVFA 1ELOA 1E9CA 5L3RA 4HAVA 1ESMA 1D9XA 2J7PA 4C0BA 3U61B 1KY3A 2PH1A 3HWSA 5G40A 4B74A 1XMJA 4BLSA 3K0AA 4OI1A 1L8QA 1OIVA 3IHWA 2BKUA 2I3BA 1H8EA 2RMKA 4LHXA 2FFQA 1E9BA 2ORIA 1TQ2A 3AF1A 4HAYA 4JZKA 1MRNA 1Q22A 4URWR 2N42A 4HLUA 4GMDA 3QXXA 2P3SA 4OL0A 2PT7A 1P5ZB 3HJNA 4N1AA 1GWNA 4M22A 2GEDA 4IRUB 1NL3A 1XJ0A 2REBA 4PR0A 1W36B 2ZI6A 1GG2A 2IYYA 2QM8A 3OAAD 2AXPA 4XVRA 1W4BA 2GJKA 5FTMA 3AUXA 5TXGA 3RS5A 2GHIA 3GFTA 3GLHA 1EFRA 3QOFA 4M53A 3VHXA 3X1XA 1ESNA 4EPTA 3O8BA 2V55B 3SBDA 1TQDA 1UBFA 1T3HA 1J7KA 1G17A 1ZCAA 3LQQA 3DPUA 2XSZA 1KIMA 2ASEA 3RS4A 3R7WB 3LW7A 4B44A 1TF5A 1OFUX 1G8PA 2V54A 3GLGB 2ZJ5A 2GCOB 3KJIA 2F9MA 1ANKA 2XAUA 3AB3A 4BWYA 1W0KD 5HR5A 4TQ9A 3THWB 1IN8A 3KQLA 5J40A 2IYTA 4B3FX 4TTPA 2VF8A 4IVPA 3VHLB 2WKQA 1TNDA 2H8KA 4TYPA 3U7FB 3FFAA 2PL3A 2WIBA 3RRZA 3U3RA 1Q1QA 3W6NA 1MH1A 2R44A 2WWWA 1AQYA 4YLGA 4TMWA 4C0LA 4UNRA 1JPJA 2EYQA 3NTUA 3KQHA 4Q4HA 3W5IA 2ZJ2A 1OFHA 3FE2A 5TY0A 3EIQA 1AQUA 5FL7A 2FGKA 2RGNC 1KDPA 2XJ9A 3BH6A 3EIEA 3K9GA 5JWHA 3IEUA 3CWZA 1GILA 1OKKD 4GOJA 4AG6A 1N5KA 5KSOA 2HV8A 3QEJA 5FI0B 2XGJA 1NVXQ 1S0UA 1CJKC 1TMKA 4RFSA 3OEHD 4TL9A 5E4FA 1W47A 2WSMA 1Q1EA 4C0SA 2IYRA 1KMHA 4TYYA 3NG1A 3H84A 4EFNA 1Z28A 1UF9A 1KAOA 4MYUA 5HZKA 4NYIQ 1KI9A 3QVVA 1FNNA 2QI9C 4QJ4A 5HKKA 1CR2A 3GJXC 1DG3A 4C2TA 4M9SA 2LCFA 821PA 1QHGA 1BMFD 4MRNA 2BMFA 4B6EA 2BHRA 3JZAA 4D4KA 1KI7A 1KTVA 4PSKA 3R9XA 2GXUA 1SXJA 2WZQA 4Q21A 1KSGA 1GZSA 3LLUA 2CL0X 4AY2A 1HV8A 3F5FA 4LX0A 2AL7A 4A0FA 3QE0A 1YR8A 4HDQB 1ZYUA 2FA9A 1JPNA 3SEAA 4C0HA 4MGZR 2ZE8A 3ADCA 5CB8A 2QE7A 2QEQA 4LJ5A 3KQKA 4A92A 1KAGA 4Q1DA 5JHGB 1YZKA 1OH5A 3REGA 4OI2A 3ECCA 5AJVB 1AM4D 2TMKA 2QP9X 1CF4A 3H4MA 5DGXA 4M1OA 3NXSA 4LPSA 3SR0A 1OFTA 5FTJA 1OH8A 1EWQA 4BEJA 3G82C 2B6HA 4IKEA 4JLMA 2F55A 4DBLC 4PQRA 3EZ7A 3CRVA 3MUFA 4BFXA 1T4GA 5D3MA 721PA 3FMIA 1CBUA 1W0JD 2OG2A 5BQ5A 5L3QA 3GEEA 1NVWQ 4M21A 2JJ2D 3K9HA 2J3EA 3KFVA 4YC7A 3ZIAD 2REXB 2CMKA 4DKXA 3TSOA 4HAZA 1EX7A 3ZQJA 4DSUA 4RD2A 5AR1A 3GLGE 5G41A 2ZR7A 2H92A 2PEZA 3WNDA 1XMVA 2AWOA 2Q9BA 1RFLA 2YZ2A 4JIMA 3CIOA 3LBHA 3N70A 1BH2A 4MDFA 1QF9A 3GJ3A 1W36D 1L4UA 2OXRA 4ERNA 3IBYA 4F92B 2JIZD 1SVOA 4DIDA 1VTKA 2OE2A 4HEJA 1KGDA 4Q4JB 4FIDA 4B76A 3NBFA 3GJ7A 1RYFA 2F1HA 4CGZA 4TMKA 1QZXA 2RHDA 3VQTA 3PEWA 5DI9A 1XXHB 3CH4B 3Q85A 4O2LA 4EFMA 1UJ2A 1NLYA 4KHZA 4HUQB 4EJSA 3EPLA 1E9RA 2FSGA 1KKLA 5KUTA 2ZPTX 4MITA 3OIYA 2XOKA 2EFDB 4TTQA 621PA 2WWHA 1M7GA 3LH5A 4TL7A 4TMZA 4OBEA 4I81A 2JLVA 1E1RD 4IEIA 1MT0A 3LDAA 5JJIA 3T12A 1E2JA 2X77A 1KI3A 2GTPA 3O8CA 4UXJA 4F4IA 1R5NA 3OHMA 3W34A 3W9YA 4GPTA 3CNOA 5BXQC 1VCMA 4Z8XA 2ERXA 2J1LA 3EA0A 3PUZA 3T1OA 1UAAA 1EFHA 2PJRA 3BE4A 2QZ4A 4LWZA 3K0SA 4MRVA 1G3MA 2QTFA 4W7SA 4A8JC 3RNLA 3NBXX 1PUJA 2YV5A 4PQFA 1G4AE 3O8DA 5KSPA 1YR9A 1L2TA 3GJ5A 3EC2A 2C96A 2WSSA 1TADA 3BJIC 3VAAA 5AWFC 3A4NA 4BFUA 4LV5B 2W6JA 2XZLA 4TSFD 3RVBA 2OAP1 4MKGA 1VDZA 1AKYA 1YZTA 2XTNA 3S1AB 1HQYE 3KUDA 2JLWA 2O5VA 3CR7A 4MA4A 4DCVA 4H1UA 4P4TA 1KNQA 3ICQB 1P6XA 2GEVA 4OHVA 1LF0A 1JR3E 2CJWA 1GM5A 5EZ6B 1NY6A 2QPTA 3WMGA 1JJ7A 4CEIB 4DLXA 3Q8XB 3BIFA 5FUXA 2J41A 2HEIA 4G5GA 4PC6A 2F7SA 4U00A 2GAAA 1LV7A 1G18A 4V0LA 3PCRB 3UMSA 2MSCB 4LZZA 4ZCIA 4NZYA 1W2HA 2ZM5A 1QVRA 2R6GA 2OCPA 1J90A 2W2XA 3IDQA 3OIVA 4UKDA 3BXZA 5CJ2A 5EE3A 5FL3A 1O87A 1AGRA 1U9IC 1XEWX 2FEMA 2WWXA 2PX0A 4C2UA 1P9RA 2JA1A 2BM0A 1HA3A 1U90A 1KK0A 2C95A 2G6BA 3HU2A 4GP6A 5DYIA 5EUMA 4LV6A 3TUJC 2ZRNA 2BWJA 2IYXA 3A1TA 3OFND 4LJAA 4ZIRA 2EU8A 3L2OB 2GESA 1GNRA 3DDCA 4B3CA 5AJZA 1QHHA 1KI6B 1NVVQ 5JZVA 1MO3A 2WMNB 3ASYA 1AK2A 3GJ4A 3SHFA 4EPRA 1G19A 3H86A 2XZOA 4Q02A 1IQPA 2ZI9A 3DMNA 4WXPA 3ZYCA 2RGNA 2AD1A 2ZSDA 3FKSD 5C4GB 3U6KA 4Q66C 2OAQ1 2IYZA 3B8HA 2ZRLA 3SI7A 1YRBA 1XPRA 1IN4A 1ZD9A 2IHYA 5BN4A 2YC2C 1G5RA 4R98A 3UWOA 3VU9B 4A0GA 3IO3A 2QT0A 4IEEA 3CF2A 4GOKA 1I4DD 3SFZA 3KDSE 3QKRB 4DCSA 1I4TD 1K6MA 1KO5A 2DYKA 3T5GA 2GAOA 4EAQA 4ZKDA 3QXJA 3A36A 2FEOA 4GBMA 2NO7A 4W9MC 3BAFA 4JJKA 4YQFA 3ADKA 5CM8B 2QL6A 4QGGA 1EFUA 1XD2B 3FMFA 3LX8A 5CLLA 4DSNA 3MMPA 4DCTA 3IUYA 2F1RA 2GF9A 4M1KA 2XX3A 1AZSC 1I2MA 1N0UA 3A8TA 4BRWA 3B78A 4OQNA 4MGIR 5G3ZA 4ASUD 1G5TA 3PIRA 3NIBA 3NBYC 4BECA 4TT3D 3PV0A 1OH6A 2CHVA 3AUYA 1R5OA 1ZCBA 2WPDA 1CP2A 4A15A 2IUTA 2Z83A 1XMSA 4M1MA 4M8NE 1W49A 3GJ0A 1AIPA 2ZXUA 1XCMA 5G53C 1XPUA 3FMPB 1OXVA 3U7GA 4QHSA 1TF2A 1D6JA 2KBEA 3B1XA 4QBIA 4UJ5A 2KB0A 4OJKA 1T5LA 1NBME 3P20A 2NG1A 5JRJA 4IOMA 1NNEA 4JKIA 2OCBA 3K0FA 1ZBDA 3MFYA 1EESA 2VBCA 3NH6A 2D06A 5JI2E 2VEDA 3LD9A 3ZIAA 1PVOA 4JLVA 4P33A 5FPYA 4C0JA 4DEXA 4R7ZA 2VP4A 3O47A 3SYNA 5CK5A 2FPLA 1HT1E 2WAYA 3WHKA 2CK3D 4BGDA 1FTNA 5KNBA 3GD7A 2V1XA 1OB5A 4PSAA 3X1ZA 3BH0A 2BCJQ 3RSOA 5JWRA 3NC0C 1RYHA 4OQFA 1FMJA 4URZR 5EXXA 3ZH9B 3AVOA 4L4UA 2ZUDA 4EQ6B 2WOOA 3OAAA 4N3NA 4B3XA 4PPGA 3TK1A 1YVDA 2BCGY 5E3HA 1S8FA 2IXGA 2MMCA 3UATA 4OK3A 3RRYA 4HLUC 4EPXA 1RJ9B 4LJ8A 1JAHA 1NSFA 3OEED 1NBMD 3W3AA 5GADl 1Z8FA 3CX6A 4GFDA 3TSZA 1U8ZA 4WZ6A 1XPOA 1I4LD 4MH0R 1LB1B 3R9IA 4P4UA 4RZXA 1Z2AA 4Q7JB 5EP1A 2IWRA 3GLFE 2A9KA 2DB3A 4LK2A 5AUQA 2ODEA 1SVIA 3D7MA 1IN7A 1RRPA 4Q7MB 3W8RA 4CDGA 5KSYA 2WWYA 3U44B 3ETLA 5C46F 4KV9A 2R6CA 1WB9A 2CXXA 3LAWA 1GKYA 2FFHA 1GL6A 1W0KA 4MQBA 3T06B 1OT3A 4D81A 4PFSA 4HB3A 1HH4A 1NLZA 3DZ8A 4HLCA 4F4CA 4RKFA 2OFOA 1CTQA 2VSFA 3KKQA 4TN1A 1RIFA 1E2FA 5FH9A 4NTZA 3KL4A 1MABA 4EDHA 3N2IA 4ZV4A 2GRJA 4AKGA 3L0OA 3SS8A 3AP1A 1X1RA 3HU1A 1CJVC 2F43A 2OLKA 4LHWA 1Z83A 3U7EB 3QI2A 4AC9A 2QBYB 2A5GA 4V0ME 3F8TA 3KKNA 3LXXA 5TDHA 3TMKA 4QG7A 1OKKA 1Z0AA 4DSTA 1W4RA 2PT5A 1W4CA 2IS4A 2IYWA 2IK8A 1ZU4A 2OFWA 2ZS9A 1BIFA 3OEHA 3U5ZB 4NH0A 4BE7B 3QKSB 3M1IA 4XSGA 3K70D 2V8OA 1JXMA 2GDJA 4YXWD 4TYQA 4V0NA 2A5YB 1DAIA 4A8JA 2ZI5A 1ZAKA 1RKBA 2VHCA 5LD2B 1YZQA 1EGAA 221PA 1QHXA 2WKRA 1UBCA 5DISB 3PUWA 1Z06A 4FW9A 1R6BX 1R0ZA 2B8WA 1I2DA 2F1JA 1AN0A 1BMFA 1WA5A 4AKIA 1HEIA 3W3ZB 5KOYA 1CRQA 3CW2A 3PFIA 2GXSA 1YRAA 1Z6AA 1WBBA 5JFGA 3HP1A 5FTKA 4KU4A 3KQUA 1ZM3A 4D0LB 2Q9CA 4PC1A 3ZLJA 5AUOB 2QPAA 3EWSA 2ATVA 1CJUC 1HQCA 3NEYA 1M8PA 1U8YA 2ZE6A 3C5CA 1TF7A 2VP0A 3UK6A 3WYFA 1ZNWA 2XEXA 4CVNA 4RD3A 2XZPA 1KI1A 3KXKA 1G3UA 3C41J 2AR7A 5EXPA 5B58C 1GL9B 3QIAA 2CBZA 5CM9C 2OESA 2Z0MA 1GDDA 4U5XA 3EAQA 2O8FB 1ZIPA 4D0GA 1IN5A 4JLBA 2X1VA 4EJSC 1OW3B 2QRNA 1K8RA 4ABYA 1U9IA 2ORWA 4LBWA 4Y0AA 2BBOA 4CEJA 2PX3A 3TVTA 1M1YE 1OIXA 1QHYA 1SKYE 4KVAA 4P3YA 5J47A 1W0JA 3A1WA 4CYMA 1IONA 1KI8A 2BC9A 5IRCD 2JJ2A 5J4KA 3WXMA 3Q5EA 2IL1A 5ANRB 4OQXA 1E2MA 1GKIA 1SKQA 4UNPA 5B57C 1CXZA 4JT2A 1YE8A 4A4DA 1DAGA 4JLNA 1GP2A 2QMEA 3M6AA 4O0MA 4NYJQ 1W5TA 3CLVA 3NH9A 3AP2A 3RRNA 5FPTA 2ZAMA 2P6NA 3JVVA 2O8EA 2YOHA 5GVSA 2ODNA 2WJGA 1E3MA 1NF3A 1TU3A 3BFXA 5K8LA 1IAQA 4F93B 4Q9LA 2Q3MA 2KI5A 2OILA 4ZI3A 2PEYA 1R5BA 3OIWA 3UMFA 4PAQA 3DL0A 3Q7QA 4US2R 1D5CA 1ZM9A 1TTTA 4JBWA 5HCIA 4LYAA 2R2AA 3FKQA 1VPLA 3KXLA 4JMPA 4JVLA 2GJAA 4QL3A 2OT3B 2WJJA 1EK0A 1J70A 5CDFE 5E7IA 3ZD6A 3CRRA 5E7MA 1IXSB 1KY2A 2RHMA 3V9PA 1IXRC 3EZFA 4CRWB 2GCOA 2F1IA 1HTWA 1WQ1R 2FGJA 3U6BA 1CIPA 4B3GA 6Q21A 2GVDC 1KSFX 3IGFA 5IT5A 1F60A 4ON9A 3THWA 1RZ3A 2VHJA 3AF0A 3CRW1 4MKFA 4LBZA 3ZVRA 1B23P 2QGNA 1E1RA 2QAGC 1LF5A 2B21A 1S96A 4DLZA 1ZM4A 2PMDA 4OHZA 2JDID 3A37A 2A5JA 2D7DA 4UXIA 5JJLA 2FJUA 3WNCA 4B35A 2UVQA 1NN0A 3AKYA 3RWOA 3K70C 2RB4A 2W00A 3RS2A 1BYUA 3T1VA 2Z6VA 4G01B 2FV8A 3BD9A 4NKRA 4TLBA 5GJBA 3J81k 4KFUA 2ZI3A 3QF4B 4ACBA 2NGRA 1Z5ZA 3X2SA 1IBRA 1UBEA 2A3RA 4GP7A 4ARZB 1G7CA 5DNYB 4D80A 1KI4A 4GMXA 2OM2A 4QRHA 1FX0A 2PZFA 4TSFA 3A1VA 1WE2A 4AYWA 5CJPA 3FWYA 2BBWA 4KLZA 3AKEA 4U02A 1U2RA 2QORA 5IDVA 2BJVA 3EPJA 3PUYA 2A30A 4FXPA 4JLOA 1L7VC 2I4IA 2V6IA 1XTRA 1FUUA 2X19A 2ZS8A 4PHHA 2BJWA 1XDBA 4IOLA 2IF2A 4A6PA 4BQSA 2R9VA 3W6PA 2OO7A 2G83A 5DSZA 2CE7A 1N25A 2CCKA 1E1QD 1DAMA 2V4ZA 2WJIA 3TQCA 3TRFA 4PO9A 2GILA 4NDZA 3THXB 1JXOA 1T9HA 3H2YA 3KKOA 3CZPA 1M7BA 1X6VA 1XTSA 1OSNA 1E4VA 1H65A 2VSXA 5LDDC 4HYYA 2ZJYA 2G1JA 1KMQA 2C98A 3IPYA 3RS3A 4ILEA 1VG0B 4Q7KA 2DFTA 2YINC 2QM7A 2RCNA 2J9RA 2H7VA 1G3IA 3OFNA 2NO9A 4XIGS 1G7SA 4G3XA 4GOXA 4I99A 1E0JA 1OXUA 1Z6XA 1NN5A 1VYTA 5SZJA 2G0TA 1ZRHA 1Q1ZA 1MO5A 4DCNA 3FKSA 2PLFA 2ANBA 4IW3B 5CYOA 1S9HA 4P4SB 3REFA 2GK7A 3IILA 4II7A 5JSZA 1N6NA 1F6BA 1OB2A 1ODFA 3QSYA 4QHTA 2J0QA 1FNMA 4B2PA 4TZ6A 3WNBA 2AD5A 2NIPA 4D82A 2MMGA 4OQMA 2ZI7A 2RGGA 4HLQB 2W83A 4ZO4A 2B92A 2KSQA 2XTMA 1IM2A 2CLDX 3D8BA 4JLKA 3TQFA 5KNCA 3UPUA 4BFSA 4FCVA 5BN5A 4LUCA 4B47A 4CEHB 4TZ0A 4D4LA 1XFAA 4TL6A 1F2UB 4XTCS 4IJMA 1GIAA 2C9CA 3L43A 4L15A 2AK3A 2HYIC 1N6OA 2DPXA 3LBIA 1E96A 3E2IA 4RSGA 2W6ID 2ONKA 1PZNA 2B8TA 4ASUA 1G41A 5JWOA 2NO1A 4NU0A 1XXHA 4KODA 3HR7A 3ZDQA 4MUBA 4KO8A 1A5TA 4HUQA 1W4AA 3VR2A 3EXAA 1YR6A 4M1YA 4CW7A 1FQJA 2DY1A 3CPJB 4F38A 1RRCA 3WP1B 1G5PA 3NDPA 3T5DA 1SVMA 4DC9A 3VX4A 3I62A 4R2IA 2ATXA 4TQUS 3Q9LA 1R10A 2JLXA 2QROA 1NKTA 3GLIE 5F98A 4C0QC 1DAKA 4YMSA 4LCBA 2CE2X 2WWGA 3EW9A 4FWIB 1D2NA 2AHOA 3HPRA 3IHLA 3K0AB 4RFVA 4ACAA 1KYIA 1BYIA 1G9XA 1E2LA 2EFHB 2EWVA 3A4LA 3BGWA 4PC7A 1QDEA 3Q5DA 2KE5A 4DB4A 1P4SA 2X2EA 3BBPA 4XOIA 1XZQA 4V0OA 4B3BA 2IYSA 2OEPA 2CLSA 2AK2A 1E9AA 1ZC4A 4QBGB 1XMIA 3CPHA 2CK3A 5AJWA 4D2IA 1DAFA 4OKSA 2QP3A 4G5SA 3VNUA 1G4UR 1G7RA 3ZVMA 3ZGXA 3MWLA 4P0TA 3RSLA 2YWEA 2QSZA 4NBSA 4WW0A 2YJTD 4UNNA 3GLHB 3CRMA 4NYMR 4PAMA 4LRWA 1W48A 3OEEA 1GL7A 4JBXA 3RC3A 3K1JA 4IFEA 4B2LA 2B7BA 3PJRA 3N2EA 4W5JA 4ZDKA 4HAXA 1Z29A 1N6KA 4LDJA 4M4SA 5JRZA 3AVWA 4DZZA 3ICEA 3QUSA 4LSGA 4NE2A 1VIYA 1Y63A 3FTQA 2EFGA 2IYVA 3B82A 2PCLA 3RS0A 3P1JA 2GKSA 3CR8A 4A2PA 5JCPA 1DAEA 1N5IA 1T3LA 4URVR 4NL4H 4G5RA 4PX9A 3NHBA 5EE5B 3SFVA 4OHYA 2D2EA 4XVQA 2VH5R 1DARA 4FMCF 1C9KA 2VIIA 2ECKA 1D8TA 1XJCA 5EE0A 2FZLA 4Z1MD 1U81A 2C78A 1FUKA 2AXNA 2YWHA 1CRPA 1KZ7B 3U60B 4OYHA 3IQWA 2WMOB 2MSDB 4MRSA 1DEKA 5K8UA 2QAGA 3AH8A 5GJVC 4PO8A 1NMXA 2GNOA 2FFAA 1WF3A 4PPNA 2WICA 4CT4B 3A6PC 4Q1BA 3B13B 4Q18A 5FOVA 4AKHA 1E9SA 1FOEB 3PXGA 2VRWA 2NO6A 5LPNA 1XEFA 1T3SA 1OPXA 4YXWA 4JL5A 3AF3A 4TMTA 4KSCA 1L4YA 4RD0A 4WZBE 1LY1A 3VR6A 2Q21A 4MRPA 4TTRA 3A58B 5DE3A 5FR1A 4Q9HA 3QKTA 3W90A 3ZZ0A 3VU9A 1E2QA 3AVQA 4RVCA 3TAHA 5F9HA 5HTKA 1QHIA 1VMAA 2R6AA 3VFDA 4MGKR 2C99A 1P2SA 1Q57A 4TLEA 4L9SA 3Q72A 1SHZA 2GZDA 2WJYA 2BDTA 2QPOA 1SXJB 3TUZC 2ZSFA 3CM0A 3CZQA 5DHAA 1N0WA 3M0EA 3QXCA 3TGPA 121PA 1J8MF 2RGXA 1IJFA 3N5CA 1AA9A 3LA6A 4RD4A 4YMTA 3PEYA 1XD2A 4DB2A 2UZ3A 3AV0B 4URXR 1ZM2A 1V43A 2ZS7A 3FHCB 5HE9A 2R6DA 2QU8A 3V00A 4WA7A 4HLDA 1E99A 3KJGA 4R2HA 5KPJA 4M9ZA 4G5OA 3WY9A 2D2FA 5EE9A 2HDNB 2ZQ5A 1UEJA 4QHYA 3TUIC 4JBYA 3K0CA 1ZJ6A 4HZIA 1WP9A 1N6HA 2O0KA 2QNRA 2C77A 1XX6A 1E9EA 3TAUA 3SN6A 4BRUA 1R0YA 1XBTA 2AKAB 2P0EA 2XTZA 4JVSB 4DLSA 1F5NA 3GLHE 1Z0KA 2R62A 5JECA 2HCJB 1A4RA 4JSTA 1BOFA 2X8AA 4HI0E 5D3MB 5C4MA 1IY0A 4I1VA 3GEIA 4DLTA 5L3QB 3TLXA 1RPZA 2BBTA 3T35A 2V3CC 1DG1G 2VTKA 1W44A 3AEZA 2FPKA 4D4JA 3WMFA 3L0SA 2XITA 4PXAA 1OH7A 2ODBA 3B1ZA 2OXCA 5J4LA 2J0VA 3TVDA 1II8B 1XF9A 5JMTA 5EP4A 3OE7D 1WCV1 5EQTA 1FTSA 3FYHA 4POAA 4Q4AA 1PLLA 1DELA 1JR3D 3GLFB 2J59A 2JEOA 2OUKA 3BERA 3KQNA 2I1QA 2H18A 3AM1A 5FPHA 4JYCA 1MRSA 3U4QB 4ZDJA 1KO7A 1HT2E 3I1FA 4LC1A 2VHUA 2NPFA 3CF0A 4KI0A 1KNXA 4G0NA 2GETA 4EUNA 3KFXA 4JL6A 4XSHA 5HZHA 4EPYA 1E79A 4E5UA 5C2JB 3TH5A 4C0AC 3QY0A 1YJ5A 2K5UA
chains in the Genus database with same CATH superfamily
4ZI5A 1P3JA 2RG1A 2R8EA 1PFKA 1T15A 1XNGA 3EW7A 2HBYA 3K1YA 3AUFA 4CIBA 1W36C 2KMLA 3DHWC 1CDOA 4JNKA 1VJDA 1CY8A 3KO8A 2D2VA 3MN1A 4GYWA 5I7HA 5CYPA 5GJCA 1GGEA 3KNZA 1ODSA 2VF4X 4TYWA 5FULA 3O73A 1KDVA 2FCAA 2MSKA 4AJLA 4P7KA 4ARBA 2EZ4A 3BMOA 3DHYA 4LN1A 3KWJA 4YPFA 3S28A 2ZSJA 5C18A 4TRRA 2EWWA 1AKWA 1H2XA 2BBSA 2GBGA 3DCNA 5FBRB 5B7NA 2CEAA 2JIBA 3I3SR 4FBMA 3EZXA 4HB2A 4XA8A 4F06A 2IV2X 3PNBA 4YAJA 2Z3ZA 1ONSA 4YAIA 4AJJA 2B4KA 3O4IA 1FBNA 1Y89A 4P3XA 2FMUA 3PT9A 3KCQA 1GPDG 2VP6A 3BZWA 2D7CA 4TZTA 4ZAVA 4NU5A 4DMLA 5KTYA 4LZJA 4IINA 4EHJA 2QBYA 3BORA 5DBOA 3ZE9A 1CUDA 2HQSA 3B1FA 1WPQA 5BSEA 2HIHA 2VXOA 2E87A 5KYGA 1ORVA 2RKOA 4QO7A 5EKUA 4WJZA 3IA7A 2HREA 3ANNA 3H3XA 1MOPA 5FBLB 5FFNA 3NALA 3WB9A 5CIWA 3OQOA 1OAOA 1NFRA 3UXMA 1JFRA 1OXTA 1SUEA 1T91A 1JEDA 4MI3A 1D4ZA 3E8MA 3S7TA 3S8YA 4Y9RA 3R5KA 3BM5A 5JZVA 3WZLA 1L1RA 3GELA 1GTVA 1DWPA 2J0SA 2W4QA 2ZT8A 3V4ZA 2E1PA 2OGUA 1GARA 3CLSC 4G24A 4QSMA 2DR3A 1N2GA 4Z86A 4O4LF 5KYUA 4DA0A 1IEQA 3ZK7A 4AKEA 1M34A 1L4GA 3SGLA 4JJZA 4W5WA 3V3TA 2I80A 1G8AA 4OYLA 4WOPA 1AQ6A 5EXTA 1ZHHA 3DNPA 4IRMA 1QQAA 1Y8AA 1U8TA 1A71A 3CPEA 4K03A 1SBNE 4JQYA 3RHSA 4EY4A 1E1QA 4FC6A 5K3FB 4YJ2B 4P32A 3DPSA 3FH0A 4JKOA 1V8FA 4N5HX 3T9DA 4JYBA 5FEUA 1OFVA 3DG9A 3H9GA 5CLGA 1NQTA 3NAMA 4D4MA 4OLAA 1C0EA 4KRGA 4TYNA 3LT0A 2PUJA 2O0JA 1HY3A 3GFPA 2FG7C 4CR6A 5JJCA 4E5KA 2QTVB 4O4LA 1XKTA 2AA3A 3EG5A 4M0FA 4RPIA 2MYTA 3ESQA 1I6KA 5BUCA 1CRWG 1K66A 4N7MA 3M2PA 2Q62A 1XU9A 2EX4A 4L8VA 4B7UA 1DDGA 4IEFB 4DIFA 3OCWA 3PXCX 1QFJA 4ZODA 1FLVA 2OTCA 3O2NA 2OO3A 3WTCA 1E0KA 2DX7A 1QHHB 5K3AA 4B6QA 2XNDD 1YZVA 3QLJA 3P9PA 4EA9A 4TROA 3LI2A 3VKWA 5SY6A 4N6OA 2WB2A 2UUBB 5KTSA 4GI7A 2WTEA 1NAHA 2VPYA 4MR8B 2XOEA 4QJ3A 3HFJA 4KXMA 1FZQA 4J94A 4LI0A 3UC9A 2Z8XA 3N6VA 5FOUA 3ASVA 3DUFB 3EFOB 3TOZA 4UM8B 3DEAA 3GDFA 2PMWB 3OCXA 1GVHA 2YFQA 4TXMA 4UU8A 1VPWA 2BEKA 1M6VA 4DIUA 2BAGA 1M8JA 3GCGA 4PGHA 4AMUA 5JDIA 1PV4A 3BWVA 4QA9A 4IUBS 2P2DA 3RT9A 1RRMA 1TCUA 3KQVA 5H5JA 2EL9A 2OCAA 2Y0CA 3I34X 4GUDA 2ZOSA 4MGEA 4X8OA 3ODPA 4QGHA 3RKUA 3I2YX 1N2CB 4ZRDA 1V3TA 2Y1CA 4KE8A 1NXWA 4INOA 3PLNA 2R1TB 4B09A 3K6SA 3A3PA 5IJ0B 4YGYA 4HQ0A 4UMDA 4Y6PA 4PIPA 2G4CA 2YUTA 4QBHA 4CM4A 1GQ2A 4ND5A 3ZE1B 2K2WA 5FI1B 3ZQ6A 2WP8J 1Z0JA 2HT6A 3KS9A 4N5DA 3K20A 1MVOA 3TW8A 4RTRA 3V4FA 3IT3A 3OBIA 4LNUB 5TR9A 4JLDA 4X3PA 2C5AA 3KQPA 5FQOA 1YZUA 2P9CA 3URMA 6AT1A 4B0PA 2YNMD 5J58A 1E2HA 1A5ZA 5F52A 3FW1A 3ZVLA 1Q0QA 4DC0A 1GZ3A 4Y2VA 4LYHA 1SBHA 4LXGA 5HFJA 2I3GA 4GM0A 4QKQA 1FP2A 2G1PA 2XGSA 4ZQFA 1VECA 2D62A 1N1EA 4Q01A 4GECA 4HSGA 4LZOA 4FWTA 2NMVA 1CYEA 2XCQA 2YWJA 4MXDA 3B5JA 3ZIUA 2H4WA 3ZJYA 4C7JA 3G02A 3DKRA 2WWVD 4D9EA 1LLUA 1N92A 3B36A 3MJHA 1JBQA 3F2IA 3VR5A 4Z7QB 3QTTA 1JLLB 1R8SA 4U7WA 4D5EA 5EKSA 1KXZA 4WESB 1DBIA 2COEA 4COKA 4J2TA 4DLAA 3KKZA 1B3RA 1Z07A 1N4AA 4ZAGA 1N2IA 1IUNA 4LOIA 3UBMA 2PGNA 3CNQS 4DR2B 4KVFA 4AKTA 2QTBA 2NO5A 2C2WA 1Z39A 2HH9A 4G8CA 4PGGA 1ISMA 3WLFA 2IUYA 2OWEA 1OYYA 1P1JA 4N5IX 4R5MA 4EG3A 4GLFA 1O6BA 2ATCA 4HPXB 5DGTA 2O8DA 3MMSA 2ZSAA 1IY2A 5GINE 2G9VA 4MVJH 5E6UB 2IFTA 5EI5A 1D1SA 4J8PA 2PFGA 3GEHA 4RBNA 1M6NA 5DTMA 1C4OA 2QM3A 2JHPA 3DVRX 3SF0A 1EHIA 1NONA 3UAYA 1E2NA 3H8SA 1YA6A 1SVNA 2X2FA 4ZYXA 1LWNA 1QHEA 1JDBB 3CB4A 2XNCA 3DEZA 3R0JA 1Y3AA 1ZK1A 1OHHD 3AONB 4Q37A 1BDJA 3P5BA 5EIEA 2EKZA 5EJ7A 1WO8A 5TLSA 3OA2A 4R1NA 4L4SA 5AW7A 4NG4A 3I9V1 4E2YA 4WJKB 1X1SA 4MO9A 1G42A 1LVGA 2VDLB 2JCGA 1ZR2A 2PS1A 5I9SA 2GYVA 3QU5A 3GLRA 3W7AA 3W9BA 2J0UB 1Z34A 1P0QA 2PLAA 2XYVA 4XIYA 5ELLA 4AJKA 5CD9A 1B74A 3NIFB 5ELXA 1W46A 1H6BA 5BW6B 2RGEA 3WIVA 1U7ZA 1YDWA 2PKQO 2ZUWA 5G02A 4V3BA 2JIZA 5KWIA 4KFSA 3S68A 1M6HA 2PGOA 2GEBA 3COWA 1DFHA 4RETA 2H51A 5EIOA 3QI7A 5B30A 2G5CA 4B31A 2KX7A 5CB6A 3P2MA 1QIJA 1AKRA 5D7BA 1NLFA 1B8OA 3S5JA 1N3BA 3FG9A 2JI7A 3MIZA 2AN9A 3VZPA 4FYXA 3ZZUA 4EMTA 3K5HA 3GJRA 3A14A 4NE9A 4F3TA 1OLUB 1C3XA 3ZWMA 2QT1A 3ILSA 3SX4A 5ECDA 1YDGA 5KMGA 1Q7BA 4IIHA 4A10A 3NTQA 4X1IA 1W5EA 4PYQA 5A3SA 1GKUB 1N2CE 3HUUA 4WVLA 1M6YA 4HWRA 5DT9A 4FN5A 4QULA 4BU1A 3ZDXB 2DEUA 4CM9D 4GUAA 2VDWA 4MPJA 3LWBA 5FOSA 2NU9B 3TR5A 4DLRA 3OHPA 3SXPA 1WY5A 1YB5A 4EI8A 3KTAB 3OPNA 4E32A 3IMCA 3A1EA 5JS1A 3L4BC 5CFLA 3NIDB 3IQDB 2O1WA 1KSHA 4YFVA 3I92A 1UJBA 3UAZA 4LK3A 3ZCRA 2EQBA 3KOZA 4Y2TA 3LOUA 3I83A 3NHLA 2YW9A 1PR1A 2CXNA 3IERA 2JJ1D 1FRVA 1D2RA 2OO5C 1E0SA 1DTSA 1EBBA 2H65A 1GEEA 1FFBA 2E4WA 4CF7A 5M34A 2JZNA 4E03A 5FX2A 1Z4IA 3M4XA 1VIVA 1MGOA 3O4VA 3O5AA 4P86A 2V1UA 5HJ7A 3DCJA 3HY3A 4MLDA 3SC3A 4ECAA 2DUWA 2VQSA 4GP9A 4D3FA 1OFUA 3AVVA 1G6HA 1MB9A 2WSLA 3NWEA 1EK2A 2J3LA 2ZATA 1X86B 4Q24A 3RYIB 1YVUA 3SYLA 1H2WA 2ETVA 5LBUA 1CRPA 5B3KA 3MG9A 3FI9A 1BGVA 4G9EA 3BD7A 4J43A 3EVCA 1OWNA 5IVIA 4F3CA 1ZD3A 3KEFA 3C6ZA 3PQCA 1U0TA 5DLYA 1CD5A 3VJMA 2Y1KA 4JJEA 3RU9A 2WW8A 1CB7A 2R5NA 1GUFA 1DOHA 2ZIUB 4Y2RA 4LRTB 1KGSA 1ZQ1A 5AUNB 5AVZA 1CQWA 1GYPA 4MYTA 5K09A 3MYYA 4GQAA 1QPGA 2QIOA 2NYVA 2A1UB 3SHWA 1GZ4A 4Y2YA 3KKEA 1KH3A 1LS6A 1SHJA 5CPFA 3L7OA 4CKEB 1E5DA 4DSOA 4F4FA 3EIHA 1UKBA 4LJ7A 4MYCA 1G63A 1J1IA 3WBBA 1AURA 1FFXA 4P5DA 5CUQA 3FYUC 3LLMA 1YZLA 2GLTA 4UQOA 5DYYA 3UKDA 2JJMA 2I2AA 5JD5A 1YJCA 3C1AA 4H7FA 1VBFA 2JAQA 4KSYA 3LQFA 3LBNA 1NVVR 2HWXA 4MKIA 1UFVA 3UK7A 2AYXA 1Z6GA 4Q0MA 4F6RB 4EJ2A 3RF7A 2JATA 5JMOA 1B0UA 3BRSA 2NUAA 2L69A 1GPBA 3N2ZB 4YRQA 4I4TB 3AZPA 2O8CB 4MRRA 1IXYA 3R6GA 1L5ZA 1UCFA 3KYJB 1BQEA 4TTIA 3TXXA 2YXLA 3L0BA 1ZD2P 3QZUA 4PZ0A 3NIGB 5DTEA 4I1OA 3WYCA 3T1TA 2GTIA 2ZYIA 4Q15A 4WK6A 3O1HB 2RHCA 4XCQA 5ERGB 3RBVA 1OWLA 5TPZD 2XMCA 5LL6P 2Q3HA 2R2GA 3EIFA 3PEEA 4RYLA 3H2GA 2QE6A 3I30X 5HPYB 2H3HA 1W5BA 3FF1A 5EWLA 2NXWA 3GCWA 3X1DA 2BEJA 3DNMA 1KS9A 4G9BA 2VQDA 5KYXA 4W5OA 1F2VA 3UG7A 3RSZA 2G9UA 1USWA 1NN1A 1JILA 1NVEA 1CQJB 1KA9H 3K9BA 4NBTA 4PVDA 2AMFA 3TLGA 3WRXA 5JC1A 4Q1FA 2YOFA 3I9FA 1SD5A 1BDBA 1N2BA 2HAEA 4TKUA 4G63A 4U2EA 1CJSA 1CY1A 2EX1A 4BEBA 3HBLA 4U63A 5BUQA 5CLQA 2AFVA 3ET4A 4YPVA 1XA3A 1CSEE 3I72A 5EE1A 1WVGA 3U3OA 1S9DA 4BB0A 2YVLA 1Q0ZA 3C1OA 3S2YA 1X0XA 2V7GA 4TWRA 3QELB 2FMKA 3RAEC 2CCGA 2Z8YA 4MUIA 5CIYA 1K2WA 2PGIA 2QTAA 4ZREA 5L3SB 3NHAA 2FR8C 1ENZA 1ODCA 4HH4A 3G68A 5AHOA 3HKCB 1Y8RB 5K0LA 4DMRA 3EZ2A 1B26A 4LGVA 3RYFB 3RUHA 3U4CA 3BXHA 2ZWAA 3KR0A 1ONNA 4RX1A 1XZ8A 3ZS8A 3CG4A 3OJEA 4QXAA 1HNNA 3P2KA 1BVYF 1E4YA 1EUDB 2PWZA 4IJWA 5CH8A 2YY6A 1RC8A 1HDGO 1YHYA 4WZBB 4QM6A 2VS1A 4BZXA 4DIOA 4UNSA 3KHSA 1F4LA 2Q0HA 3WK6A 1WCIA 4P0QB 1I2CA 1A96A 5CDSA 2ZRMA 4MW0A 1K88A 1EUQA 1MG0A 1Q83A 5TMEA 2FQQA 1GR1A 1VHTA 1NVDA 3OQNA 3NHRA 4US0R 3WGVA 1FYVA 3UHPA 3QKUA 1FX0B 2ZEJA 1JNXX 1TVKB 4LECA 5BNWA 1W85B 1E6WA 3FPHA 3EG9B 3FPSA 2YHIB 3QE4A 4I50F 1X2EA 3IVGA 4OXXA 5AKLA 2H4YA 3T9EA 3RIXA 4CR7A 5TQ2A 1U0OC 4CM8B 3GZNA 3ZQKA 2QZ9A 3NWOA 3VO1A 1OJ7A 3AR9A 4KQWA 4ZOLF 4DDVA 3FJOA 1FLDA 5DM70 1TC1A 1UPBA 3VKHA 3SZGA 3OQIA 2BTQA 4X1OA 10MHA 3MGKA 1EJ0A 3B1VA 1GQYA 2GLUA 1ONBA 2WBLC 1T0JB 3CJTA 3I6MA 4D74A 3S40A 4RD6A 5H02A 1ZUHA 3A9UA 4OJQA 1G8GA 1V8BA 5LXTA 3QPBA 2QQ0A 1J9GA 4OFZA 2JGKA 1OE0A 2X0NA 3G8BA 2WILA 3FOCA 3C3AA 1C29B 1PR5A 2VYFA 4JOSA 1J00A 3WRYA 1M5UA 2N75A 3DEKA 4I50A 2MT9A 4HFNA 1BVUA 2A1IA 4UHFA 1NLUA 3HBJA 3I61A 5HCUA 5C8ZA 3R1IA 2IC5A 2QG9A 1BA3A 4QOSA 3VM6A 1LX6A 3UFXA 1RZUA 2GM9A 3DZJA 3W06A 2RARA 4FYIA 4OXIA 4NMHA 4QATA 1L8AA 3WWPA 4YCAA 1LSJA 4OLBA 2A6PA 1R4AA 3P4YA 3OIFA 1KMCA 1JFLA 2JFYA 4WZAB 4LE0A 4G26A 4AO8A 1E2KA 1VL2A 3A0UA 1JYSA 3S6JA 4B4UA 1TYCA 3UOGA 4WNAB 3W5JA 2D1QA 3PFGA 2VP9A 1RWOA 3TRKA 1KJIA 3UWSA 4IOJA 2XNDA 4NMMA 3NM5A 3UYLA 2V6JA 1KP3A 4RCVA 5DHFA 3JPYA 4B73A 1PWEA 1VIMA 2I3ZA 3NC4A 2V4MA 3HJTA 2R87A 3WGYA 3A6LA 4OHXA 4BZPA 2XMDA 1TL7C 2BRUA 3W3AH 3OTGA 2YN0A 2D74A 3CX7A 4YQYA 1J20A 3FGNA 4W5TA 3C5HA 3C1TA 1T34A 1WQ4A 2GBCA 1ZRMA 4KW7A 3T1QA 3UJ6A 1NVUQ 3TKLA 1SBIA 2B7CA 2YV3A 5HIAA 1N6PA 5DM0A 4Q4HB 3TQQA 5A5EA 2NUTB 2XXBA 3AF6A 1ZMTA 2NU6B 4MVYA 3C4VA 2CNOA 4ND8B 5FUWA 1FFHA 3TINA 2PHZA 1D09A 3IDZA 3ANSA 3GLFA 4KJZA 3ND8A 3LOQA 4E09A 3VPGA 4EGJA 3E70C 2Q5FA 4RWEA 3AG6A 3WK4A 4RJTA 1D0VA 3GZTB 2AZTA 1DBPA 3VZDA 3U4QA 1BJRE 1OV4A 1AHPA 3GDHA 3KAPA 4EG1A 3DOCA 2VAWA 3HY6A 1WLYA 3BKXA 1A7UA 1A7JA 1B6GA 1M33A 2IZOA 3ANYB 2BFMA 3G5MA 2GO7A 1S5PA 1XQ1A 3F97A 2JANA 2XH8A 3CH6A 3JS5A 4F21A 5CITA 4B33A 4B3DA 1AQNA 1XK7A 4XD7D 1HETA 4D99A 2HA6A 2I7VA 2TMYA 3FCEA 4WFIA 1P61B 3DOEA 4RPKA 2YNMA 2VHQA 3VYTB 3QNUA 1XK6A 1U9JA 5D51S 4UBNA 4C4ZA 5T57A 2ZWVA 3IV6A 1IIRA 1KKMA 1U0EA 2AFIB 2VJMA 4TM8A 2PAFA 4V0MA 4YTEA 3NNDA 2YOGA 4MWCA 4X8LA 5EKDA 4CHTA 4HKTA 4IIDA 4KV7A 4LZPA 2ZWOA 4IDNA 3W8NA 4EPVA 3M9LA 1GL3A 1P0MA 2BZ0A 2J46A 3SKYA 3D31A 2I54A 2XMRA 5EPOA 5F9FA 2NM0A 1HE1C 3SFTA 4DDKA 1XJWA 1NY5A 2P3QA 2WFAA 2N1BA 1CVRA 2Q8QA 1SJ9A 2Z2ZA 2BFCB 1MIHA 1TM2A 2OK8A 3D6MA 2F1OA 1E6CA 5DWDA 3W2IA 3VZRA 3Q3CA 6ABPA 1SQSA 3M89A 1PNVA 2DFNA 2VDKB 3T15A 1M1NB 4XDGA 3RS7A 4BO1A 5K3OA 1F1BA 1T5IA 1VDMA 3HCRA 4BWVA 5L9AA 2BR3A 1HT3A 1EJ6A 2MIIA 3IEVA 1JSZA 2XLCA 4OLJA 3HNOA 4MVXA 5HNKA 1EGHA 2ZAOA 4W82A 3VPSA 3L5OA 3DXXA 3ZEIA 2O2IA 1G5QA 5ALPA 4IDOA 5A7GA 1Y37A 5C80A 1JSXA 1JEQB 3WK5A 2YZKA 4TS3A 5JLJA 4EZIA 2G0NA 4ZVSA 2IY9A 1RM0A 2V6BA 1CEYA 3UA3A 1PJ4A 1SUAA 2AMVA 4WZAE 1XTJA 3DF9A 5C8YB 3GLGA 2WR8A 3WFIA 2X0EA 1BEEA 3H2BA 1CNEA 4G1UC 4OPMA 2FMXA 1LKZA 4LDRA 3RLFA 4PQYA 1OHHA 3QUCA 5K3SA 3V2GA 4BNIA 4DVGA 3D8UA 5I7UA 1Y1PA 1CRZA 1FFWA 1ABEA 3RTAA 3SS7X 3THYA 1MDFA 1VCNA 4K46A 4IPTA 1QAMA 1XZIA 1EJ2A 1R12A 2AOTA 3B1WA 3G9QA 3NQ41 3VR4H 4EQ6A 3WMEA 3AHCA 2BHTA 2JD1A 3OZBA 1EFRD 1SHKA 1NI3A 2OSBA 2ZU6A 5IF9A 4KCGA 2CL7X 4O2BF 4YCSA 3HB9A 4HMQA 3E22A 5L3ZA 4HNUA 1IVSA 2JD2A 3SKXA 4RK1A 2FN9A 5FTLA 2ODTX 2EJVA 2PUFA 3L6EA 1PN3A 2P0AA 4ZO7A 1XEXA 1B8VA 2ENWA 3FTFA 2FOXA 1F3OA 2BGNA 4U7PB 1XSEA 1UEIA 4K8OA 4ZYLA 1NVFA 2QGZA 5HRCA 3RYTC 3L7IA 2PUAA 7GPBA 2GSWA 3CZAA 4XH9B 1UFRA 4CM9A 3BF7A 2C4WA 5AI6A 5ITWA 2ZRGA 5T6MA 2JEZA 4IQ4A 4LVNA 4F2GA 1TCAA 4K9OA 3W79A 2PV7A 2HK8A 5C1BA 2OLJA 3HE3A 4V2UA 2OSVA 3HH8A 2AN3A 1RMTA 3H5TA 1QK3A 1V1JA 3AYZB 1WRBA 3LFHA 5DBFA 2DY0A 1E9DA 1RS0A 5F77A 4OP1A 4FQ8A 1I3CA 5AW2A 1O4VA 5BMVB 2VH1A 2VJQA 2JJ1A 1T9AA 4RLSA 1I33A 2Z2KA 3JZMA 4NCIA 3K9NA 3UK2A 1HYHA 2YJ6A 1MTOA 2C7RA 3MRXA 5M3BA 2YVAA 4YCJA 4WKGA 1ECJA 2ORED 1SUSA 1VJRA 2FPGA 2AFHE 2QQEA 1PUIA 4FDAA 5E3IA 4BLOA 4D26A 1XRMA 4MKRA 1SZJG 4ZT7A 3ULKA 4QTYA 1J0BA 2EGGA 1YMVA 4M9QA 1Y9EA 2BN4A 1PFUA 4FEYA 4C3ZA 4DFDA 2VXCA 3ETJA 2DLCX 1XMQB 1REQB 2G40A 4Z9BA 4HRXA 2ZRDA 5BW8A 5JYEA 1L7XA 1O6ZA 2EBWA 3E1SA 2F6RA 3DZKA 5DBIA 1L5NA 4YJ3B 4CM7A 3LUPA 1ZLYA 2QX4A 3B3GA 3L41A 2Q1YA 3NV9A 5J4YA 3AR8A 5I7WA 5CPBA 3E27A 3GYGA 1JT9A 5CNMA 5DLPA 1GLVA 4ZJUA 4A0HA 4BAZA 1IRXA 2ZITA 3OLWA 3WBJA 2XE8A 2O52A 1Z0UA 2F62A 1OJLA 1NOKA 1MV5A 1QB8A 2H5IA 3ONVA 1JR6A 1NG1A 2I6SA 3GVPA 3HNRA 4L4RA 2C2OA 4DYVA 4DLYA 3QPDA 2OHOA 5JAOA 5LZ9A 3C15C 1Q7RA 1RXYA 1ZGGA 3GY0A 3WBKA 1J22A 2W8BB 3RIHA 1JKJA 4D8WA 3D02A 3HB1A 3QVJA 1JXAA 1HWYA 3G13A 3GAAA 4LWOA 4B85A 2W98A 2YV1A 3OQ6A 4MR7B 1SB8A 1ZN9A 3I9JA 4KGZA 4S2EA 4UZSA 5CVDA 5E2AA 4AJ1A 3WHPA 1ZH4A 5EJGA 2GX6A 3CUSA 4TQAA 3TTVA 3V97A 5A5DA 5I7EA 2PUCA 2Z6QA 2Q3JA 5KPDA 4LBYA 5JI3E 1O6GA 1KQOA 1TW2A 3K2IA 4MIYA 5E1BA 1ZNXA 3AJEA 3L0YA 1ZINA 1XQVA 4GVXA 4UAGA 4ZIRB 1VKJA 1YI8A 3LY9A 3ESAA 3Q40A 4C4PA 1IN6A 2HFJA 3HG7A 4E2XA 1XWWA 1NT2A 3H1TA 5C5CA 3GAZA 2P1ZA 3MW8A 3LQYA 3PQ2A 5TPZA 4HVLA 3FPJA 2GK6A 3UHOA 4FI3C 3NFYA 2QLTA 2X0DA 1ZRNA 5JD4A 2ANCA 2FPWA 3PVSA 2XNSA 1LQUA 1NVBA 1NJGA 2A5DA 1FYEA 1QIEA 1Y1SA 2GGSA 2RAFA 2LD4A 2YC4C 3EASA 2WZBA 4NOKA 3GEDA 4DXAA 4FYWA 2EJBA 1R0BA 4UTZA 5D6OA 2A14A 1KEZA 3WLQA 1I6LA 2AKYA 4IJUA 3I5AA 3KJXA 1U0LA 2ZVDA 3G9UA 5AW6A 2YHSA 4BEWA 1CR1A 3A4YA 2XNHA 3DMFA 2WMYA 5EHGA 2JLUA 1IEWA 4NYMQ 4I5EA 1CUUA 2CZCA 5H70A 2R4TA 2ZANA 5FR2A 4Z4EA 3ANMA 1JHPA 3H6KA 2PJUA 4UU1A 2EDCA 2QX6A 2DRIA 2H1CA 1SG9A 5ER6A 4CFSA 4EYSA 1Y6FA 1HFKA 1E2IA 5AOCA 2BZ1A 3GOHA 3NEJA 3SDZA 4FFBB 4R2XA 4IVNA 1LFDB 3NWJA 3QEKA 1B15A 2QUKA 1L7QA 1ACLA 3DFZA 3MTGA 5IC6A 3PHIA 2L2QA 4ARUA 4KIUA 2VZLA 3ZCPA 2HA5A 1E2GA 5GZ6A 4BX2A 5ENZA 4V1CB 4C30A 4H7KA 4BO3A 2O19A 2NW6A 3WE7A 4A8PA 1G21E 1MQ9A 1VYVA 1YR7A 1M2OB 2DBVO 2ZUCA 3AF4A 3FYCA 3G5TA 3CEJA 2HA7A 3I4LA 5CLHA 3N2NA 5DLDA 3BXPA 3ZE6A 3TIGA 3NKVA 2V6MA 1N75A 1JIKA 4TN5A 1M76A 3B7WA 2DGDA 1AN9A 3AIMA 4WZZA 4DJTA 5AXCA 2HLHA 1NU6A 1JALA 4P31A 1VKOA 2J3JA 5B3AA 3IC5A 3GGOA 1JHDA 4PBRA 5KSZA 2V3WA 3NBAA 1KZHA 1T8YA 4DT1B 1XWIA 3AUTA 3ITNA 3IULA 3KUKA 3RBAA 4HN4B 4FMDF 3OD5A 4UHEA 1RI1A 1KEEA 2HA3A 2JIMA 4HGRA 4ZVPA 3A06A 3OETA 4ZV7A 3IPXA 4D9JA 2OENG 1TPZA 5KU1A 4J0DA 4X1KA 1BXGA 1RQ7A 3LCJA 4GPEA 4YYZA 1PZGA 2QQGA 4JL8A 1OR8A 2NZWA 4R1QA 1B42A 3NRJA 2FDCA 4Z0TA 3W4JA 4M8KA 1ZA2A 3LLVA 3DE2X 4GYYA 1SKBA 3K2EA 2IXDA 2G71A 3V9AA 4N0DA 1KEUA 2OHJA 1UKVY 5KOIA 2ZR8A 2GBLC 3AI3A 1OCEA 3PQ5A 2VTBB 4L95C 1N78A 1P29A 3RLIA 1FB5A 3C98A 3JPWA 1MIOA 4ARZA 1YI0A 2IF0A 1CF2O 1MU0A 2MSEB 1GHTA 2Z5FA 3D43A 4IDPA 4M1WA 5I9TA 4K9RA 4QTXA 2WY2D 3QVGA 4QM7A 1LFAA 1VGRA 1O8CA 2QENA 3G2PA 5FWYB 4YWHA 1WZEA 4CIDA 4UDXX 3UC5A 1I2ZA 4GVPA 3ER6A 3UMRA 2FK8A 1FTGA 4WCFB 3U80A 3NTOA 3JWPA 2EFYA 4EUFA 4ZDWA 2O3TA 4N48A 2WJVA 1UK6A 2YV2A 3ZCXA 4TUYA 4JGIA 1VCIA 4JA2A 3MD0A 1XQ9A 4A1FA 3E7XA 5JEDA 1F7UA 4DMMA 3T41A 1PFYA 4JB2A 5TPWB 3A6EA 2Q5EA 4BVFA 2J4DA 1D2GA 1NP6A 4FONA 4UUQA 4R1UA 1R6UA 1US8B 5AVJA 1HR0B 3OQJA 4ZAFA 5HKLA 2QMZA 3VOAA 3TWOA 4BO5A 1ZLXA 1XRNA 4GAEA 3LC2O 1OBHA 1HE8B 1FU4A 3BE6A 4H7EA 3THXA 1NUPA 1UOPA 2PYDA 3DM9B 4HFRA 2DXIA 1QOQB 4DXHA 3IAS6 4NEGA 3IIJA 3P9QA 3HV0A 4KQGA 3SG0A 1JLRA 3AL2A 2NV6A 3O4GA 1A2KC 1TAUA 1EVJA 4JR0A 4JVMA 3EGVA 4O2AA 1PE0A 4L2IB 2O7VA 3C8ZA 4IVQA 2VPPA 3WYGA 2C9YA 1FP4B 1KIFA 3PBKA 1KPHA 5BW4A 3GGCA 3B12A 5TMPA 2P2LA 3IB6A 3GCDA 5EJAA 4JDPA 5GOZA 2JBAA 1JKFA 2IXEA 4DABA 5BSWA 4TTSA 1DB3A 4K9PA 3QLUC 4TYMA 2HF8A 3BC1A 3PWTA 3FCXA 5ALZA 4OKIA 2ZIZA 5WRFA 2WVJA 2O2HA 3NBZC 2IP2A 2XB8A 3CBQA 2Q4OA 3K4PA 4GO1A 4HNAB 3D6TB 4ZO6A 2JIQA 5EJMA 5GJWC 1LNQA 4EMUA 1EFVA 1W6RA 2C54A 3A6KA 1E6KA 4UHCA 4YQEA 3OQ1A 4R3NA 4RZ3A 3WB2A 3ZWOA 1UR5A 8GPBA 5KHOC 2ST1A 2E4AA 4PSCA 3I64A 4MR9B 1Q3KA 2R7AA 1IOLA 3DP7A 3N87A 4MYHA 3DAGA 3QWFA 1FNCA 2FN7A 1QYIA 3HZHA 2E6KA 4QU5A 3DO5A 1NPDA 1B41A 1PHRA 1WUYA 1ZRSA 2CXTA 2Q0XA 2V74B 4XD7A 1KMIY 1T3TA 4IHKA 3UO8B 1CKEA 2H52A 1G8HA 2JLRA 4BLQA 4RTPA 1C0IA 3K53A 3S2GA 5UKDA 1G3QA 1Q0HA 3GI1A 5JHHB 4OQLA 2QMUA 2I4OA 3KSBC 4C7MA 1A72A 5TB5A 1PNQA 2DWQA 2G88A 1F17A 4MLZA 4Y9UA 3V2UA 2MWMA 2OFPA 1RC0A 3J7AC 4B3MB 5FYDA 4CNQA 2C3PA 1XTTA 1IUKA 1KWKA 1NJ6A 1Z2CA 1Q44A 3ESCA 1TLFA 4NAHA 4B17A 1UWLA 4J1TA 2B9VA 4CU2A 5KC8A 2P9QA 1KZGB 1N6RA 3AUSA 1PJBA 3PI6A 3VR1A 1H2RS 5MHTA 4B6RA 4WFKA 1VHQA 2IE0A 4DL9A 1LSUA 1Z0FA 2C4HA 1U2TA 5CX1A 3RVMA 1PJTA 2EATA 2YRFA 2NSJA 1RPTA 4DUZB 5L45A 1QV7A 4FTWA 4WV3A 5AOBA 2OCLA 4P82A 3IIMA 2CWWA 1BZYA 1U2SA 1ICIA 4H9GA 1F9AA 5H68A 4YAKA 1THZA 3F3KA 3O93A 4PCVA 1NM5C 1C0LA 1TYAE 4EGFA 1E9CA 1SXQA 2X4GA 3PEFA 3T7TA 5K6TA 4NOMA 3MQFA 4NZNA 4OQDA 1NT4A 2Q41A 4B74A 4BLSA 3K0AA 2Q1WA 1W96A 3Q6MA 4OEHA 4FC7A 4E94A 2G25A 5J2TF 1L8QA 4WERA 3EH2A 2XUPA 2OXTA 4LHXA 4BGEA 4HAYA 1TQ2A 2HSJA 3AF1A 4KE6A 1Q22A 1TZKA 4GMDA 3TX6A 4B4VA 4RMJA 5AI5A 3HKDB 3VA7A 3EGIA 1CVIA 3D64A 1HFWA 3HCAA 4ZVMA 3D0RA 1P5ZB 3G7NA 3PDCA 4N0MA 1FS6A 1GWNA 4M22A 1BDMA 4HYTA 5GP1A 4NV3A 1NL3A 4IUDS 2YUIA 2WYOA 1PJSA 1GG2A 2ZI6A 3F67A 1OPRA 2AXPA 1L4NA 1W4BA 3DJYA 1QIHA 3GLHA 5JXHA 1EFRA 3DONA 1EM8B 3HYNA 1RPJA 2A9FA 4AXXA 4B3IA 4F2WA 1X1BA 5J2TA 1MEJA 3D0QA 1J7KA 3QLTA 4TPKA 4J16C 1KQNA 1TO2E 2C2MA 4B46A 5CB4A 1CVLA 4PQGA 1ULAA 4B9AA 4PHCA 1P6UA 4DAOA 1MAWA 1EUYA 1MX9A 3RS4A 2FP4B 2P5UA 2SNIE 2D5IA 2XRYA 3LW7A 1TF5A 1OFUX 3PTLA 4M7WA 4OU4A 3TRIA 1R64A 4KWHA 1KP9A 1Q0SA 1G38A 4HNSA 1Y8QA 3I2JA 3J7TA 3R41A 4XGIA 3H0EA 4WLFA 1HDRA 4F9TA 4L0DA 3ZHRA 2ZWMA 3GQVA 3F96A 4M6WA 5E9JA 5A0VA 4QYMA 4TQ9A 4BVAA 5KQSA 1CQXA 3KQLA 5J40A 3HYSA 4HQKA 1D03A 5A5VA 3L1HA 2WKQA 1TNDA 2H8KA 3H1EA 5AD1A 1R9NA 3FFAA 3U7FB 4HDMA 1NW4A 3UA4A 1O0SA 1XDGA 1CP3A 4M7RA 4YLGA 3D4LA 5ECGC 2ODAA 1H94A 2FLKA 2QF7A 3HYCA 5JQGF 3VNAA 2V0NA 4RJ2A 3KQHA 1N5RA 2ZJ2A 1OFHA 3FE2A 3V32A 2XB6A 4E5PA 4YV0A 3BH6A 1ISHA 1A9OA 4YLEA 1GZ5A 4XQCA 5K3EA 4FNMA 1PWZA 1RACA 3QFRA 1FRFS 1D3AA 1T8PA 1VLMA 3A3OA 3OJCA 4HNGA 4WK2B 4ZARA 3CGGA 1CF9A 4TGLA 4ZYUA 2WSMA 2FN8A 4YFYA 3ROFA 4UVIA 4IWXA 3BMNA 5ADWA 2EAUA 1MJGM 3H84A 4LHEA 3BMCB 4WY5A 4OB8A 5DNAA 4E7OA 1CZUA 1DXYA 1Z28A 4UREA 3TN7A 4IZIA 4BTEA 2RHBA 1GZVA 3H5AA 3Q6IA 4NYIQ 4FGZA 2OMKA 5HYVA 5JQGA 3T3IA 1R15A 1CR2A 3HACA 2GPNA 5FBKA 1I6WA 1Y42X 3F78A 2XE6A 3UXYA 3AHJA 4JV5B 3PDIB 1QHGA 3V1KA 1EX9A 4I5GA 1M72A 2BMFA 4WOKA 5KKCA 1T9GS 5L6MB 2I03A 1EIWA 1UBUS 3Q3IA 3Q15C 3R2JA 4YRJA 3S27A 4JLWA 1X2BA 2O4UX 1KI7A 1BWSA 1U6IA 3HV2A 2DLDA 2EP8A 1P17A 1GZSA 3N8GA 4AY2A 1K86A 1QYXA 1RWPA 1YS6A 4LX0A 4XQGA 4RABA 3V1TC 3EHEA 2C7GA 1DXQA 4DSZA 3WIDA 4YRBA 5HX7A 1PV1A 1ZYUA 1JPNA 3ADCA 2CSUA 2RHGB 3KQWA 4C89A 2APJA 3TLEA 1HZJA 4ZA2A 2IOFK 2DHCA 3K1AA 3LQ2A 5TT1A 2E4YA 3FKJA 4XB2A 3ZHTA 3NHUA 4AUNA 2PX4A 2JIOA 3DH0A 4BP8A 1IUOA 3UT6A 1RXEA 2FEAA 4RW0A 1DQRA 1S2NA 5FTJA 1XKXA 1XI2A 2X22A 2O2YA 2GKGA 2ZIXA 1OH8A 2UZ1B 3G82C 4DMHA 4IKEA 1ZJ4A 4TV8F 1IPHA 5KNBH 1V6AA 5LZ8A 4DGSA 5U4QA 2AJLI 2K4MA 3IVCA 1NKVA 4BFXA 5D3MA 3HKBB 4DR7B 1ESDA 2XUJA 1CBUA 1Z74A 3FMIA 2WMDA 4FDUA 2OG2A 3P9ZA 4P4GA 2J6HA 3FZNA 2V7EA 3GEEA 1NVWQ 4UCXA 2JJ2D 3E0QA 3K9HA 2D8MA 1RJEA 3OT1A 2J3EA 3KFVA 4AULA 5AHWA 5HGXA 5JSUA 4GC9A 4B8WA 4DKXA 2CMKA 1DQPA 3MVEA 2NZUG 2QSUA 1RKQA 1Z5WA 4RD2A 1RJFA 4PFQA 1KAEA 2CBXA 1Y1LA 5D5PA 1M2FA 2PEZA 3TTUA 2JFUA 3PC8A 3WNDA 1RIIA 3JV7A 4TV8A 1RFLA 4O3FA 1GUDA 1SA0B 2G72A 4HEA6 5TGTA 3CIOA 2IYAA 1E8MA 3QVMA 4XUGB 4DWOA 3LBHA 4TVBA 4DM3A 3Q0TA 1LU9A 1N4DA 1YVRA 4UPEA 1RCUA 1FU7A