2H7VA

Co-crystal structure of ypka-rac1
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
182
structure length
182
Chain Sequence
b'GSKLMQAIKCVVVGDGAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVMVDGKPVNLGLWDTAGQEDYDRLRPLSYPQTDVSLICFSLVSPASFENVRAKWYPEVRHHCPNTPIILVGTKLDLRDDKDTIEKLKEKKLTPITYPQGLAMAKEIGAVKYLECSALTQRGLKTVFDEAIRAVLC'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Migration-inducing protein 5
molecule tags Signaling protein
source organism Homo sapiens
publication title Yersinia virulence depends on mimicry of host rho-family nucleotide dissociation inhibitors.
pubmed doi rcsb
total genus 58
structure length 182
sequence length 182
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-06-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2h7vA00
4TZ0A 4S35A 1S4QA 3EA5A 3QF4B 2JGNA 4GDFA 4JLDA 1KIMA 2J87A 2UVQA 2REOA 4LPKA 3W6NA 4M1TA 1DOAA 3FWYA 1Z6TA 4BRUA 1E3MA 5BYJA 3UWOA 1XZPA 4PPQA 5JCPA 1XTQA 4J0QA 4JT4A 2AKAB 3RRYA 3D8BA 1W48A 5C2JB 1GL9B 3TLXA 3JZAA 1J70A 4YMSA 5CIWA 3NDPA 3L0OA 4B6FA 3RWMB 1Z08A 2XTMA 2R2AA 5KU1A 3C15C 4PSAA 2ZSBA 3QPWA 4TQ9A 5BYKA 1ZM4A 1P9RA 4DC9A 2ZRHA 1CKEA 1KI3A 1XPRA 5J4KA 2C8VA 2HF9A 1AQUA 1N3BA 2BKEA 2JIZD 3JZMA 4LBWA 3BFKA 4DLTA 3GLIE 3DVLA 2WSSD 3RHFA 1ZD1A 3CIOA 3KB1A 1IHUA 1FNNA 2AFHE 1NY6A 3J81k 3CKLA 4RVCA 1E94E 4EAQA 2FPMA 1T6NA 1HUQA 1W46A 1K5DA 2H5EA 3FFAA 4GRAA 1NN3A 2ATVA 2BEKA 4RSGA 2WAYA 2RGNC 3O8DA 4PAMA 5EXTA 3F0TA 4YONB 4UXIA 1R4AA 3OE7D 3WP0A 2PT5A 4C3ZA 1L7VC 3M1IA 4AYWA 1R5BA 2OCPA 4JLAA 3W34A 3THYA 1OB2A 1AJEA 2OILA 1XRJA 1QHYA 3BFXA 1DADA 2D4HA 3K0AB 4Y0AA 4MRVA 5EE1A 4KJZA 4ON9A 1XJ0A 1HV8A 5KDDA 4C2TA 1LTQA 1KI7A 5BXQC 3G0HA 3Q3JB 4DWJA 4G01B 3DZ8A 1J7KA 1CJKC 1SQ5A 2J0VA 2QMEA 2QTVB 2F55A 4CGZA 4HUQA 5FUXA 1P6XA 2A9KA 1S0UA 2J0UA 4HAVA 4TTQA 2IUSA 4ACAA 2A5JA 2XOKA 1RE0A 3LDAA 4JKYA 4RZ2A 2QNRA 4C4PA 1S9DA 4Q1BA 1E32A 3IEVA 4DSUA 5EE5B 8OHMA 4LCBA 2PZEA 2QSZA 1YR6A 1F2TB 3NTUA 2JLQA 3BB3A 3FGNA 4I4LA 4HB0A 2ZXUA 4B3GA 4FMDB 4JLBA 1W0JD 1E99A 3QIAA 4N0EA 3LW7A 4DDTA 1OF1A 3QOFA 5A4JA 1J99A 4PHGA 4IXMA 2WKPA 1ZM2A 3DOFA 2OFWA 4PO9A 3MJHA 4GPTA 4IVRA 1TL7C 4KVAA 3A1TA 1ZC4A 3WMEA 3W8RA 4BLSA 1DE0A 5E4FA 4C7OB 3TQFA 1P2TA 3SOPA 1E69A 3LWNA 1E6CA 1KTVA 2ZSEA 1DAMA 1G16A 1QVRA 1YKSA 3SYKA 3IQWA 4Z54A 1NLFA 2AK3A 3AUYA 2WJIA 3KB2A 2F43B 1GILA 1VPLA 4M9QA 3ZVMA 4MGIR 5TV2A 1R2QA 2AX4A 5KO2A 4URYR 1FL9A 1NIJA 1V5WA 2AK2A 4EPWA 2IEZA 3UG7A 3SJBA 2JCSA 4HDQB 2KSQA 2AL7A 2GETA 3I3SR 1G7RA 1NVUQ 3LBNA 4OQLA 1X8KA 4HAXA 1E2DA 1FUUA 2R62A 4CZ2A 2ZREA 3D31A 4OKSA 4ERNA 4AYXA 2N42A 3AVOA 2YOFA 3P32A 2IYLD 1VHLA 4UNQA 2GF9A 2A7QA 1HYQA 1SKYE 1Z22A 5IHPA 1D8TA 1KI6B 3QXSA 3KJEA 5JHHB 4NYJR 3GLGA 3REFA 3BH6A 1NSTA 1XTKA 3GJXC 3IDQA 2EU8A 3Q5EA 4FN5A 1IJFA 3RWOA 4A92A 4B32A 4K81B 1CBUA 1OIWA 1UEIA 2V3CC 3ZVLA 4KLNA 1K8RA 4A8JB 5BN3A 1TQ6A 5DN6D 4OK6A 2GEDA 4O2RA 2ZVQX 5AK0A 3B9QA 1FTSA 3KL4A 2ZS8A 5D3MA 5JECA 3GEEA 5K8LA 3QEJA 1XMSA 5B64A 1OH5A 5EP4A 1TF7A 4MKGA 5F2EA 4C0LA 1QHSA 1KO5A 1WQ1R 1T3SA 2IYQA 4Q7MB 3T1VA 3TRFA 3B13B 2VYFA 4G5GA 3U4QA 1NI3A 3CNNA 4PSKA 4QFMA 4TTPA 2GRJA 2H57A 5DGXA 3W90A 2QBYB 3IGFA 4D81A 2VHTA 2RGCA 4KVGA 5FTNA 2ZRFA 2NIPA 3TKLA 1NMYA 2AXNA 5J40A 3ICQB 4UJ3A 2WKQA 3U6BA 1BYIA 1WXQA 2FFHA 1AZTA 3PEVA 4JJZA 3TR0A 4B2LA 2OAP1 1QHNA 4Z8YA 5FBRB 2JA1A 2OE2A 3QBTA 1YU9A 1P2VA 4I99A 4M9SA 1NKTA 3GCGA 1Z0JA 2O52A 2JDIA 4HI0E 1U8ZA 4JLMA 2GXSA 1VKJA 4A2QA 3BXZA 4A8JA 4MDEA 3QUSA 2AN9A 3CWQA 3K9GA 4M1OA 5A5GA 2ZRBA 2X77A 3MJRA 5KSYA 1DELA 1TPZA 3N2EA 4L16A 3WNCA 1YHNA 1KK3A 2B21A 3SBDA 1W7AA 3EX7C 2X19A 1OFTA 4LJ7A 4XWAA 4V0MA 4Q1DA 1RJ9A 2WWIA 1OPXA 2ZM5A 2WPDA 2JLRA 4U02A 2FSGA 4KSBA 4R9UC 2H17A 1JQLB 3BD9A 1NF3A 1KJZA 6Q21A 1X8LA 2ODNA 3ECCA 4PC7A 1S1MA 2F1HA 2EW1A 4QBFA 5SZIA 3C41J 1NJFA 2IBMA 3DM5A 1E4VA 4HATA 1HH4A 2GEUA 4LY6A 4NYIR 4OQXA 4DLXA 3PUVA 4ESHA 3E70C 3FKQA 1ZBDA 2OFOA 3QBVA 2MSEB 2Q9CA 3KXIA 4YLGA 3B6EA 3B5JA 2EFEB 2IYVA 4D0GA 4QGAA 3TVDA 3P20A 2EWWA 5JWRA 2W2VA 2YJTD 1W1WA 3CONA 2CJWA 3CH4B 1Y63A 4Q7KA 1G8GA 3CBQA 1DVRA 5FBVB 4FINA 2QE7D 2RGXA 4NKRA 3LQQA 1B23P 1G9XA 4LYAA 1W0KA 4DCVA 2ZI4A 2ZUCA 4PC6A 3TAHA 2E1RA 1WBDA 4L4UA 1LF0A 2VTKA 2R6DA 3U7FB 1IONA 2PMDA 3RRZA 2QU8A 3QKRB 4Q4JB 1E9DA 1E9BA 3TUJC 2ZRJA 1ZU4A 2O8CA 3U3KA 2LKCA 4HZUB 4P3YA 1ZJ6A 4EFLA 2PCLA 1IBRA 2WSSA 4L9WA 1N6PA 2JIZA 3AQ4A 4LV6A 1TF2A 3CF0A 2G9NA 1UBEA 3FKSA 5IK2A 2V9PA 3BH0A 4YDSA 2A5DA 3KXLA 2BMEA 3NBXX 2GTPA 4LJ8A 4BQSA 4HLUC 2GJSA 4Q66C 4QHTA 1FFHA 1GKYA 1KAGA 4OHXA 1SVWA 3B1XA 3LXRA 4MUAA 4C0AC 3QVVA 4ABYA 2HT1A 3PVSA 3AVVA 5JSZB 1KZ7B 3QY0A 4KYUA 4LDJA 4QGFA 3NEYA 1CP2A 4KYIB 2RHDA 4LRWA 4RKFA 5JEDA 3K0SA 1N6NA 4BASA 2VRWA 4B75A 5FR2A 2J9RA 4F7WA 2QUZA 5DHFA 1ZIPA 1SVSA 4GFDA 4A0HA 4DLRA 4F93B 2ZQ5A 3LD9A 5A0FA 4M9XA 5CM8B 3GMTA 2NMVA 2JLUA 5EE0A 4HUTA 3KZ1E 3NIBA 2IUUA 1PLJA 1DPFA 2O8EA 4JS0A 3A1VA 1GVNB 5FTLA 3RS4A 1PUIA 1A2KC 1W4RA 1KI4A 1TF5A 4P31A 1VHTA 3A4LA 3AUXA 1KDRA 1IY1A 1G3MA 3CF2A 4TSFA 3CW2A 3VR6A 1XD2A 2WSMA 1TEVA 5JCZA 3U61B 2BDTA 3NHBA 1U81A 3WHLA 2RGBA 4Q00A 1N5JA 3VKHA 1U8YA 4DBLC 3TBKA 3BC1A 3NVAA 2GVZC 2G83A 3M4YA 1Q0UA 1TX4B 3K09C 1SVMA 3MWLA 4R7ZA 4CT5A 4U5XA 2CHGA 3GLFE 3CNOA 1IXZA 4FMCB 2FF7A 4BRWA 2KI5A 4F38A 4P4TA 5EZ6B 1M7GA 4F4IA 2YWHA 2L0XA 1E98A 5JHGB 4D0NA 1KY3A 3W6OA 2V8OA 3AVQA 2CE7A 5AJXA 1E2LA 4G0NA 3RAPR 2O8DB 1ZAKA 4FI3C 2J46A 5HPYB 2QL6A 3LY5A 2V1UA 2G0TA 4C0KA 1FUKA 1G3UA 4RCZA 3Q7QA 5LBIA 3BGWA 3VX3A 3Q9LA 1IN7A 1IXRC 1ZUNB 3EZ9A 1AK2A 3CR8A 3VMFA 3QXCA 2OM2A 3OEED 2V6IA 4QHSA 4ESVA 4B6EA 3K1JA 2BV3A 3K09A 2ZAOA 1UBCA 1XF9A 3IO3A 4PPNA 4DT1B 2B7BA 3SN6A 2YHSA 3HR7A 3QKRA 4N0DA 4PPGA 1CF4A 3QPVA 2WHXA 2ZJ2A 1FOEB 1OFHA 3T5GA 4F91B 3DMDA 5H1YA 3BOSA 5AJWA 5HR5A 3EZ6A 4BWYA 3CO5A 4AKIA 2XNDA 4C0JA 1JBKA 5CDFA 1RYFA 5CLQA 5SZKB 1ONBA 4BUJA 1E0AA 1J90A 3IIMA 2W2TA 4Q5IA 4AYTA 1AGPA 1KJWA 3AV0B 3ND8A 2H16A 4JVNA 4Q9KA 3LRPA 2ZR9A 2QY9A 1NJGA 4QGGA 5FL3A 3U7HB 3AP3A 4QGHA 4TSFD 1WE2A 2J5XA 5DI3A 1FPMA 1JXMA 3ZS8A 5HCIA 1DAGA 2GEVA 4X8MA 3F5FA 4B74A 2ZANA 3SEAA 2JASA 2WIBA 2VHCA 2KB0A 2A30A 1YZLA 4CW7A 4AWXA 3B7GA 1YZTA 4M53A 3GLIA 4D4KA 2EFGA 5FI0B 4B76A 2QN6A 2B92A 3QQ5A 1LVGA 3I8SA 4TL8A 2XTZA 4Q02A 1I4LD 2BM1A 4XSGA 4H1VA 1XTSA 4EPTA 1Z0IA 1ZC3A 2XZOA 1AS3A 3WRXC 1Q1BA 2X2FA 5EE9A 1ESMA 4PZZA 2YOGA 3PEUA 4MYUA 4HB3A 4NONA 3LO5A 1F2TA 2FZLA 5CB6A 4PAOA 1G5RA 2G1JA 4R98A 2GJ8A 2HLDA 1MABB 3GLGB 4RZUA 2NO1A 3BE4A 4FMBB 1UKVY 2C03A 3UIEA 3C4JA 2IHYA 5TXGA 1XPUA 2D2FA 1P75A 3RSOA 2JLVA 2DWQA 5JRZA 3RABA 2VQSA 3FOZA 2GESA 5FPSA 5C4GB 2QM7A 2OCBA 3I62A 4QNMA 2P5TB 1EXMA 1JPJA 2FMXA 3DDCA 4GMXA 4B43A 4MDFA 3F3YA 1Q21A 2W00A 1P3JA 4G5QA 3BBPA 1JEEA 2G77B 1AGRA 1CRQA 1N2CE 2WICA 3HWSA 4JZKA 4QJ5A 4X8HA 4BZQA 2RB4A 1XMJA 1X86B 1MO4A 2V4ZA 2VA8A 5J5CA 2DB3A 1G17A 1I4TD 3VNVA 1U2RA 2XOKD 2NO9A 2F43A 5FL7A 3GD7A 5EQTA 3TH5A 4EDHA 2QT0A 1M6NA 521PA 2VF8A 3RYTC 3BERA 5JI3E 4PO8A 5FPTA 2F1JA 2ODEA 4HYYA 1E2EA 2W58A 4IEIA 4DLVA 3V9PA 1MR3F 4TT3D 1JJ7A 4M9ZA 4WZBE 2VHJA 1XXHE 1R0WA 3B1YA 5E7IA 4BFSA 1N0WA 5L3QB 1NN1A 1UJ2A 2XB2A 1T3LA 4NCKA 4D4MA 1UEJA 3MWKA 2Z83A 3PUWA 2J0UB 2CCKA 3ZVNA 4LYHA 4TLEA 4OYHA 1BH2A 2V55B 1R6BX 2CDNA 1XCPA 2NZJA 2QGZA 5JMTA 2E9SA 3QEOA 1A2BA 1ZINA 2BIFA 2JATA 5K8UA 1I4DD 4PR0A 4OQMA 3THXB 1W2GA 2HCBA 1E2IA 3CM0A 4BE7B 1MT0A 3A36A 5DYIA 5SZHB 1U99A 3U7EB 4C7OA 2BCJQ 2CLDX 3CPJB 3OAAA 1OLOA 1RRPA 1CU1A 3K0AA 4TYWA 5J4VA 1IN8A 1E0SA 2IXFA 2F9MA 5LPNA 2RHMA 3IBGA 2H1LA 4LSGA 1LS1A 3NC1C 2K5UA 2VH5R 2WJHA 4FMDF 4P32A 4XOIA 4NPHA 3QSYA 1P9WA 2O8FA 1HE8B 4MGKR 2FSFA 4TL7A 3TR5A 1DAHA 4NMMA 2PEYA 1NBMA 4Q03A 3DM9B 4LX0A 4HDCA 5KPDA 4YXWD 4TTRA 3BRWD 2IWRA 4TN1A 1UPTA 2BBWA 2DPXA 4HLUA 4RCYA 1Q57A 2AD1A 1DG1G 4XSHA 2IF2A 1M1YE 4QBIA 5JS7A 5JSZA 1JECA 5TVKA 4KLZA 4YQFA 2IS1A 5B58C 4JYCA 5JLJA 3KQHA 2RGDA 2IXEA 2QRZA 3RDPA 1W4BA 3H2YA 4CRWB 4KO8A 4TQUS 2ZRPA 2YWGA 1NKSA 1I2MA 2KE5A 2CJWB 1E2MA 2RCNA 1GITA 2ZYWX 3M6AA 4A2PA 3THXA 3ZQJA 2QEQA 1L2TA 2BOVA 3HDTA 1Z06A 1E9CA 1QF9A 1XMVA 2C9YA 1UF9A 2ZI9A 1PV4A 1F2UA 4RZ3A 4P0TA 3CLVA 5CYPA 3SJZA 4BLOA 4TLDA 4OQNA 2QZ4A 3W5JA 1A1VA 4D26A 3B2EA 4ZCMA 4M1WA 4LPSA 4DB2A 4KFRA 1J8MF 2P5SA 1YZKA 1E0KA 5J4HA 1AQYA 1G21E 4QG7A 3P4XA 2GCOA 4RZXA 3MWJA 4UNRA 3R9WA 2WTUA 1NMXA 2DFTA 4AC9A 3SFZA 2P6UA 2NO7A 1YZNA 1YZGA 3PQCA 1EFUA 4W9MC 5BQ5A 1Q20A 4PHTA 4UNNA 1SXJC 3EIHA 2BM0A 1K5GA 2PJRA 4MKIA 2BJVA 4ZDWA 1NBME 2WM9B 2V7QA 1W49A 2CHVA 2OBLA 4ZV4A 5L3SB 4FCVA 3T1QA 3EWAA 1OXSC 3GLGE 2J7PA 2FGJA 5G53C 4LGMA 2Q0HA 2ZEJA 2NO0A 1U0HC 2V6JA 1P72A 2GAAA 4OI4A 2C99A 3PEYA 1KI1A 4LBYA 1KSHA 2YWFA 4NU0A 2RGNA 2CCJA 4V0ME 1DBSA 1SHZA 4RFSA 2J0QA 2A2ZA 2GJKA 2B6HA 1JQJC 4RFVA 1W0KD 1GRQA 1P2SA 1G7CA 3ZZ0A 3RLFA 2GCNA 4Q1EA 3O8BA 2FGKA 1CJUC 1KKMA 3ASZA 4QXAA 1FX0A 2XNSA 4M1KA 5TDHA 1DARA 2ZU0C 1WRBA 4B34A 1T0HB 1KDOA 2EYUA 4Q9IA 1YE8A 4HDOB 121PA 3PV0A 3ZH9B 2FA9A 2YVUA 3QENA 5J4LA 1FW6A 1JPNA 1OFIA 4Q01A 1G41A 1G64A 3R20A 3HU1A 5LB2A 4CYMA 2DFNA 5E3HA 1G7SA 3R7WA 1ZUHA 5DI9A 3QF7A 1S9HA 1XEFA 4CF7A 4EPRA 2AWNA 3BIFA 3FDIA 3MWYW 5DLQC 4P4SA 3RANA 5TY0A 1KZGB 1QHXA 4D80A 4IW3B 5L3QA 2J45A 5E95A 2PZFA 2PCJA 1F60A 3CRRA 3RRMA 4JLPA 1GL6A 5D3QA 1US8A 3IIJA 2CLSA 4U00A 3UATA 3HU3A 3SNHA 2WWHA 1G3IA 1ZM9A 2QAGB 1AN0A 3MUFA 4U7DA 2HYIC 2XB4A 1IQPA 1LS6A 3FVQA 4OQFA 1J8YF 4RD2A 4TL6A 5HTKA 2JLWA 1VG8A 3U3JA 3O8CA 3EXAA 3KFXA 2N1BA 1DTSA 3B8HA 2RAPA 3X1XA 4CEIB 5C46F 3AVXA 3PG5A 1UFQA 1CULC 3TE6A 3VR4A 3X1DA 1NLZA 4I1SA 5FBLB 1OIXA 1EK0A 2OFXA 2AFIE 4CVNA 2IYZA 2DFKB 3K70D 1RJ9B 4URUR 1W5SA 4QNRA 3GLFB 1N6KA 2LCFA 4KV9A 5CK4A 3K0FA 2TMKA 2H92A 5GVRA 3A1WA 1EFCA 3GFTA 3T61A 4V03A 2GJAA 2XEXA 2A3RA 4XVQA 1CR1A 1Z5ZA 4ZI3A 1R0ZA 3CB4A 4TMTA 1KI8A 1T9HA 4ZCLA 2JLXA 2WOJA 2A5FA 5FI1B 3RS7A 5JWOA 2OXCA 3L82B 1PZNA 1AKYA 1S3GA 2C9CA 3SBEA 4MA4A 1NG1A 4AG5A 4RD6A 2IUTA 1CLUA 1CR2A 2AR7A 4GOXA 4IXNA 1W36B 3EPHA 3AKDA 1XEXB 1Z2AA 2AD5A 2ONJA 4AIIA 1G8PA 1KK0A 1NLYA 1I2DA 1PLLA 4JLOA 4XWOA 1Z0FA 2R8RA 1G8HA 2RGAA 3FMFA 1WDTA 2DYKA 3H84A 5K8IA 1K6MA 4LYJA 1DG3A 1KI9A 4LHZA 4ZKEA 4FCTA 3MAAC 2VP4A 4WOPA 4C0BA 2ODWA 3LLUA 2FOLA 3K0EA 3E1SA 1U9IC 3UWKA 1Q3HA 2EVWX 3AEZA 4F4CA 1W36C 1EFHA 1E1QA 2R9VA 5DYGA 3U3OA 1U0JA 4G5OA 1NVXQ 4Q9JA 1WBBA 5JJIA 1KKLA 1YJ5A 2OXRA 1FX0B 1R8QA 2ODBA 4Q1CA 4BFWA 4A0FA 3EWSA 1NN5A 2OCYC 4LBVA 2CXXA 4FXPA 2CE2X 2LWIA 2J0SA 1N6HA 4R2IA 1YZUA 4DLZA 4P4SB 2GBLA 2ZIAA 1VCOA 2HYDA 3AVTA 1VDZA 2I4IA 3C5CA 1OH6A 1H8HD 5FUYA 3U44B 3ZZUA 3I61A 5EXPA 1RPZA 3KJGA 2D7DA 4LJ6A 1EWQA 5FTMA 2ZR0A 1Q12A 4LC0A 3U44A 5KPJA 1SULA 1KY2A 2W6JD 1ZRHA 3REGA 3UPUA 4CEJA 3EARA 4IOJA 2GXUA 3LXXA 5E7MA 5E7JA 2QAGA 1UBFA 3QXXA 2IW3A 2ZYTX 3TNFA 4E03A 3MRSA 1N0UA 3X1WA 3QXJA 1IN5A 3BS4A 4BLTA 2F6RA 2CEAA 2G1KA 2F3TA 4JT2A 4V0OA 1N5LA 2BBTA 2QPAA 4CT4B 4BFUA 3KKOA 3HYTA 3KUCA 3PUYA 4PXAA 2IS6A 3HU2A 2JJ8A 5B57C 5EUMA 1HT2E 1AIPA 2Z4RA 4RY2A 1G5PA 2EQBA 2Q9BA 2IC5A 2QORA 1NP6A 2FN4A 2FNAA 4OI0A 1VCIA 1A4RA 1QVAA 2ERYA 4BFZA 3OFND 2EFHB 4QHYA 1WB9A 1RFLA 2QBYA 4M1YA 2UZIR 1E1QD 2X8AA 3EASA 4HAWA 3RNLA 2ZJBA 1M34E 4ASUD 5KNDA 3B78A 2ZYUX 2D7CA 2P3SA 5FUWA 3FKSD 4XWKA 1PVOA 3AF1A 1II9A 3ZVRA 1QHIA 4C2UA 4NYMR 3B9PA 3CUEF 3SFVA 1R0XA 3H0KA 1II8A 5EXSA 2VP9A 1SZPA 4KODA 5CDFE 1EWRA 4GNKA 3CWZA 4B3XA 2PH1A 2CVHA 2C5LA 1YQTA 3B1VA 3LV8A 3ZZTA 1E2GA 3D6TB 421PA 2WVJA 1WMSA 4EJSA 1MO3A 2IL1A 2Y8EA 2OESA 4TT3A 2OAQ1 2ATXA 3WRYC 5UKDA 1LB1B 1TQ4A 1V43A 1D6JA 4OHZA 4B44A 1IY2A 4II7A 2A5YB 3H86A 4BECA 4KAXA 2GBLC 5CYOA 2GKSA 2IHBA 2QROA 4QBGB 5FOVA 4YMUA 2QPTA 2WJJA 5LDDC 2W2XA 1RVDA 1ZNYA 3LNCA 3FPAA 4Q9LA 2SHKA 3OEHA 4GZLA 4FW9A 4TMXA 1KDPA 2YC4C 4KXFB 1VIAA 2QMOA 3TAUA 4TYPA 3L8YA 4PX9A 4Q4AB 3FHCB 4DIDA 4JBXA 4TMZA 4EIWA 5ANRB 4W5WA 3IEUA 3QKTA 4X8OA 1SHKA 1U9IA 4LHVA 4NCHA 3SHFA 3V4FA 2NOAA 4IVPA 2XZLA 3QG1A 2QMUA 4W5HA 1TADA 2ZRNA 3I92A 2BBOA 4UNPA 4WW0A 2C04A 1AZSC 5HKKD 3EIQA 4DDUA 2FFAA 3SYNA 3VX4A 4EQ6A 3BFVA 2HLDD 3G5UA 5SZJA 4D4JA 4DHEA 1J2JA 221PA 5F98A 4KFSA 3WNDA 2IS4A 2EFCB 3BB1A 3NBYC 1ZM7A 3X2SA 2J3EA 1E2QA 4KBGA 5EZ5A 3WMGA 3NH9A 5KNCA 3LLMA 3SC3A 4IFEA 1NY5A 2DR3A 4M21A 1WCV1 2GK6A 4D4LA 1UAAA 1VG0B 4URZR 5HE9A 1D2EA 3DL0A 2PZGA 3AGQA 2Z5FA 3K9LA 1NRJB 2CHQA 1GNRA 1QG4A 1DAFA 5FTJA 1GG2A 2PJZA 1W5TA 1W4AA 2HJVA 1G20E 3WNBA 3IBYA 4LJ4A 4LC1A 3ETLA 2QI9C 2WWXA 5D3MB 2ZETA 3GJ0A 4NBSA 2R6FA 1VCNA 1UBGA 2R6AA 4JVMA 1BOFA 1OW3B 2QP4A 2XNDD 5K8TA 1CEEA 2FJUA 1SKQA 2IK8A 3CZPA 2ASEA 4O0MA 1E1RD 3LX5A 5TARA 3Q72A 3TW8B 3A4MA 2YOHA 4LJ9A 1IOZA 2WMNB 4KFUA 1ZNXA 3IPYA 3MG9A 4V0LA 2LKDA 3PUXA 3GEIA 5KYKA 4C0SA 3PUZA 5GJBA 1XTIA 1N6OA 1QRAA 5DHAA 3ZYCA 3MSXA 4IDPA 4NTZA 3U3RA 2V54A 4AK9A 2RGGA 4GOKA 4EPYA 2BEJA 4F4JA 4AI6A 3AVYA 2F7SA 4WXPA 3TJZA 1YR8A 1FNMA 4US0R 2BJWA 4TZ6A 1T91A 5FL7D 1Q1ZA 3GPLA 4NP6A 3B82A 3A58B 2AKYA 1XTJA 1OHHA 4DRZA 4Q9HA 2GWHA 5CITA 4I81A 5DI3B 1B0UA 721PA 3KTAB 4Q4AA 4HLDA 4MRRA 1A82A 2VP5A 1QHGA 4DCTA 5IRCD 2NPIA 4LBZA 2IYSA 2YZ2A 4N1AA 2H8KA 4XVRA 5GJWC 2HJGA 2QP3A 2GCOB 2ZROA 3X1YA 1Z63A 4IVQA 1R0YA 1E2NA 2J1LA 1D2MA 4W5JA 1TU3A 3KJHA 3THWB 3QKUA 4GZMA 1HQYE 2IXGA 1CRPA 3ZLJA 2FX3A 1Z28A 2ONKA 4LJ5A 3SR0A 3WBKA 1E2FA 1T3HA 2IYWA 3GLHB 5B30A 1R10A 2UZ3A 1MOZA 4NYIQ 5HKKA 1VTKA 4IDNA 4BZPA 3IUYA 1JAIA 4TLAA 3SHWA 4S2EA 1E2KA 4IOMA 3E2IA 5G3ZA 4QBHA 2XTNA 1RW4A 3IO5A 4LUCA 1SXJB 3K9HA 2OO7A 2WZQA 4FIDA 4XD7D 1O87A 1XEWY 2KJQA 1OKKA 4A82A 1NBMD 2ZU6A 1P61B 2ZUBA 3ND9A 3AKCA 3R9IA 2ZJ8A 3A6PC 1KO7A 1T8UA 2W0MA 1GKIA 5IT5A 4ZIRB 4E5UA 2D62A 4BFXA 1TUEA 5FTKA 2BMJA 4PC2A 2VSXA 5KHOC 3LA6A 1QHHA 3RS0A 4NYJQ 4ZPXA 2CK3D 2ZRDA 2QMHA 3PFIA 4NYMQ 3LVRE 2VP6A 5JJLA 3V00A 2O8DA 5JWHA 1DAEA 4DCUA 2O5VA 1JI0A 4TMWA 2ZAMA 5H70A 1NN0A 1JALA 1M7BA 1CS4C 2FSHA 3B1ZA 4BFYA 4M1SA 3U60B 1KHTA 1Z2CA 4G5SA 2WIAA 4FD2A 3Q85A 1EFRD 1P9NA 2IEYA 1ANKA 2HT6A 4B3BA 3EG5A 4IEEA 1X1RA 4GBMA 5L3SA 4B3DA 2GJ9A 4A4DA 3QI2A 4L8GA 5KOYA 3O8RA 4PSVA 1C9KA 4BPBA 2CL6X 2W0SA 1E9SA 3TQCA 1F5NA 5FUVA 2OSBA 1XMIA 2P67A 5J47A 1VYVA 2JJ2A 3AP2A 4DEXA 1U94A 4A8JC 4ZDJA 3L2OB 3GEHA 1T4GA 2REBA 3TIFA 4DZZA 5TMPA 4NHOA 3GJ7A 5FFMA 1NL3A 4GSYA 4NH0A 1ZUIA 2J41A 2ORWA 5JS8A 3LW8A 2F9LA 2YWEA 5H68A 5LD2B 1YRBA 3KTAA 3P1JA 5FR1A 4EJSC 2QPOA 2ORVA 2JLYA 4QRHA 1Z6AA 3KQLA 5FPKA 3AKEA 1IY0A 2Q9AA 1IN6A 1XWIA 1HA3A 2FU5C 3VAAA 4LK2A 5BW8A 1TTTA 3GLFA 1OKKD 2WKRA 1U98A 4UKDA 4AY2A 1ZU5A 1YR7A 4O2LA 2H18A 3N2IA 3ADCA 2J59A 4MQBA 1N6LA 2IYYA 1U90A 2HV8A 3IILA 4POAA 3T1TA 1GL7A 4D82A 1EX7A 2GCPA 3S1AA 2QAGC 2XSZD 4Q7JB 2PLRA 3DO6A 4RD0A 5GADl 3NC0C 3IKJA 4LV8B 2FEMA 1D5CA 4LWZA 3DKVA 1DS6A 4A2WA 4ACBA 3FYHA 2ZSAA 4CEHB 1JR6A 1HQCA 1EGAA 3OIYA 1US8B 3E5HA 4ITRC 4H9GA 1VYUA 2IS2A 2CNWA 3K53A 1SKYB 1IAQA 1RRFA 1SXJA 1XJQA 3CRVA 5CK5A 3VR5A 3AF0A 4A36A 5JFGA 4DLWA 1RRCA 4DSOA 1OH8A 1COWD 3ZDQA 2XJ4A 3SS8A 2P0EA 3BJIC 2DCUA 2C95A 2IYUA 3JVVA 1Q1EA 4WZAE 1OFUX 3IHWA 1KK2A 4RJLA 3H1TA 5DIFA 5L3VA 5BN5A 2D3WA 3ZS9A 4OHVA 4MYTA 1Z47A 4C0QC 1QHHB 1Q1QA 4I1VA 4K8OA 3VU9A 4ARZB 4DUGD 1C4OA 3SYLA 1G5TA 4HLCA 2ORIA 3MFYA 3AH8A 4EFNA 1M7HA 4MITA 4Q47A 3OEHD 3U4QB 1XNJA 2D74A 2GZHA 5JRJA 4YMVA 1OXUA 3K0FB 2OCAA 1JB1A 3NH6A 1YVDA 3BWDD 2VO1A 4OBEA 2IX3A 1Z0KA 1SXJE 5CJ2A 2UKDA 1KNQA 2OLJA 3OIVA 4LJAA 2I3BA 1XEXA 1CR0A 4Q4LA 4Q4HB 5FPYA 1P2UA 2C9OA 5DNYB 3GJ8A 4G3XA 1KO8A 1GSIA 3ONWA 3MMPA 2ZSDA 3EW9A 4URVR 3DEFA 1AA9A 2ZRKA 1N25A 3FB4A 2VHQA 1P60A 3SDZA 1ZMXA 2Z43A 3M0EA 3EZFA 4US2R 2WWYA 1XD8A 3LBIA 5FPHA 1A5TA 1VECA 2REXB 3OAAD 2HXSA 5B2ZA 3I5YA 1F48A 3VR1A 4PHFA 5FOUA 2ZE7A 1MRNA 2CLCX 2W6ID 4ASUA 4BGDA 1QBKC 1ZNZA 4B3CA 2OV2A 3I5XA 1Z6YA 3T34A 2B7CA 1ELOA 3GJ5A 1F6BA 4JVLA 3BORA 2O8BA 2BMFA 2KBEA 4BFVA 4TYYA 3QKSB 4OL0A 2PMKA 1XU4A 3NXSA 1RKBA 1BYUA 2Q3HA 3D3QA 4P4UA 4KITB 1WP9A 3DZDA 1E1RA 1G3RA 2QG6A 4Q1AA 1OXVA 4XJXA 5G3YA 4LOAA 1XCMA 3R7WB 4NE2A 1JNYA 4BZXA 3BB4A 4A0RA 1G19A 3GJ6A 3NHAA 4HZIA 3FTQA 3HP1A 4XTCS 4KU4A 1SVOA 1Q3TA 4IHQA 3A37A 1G4UR 2J7KA 4O3MA 4DEYA 3OESA 1CTQA 4ZDKA 4HEJA 4HAYA 2YKGA 2OEPA 3DPUA 4PC3A 2PL3A 3B60A 3KKQA 1O3YA 4PHHA 2W83A 4US1R 3OZXA 2GDJA 5P21A 1OB5A 2ZRMA 5AJVB 3EPJA 2E87A 3EAQA 2HXYA 1OV4A 4GP6A 4PPFA 4IOKA 4TLCA 3DOEA 1R7RA 1TNDA 4KFTA 2FFQA 1XDBA 3FHOA 4OJKA 1G6OA 1D9XA 1VG1A 4W7SA 3KKNA 3K70B 4PZYA 1JXOA 2WMOB 3N5CA 3UK6A 5ELXA 5AJZA 4DCNA 1TMKA 2ZITA 3T15A 1KSJA 4AKGA 2ANCA 1MO5A 1NSFA 2OHFA 1S8FA 4YDHB 3EZ7A 3RSLA 3AVWA 1KAOA 2ZE8A 3R8FA 1NVVR 1RYHA 2IYXA 1ZIOA 2RKOA 3CF6R 3WMFA 4A1FA 3CRW1 2VL7A 5JZVA 3EPKA 4NCIA 4UJ5A 2AHOA 1P5ZB 3GJ3A 4OJQA 2Q21A 1AKEA 5HZHA 4MYHA 4Z51A 5IK2D 3K70C 3ADKA 1G291 3AF2A 1E0JA 3B85A 2Z6VA 1G1MA 3P4YA 2XXAA 4C0HA 1KSFX 2GF0A 1T5LA 1VCMA 4M22A 2NGRA 4A0GA 4MGZR 4HUQB 1OHHD 4PTLA 2DHRA 3KDSE 1KO1A 1AS2A 1S3SA 4FMCF 1E2HA 4M0LA 3TUZC 4XVUA 1SVLA 4JLNA 3FHTA 2ANBA 2VEDA 3WYGA 4ZO4A 1S2MA 2HDNB 2O0KA 4D6PA 4I1OA 4E22A 3EIEA 1R5NA 2YC2C 3MGCA 4EPVA 3KX2A 1BIFA 2ZRAA 5KTYA 2BCGY 3OFNA 2YYZA 2D06A 1E9EA 1WF3A 3U5ZB 1TAGA 1P4SA 3VHXA 1G8YA 4TWZA 1XD2B 1YRAA 3EPLA 2HF8A 2WJYA 4H1UA 5G40A 2JJ1A 2C77A 3HJNA 5FBWB 4KI0A 4IDQA 1OT3A 4A15A 4XTRA 3L43A 1W0JA 3VNUA 2BBSA 5CB8A 1EFRA 4HB4A 1EX6A 1DO2A 1E79D 3T35A 1H8ED 3GJ4A 1YR9A 2FEOA 4D0LB 2DWPA 4CEJB 2WV9A 1TQDA 4CEIA 2QAJA 3C5HA 4JKIA 3QPUA 4DDWA 1GP2A 1CJMA 3DHWC 3AKYA 1XPOA 2GXQA 2ZI7A 1D9ZA 2ZJOA 3U6KA 1HTWA 3AVUA 3NEJA 4M1MA 5AUQA 2QP9X 4A9AA 2ZRLA 1HT1E 4LHYA 2IT1A 1ZM3A 4EPXA 4OI2A 5EXXA 3CR7A 1CXZA 1GOTA 2ERXA 1DAIA 4URWR 4TLBA 1KMHB 2G88A 4DXAA 1IJEA 3C16C 2EYQA 1H65A 1H8EA 4QOSA 1KO4A 5DE3A 4O25A 3QF4A 4YMWA 2GHIA 5DISB 3UMRA 4P33A 1TU4A 5FBQB 1QZXA 1HURA 3GLHE 1LV7A 3QKSA 1GNPA 3CZQA 2ZS7A 1XB2A 2JJ1D 4B47A 4KSCA 3X1ZA 3IIKA 3THYB 3KKPA 2I1VB 1VIYA 2FE4A 1E96A 2XAUA 2VPPA 5L8VA 2RMKA 5CM9C 3CX8A 4UXJA 3OIWA 4JIMA 4BFTA 3CNLA 1E4YA 1R8SA 2QGNA 4FCWA 5EUQB 3VTKA 2XXAB 4JBYA 3W3AA 1GFIA 2VBCA 2D2EA 2JLZA 2IF0A 2ZSFA 3CPEA 4A6PA 2GAOA 3DMNA 5TB5A 4DVGA 1L8QA 5F9HA 1QG2A 5AWFC 3FE2A 3LBHA 1RRGA 3LH5A 3MLEA 2BWJA 2C96A 2FH5B 4UXHA 2GVDC 2G0NA 4LV5B 3VQTA 3UG6A 2MMCA 4PQFA 2QA5A 4M4SA 3I1FA 5DN6A 3W9YA 1G3QA 4QM7A 3I72A 1JR3D 3GLHA 3THOA 2ZR7A 2RGEA 1SVIA 2ZYVX 2BKUA 3P27A 3CX7A 3NBFA 3L0SA 1NMZA 2X1VA 4BLPA 2F3RA 1TUIA 4MRNA 3IQXA 5EP3A 4Z1MD 2AWOA 2DY1A 4IOLA 2FSIA 3PENA 4NZYA 4GL2A 4V0KA 4PO1A 5FOXA 3AB3A 2F1IA 2MSCB 4ZDIA 5FOTA 2BHRA 4DSTA 4DUGA 3BAFA 4QM6A 5FOWA 3LAWA 4QJ4A 2VF7A 1GNQA 2QE7A 3VR2A 4LZZA 1LFDB 3SZRA 3P26A 3N70A 2CL7X 2OZEA 1E9FA 3VFDA 4GT1A 4EKDA 1CIPA 3U3MA 2QQEA 3RC3A 5JBQA 2F1RA 1PJRA 1ZD9A 2VLIA 3SU8A 4DLUA 5F3WB 4MH0R 4UNSA 4JL6A 3C8UA 2FDCA 2QQ0A 4YC7A 3WYAA 3A1SA 2WWWA 1XXHB 3IPXA 3Q8XB 4NCNA 1KNXA 5AJYA 3NWJA 4JBWA 1LY1A 1FZQA 3KFVA 4LJYA 1BMFD 3EC2A 1ZP6A 2FV8A 3RRNA 2GA8A 4ZI2A 1DEKA 4DJTA 3EC1A 2WPDD 5LB4A 3TK1A 4C9BA 4C30A 5FH9A 3LX8A 1MRSA 3GQBA 5FOSA 3H4MA 3W5IA 4CIDA 2IYTA 5GVSA 3F8TA 3LVQE 1MABA 3EZ2A 1U8AA 3TMKA 3PR1A 2NO6A 3TSWA 4B73A 3UMFA 2Q3MA 2OT3B 1KJYA 1P62B 2V1XA 1ZYUA 1Z3IX 2IWHA 1ODFA 5JEEA 4UQOA 1QDEA 4ZKDA 2CBZA 1XBTA 4OK5A 4EFMA 1NIPA 3T1OA 1ZCAA 4X8LA 5JJKA 1BMFA 3UMSA 3QVUA 4JSYA 5CIQA 1VMAA 4HB2A 2G6BA 4JVSB 1OIVA 4PZLA 4TMVA 1U0LA 3VHLB 2EFDB 4PQRA 1W47A 1UADA 5AUPB 2IYRA 4GI7A 4ILEA 1Y3AA 2B8WA 1FQJA 1XXHA 3W6PA 4V0NA 4OK3A 3SQWA 1OJLA 2GK7A 2NQ2C 1JAHA 2C2HA 1UDXA 4M8NE 1LF5A 1GM5A 3KUDA 4Q48A 1Z6XA 4PANA 4BLRA 1IN4A 2QT1A 1NVVQ 2PEZA 5LD2C 4JL8A 2PBRA 5J4YA 2GXAA 2ZRIA 1SVKA 5F9FA 2O8EB 1A7JA 4QL3A 1WA5A 1JR3E 1KDTA 3WY9A 4CEHA 4B48A 2CVFA 4R2HA 2YINC 4AURA 2H7VA 1II8B 1FP6A 4Z1MA 2NTYC 3W3ZB 4AG6A 4DSNA 1BO6A 2ZVPX 2O0HA 4WBSA 1DAKA 1E2JA 2RH5A 4RFSB 4GMDA 2ZE6A 1X6VA 3HPRA 5DSZA 3HPQA 2B8TA 821PA 1JR3A 4HSEA 4BEJA 2DBYA 4D25A 1OXTA 2OLKA 2QTFA 2C98A 3AGPA 2OG2A 3ZGXA 3HYRA 1MO6A 3TW4A 4EUNA 3TGPA 1IXSB 1X3SA 2HCJB 1Z8FA 3VKWA 3KQUA 1KYIA 3PXGA 3SI7A 5KUTA 2GNOA 2J7PD 4JLVA 3GP8A 1OH7A 1T8TA 5CJPA 3B1WA 4MKFA 1EESA 3EA0A 1GUAA 2JLSA 2KWIA 4MKHA 5KSPA 5EP1A 1PUJA 4JMPA 1Q22A 1Z6GA 1W36D 2XZPA 1N5IA 2NZ8A 5KSZA 3SQXA 1DO0A 5KSOA 1FMJA 3CPHA 2X2EA 5L3RA 3ADDA 2ZTSA 4TL9A 4F92B 1OYWA 4JYBA 3ADBA 1HE1C 4LI0A 1XD9A 2NG1A 1KK1A 2CNWD 4B3FX 2JEOA 1R5OA 4E07A 2O0JA 2VP0A 2C78A 2ZS9A 2YNMA 1UKZA 2GZDA 1COWA 2P65A 1PLKA 3ZD7A 4Q4JA 4IRUB 2QENA 4DLYA 4DIEA 4XIGS 5C1BA 3ZD6A 2Q6TA 4WA7A 2DFLA 2GILA 4IDOA 4NDZA 4XH9B 4ZCIA 3VU9B 4NCJA 5EE3A 2WOOA 4ARZA 1W2HA 1N0VC 4FWTA 3QG5A 4NL4H 3KQKA 1P7CA 5GJCA 3RS2A 3GFPA 1Z83A 2ECKA 2P2LA 3FMOB 1ETUA 2ZJYA 1ESNA 4N3NA 4KBFA 3WBJA 5BN4A 3ZIAA 1XEWX 1GTVA 2DWOA 2ZRCA 2WWFA 3Q7PA 4ZIRA 1ZNWA 1CR4A 2W6JA 2XJ9A 2GZAA 3JVUA 2WBLC 4HLQB 4OHYA 4Q21A 3TUIC 2ZI6A 4TMKA 4JSTA 1T0JB 1XJCA 4DKXA 3TSOA 1S96A 3QNUA 5EJEA 5M04A 2Q3FA 5HE8A 2HEIA 3PJRA 3THWA 4QC2A 3T5DA 1KOFA 1FMLA 621PA 3T06B 1EG7A 1TEXA 3UKDA 2FZ4A 1P73A 2I1QA 1S1CA 4AKHA 1LNZA 2CMKA 3NG1A 4TYQA 3AP1A 4DCSA 1RC8A 2ZI5A 3CRQA 4PAQA 3RS5A 5HZKA 3OE7A 1Z29A 4MUBA 4Q1FA 3CX6A 1XZQA 3TVTA 2ZRGA 2W6IA 4B2PA 2QM8A 2N46A 5CLLA 4HZUA 3PIRA 2FPLA 1T5IA 1X8JA 2WJVA 5DH9A 3ZIAD 1NVWQ 3AF4A 3RS3A 5GJVC 1MKYA 3NKVA 4IJMA 2YV5A 4L15A 4AKEA 5AUOB 3KQNA 1GRNA 2R65A 4LHWA 2R6GA 2OBMA 1C1YA 2WWGA 1MV5A 4R71A 1UKYA 1ZW6A 1Z0DA 1N6RA 1GRRA 1HY3A 1NG9A 3K8YA 2KBFA 1JEDA 1XX6A 1ZVQA 4MRPA 4B35A 3AM1A 1M74A 3LFUA 4URXR 2ZE5A 3K9NA 4V02A 4A6XA 3L0PA 1VG9B 5C18A 3SJCA 1KGDA 2P6NA 2XITA 3A4NA 5IDVA 4QKQA 4YMTA 2BVNA 1E9RA 3QE0A 1CJTC 2CCGA 4JJKA 3V4RA 1OXXK 1ZCBA 1OYYA 3R8CA 4Q18A 4WAUA 5AUNB 2WJGA 2PLFA 2VP2A 2PT7A 3QXHA 5KDOA 1GDDA 3W8NA 3KKMA 3MD0A 4L9SA 3VR3A 1TQ2A 1E2PA 2FPKA 4RD1A 3GFOA 2G3YA 3QJYA 1W44A 3OIUA 1JJVA 1XTRA 1UKEA 5JI2E 3NDBB 1GAJA 1G18A 1IM2A 1RIFA 4JL5A 1GIAA 4G1UC 2PX0A 1KMQA 4RD3A 1FQKA 4WXRA 3SJAA 1FTNA 1YZQA 3UXMA 3FFBA 2IA5A 3G82C 3KJIA 1G8FA 2CL0X 1X1SA 1G6HA 1EFTA 1N5KA 2XX3A 3Q5DA 1ZD8A 3UANA 3HR8A 5AR1A 3AF3A 3A8TA 4Z8XA 2R6CA 2Z4SA 4YXWA 3MCAA 1BS1A 2ZJZA 2QTHA 3S1AB 3GLIB 4Q19A 2A5GA 3BH7A 1G4AE 1Z0AA 3K0CA 4IKEA 1XP8A 1GWNA 2HUPA 4BEBA 2QRNA 2ZJAA 2ZI3A 1KSGA 2XSZA 1NNEA 4OHWA 4QJ3A 1AM4D 2FG5A 5EP2A 4DLSA 4B33A 1XFAA 2BC9A 3ICEA 3R9XA 4G5RA 3WP1B 2XGJA 3L8ZA 2OBNA 4L5BA 2MSDB 4MRSA 1HEIA 2FFBA 3FMPB 3OHMA 1AS0A 1UDWA 4WVFA 3C7KA 3VKGA 1KMHA 3I73A 3U7GA 4WZ6A 3SE0A 4PQYA 2NPFA 1L4YA 3L0IB 2FWRA 3D7MA 1CJVC 2VSFA 1Q44A 3O47A 4HAZA 4K46A 3U2QA 2ZUDA 5H8WA 4LHXA 4I1UA 2P6RA 4M2LA 4DT1A 4E09A 4JLKA 4RKEA 5C4MA 1D2NA 4TQAA 3ZJYA 2WAXA 1VYTA 5HCNA 4GP7A 1FP7A 3WHKA 3CRMA 2JJ2D 4DB4A 2ZPTX 2O8CB 1OSNA 1G7TA 2O8FB 1OE0A 3OEEA 1M8PA 3T12A 1UM8A 4CDGA 4DDVA 4KCGA 3I32A 2O8BB 3PCRB 4D2IA 3FMIA 4AD8A 5KNBA 3I4LA 2VHUA 4WIAA 2Z0MA 4JLJA 4Y0VA 4Q7LA 1N6IA 2R44A 3RC8A 2V7QD 1MH1A 2BMDA 2QSYA 4MGYR 4PFSA 1KI2A 4BLQA 1L4UA 3LQRA 4EQ6B 1SGWA 3NBZC 2MMGA 2JDID 3I8XA 3KXKA 4Q4HA 3PEWA 2AXPA 2CK3A 1M2OB 3IHLA 3WYFA 1Z07A 3DKPA 2A78A 4HAUA 5KDLA 1KI6A 3OF5A 4EJSB 2PX3A 3ASYA 3RVBA 1XCGB 3BK7A 1H8HA 3CH5A 3K0CC 3A1UA 4MYCA 5G41A 4OI1A 3AVPA 4B2IA 1LW7A 4GOJA 2OUKA 2VSOA 1SXJD 4RD4A 3WXMA 1W4CA 1E9AA 4XD7A 1F3OA 3PITA 5IF9A 5BWMA 1E79A 1RZ3A 2JAQA 4PC1A 2EWVA 5DO9A 4B71A 1BKDR 3TSZA 4KHZA 4LYFA 2VIIA 4IFBA 3ZQ6A 4IDHA 1GZSA 4TYNA 4FWIB 3C14C 1II0A 2ZJ5A 1GKUB 1F2UB
chains in the Genus database with same CATH superfamily
2VYQA 1PEAA 1MZVA 2FPGA 3IA7A 3NGMA 1XU9A 1YJBA 1S4QA 2PFKA 3EA5A 3HJAA 1JBEA 3QF4B 1KIMA 3AM3A 5DTEA 5GOTA 4EW6A 4U8GA 1M34B 1GKKA 3CC8A 1VHQA 5B58T 5DYWA 4LPKA 3W6NA 3FWYA 2OO5A 1Z6TA 3P8ZA 5ER6A 4GE0A 3LSYA 5T57A 1P4RA 2GM9A 3E6AA 4IV8A 3KZMA 5BYJA 3RSFA 3TX6A 4UAGA 4BUZA 4JQYA 1JQEA 5GIOE 2ZIVB 3CEHA 1W48A 3ITKA 4IXDA 1G0NA 1PSZA 1UPUA 4QT0A 3T4EA 4DARA 4F21A 5C2JB 3MRXA 3FVRA 5LNK1 1J70A 1LPSA 1FXSA 3FG9A 4AZ0B 3A14A 1H0SA 5DHQA 4NV1A 3HB1A 3NAQA 1M0SA 5F5NA 4D9EA 5LNK6 1ZL2A 5AT1A 2XTMA 2JL1A 4AY3A 1O5OA 4YPVA 3C15C 4PSAA 3HRHA 3VZQA 3QV2A 5BYKA 4X84A 4KDEA 3AM5A 4G8JA 1OZAA 3HRIA 1KI3A 3HL4A 4U9HS 1OU0A 3WOHA 1YJCA 2C8VA 2HF9A 2HPZA 3UK0A 2Q7XA 4DLTA 2G9QA 4Z2AA 3GLIE 1K6EA 4FFSA 1RM5A 4HP8A 5E6RB 3FJ1A 3CIOA 3KB1A 1UPFA 3T1NA 1FNNA 2AFHE 1KFEB 1POWA 3CKLA 4MUMA 5LXTF 1YULA 4RVCA 4PZDA 3VPDA 1IK6A 4TKLA 4HX2A 4X95A 2H5EA 3BA6A 3WJ2A 1QTIA 4GRAA 2Z5GA 2FPOA 1YRYE 4RSGA 3WXBA 1FVOA 3JVEA 3TCXB 4DXDA 3B6KA 3DKIA 1TTQB 1J0AA 1BDMA 3HN7A 2WY2D 1LDNA 3P0JA 4YEDA 5JNSA 1NX6A 5EHIA 3M1IA 1ULZA 2R60A 2CV0A 3NHJA 1TD1A 4JLAA 4FB5A 4IV5A 4MWSA 3ZOKA 2NTJA 1N2EA 5LXTA 3CT6A 4NQRA 3THYA 1G59A 4JUFA 3WWYA 1LK7A 2PAAA 3K0AB 3R1IA 4P7KA 4FHCA 1YFKA 5EE1A 3ER6A 4Q37A 1XWWA 4KJZA 4ON9A 2BP7B 5IAJA 4BJ5A 1U7UA 2CLOB 5IJ0A 3IP1A 4MW4A 2WUEA 2OD9A 3DTVD 3COJA 5BXQC 2XMDA 3H5TA 3G0HA 1HRDA 1K9SA 1VB3A 4KQJA 4BYGA 5IW8A 4G01B 4Y6PA 2FMUA 4AU1A 4CQMB 3TOCA 1CJKC 4CXMA 4OHPA 2GBCA 2DSTA 2QTVB 1J22A 1SC9A 1G20B 3K3PA 5EMMA 4HUQA 5FUXA 1Q6ZA 5E6SA 2YUTA 1P1BA 2A9KA 2FWMX 2J0UA 3PFHA 1ZVJA 2F48A 2ZWAA 4JFAA 3ZHQA 3SCZA 1ISIA 4JY7A 3SBXA 2JBAA 1ODTC 1DEOA 1VSBA 1X7XB 2BFNA 4C4PA 2DLCX 1VMDA 1UP7A 3HJTA 3JAWB 1KBZA 3WGLA 2X8JA 2VZ8A 2QSZA 3I42A 3IFSA 5EWJA 1CY6A 1WO8A 1PHRA 2J9FA 5FJJA 5BVGA 1KORA 2H4FA 4I4LA 3LA8A 1R15A 3HCPA 5C7OO 1CUWA 1E99A 2P0YA 3LW7A 5DX1A 2WQ7A 3A4VA 1XAHA 5HIJA 2UZ1A 3AONB 2G67A 3UOAB 4EY3A 4R1UA 1M0TA 4KDRA 4RVSA 3MJHA 2CJPA 4R05A 2PKXA 4X65B 1J6UA 4IVRA 4H6XA 4RH0A 1TL7C 3SR3A 1WXDA 3GZTB 2E89A 4OYLA 5G1OA 1Z7WA 4QICA 2DETA 4HX5A 4OPMA 4OHKA 2PMBA 5EAIA 3S27A 2ZIXB 4LHSA 1DE0A 4GR9A 4ZO9A 4ZAVA 1P2TA 4RKYA 3OFJA 2O2ZA 1VE3A 5JC8A 5IBRA 4EENA 5LR6A 2BM9A 1BWPA 1FX1A 3F3MA 1YKSA 4UHCA 3I0NA 3AERB 5CCDA 3D3WA 4Z54A 3PXAA 1NQWA 1YQUA 1P81A 2AK3A 4PFJA 1EVKA 2A1UB 3OJEA 3A2KA 2MSKA 4UDOA 3B5IA 3ZVMA 4MGIR 5JQGB 3Q0IA 4PU0A 4URYR 7ADHA 4ALJA 4EPWA 4G8BA 5FTWA 5IKOA 4EH1A 1H85A 3SJBA 4HDQB 4RSMA 1JG7A 4QO8A 3VNQA 2QN2A 1Y34E 1Y6GA 3HGQA 1ZH0A 1IPHA 3CRNA 1NVUQ 2RJOA 2DAPA 3ROXA 2X13A 1FUUA 4KGVA 2AZDA 2CEKA 4DPKA 2ZREA 1UJCA 2X7XA 3DZJA 3G2IA 3E9ZA 5E4TA 3LUHA 1P33A 2B8JA 4Y0NA 3SIPA 2AG1A 3STVA 2IYLD 3ND6A 5AVWA 3OE5A 4X97A 4UNQA 3U9LA 1L5OA 1Z9BA 4I55F 3TXYA 1Y4ZA 2VBFA 4H7FA 1KI6B 5TMDA 1JTVA 3WWDA 1SUEA 2B3TA 3PUHA 5IAKA 3OZSA 4EYKA 3SF8A 4O2AA 4AAYA 1J23A 1D2RA 3DDUA 2OXTA 2EU8A 4UHJA 1IJFA 1YA6A 4A92A 3VAYA 2SECE 4K81B 1QCZA 5CA1B 2V3CC 1UEIA 1GZVA 2JLAA 4D0RA 4BNVA 1OAOC 3NHRA 3BGDA 3FLBA 3PA8A 2WYIA 1QV9A 3WTCA 2O7VA 3H13A 1YI0A 2XE8A 1FLVA 5AK0A 4PICA 4P34A 4BGEA 2HZ7A 1NR7A 1MQAA 1P2BA 4KN5A 5TF4A 2H2HA 5JECA 1OH5A 1TVMA 5CAEB 1EM8A 2HO4A 3HWX1 3MJ4A 5IAAA 5L9AA 4JJ6A 3ZWBA 2E6KA 3DTVB 1APBA 2FPXA 2IYQA 4EI8A 5C51B 2M1XA 5CX1B 2Q5JA 4Q7MB 1DEAA 3N0RA 1C7EA 1QNFA 4DWVA 1K7SN 3KYCB 1NI3A 1K06A 1C0EA 1Q17A 3CNNA 4JIGA 4QFMA 3AM4A 3I6IA 1FBTA 4U2DA 4D81A 4O8ZA 2W2KA 1T5OA 4F3CA 1I9CA 5BOSA 2ZRFA 4P9NA 3VOAA 2BGJA 1MRZA 2AXNA 3QM1A 1P6UA 1HDRA 1N3IA 3JQBA 1U4SA 5BPFA 1OBCA 5DF1A 1BYIA 1Y9JA 1LQ2A 1HDIA 1AZTA 1TJ3A 1RYDA 1B93A 2OENG 2R8BA 2F3QA 3QPCA 4JJZA 4RH3A 3PJGA 5EJAA 5JDCA 1NJSA 3TOZA 4TZKA 2OE2A 1X7ZB 5U4QA 1REQA 4MHOA 1FU4A 2AOWA 4WGFA 2HSDA 2VUHB 1Z0JA 4WUTA 3UJ8A 3Q3VA 3G2HA 5I9LA 1X38A 3F1KA 5TT1A 2GCGA 4IWXA 4V3BA 4KLRA 2VPXA 4IKPA 1RWWA 2WDZA 4RESA 1JPVA 3IUNA 4WY2A 3TZBA 5BURA 2G8NA 3A6JA 3V2GA 4V0SA 1YB2A 2X77A 2ZRBA 3C39A 3PCXA 3LC0A 1DELA 3IP9A 2YV2A 3OPNA 1VMIA 5BYAA 5L45A 3GT7A 2O2DA 3ELUA 4IICA 4Y9SA 3SBDA 4RTKA 1OFTA 3U4MA 3BDAA 1RJ9A 3QE2A 4OREX 3KZCA 2RHLA 4I6EA 1Q84A 4U02A 3GNQA 2H17A 4PYLA 1P5FA 5FWXA 1MIOA 1QYVA 1X8LA 2BUBA 1FLNA 4KZKA 1PYOA 2ZKLA 2F1HA 4OBXA 4OQEA 3K32A 4PC7A 4ZEOA 1V7ZA 1SC6A 3C41J 1NJFA 2IBMA 3DM5A 1E4VA 4LY6A 3HV2A 3RBXA 4NYIR 3IYLW 3TMYA 4DLXA 4ESHA 4IINA 3E70C 2VRBA 1L4FA 3Q88A 3W5SA 1ZVVA 3WOVA 3G8DA 1T3TA 3JASB 5ALFA 1TDJA 2JHFA 4YLGA 1ZWLA 5A6SB 2YFKA 1DIBA 2JFWA 1MJGA 2IYVA 4L5IA 4L5AA 1DG9A 1XZIA 2J4DA 3VU3A 2EWWA 3S2ZA 1KFJB 3FSRA 3V33A 2VDMB 2YJTD 3CZ9A 1PW5A 3S2EA 1W1WA 4HL6A 2Z1NA 1Y63A 2W2OA 1G8GA 3HO6A 1A88A 3G5AA 3MYYA 2O3QA 5DSXA 3HXLA 3WK4A 3TF5A 3I45A 4FINA 4X7RA 1KU6A 3U7IA 4JCCA 2X1HA 2RK6A 4JKOA 1LCIA 4CV0A 4DCVA 3Q3IA 2ZUCA 4ZTBA 5IAOA 4KZPA 3HXPA 1SVUA 4L4UA 3QJ5A 3CVJA 3N6XA 2PKEA 1MIHA 5CFPA 1AGXA 1PU2A 1W93A 3HRKA 5DCUA 1G8JA 1CEYA 1L5WA 1IVYA 1E9DA 1FY2A 3TUJC 2H7CA 2B1JA 1ZU4A 3U3KA 1N9GA 4P3YA 1ZJ6A 2DP4E 3DF7A 2B30A 2R1TA 3FVTA 3IOMA 3RRJA 3DO8A 5ECGC 2O4UX 2I33A 3GBSA 1ST2A 1Y6RA 3CF0A 1IHPA 4J94A 3ZN2A 2C54A 2OV3A 5EPOA 3DAHA 5DW0A 4Z7OB 1Z2NX 1UBEA 1L7EA 5LZ2A 3B5EA 2V9PA 3FBGA 5A4KA 3NVDA 1SPBS 4QU0A 1Q0QA 2BMEA 1EWKA 2GTPA 3KXLA 4LJ8A 4XGNA 3TJRA 4XYMA 5JCJD 2NPOA 2WUGA 1FFHA 1KAGA 2DBQA 4OHXA 4EJ6A 3LXRA 5ELMA 3WK5A 1OT5A 3QVVA 3QZUA 1JHMA 1MDBA 1KZ7B 3ANYB 3GCDA 4HGPA 4EA8A 1J2UA 1D1SA 3NEYA 4YIKA 3BVPA 1ISSA 1XROA 5EMNA 5I4KA 2QW8A 4OHOA 3L06A 3K0SA 1UFOA 2VRWA 2ZG6A 1Z0SA 4H4DA 5LZ5A 4B75A 2BR3A 3F67A 4C0XA 4IIJA 3RK0A 1ZIPA 1SVSA 3CNQS 1F4PA 2V45A 1U0FA 5A0FA 3S5UA 2OZPA 5CM8B 5B3LA 5KWEA 2P2SA 5LJIA 5EE0A 4KGDA 2IIBA 3C3XA 5LP6A 2O8EA 4JS0A 3MPUA 3A1VA 1J9ZA 4FSDA 1CJBA 3K5IA 4CLDA 3CMCO 4FE3A 4PLYA 1OGJA 2K87A 4II3A 3OJWA 3AUXA 4MWZA 1JWBB 1G3MA 3EY9A 1I6WA 3VR6A 3CW2A 4FNOA 5AESA 1KR5A 5JCZA 1TEVA 4ZMBA 1LPOA 1ZZGA 2V9CA 2BSXA 3OLYA 2RGBA 1JU3A 2QLLA 2XVYA 3NWBA 3VKHA 1NYLA 2QM0A 1Y81A 1E77A 3H6KA 3TBKA 1M5RA 1SB8A 2GVZC 4CMIB 5HOEA 3K09C 1N9GB 1W87A 2YV4A 4RS4A 4CT5A 1GFSA 3ON5A 1L7BA 2VRNA 1FFBA 2QX8A 1P4AA 5KWSA 4D99A 2KHZA 3CNOA 3OBIA 3OPMA 2FF7A 2ZBGA 4JU9A 2KI5A 4F38A 2A9VA 5KYYA 4F4IA 1RBYA 2L0XA 2C7PA 1YE5A 1E98A 5EJGA 3SZOA 4F3NA 3EOAI 1V71A 5AJXA 3VPSA 2XUFA 5GZ1A 2XRYA 1BA3A 3W0LB 5JC1A 2O8DB 2XEDA 2UUCB 1Z6QA 2RH9B 1VHDA 3WLLA 5WRFA 1NW7A 1Q50A 4GOND 3JALA 3LY5A 2G0TA 4DAOA 4J9UE 4A91A 4B0PA 4LQCA 5HGXA 4JZYA 5ECYA 1ZUNB 4FHEA 2XCRB 1AK2A 1M1UA 3QE9Y 2V6IA 3EDMA 4HH3C 2C3PA 2O1EA 2WT9A 4ZHSA 1ZJYA 4ESVA 3K1JA 2QF7A 3A6ZA 1ZQ1A 4BRZA 2QNBA 3GGGA 2ZAOA 2PRSA 1SWWA 1CRWG 3ZXXA 2Q8QA 2BFPA 2XW6A 4OB8A 4DT1B 2QM3A 4DG9A 1SZJG 1RXWA 2YHSA 2NZUG 1ODKA 3OUTA 4IIUA 1UC9A 5BT9A 5B4TA 2ZJ2A 2HF2A 1FOEB 1OFHA 3MT0A 3T5GA 4YR9A 5I9TA 2GS9A 3EZ6A 4QJBA 1PR4A 4NLLA 2PT6A 1TCAA 2D1YA 1JHUA 1J2EA 3ZHBA 1PK8A 2AYXA 4Y2VA 4XEUA 3IIMA 4PAGA 2LW7A 1KJWA 2Y2UA 1K88A 3EGVA 1ISRA 3A4TA 3DEIA 3HLKA 2PWZA 4KVZA 4WCFA 5H16A 4LZOA 1MG5A 2ZR9A 3PRJA 4QGGA 1P7WA 3C7DB 4TSFD 1WE2A 5F1OA 3UFBA 4BKQA 3AJAA 3M5PA 3ZS8A 4YV7A 5KNLA 1U7PA 3MOGA 1X92A 4O4LF 5F1YA 1GPYA 2GEVA 3DPIA 3F5FA 4X8MA 5TPWA 4F04A 5J2UA 2WIBA 2A30A 1I33A 3U13A 1M76A 1MOPA 2GPWA 3ANLA 1CZHA 3B7GA 3CRZA 3LY7A 4M53A 5FQNA 3GLIA 2DXIA 1FXWA 2GBGA 3IESA 4O08A 3IQDB 2B92A 2C83A 1MEJA 3QQ5A 5EKSA 2OO3A 5GONB 4ZEVA 2XTZA 2D5CA 2XDWA 4II2A 1I4LD 2GPAA 4Q02A 5D87A 3ZCQA 4JC8A 2FXVA 1ZC3A 1EFDN 3EB9A 5I7OA 3WRXC 1Q1BA 4YROA 4MR8A 1ESMA 3ZE9A 4C2UA 1E7QA 2P5YA 3TGLA 3OOYA 1F0KA 2PUWA 2WHRA 2WP8J 5CB6A 2GZMA 1X7GA 2GJ8A 1BXKA 4M0FA 1MABB 4LRYA 3UAWA 3WGVA 3DAYA 3GLGB 4FMBB 1UKVY 2C03A 4YACA 3N3BC 2WM3A 1JFFA 1Y37A 4M7WA 4BNGA 2H4YA 2ZIUB 3VPXA 4J3NA 4G1EB 1LDYA 1EJ6A 5IN4A 5JAIA 2GESA 5FPSA 4C6SA 1BGXT 5C4GB 1E5XA 1BKYA 1LI5A 4QNMA 4KYVA 3I62A 1S6YA 2P5TB 3SZMA 3M1AA 3DO5A 4FS8A 4BMZA 4MDFA 4IF4A 3F73A 2R3SA 1ZOSA 2W37A 2W00A 3JD2A 2PH5A 4FI3F 1YL6A 2G77B 4TXHA 3LSTA 5DBIA 1YMVA 2EBFX 3ONVA 3PSAA 4JZKA 4YLEA 3KUXA 2RB4A 4LXQA 4RHYA 5JRDS 2VA8A 5BO5A 5J5CA 1G17A 1H6BA 1U2RA 3BXXA 5C52B 2FPPB 4W5OA 1YS7A 1VLZA 4K05A 4QREA 5FL7A 5EQTA 5BR4A 2QT0A 2VF8A 2M32A 2Y1EA 4GUAA 4PG5A 3RYTC 4PO8A 5KB3A 5FPTA 2F1JA 5YASA 1EHYA 4OO3A 4HYYA 5IKPA 3E22A 2W58A 3INYA 1N75A 3QTLA 4F2PA 1P91A 3EMDA 4W6ZA 3IQEA 2WG0A 4DJJA 4CL2A 2F3SA 3V9PA 1U04A 2IH2A 1JIVA 1VRWA 4F5YA 3ER8A 1H4TA 4TT3D 3KLOA 2Y6VA 1AHNA 1XXHE 3G68A 1XR3A 3DOJA 1ONOA 3P9QA 4FFBB 4WZBE 4ZAZA 1K6JA 1N0WA 1WHTB 5JD3A 2DJIA 1T3LA 4NCKA 4TUYB 1UEJA 1QO9A 1HF3A 3OZVA 5ALWA 5K6AA 2PGXA 1GNVA 2JGFA 3H0CA 4LOJA 5F9MA 1DBIA 2GI4A 1X7WB 4MA5A 3D02A 3THSA 4NWIA 1XCPA 3KR1A 1V8DA 4HD8A 2EJUA 1TFUA 1Y4SA 3QEOA 1A2BA 1DQNA 1L4KA 2HB6A 2WLSA 1PL6A 4HTAA 1IDOA 4UCXA 2JATA 3R7FA 3VUEA 3ZWOA 3GGPA 2Z98A 1I4DD 4L7VA 4R1OA 1EPUA 4E2WA 1M6HA 2K7FA 1TLTA 1RLTA 2Z3WA 4Z6KA 2E82A 2PUJA 2DTDA 4O2BB 5DYIA 4B6SA 1CF4A 3Q6MA 3DB2A 3U7EB 3AW8A 2NV2B 5ESWA 3A27A 2CLDX 4UFNA 1T2DA 1J56A 1OLOA 1RRPA 2P9TA 1IN8A 1L5SA 1WLYA 4BNDA 1EAMA 3IHTA 1ZD5A 2F9MA 2Q3BA 1ZUD1 5LPNA 3U09A 3D0KA 2AZ4A 3IBGA 4B4VA 1J2YA 3NC1C 1UBRS 5EL0A 4YR7A 4FMDF 5AXDA 2JA2A 1JEAA 4K40A 1TM5E 2C94A 4YDQA 4RTSA 4ONEA 3E7DA 2BFBA 1EFPA 1JIUA 4MGKR 3SICE 5EIBC 2BDEA 4W5NA 4RE6A 4RIIA 2Q4BA 2W71A 1M75A 2K7ZA 3DM9B 1CR6A 5ITVA 3UBMA 2A7XA 1LUAA 3NYWA 5DNDA 5IM5A 1EUDA 5NLLA 3ZDEA 4CN8A 2VKQA 2LR0A 2ORYA 3BRWD 4O4JA 5HFAA 3ZWWA 2DPXA 4RCYA 2HIHA 4KAFA 3IX7A 4NZPA 3EGEA 3QUQA 1NVGA 1M1YE 3OHPA 4WLVA 4XWTA 5G1PA 5DTQA 5JQWA 3WLEA 3PRKE 5A9SB 5JS7A 4KLZA 1U7DA 3WQQA 3DWIA 2IS1A 2RI1A 4FZVA 5JLJA 2NU7B 1N2HA 5AM2A 4WZZA 3KQHA 3WGHA 4HTFB 2IXEA 3AL0C 4UHHA 1NMSA 1Y6JA 4JLWA 1USVA 2I3DA 2DRIA 1THMA 1V4BA 1Z4QA 4TQUS 4EB0A 3EXG1 1E2MA 2RCNA 1C9DB 1FXWF 4F46A 4A2PA 3R8XA 2QEQA 3C8DA 5MFPA 3AF6A 1XZCA 4YHBA 2KLHA 1NW8A 1FYWA 4F60A 1LWNA 4NOLA 2H7YA 3KEQA 1F8FA 3OJLA 4DNQA 3FRHA 5JNTA 4ZODA 4HMQA 3CLVA 5FWAA 4G63A 4M86A 4OQNA 2QZ4A 2OHIA 3H18A 4M46A 4MYDA 4TLDA 3NAZA 3W5JA 4CCWA 2FZGA 2IDZA 1QJCA 3UENA 2E49A 4ZV9A 3D1VA 5BN4B 1YUNA 3L6UA 1KPHA 3ENZA 1J8MF 2HJHA 4G0UA 5KTTA 2P5SA 4OBWA 5DK4A 3IEXA 4RZXA 1QIDA 2GCOA 3P4XA 1WAMA 3QFCA 3R9WA 4RK4A 3AJ8A 1WIWA 3SFZA 3WV4A 1KTIA 1KAMA 1D8AA 1EBUA 3FPKA 4QPPA 3ELBA 4JNCA 2O7NA 4MTLA 5BQ5A 4QARA 3TEMA 1SWVA 4PHTA 3X1KA 1U0NA 5H83A 4O1MA 1PAUA 3BZUA 4JLSA 4UU0A 3FNRA 2PJRA 5F2NA 1C1DA 2WM9B 4LOKA 3P9KA 1NSYA 4EYQA 2HK8A 4ZV4A 5L3SB 3IAM1 1IXKA 3FETA 4EG7A 2BI7A 5ALXA 4ENQA 2MSNA 4M0UA 3OY2A 3ZR4B 1KYVA 3TDMA 2WHPB 3I9OA 1G5HA 1R6DA 4LGMA 1JIXA 1P45A 1P72A 4KXVA 3OFKA 4OI4A 3I04M 4XR9A 1FNCA 5CW2A 4LBYA 3T9CA 2G9VA 1NJ8A 1E9VA 4K7JA 2PRIA 4B46A 5MGNA 3INGA 4Z4EA 3P7MA 1SHZA 4RFSA 4D92A 4BLWA 2EZUA 3C70A 2QYSA 3V8RA 4BN5A 1GRQA 4R1TA 5J9FA 3DZHA 2GCNA 1L6IA 3E9YA 3PNSA 4ZOEA 3RVSA 1BCSB 1O4VA 1R8YA 5BY2A 3ASZA 1AB6A 3NT5A 2AOUA 4QYXA 4QXAA 4EW3A 1P39A 5TDHA 4DR1B 3U4DA 1ADFA 1DX9A 2EYUA 3OQVA 3KS9A 2ZXFA 5A3QA 1CY0A 1YE8A 3BRCA 2BYTA 121PA 4B84A 3QLVC 4J2OA 2PGNA 3QENA 4QEKA 2OHGA 1FW6A 4DNPA 5AK6A 1N4DA 1JHZA 1OFIA 2VT7A 1ECCA 2ZIXA 5FF9A 1LZLA 4TWIA 2EX0A 4WK2B 5LB2A 4REQA 1OVGA 3GO4A 3TJMA 2C57A 3G9QA 1YCDA 3KKKA 1OY1A 2NAPA 4EPRA 2Q62A 4EECA 2JFPA 3BIFA 3FDIA 4INAA 4MIOA 2OCKA 1RM4A 5DLQC 5TY0A 4FBMA 4MQMA 3RANA 2WAOA 2PJDA 1QHXA 3IV9A 4IW3B 5L3QA 2QTBA 4OA8A 5E95A 4DANA 4FLMA 3JRXA 2CLSA 3DBRB 5EJ6A 2VPWA 3HH8A 3RS9A 4WXYB 1NLUA 5LIPA 1EM6A 1LS6A 4OQFA 4RD2A 1J8YF 4RIFA 1ENZA 4RH1A 4Z7NB 1F1JA 2XA1A 4QUJA 3FTEA 3EXAA 3PDUA 1TYDE 1ORTA 4BPRA 5J2UF 3B8HA 3H2ZA 1NDHA 2CMFA 2AYYA 3QMMA 2J32A 4D9KA 5IUJC 4BX3A 1LBHA 1GAQA 1YL5A 1CULC 3DDNA 4L7QA 2Q41A 4OGGA 3TE6A 1XDUA 3E03A 3C3CA 1ZSNA 3AR4A 1EH5A 1OIXA 3G88A 2AFIE 3A4YA 5IUKC 3SDSA 4I55A 1E8MA 1Y1PA 3VR6D 1PP4A 1C3LA 2IYZA 3EIFA 5LMZA 4RGBA 3KQSA 4URUR 4J0IA 3B20A 3V6LA 5IWCA 2QTNA 4QNRA 3PUJA 3GP5A 4TVOA 4X6LA 4DZRA 2FP4B 5F2KA 3VTZA 1N6KA 2ZTHA 3ZW8A 2XDYA 2Y4NA 1PZHA 2JGMA 5CK4A 5ADUS 1OROA 2TMKA 1JT9A 3HADA 4KSYA 2LD4A 2XUQA 5GVRA 4MCAA 3PK0A 2QRQA 4AZTA 5I7VA 2C58A 3GFTA 1SUDA 1XLTC 4N0PA 4NC9A 4V03A 2XEXA 1JP7A 2OXFA 3W5HA 4ZI3A 1R0ZA 1Q0LA 4MA0A 1ZICA 3IH5A 2P4SA 5LP1A 2O59A 4U5QA 4ZCLA 1GR1A 5FI1B 4E11A 1X39A 2ZR8A 1JLRA 5AW8A 4WXEA 4PTYA 3ZZNA 1AKYA 2WK1A 3R3VA 4GW3A 3DTTA 3ECAA 3B6JA 4RD6A 4O4IB 1LW6E 1CLUA 4G85A 2P78A 4FYVA 1Z2AA 2AD5A 4MARA 4Q9AA 2ONJA 4RHUA 1QDUA 5F2OA 3P2YA 5LBTA 1CUDA 4BVLA 1B1CA 5EXDA 1OWLA 1XE3A 3FMFA 4ZVSA 2DYKA 3HJUA 1DKOA 1MB0A 1SUWA 3F46A 1VGRA 4NEGA 3W79A 1RWQA 3DD1A 3MTIA 1DG3A 3O0TA 1C9NA 4ZKEA 4FMPA 2O5CA 1OLSA 1JG3A 4MNTA 2Z2IA 2VP4A 4WOPA 4C0BA 3U56A 3BMQA 4CM7A 2FOLA 2QVGA 4N5NA 3AG6A 4HDKA 1I4WA 1E3LA 3CBGA 5LQNA 1QSGA 4WJZA 5HTOA 1QAOA 3AEZA 3D4BA 5BV7A 2PWPA 4KDFA 3VU8A 3HYNA 5ES4B 1TQ8A 5A05A 5PGMA 3ZVKA 1JLKA 1SURA 2FW6A 3FA2A 4BATA 4MRAA 2QK4A 2OXRA 4JJ4A 4WCVA 1C0PA 1JTFA 3V7WA 2WSBA 1NN5A 3SIWA 3ZX4A 5CVDA 5F64A 4LBVA 4BFWA 1CWUA 1NVEA 1V48A 2LWIA 3SC6A 1I24A 1N6HA 1D4OA 2Z2ZA 5HIAA 4RELA 1F4LA 1NBOA 4G0WA 1TJ5A 1Q16A 2I34A 4YYZA 1WCYA 4P4SB 2GBLA 2YWCA 1I7QB 2C5FA 4Q1VA 5L7WA 3HXMA 4FDLA 3AVTA 3G23A 2I4IA 2NUTB 2OORC 3B7PA 3MPOA 4V2IA 3K1TA 5FUYA 3U44B 3O8NA 1RPZA 5EXPA 1N2GA 4LJ6A 1DT3A 4EHHA 2ZR0A 1K98A 1SRRA 4YMIA 5AW3A 7REQA 4LGYA 2UDPA 4HTFA 1UJ6A 5A1JA 1KY2A 1MCZA 1ZRHA 1XLWA 1C8KA 1YS9A 3O73A 3UPUA 3UGKA 4HNVA 2YV3A 2BN4A 2BGRA 3EARA 4OGWA 2WSLA 4Y6RA 2XUHA 3RVPA 3UAOA 4B9AA 5E7MA 5I3ZA 2UXBB 4XB1A 2QAGA 1UBFA 2IW3A 2R25B 4XWYA 2J3QA 2ZYTX 5DBOA 1YRQA 4JUCA 1L1QA 1N0UA 3AF5A 3X1MA 1IN5A 5TIIA 2F6RA 2FX2A 1AKQA 1QOPB 1T1IA 3ZD9A 2BBTA 1YCHA 5BR7A 4OCZA 3QITA 3DUFB 3AR5A 4YT8A 2GRAA 4ND7A 5ALTA 1X2BA 2BHLA 4QLOA 1EE1A 2JJ8A 5K3BA 3LQKA 1O0CA 2WE7A 4JUBA 3QFTA 2HF7A 1ECFA 4RY2A 5BRAA 5K03A 4DB4A 1SPXA 4UBLA 1DBVO 4ABTA 3P9SA 2FN4A 4EP1A 1VCIA 1QVAA 2ERYA 1X7DA 3OFND 5LUBA 5T6MA 3SQOA 3JQGB 1SOMA 1ODIA 2OY0A 3RJTA 3GELA 3BMOB 3W77A 4DDHA 4S0ZA 1T2NA 3UGJA 2QBYA 1DUVG 1ILEA 3WLHA 3GROA 1CB7A 1EU1A 1WCXA 3FPLA 4YAOA 5U4XA 2ZJBA 4YJ3B 2C5SA 5KMGB 3BICA 3T94A 1SU8A 1ONNA 1FFEA 3VSAA 4R31A 2E4ZA 4UTVA 3BEOA 3AF1A 1SD1A 2ZTLA 4Z4CA 3EGXB 2VTDA 1V11B 1EKXA 4NQZA 1QGYA 1C3JA 3CUEF 3A06A 2PSHA 3F5DA 3SFVA 1MGOA 3H0KA 1II8A 5EXSA 2QIPA 5BRNA 6ABPA 4N7BA 2XCUA 2Q6IA 4GNKA 3ESRA 1KU0A 4ZARA 3L4BA 4WZBA 4KQHA 2PH1A 3EWNA 2JGDA 3M1LA 3AY7A 3QJGA 4C88A 4KRFA 1MV8A 5C80A 2WVJA 1J0CA 3PTLA 4EJSA 1KY4A 2OESA 1NBWB 1XQWA 1UK7A 3CEPB 3G49A 3P19A 1H3EA 1ONSA 2ACVA 1W9HA 3B6MA 2GFHA 1LB1B 3E9MA 3MBIA 4CIVA 1E20A 4PGFA 4U2BA 5BSGA 1IY2A 1LU9A 2YXEA 3NLLA 4II7A 2A5YB 1MX5A 1MX9A 1WR8A 4TV8B 3ITEA 4BECA 1VZ3A 1B74A 2LUOA 4MI6A 3TX2A 5HCUA 4BJ1A 2MYPA 5LDDC 4GH5A 1D4ZA 3IUPA 3RIXA 3LNCA 2QL5A 3FPAA 4HH4A 4JXJA 4NZMA 5IANA 3BD8A 3ICVA 1NR1A 3RFXA 1M2KA 3O8OB 3IVCA 3IP6A 4RE5A 3JARB 1KDPA 1W94A 1EDZA 5BSRA 4EOGA 1UBTS 2SBTA 1U6JA 4TROA 4Q4AB 3GEBA 3PQEA 5IYZB 1EP3B 1TKBA 3EG9A 1IFXA 3OTGA 1QQAA 4JBXA 1MTZA 1YIOA 3ENNA 5HMMA 4Y7CA 4MK4A 5ANRB 4KQ1A 3EGWA 4KN8A 5COBA 1SHKA 1U9IA 2EKLA 3K73O 4LXUA 4NCHA 2OHXA 3H2JA 4IVPA 2XRZA 1U2GA 2XZLA 4HGNA 3I92A 3QY9A 4DRYA 2J08A 4RUKA 2G4CA 4ZTZB 1M1NA 1UFVA 4MTCA 2C04A 3MEQA 3OZTA 4WXHA 1RR6A 2FTKE 3AIKA 3Q40A 4DDUA 1YB6A 5HKKD 3SYNA 3A6KA 4BMNA 1QGAA 2HLDD 1JQAA 2HU8A 2IZ7A 4QQKA 5F23A 1YC2A 221PA 4NF2A 3PWKA 3GK3A 3BRWA 1CUZA 2OHHA 1X9HA 1ZM7A 4RQAA 2J8ZA 2Q3EA 4CLHA 4FX5A 3O4VA 1YU6A 4J6FA 1TXGA 2O3SA 5KNCA 3LLMA 3M4NA 5A7GA 3ZWNA 3WKDA 5LLSA 2JVKA 4X5OA 1NY5A 3TGWA 2DR3A 1JX6A 4X54A 5BMVF 1CFJA 5AW1A 4RL6A 1P4GA 4EWLA 3QVJA 1QZTA 2JKYA 4UNIA 3TLKA 2PZGA 3AEKA 1SR8A 3KB6A 3K96A 1IMJA 3BXOA 4EF6A 3NV7A 4DLLA 5FTJA 3WL6A 5BN5B 2DPYA 1OLUA 2X0JA 3LKDA 4RPCA 3IBYA 4XFJA 4ARIA 3NBUA 4RHEA 3ANNA 1SBNE 5AVYA 3WGTA 3W6ZA 3MHPA 4EDFA 2QI9C 5AFSA 5D3MB 2BGUA 5K51A 1DRKA 4HDSA 1VCNA 5TQ2A 1MENA 4JVMA 3UICA 5DLEA 5JAMA 4MAAA 4RMIA 4EY6A 3IMFA 5K8TA 3H9BA 1CEEA 5CBPB 1YQQA 3L93A 5F7JA 3S29A 4HKTA 6GPBA 3F9RA 1E1RD 3MILA 3RK1A 1SNYA 3OURA 5C3MA 2XWSA 1OX4A 3B9BA 5HQJA 5EIOA 4B5LA 1N77A 3QA9A 5TARA 2LKDA 4UM9D 5BQPA 5GJBA 2K6GA 3PUZA 3ZHVA 4YY3B 1N6OA 4K0RA 4WDRA 1O97D 4XIIA 2IHJA 1A5AB 3NAMA 4HGYA 4NTZA 3U3RA 4DKJA 2JIBA 3AC0A 3VR6H 2VUTA 1KOGA 3HJHA 3S68A 1E6MA 4FNAA 3TJZA 1YR8A 4GE3A 4US0R 2GPBA 4DQLA 4YUAA 3PNPA 4JXKA 5BRJA 1XU7A 2XGMA 1U7WA 4ZQEA 4G4IA 2C00A 1WEHA 3B82A 3TZCA 1X80B 2AMYA 5B7GA 2ZZNA 3ZBTA 1GARA 3BDVA 1U5AA 3FUXA 4JJFA 3UHFA 4RLSA 4XQGA 5K0BA 5CITA 4I81A 3V6MA 721PA 2YY6A 3KTAB 3DBVO 5JOQA 4IWNA 1E2UA 3HKDB 4MQEB 3KVRA 2YN0A 1XHLA 2H8KA 3NI2A 3NIWA 2YJGA 4Q3LA 1T8PA 3SZ3A 3ZWPA 4WDQA 3X1YA 5ISMA 2RGUA 4DUZB 5CHYA 2I4MA 4MVJF 4DUYB 1EDEA 4ZOLA 1YJAA 4DV4B 3QMVA 1ZXBA 1EK1A 2FZCA 3B89A 3QKUA 4GZMA 1HQYE 1RU3A 1QE0A 3ZLJA 2FX3A 5ESDA 3WBKA 4RLQA 4GGOA 5SY6A 1QAQA 2EOAA 2FE1A 1A8UA 1TC2A 2EEZA 3BJRA 4TSKA 3DMPA 1MNQA 2FVXA 3IDFA 4MW6A 1VTKA 4BDTA 5HQ3A 2WMYA 4LRSB 2AUNA 1TVKA 4NEQA 3PQ4A 2FEWB 4E31A 3E35A 3RF6A 2ZBEA 2WZDA 1K75A 2RHTA 3QELB 1W5FA 1U2DA 2BTOA 2GFIA 3E2IA 4M6WA 3VPAA 2H1SA 4QBHA 4D9HA 4BTEA 2HBQA 1NP7A 1PJBA 1BFDA 3QTBA 3K9HA 2WZQA 2Y0BA 3AB8A 4Y7DA 3MTAA 2KJQA 4WOJA 4C21A 1P61B 2GM3A 1ZRSA 2JNWA 4I66A 2PRKA 1YQ9A 4YP9A 2HSJA 2QT9A 3AJ9A 2D62A 1EUQA 5EHZA 4MUEA 3DE7X 1TUEA 3ZGVA 1H5NA 2BMJA 3HBNA 1QHHA 4FLEA 3KR0A 3OCWA 4NYJQ 2ZRDA 2FJPA 3KVYA 4NYMQ 4AJ2A 5BSWA 1DWUA 1NBIA 2VP6A 5JJLA 5DULA 5JWHA 4MHSA 4BTLA 1CVLA 3ZHSA 2XYHA 4PZAA 1DC5A 2ZAMA 1R0RE 3F7OA 1PEDA 4AUKA 4J2TA 5C8ZA 1JALA 1M7BA 3W4JA 2FSHA 4BFYA 2PBFA 2NNWB 4UAJA 1D3AA 1V4NA 4S05A 4RIEA 5BVHA 1EFRD 3DW1X 4HX9A 5FWNA 3EG5A 4QYMA 2A9OA 4MWDA 2GJ9A 3PDIA 4WK0B 4TPKA 5KOYA 3O8RA 1SD5A 3R7SA 4HNQA 4CV3A 1CDDA 1N78A 1GYRA 3DZKA 1F5NA 5I51A 2BL4A 1UKCA 1VKOA 1YFZA 2OSBA 3EVBA 5ES3A 3KYJB 5B1HA 3AP2A 5KEIA 2WZBA 3FKJA 3KXDA 1U94A 2GBFA 1MGPA 1GQSA 1RT9A 2GWRA 3GEHA 3QWIA 4WASA 4DJFC 3IB3A 1PK9A 1LJUA 1PZFA 2REBA 3AEUA 3PF9A 3RSQA 3HBAA 1FYEA 3KHSA 5FFMA 4BQQA 1RZVA 4GSYA 2HK9A 4JLUA 5ICMA