2H7VA

Co-crystal structure of ypka-rac1
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
182
structure length
182
Chain Sequence
GSKLMQAIKCVVVGDGAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVMVDGKPVNLGLWDTAGQEDYDRLRPLSYPQTDVSLICFSLVSPASFENVRAKWYPEVRHHCPNTPIILVGTKLDLRDDKDTIEKLKEKKLTPITYPQGLAMAKEIGAVKYLECSALTQRGLKTVFDEAIRAVLC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Yersinia virulence depends on mimicry of host rho-family nucleotide dissociation inhibitors.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
molecule keywords Migration-inducing protein 5
total genus 58
structure length 182
sequence length 182
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-06-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2h7vA00
1JR6A 5KSZA 3CF0A 1Z29A 3RS0A 1NN1A 3LLMA 1OH6A 5FBQB 4C0QC 2FU5C 1VG8A 1P7CA 1UFQA 1Z83A 3K09C 1NVXQ 1KDRA 4GFDA 5G3ZA 2VPPA 2P5SA 2GJKA 3K0FA 5J4LA 2IS2A 2BHRA 4MH0R 4Q7JB 2JJ2D 3QKTA 4W5JA 2YHSA 4BRWA 4W5WA 3NHAA 3NKVA 3TAHA 5KSYA 2EFEB 2IXEA 5HE9A 2PBRA 2VBCA 3JZAA 2JLYA 3ZZ0A 3ADDA 5CIWA 4NU0A 5AJZA 4PC3A 2IS4A 4NH0A 2F9MA 2WSMA 2AR7A 3QG5A 3UWKA 2HXSA 3RYTC 3KJGA 4Y0AA 1KO7A 3K9GA 4PQYA 2JLSA 3CUEF 3QBVA 4Q9KA 2O8BB 1SZPA 5CM8B 2JDIA 5C2JB 2AFIE 1MR3F 2J59A 1HE8B 4LZZA 3T15A 4PAMA 1DG3A 1DAIA 5E4FA 3THYB 4D4KA 4NPHA 3W5JA 5DI3A 1WDTA 1JAIA 2A5GA 5H8WA 3AVVA 3QJYA 2BC9A 5JHHB 1PUJA 1KSGA 4IDQA 1PVOA 5CDFA 5C4MA 2ZS8A 1S1CA 1ZC4A 1E1QA 4LYJA 3D7MA 2QBYB 2V7QA 4PC6A 3EWSA 1NP6A 4Q02A 5SZKB 2GVDC 1A2KC 2R9VA 2FV8A 3T1QA 4DZZA 2KE5A 4RD3A 4EPRA 4IVPA 3GJ0A 5SZJA 2D06A 2O5VA 3QKUA 3QXJA 1EX7A 2YYZA 4CVNA 3HPRA 1GKYA 2X19A 4KSCA 1XCPA 1CBUA 3U44B 2XTNA 1YKSA 1OH7A 3KFXA 5KU1A 3QENA 1VMAA 3REFA 2O8BA 4BLTA 3I61A 4NBSA 1UM8A 2IF0A 3CNLA 4LGMA 5FL3A 1FQJA 1U2RA 4OI0A 5JLJA 5J4HA 1D2MA 1E79D 1OIWA 3FKSA 5E7IA 4G5SA 1ZBDA 4NYJQ 4OK6A 3GLFA 3GFOA 3EC1A 3PITA 1OYYA 4WZAE 2O0HA 2A5DA 3QXSA 5JS7A 4ACAA 1SVOA 1ZUIA 3SQXA 2V54A 5BN5A 1WBBA 1MO3A 4O25A 3K09A 4TLDA 1NVVQ 2HYIC 1IHUA 1KDOA 1RJ9A 5DYGA 2G9NA 4HDQB 1CEEA 1NSFA 2DB3A 4BECA 3BGWA 1N6LA 4GT1A 2XB4A 5IT5A 4RY2A 3UG7A 1JBKA 2ZTSA 2Q9CA 2DBYA 3TK1A 3NG1A 5HCNA 3RS2A 421PA 2QMOA 3MUFA 1ZU5A 5DHAA 5CM9C 4B2IA 5SZHB 5BYKA 1OHHD 5CK5A 3B60A 5J4KA 4JVLA 4WVFA 2C9YA 2FJUA 1WP9A 3MG9A 3ZJYA 3MMPA 1TF2A 2WJJA 4TQAA 4LYFA 3AUYA 1I2MA 4B76A 2OBMA 3F5FA 3O47A 4Q4AA 4ZIRB 4GP6A 1H8ED 2WPDA 5LB4A 4DLTA 2IX3A 1CJUC 3QPUA 1VYUA 4QBFA 5DN6D 1X8LA 1DG1G 2ZI9A 3KZ1E 1B23P 1KK1A 1YE8A 2BKEA 4AWXA 2FZ4A 4WXPA 1G3IA 4BFTA 3ZVLA 4FXPA 5TY0A 4QGAA 2O8FA 3PQCA 1IN6A 1AZTA 2JCSA 2G83A 5EXXA 1R0ZA 4PC7A 4C0LA 4TMVA 3UMFA 1ZM4A 4ZDJA 3IIJA 1ZUNB 2WKPA 1G18A 5FTJA 1AKEA 2PZFA 3CO5A 1GUAA 2PLFA 3ZS8A 2ERYA 2RGCA 1YZQA 2WWHA 1P6XA 1QG4A 1GRQA 2OAP1 4HDCA 4OJKA 3RWOA 1Z28A 3LQRA 2GCOA 1J2JA 3MAAC 3K9HA 4BWYA 4QC2A 4HSEA 1K6MA 1IJFA 4O2LA 2OXCA 4Q66C 1G17A 3NDBB 3HWSA 4C4PA 2CXXA 3PXGA 5F98A 1TQ4A 3Q5EA 1SKQA 2DFTA 4WW0A 1T8TA 3K0AB 6Q21A 2AHOA 2FNAA 1DAFA 3QUSA 1CP2A 1AK2A 1Q1QA 4UJ3A 4F91B 4M2LA 1ZCAA 1YZLA 1NBMD 2HV8A 1SQ5A 3EG5A 1P2UA 3NH6A 4PQFA 1RE0A 1YZKA 2AN9A 1XFAA 3HYTA 1W48A 1XEXA 1CJKC 2XSZA 4D4MA 3KXLA 5KSOA 3VR4A 1AGRA 3ND8A 3U4QA 1GVNB 4QBHA 2J0VA 3K0CA 5EE1A 2RGEA 4XSHA 5JEDA 1QVRA 3KUCA 3T61A 1E2LA 3AF1A 4I1SA 2FSFA 4KO8A 4D0LB 1ZCBA 1FUUA 3H86A 1GKIA 3PENA 4KYIB 1XU4A 5CLLA 1E2HA 2VHUA 4IOMA 2JJ2A 2F3TA 3FHOA 1RW4A 4RZUA 1HA3A 2GZHA 1QZXA 1ZC3A 3QKSA 1IJEA 1Z07A 3RSOA 2BMDA 2A5YB 2J9RA 2WJYA 2ZM5A 1KK3A 3OIUA 2BM1A 2J0QA 5AJYA 1W36C 1NIPA 4LV5B 4MRRA 1Q21A 1XD2B 3HU1A 1XD2A 4RCZA 1IXZA 1GDDA 2ODNA 4URUR 4B3FX 5G41A 1G3UA 1D9ZA 1KJZA 2JJ1A 2O8EB 1E9AA 3TE6A 2WSSA 3WYAA 4RKEA 1C4OA 5AJWA 4MKHA 3K0SA 3B5JA 3K70D 4BFUA 2VP9A 4Q9LA 4LV8B 4URYR 3IEVA 2GXQA 2F1IA 4M9ZA 3A1WA 4A0FA 3K8YA 4G5GA 3X1ZA 2XTZA 2O0KA 2O8CB 4URXR 1TADA 2DFNA 4RZ3A 2P65A 2XOKD 1KI1A 5HE8A 3WMEA 1N6PA 3PUYA 1E0KA 2QU8A 4MYCA 2IWRA 3RC8A 3ZYCA 4JL5A 1XTSA 4PR0A 3WRYC 3EX7C 4DLRA 1KAGA 2QNRA 4DDTA 2IYLD 3ADCA 1LW7A 3QEOA 4EPVA 2CVFA 1E6CA 5BN4A 4BLSA 1II9A 4DCSA 4NCNA 1Z6YA 2CHQA 4QBGB 1W2HA 4PZZA 3DZ8A 3T34A 1E2NA 4Q4JA 4YC7A 2PT5A 4B47A 4HAXA 4QGFA 4LY6A 3A37A 4OK3A 4EAQA 1N5KA 3NH9A 3QKRA 3ZZTA 4JSTA 4G5OA 1E2IA 1FZQA 3GJ4A 2ZR9A 4CZ2A 4X8HA 3WHLA 4JLKA 3Q7QA 8OHMA 3DO6A 4RD1A 5KDLA 2CL6X 4ZV4A 2Q9AA 1E0JA 1KI9A 2OE2A 3OE7A 5J4YA 1JR3D 3KKOA 3K70C 2RHMA 2R62A 1PZNA 3G82C 4KBFA 4JZKA 4UXIA 2OG2A 2EFHB 2FPMA 4V0ME 4D25A 4A15A 5FBWB 4AYTA 2CVHA 3CR8A 3O8RA 1Z6TA 1H8HD 4M22A 1MRNA 2BM0A 4KFSA 4CRWB 4GZLA 3R9XA 5FUWA 1KO1A 2CDNA 4JJZA 3BH6A 5KNBA 1NL3A 4R98A 1ZD1A 1CR1A 4UKDA 721PA 4LCBA 1YRAA 3BFXA 3OIVA 4GI7A 4YLGA 2ZRGA 4CEJB 2DYKA 1ANKA 1CIPA 1E2MA 2H92A 1FPMA 1AQYA 3ICEA 4IVRA 3AVYA 2GCOB 4JS0A 2XZOA 1T8UA 3WNBA 4OHWA 1E1QD 1R7RA 2JLXA 1NSTA 2KSQA 4TYQA 3RHFA 1V5WA 2GZDA 4G01B 5CJPA 2ZE8A 4KFRA 2UKDA 5IRCD 2XEXA 1NN5A 1E9FA 1MKYA 1VCMA 2GF0A 4N1AA 1TX4B 2Z5FA 3I73A 3SE0A 2ZSFA 1YU9A 4J0QA 3U6BA 4A82A 4AK9A 4YMSA 2IEZA 2RGAA 4GOKA 1Z0KA 2CNWD 4I4LA 5JJLA 1XCMA 2QM8A 3U7GA 1E3MA 5EP3A 4Z8YA 1BYIA 4AC9A 5GJVC 1Z0FA 1VKJA 4IXMA 1Z6AA 1VDZA 3FMOB 3PCRB 3EARA 3KB1A 4GOXA 1X3SA 2PMDA 3H1TA 2QUZA 1VG1A 4OQXA 2QM7A 2IS6A 4PAOA 3PFIA 3QVVA 3MJRA 2HT1A 5M04A 1CJVC 1EFHA 3A8TA 2NZJA 4DCUA 2GA8A 3IUYA 4EPTA 3GLFE 4UQOA 3CNOA 1Q57A 4I81A 4TT3D 2B8WA 4Y0VA 5JHGB 2QY9A 1F3OA 4U00A 3P4XA 1EFTA 3M0EA 1EXMA 3JVVA 4YQFA 4GPTA 4AD8A 1EWQA 1OFTA 2PMKA 4TL7A 1P61B 3VAAA 3V00A 4EKDA 2ZRIA 2ZE6A 4HLCA 2HT6A 5JSZA 2C8VA 5JMTA 1QRAA 2AD1A 1ZNYA 1SXJB 3WMGA 4M9SA 2A5FA 2REBA 3IPYA 3W5IA 2QP9X 4MRVA 3I5YA 5C46F 5AWFC 4B44A 4DCNA 3TNFA 3BORA 1E96A 2REXB 3GLIB 1XPOA 1E9RA 2Z43A 1OB5A 2LWIA 1DPFA 2AKAB 4EPXA 3TUZC 3ASYA 3W8RA 1KSJA 1SVKA 2OV2A 3C14C 2ZJ8A 4IHQA 5FI1B 3EAQA 2OFWA 2ZYUX 3C41J 3RDPA 1J90A 4DB4A 1CR4A 3SJAA 1E2DA 2NTYC 2X8AA 4OI2A 1N6RA 3OEHD 2F55A 4LHZA 5TARA 821PA 3K0FB 3LVQE 2ZS7A 1JALA 4BLRA 3UK6A 1IXSB 4LJ5A 2DFLA 2MMGA 5UKDA 1BMFA 1OXSC 3OF5A 4MYUA 1FX0B 3UMSA 4B3GA 2OO7A 3AVXA 5J4VA 1W0KD 3RRZA 1N6IA 4HLUA 2QPOA 1E9CA 1DAMA 4HB0A 1T3HA 3FPAA 5FPTA 1BO6A 1KO5A 2G6BA 4Z51A 3SFVA 3N2EA 4ZDKA 4BASA 2V8OA 4IDOA 4Q1CA 5FPHA 4RD2A 3LDAA 1ZM2A 4CDGA 3AQ4A 4OQMA 1CF4A 2H18A 5J47A 2YWEA 3F0TA 1KTVA 3QKRB 4LPSA 2UZ3A 3H0KA 2BKUA 4C9BA 2PL3A 4A0GA 3PG5A 1E2GA 4PFSA 3K53A 4LBZA 3J81k 3NTUA 4E09A 5DE3A 1E2QA 1G5TA 1VECA 2OBLA 3C5CA 3IPXA 4TT3A 3UATA 1GFIA 4JT2A 1VHLA 2IA5A 2XAUA 1YZGA 4WZ6A 4GMDA 2OZEA 3P26A 3U3OA 3DKPA 1W4CA 2QGNA 1S3GA 4E03A 5L3SA 2XNSA 4ESVA 5DH9A 2BIFA 3NEJA 4A2WA 1T3SA 2J0UA 3ZQJA 5DNYB 3B9QA 4P3YA 1R5BA 4LUCA 2IYSA 4RJLA 2C9CA 4KV9A 4PPFA 2DWPA 4O0MA 5DN6A 3TMKA 2QMHA 4URWR 1G6OA 2CBZA 1NY5A 2CHVA 4B32A 3ZD7A 4ZDIA 1VYVA 2FSHA 3P32A 3P20A 1HV8A 2WOOA 3E2IA 1L7VC 4W9MC 4BLPA 4C2TA 2B8TA 2ZJYA 1DS6A 4DDVA 2IL1A 3M1IA 4LJ4A 4M9QA 521PA 1LFDB 4DWJA 3A4MA 5BQ5A 1ZW6A 2PLRA 1G291 2OXRA 1G7TA 3DZDA 4R9UC 3GP8A 2KWIA 4HLQB 4HZIA 4A2PA 1N5IA 2RGDA 2QRZA 2V4ZA 4XSGA 3I72A 3EIQA 2IEYA 1H65A 1D2NA 2F43B 4WIAA 3V9PA 1EK0A 4KFTA 4DLWA 4XOIA 1DE0A 4ARZB 221PA 3D6TB 2WJIA 1TNDA 1J8MF 4DLZA 4NONA 3RRNA 4KXFB 3QXCA 2HCJB 3FYHA 2GCPA 4EFLA 1A1VA 2DR3A 2GBLA 1OKKD 4IVQA 3M4YA 1Q3TA 2NQ2C 2I1QA 3GMTA 2RB4A 3EIEA 1E32A 5CYPA 4DC9A 5JRZA 4WXRA 2WWWA 2OEPA 1E79A 2CLCX 1ZD9A 3FFAA 4DSNA 5K8UA 1OLOA 5DI9A 1B0UA 4K46A 3KKQA 2F6RA 1DO0A 2WAXA 2ZJ5A 3QIAA 2WSSD 4RD0A 4V02A 5FOWA 4B6EA 4I1VA 3A6PC 1I2DA 1ZU4A 1GITA 3WYFA 4PTLA 1SXJC 4OQFA 1LNZA 1CRQA 2O52A 5H70A 1AA9A 3CW2A 1Q1BA 3WHKA 2CE2X 4YXWD 1EWRA 3KFVA 3A4NA 1CU1A 2W6JD 1UKYA 3U61B 1KYIA 2J0UB 1W0JA 2BVNA 1OPXA 1G8GA 3L0IB 4X8LA 5AJXA 2NMVA 2GXUA 5HZHA 4LK2A 2QMEA 5EE9A 5FBVB 1IN8A 4DIEA 2P0EA 1LV7A 4TSFD 2J41A 4DSTA 1EESA 1XMJA 4Q1EA 1VIYA 1Z08A 4TTRA 4FW9A 3FOZA 1SXJA 4R2HA 1UPTA 3TBKA 4DEYA 1MABB 2H8KA 2BMFA 4FINA 1P2SA 2ODBA 3C15C 1OE0A 2AL7A 1P9NA 2EYQA 4BE7B 1VPLA 1M7GA 4NDZA 2W2TA 3CPHA 4V0MA 1I4TD 1UKEA 2IUUA 1XXHE 3IQWA 2XNDA 4ILEA 1NLYA 3DPUA 1U99A 4UNRA 1XMIA 1IY2A 1E98A 4IRUB 2GJ8A 2XZPA 2ZJAA 1A5TA 2BEKA 4PQRA 5KTYA 4QBIA 4AI6A 1NMYA 4ABYA 3LAWA 4D2IA 5C18A 2YZ2A 5F9FA 3EPHA 3QEJA 2NO7A 3HR8A 1YZTA 1ZM9A 2FGKA 2ZETA 1GIAA 1G1MA 1N5LA 4KITB 2C2HA 1T0JB 3ZGXA 3OE7D 3ZIAD 4TL8A 2EWWA 1U8AA 5J40A 1J7KA 2FH5B 5GJCA 2ECKA 3HPQA 3DMNA 4FCVA 2JATA 2PZGA 1G4AE 4BFSA 5CYOA 2WZQA 1DTSA 1RKBA 2EQBA 1G7SA 2PH1A 4YMWA 1QBKC 1R5OA 4DUGD 1E1RA 4HZUA 4MRSA 1YR8A 1F2TB 2CK3D 3THXA 3RC3A 3GLIA 3AGPA 3V4RA 2X2EA 3LH5A 1ZIOA 1WRBA 4DLSA 3GCGA 2Z4SA 2PJRA 2WIAA 3VR3A 2GXSA 1EFUA 2E9SA 1VCOA 4MA4A 4JSYA 4ACBA 3I5XA 3ZD6A 1PLLA 4PSKA 3QNUA 2RMKA 5BW8A 1GRNA 2ZRLA 3PUZA 1XPUA 2R2AA 3CRQA 2QSYA 1MABA 1ZMXA 3WBKA 4TL6A 2C95A 1GL9B 1XZQA 2VP4A 4Q19A 2AK3A 2YOHA 3SOPA 1N3BA 2ZYWX 1OV4A 1N0WA 3SYLA 1ZUHA 1KMQA 4YDHB 3ZZUA 1S8FA 2C96A 4RZ2A 4LHXA 5FTMA 1XTJA 2J87A 2VLIA 4G3XA 3THWA 1G8YA 2G77B 1M1YE 2Q0HA 4NKRA 1NLZA 1P2TA 2P6NA 4TLCA 5FL7A 3W6NA 1X1SA 4PAQA 2KBEA 1GRRA 3I8XA 4A9AA 1CLUA 2C78A 3ASZA 1WBDA 4C0JA 4B33A 1SULA 4GNKA 4KODA 4BZXA 2YC4C 4DDUA 2NO6A 5JZVA 2CLDX 2ONKA 4C0KA 3OESA 4MQBA 1NN0A 1AZSC 1NI3A 3CRRA 3BXZA 3QSYA 2K5UA 4YXWA 3QXHA 2F1RA 3O8DA 4B43A 1N6HA 2C9OA 4Q9IA 2Q3HA 2CCJA 2BMEA 2OCPA 2REOA 4KAXA 1T9HA 1HY3A 2J3EA 4FMBB 1U90A 3EASA 2A5JA 2RGGA 3H2YA 4TWZA 5DGXA 2B7BA 3GJ7A 1CR0A 3TJZA 3F3YA 1NY6A 3RANA 1VHTA 4M1MA 3L0SA 1QHYA 3IO3A 4TTPA 4QGHA 1RC8A 3LRPA 2PX0A 3WBJA 2GRJA 5L3SB 1P72A 3B9PA 3LBIA 3KQHA 4D81A 5DLQC 2HDNB 3JVUA 4YONB 1XTIA 1U94A 1G19A 5L3RA 1W4AA 3AKCA 3PIRA 4Q1FA 3U4QB 2QN6A 3CX7A 1GL7A 1XEWX 2D4HA 1ETUA 2QQEA 1EG7A 4FMDB 4BLOA 4EJSB 3FMIA 1LS1A 4F4CA 4QNMA 1TL7C 4KVAA 4PO8A 1NNEA 3W8NA 3GD7A 1NF3A 1G9XA 2ZANA 2ZJOA 4L16A 1ZINA 3PEVA 3K70B 2VRWA 4ZI2A 2JLZA 3RRMA 3GLFB 5AJVB 3Q3JB 4GOJA 4TTQA 3OAAD 2QP3A 4XWOA 4PSVA 1NMZA 4XTCS 2WKRA 2JIZA 2GZAA 4Z1MD 1Y63A 4TMKA 4Z8XA 1FFHA 1QHHB 5LB2A 4AYWA 5TB5A 4HUTA 2CEAA 5KNCA 2RCNA 4XIGS 1SKYE 1R0WA 3FWYA 2ZRFA 3LLUA 1OFUX 2BBWA 4QHYA 3B7GA 3DM9B 1IM2A 4TYYA 5FOVA 1DAGA 2WWFA 3SEAA 4G5RA 1E2JA 1G3MA 2C77A 4JVSB 4TMTA 5EE0A 1JQLB 3RS5A 3UMRA 4C0AC 4IJMA 3WNDA 5LDDC 3NC1C 2J7PA 2WMOB 3K0EA 4NYIR 3U3RA 4BEJA 1KKMA 5J5CA 1LTQA 4Q4AB 4ZIRA 5A5GA 1DAEA 3C4JA 1W44A 3GEIA 5FPYA 1BH2A 3DL0A 4ZKEA 5B57C 1MH1A 2GETA 2IK8A 4YMTA 4HI0E 1NVVR 1GWNA 1FTNA 4POAA 4LWZA 2R6AA 1T5LA 2EFCB 3T5GA 3GLGA 1BYUA 1N25A 1GILA 2ZYTX 1MT0A 2RH5A 2ZJBA 3AKDA 3SDZA 1KKLA 4IW3B 4LBVA 1US8A 1QHXA 3UWOA 4AKEA 4DUGA 2R6GA 3DVLA 4US1R 5P21A 2YINC 3NBFA 3Q72A 3GJXC 5JSZB 4QM7A 4QOSA 4A92A 1XBTA 2V1XA 2PEYA 4B3CA 3NBYC 3VU9B 1UEIA 4HAYA 3DDCA 4TZ6A 3KQUA 4M1WA 1DO2A 3KXKA 1MOZA 2QAGC 3HR7A 3L2OB 1F2TA 1S9DA 2ZUBA 2B6HA 2XJ4A 4UNNA 3WP1B 4LJ7A 1S96A 4JVNA 5EZ5A 3LD9A 4F4JA 4MGYR 3UG6A 2XSZD 2CLSA 2JIZD 2ZRPA 5JECA 1DBSA 3AVUA 3A58B 1X6VA 4MYTA 4L8GA 4C2UA 3M6AA 3OAAA 4Q4HB 4P4UA 5FFMA 2QBYA 3QF7A 2H17A 2WVJA 1P5ZB 2ZSBA 4NCIA 4A6XA 3CRMA 1K5DA 1XJ0A 3NXSA 3THWB 2H1LA 2H57A 4I1OA 2O8FB 4DSOA 2V1UA 3U3KA 5KYKA 2ANBA 2NIPA 3GQBA 2ZSAA 1KNQA 2P6RA 4B34A 1COWD 3REGA 3CNNA 4LBYA 1OJLA 4Q01A 1E69A 2NG1A 2J5XA 1CRPA 4LC0A 4OL0A 2MSDB 1AIPA 4AY2A 1US8B 3GPLA 2F7SA 1V43A 4KU4A 5EE3A 4TMWA 4MUBA 1XTKA 2JAQA 4ZPXA 3IEUA 1HE1C 1UEJA 2HJGA 2W83A 4C0HA 1OH5A 1Z8FA 5B30A 1M74A 4L4UA 4IDPA 2GK6A 2UVQA 2IYWA 2HF9A 4JLBA 1OXVA 3VR2A 1DADA 4MRNA 3EPKA 1ZNWA 1FW6A 1CXZA 2Z0MA 3KB2A 3TVDA 1KSHA 4HB4A 2JDID 3QOFA 2WJGA 2QMUA 4OQLA 4D6PA 2OUKA 4Q7LA 4BPBA 2DWOA 1PLKA 1Z0AA 2AD5A 4F7WA 2JLVA 3NDPA 5FR1A 2EVWX 4JKYA 1G21E 2QE7A 2HUPA 3RS7A 1P60A 3QPVA 4U5XA 1PV4A 1SHKA 2R6CA 2IYRA 1GG2A 2CL7X 2J0SA 2JJ8A 1HH4A 2CHGA 2NPFA 3HU2A 2QTHA 4LPKA 2Q3MA 4QHSA 4C3ZA 1KJYA 4L5BA 2X1VA 1E94E 2VHTA 4DBLC 1KSFX 4BZPA 3LXRA 3D3QA 3WRXC 2ZU6A 4IOKA 4Q4JB 2XTMA 5EXPA 5FOSA 3I1FA 2YWHA 3B8HA 4GMXA 1K5GA 1PJRA 1UAAA 1RFLA 4NMMA 4HAVA 4TYNA 1O87A 4XD7A 5EP2A 4OKSA 3BIFA 3BB1A 2IC5A 2FZLA 1Z2CA 2V55B 3EZ2A 1F2UB 3DEFA 3CR7A 3V4FA 3AVQA 2XZLA 4U02A 4NTZA 4LJ8A 2ZJ2A 4I1UA 4FMCB 4P32A 1OKKA 1RYFA 1ZNZA 2OFOA 3CPEA 4RFVA 1L4YA 4MYHA 1HT1E 3GJ3A 1G16A 2ATXA 1OYWA 3CZQA 4V0LA 3TSOA 1S4QA 3EIHA 2KB0A 4OHXA 4M53A 3ZS9A 1OH8A 2PCJA 3VHXA 3BWDD 2OAQ1 1XX6A 2WWGA 5EUQB 2D62A 3EZFA 4Q48A 1NKSA 2P67A 4XVUA 1SVWA 3TW4A 3MWKA 4Q03A 1WQ1R 3NEYA 1TQ6A 3GFTA 4N3NA 3GEEA 1KI2A 2D2FA 2OT3B 3OHMA 1R4AA 3W9YA 3EPLA 3MRSA 5JS8A 4DCVA 3AGQA 4U7DA 3R7WB 1W0KA 1Z0JA 3CKLA 1TF5A 2QSZA 4JLJA 1Q1ZA 1S3SA 3FGNA 1GNRA 1G6HA 4O2RA 5TVKA 2O8DB 1YR9A 3QKSB 4LI0A 3BOSA 1XXHB 2GJ9A 3FFBA 2IHBA 4TMZA 3UXMA 4A36A 2QTFA 4HB3A 3U3JA 3OEHA 2FGJA 5EXSA 1Z2AA 1CKEA 1P75A 5IF9A 4IKEA 2YKGA 1QG2A 3GLHE 3RABA 3T1VA 3OIYA 3A36A 3GJ8A 4ARZA 1FOEB 1JR3A 3BS4A 4OHZA 1DAHA 5HZKA 2FFQA 1CULC 3W3ZB 2QGZA 1CS4C 5IDVA 2QZ4A 3CWZA 1W0JD 2C98A 4OI4A 3U6KA 1IOZA 2ZEJA 1TUIA 3AF0A 4URZR 1OXTA 2ANCA 1T3LA 1M7HA 1I4LD 1FP6A 1MV5A 2ZI5A 1N0VC 1UBGA 2BDTA 2AXNA 2J7KA 5TMPA 1OB2A 4JYBA 3VFDA 2ZRNA 1FUKA 1N6OA 4LJ9A 3P27A 4TLEA 1Q0UA 1JJVA 3GLHA 1ZRHA 1EX6A 2V9PA 1KNXA 2PJZA 2V6IA 4W5HA 1WF3A 1RRCA 2A2ZA 3MWJA 3AH8A 3UPUA 2LCFA 4BFVA 5KUTA 2BBSA 5BYJA 4L9WA 1BMFD 3S1AB 4KJZA 1XPRA 5B2ZA 1NVUQ 2VSXA 2WOJA 3LBHA 4K81B 3SJBA 5GADl 1XB2A 2QPTA 4MUAA 4DLYA 2VP0A 5EXTA 2FEOA 4M1KA 3AKYA 3HP1A 2IHYA 3VKWA 1KI4A 1E2EA 2VP6A 2VF7A 3L82B 4M0LA 1BKDR 4V0KA 3SJCA 2ZYVX 4B2LA 3QF4A 4E5UA 1U9IC 5FOTA 3GLIE 2XB2A 2GWHA 1UJ2A 4DCTA 3U3MA 1ESNA 2VP2A 4NHOA 4PZLA 4OHYA 2OCAA 5KDOA 4TZ0A 1KAOA 2QT1A 2IYVA 3RAPR 4DIDA 1JXMA 3Q7PA 4M4SA 4RD4A 3KJIA 4IEIA 1JEDA 3BFVA 1JJ7A 1IN4A 1NG1A 4Q1AA 3Q5DA 1JEEA 3N2IA 2JJ1D 4EPWA 5BN3A 5E7JA 3DHWC 3L0OA 3SN6A 1FP7A 3PUXA 5GVRA 1T4GA 1U9IA 2CK3A 1EFRD 1P9WA 3AVPA 2RKOA 3U7FB 1ZYUA 4LC1A 2WM9B 3KDSE 1OFHA 5TV2A 3VX4A 1QDEA 1SXJE 4OYHA 4BLQA 4BZQA 3ECCA 2EU8A 4JBYA 4L9SA 4OQNA 4C7OA 4FIDA 2BBTA 4WOPA 4FI3C 4FN5A 3AV0B 2NO1A 3KKMA 5B64A 5G3YA 5KNDA 2FOLA 2IYQA 1RJ9B 3R8FA 1CJTC 3P1JA 2OCYC 3TQFA 4MDEA 2G3YA 5JWOA 3VX3A 1NJGA 4XH9B 3HDTA 2Y8EA 4M1TA 1JXOA 2GAAA 2HJVA 1PUIA 2VA8A 3X2SA 3ND9A 4FMDF 4LYHA 3TVTA 1W46A 2HF8A 4D0GA 4PPNA 5G53C 3VHLB 2FF7A 2XXAA 4P0TA 5FTNA 4QJ3A 3NBZC 1UBFA 3OIWA 4JBXA 3UIEA 2A78A 1JQJC 2BV3A 4OBEA 2LKCA 2W6IA 2ZAOA 2OHFA 3TSWA 4MGIR 1S0UA 5F3WB 5GVSA 2A7QA 3CB4A 3IIMA 3CBQA 3TRFA 1Q3HA 3SR0A 3W34A 2Q6TA 1SXJD 4XTRA 3IBGA 3S1AA 1IAQA 4E22A 4A4DA 5CJ2A 1W5TA 5H1YA 3BD9A 2QQ0A 2BOVA 5JBQA 2E87A 2Q9BA 3OFND 3FMFA 1TTTA 1ZAKA 4A6PA 4PC2A 4QNRA 1KOFA 4QXAA 4XVRA 2R6FA 3GLHB 3FB4A 1NG9A 3K9NA 1G8HA 2I4IA 4Q00A 3FKSD 2FPKA 2ZI7A 2BJWA 2HEIA 4RZXA 1YR7A 4HZUB 4KCGA 4DVGA 5HR5A 3AM1A 4XD7D 1JNYA 4CF7A 1NMXA 3EZ9A 4JLMA 4G1UC 1X1RA 2NPIA 1ZNXA 5FBLB 1W36D 1II8A 2UZIR 2OM2A 2VF8A 2GJSA 2QAGB 3EWAA 4AKGA 1HT2E 2XX3A 3U44A 2ATVA 1OW3B 2ZU0C 4PSAA 4DHEA 3U7EB 3AB3A 1R10A 1P4SA 3CH5A 1QF9A 1COWA 3B78A 1XDBA 2W58A 2GEVA 3K0CC 1N0UA 1SGWA 3HU3A 3E5HA 1G41A 1GTVA 4CYMA 3SHWA 5FI0B 5D3QA 1PLJA 3SFZA 4UNSA 2W0SA 3AF4A 4HAZA 1P3JA 1KGDA 2ZUCA 2VYFA 2QE7D 3CIOA 1XF9A 3CM0A 3O8BA 1GM5A 4CIDA 4US0R 1MO6A 3I92A 1A82A 1ZM7A 2YOGA 2B92A 2I1VB 2ZR7A 4KLNA 5BXQC 3CPJB 1NBMA 1AQUA 2PZEA 5DIFA 1C9KA 2YOFA 5GJWC 1WCV1 1MO4A 1Q12A 1YZUA 3CH4B 2F1HA 3BERA 1KO4A 5FUVA 4MGZR 2CCGA 4PPQA 1HEIA 4Q5IA 3UKDA 2AXPA 3K1JA 1GOTA 4Q21A 1VG9B 1VIAA 3DOEA 2D3WA 4A2QA 1GSIA 2GKSA 1S2MA 4LJYA 4TSFA 5JWRA 2WV9A 1W47A 4GBMA 2V3CC 3PEYA 1R8QA 3I8SA 1T0HB 4WZBE 1TAGA 3DKVA 5DYIA 4QRHA 4XWKA 4EFNA 1RYHA 2GESA 1E9DA 4F92B 3TQCA 4TLBA 2F9LA 2W6JA 2D7DA 4C0SA 3ZIAA 4A8JB 4EFMA 4W7SA 3CONA 2ZPTX 2ZROA 4P31A 4CW7A 4IXNA 2XGJA 1Z06A 5E95A 5L3QB 4EUNA 1D9XA 1FTSA 3AF2A 1GAJA 1AGPA 2QI9C 4Q47A 3DOFA 3E1SA 3RLFA 4EJSA 4Q4HA 1OXUA 3R7WA 3IHWA 2JASA 4P4SA 2P2LA 2BWJA 3U2QA 2OBNA 3FE2A 1A7JA 2QORA 1ZJ6A 1Z6GA 2WHXA 3H4MA 5JCPA 1IONA 3B1VA 2CNWA 5AUOB 2IS1A 4AIIA 4IOLA 3CZPA 1WE2A 1XTRA 4ZCLA 5FL7D 3QG1A 3PUWA 4URVR 3LY5A 3N5CA 4KHZA 4LYAA 3TAUA 3MGCA 4LHWA 3RS3A 4MKIA 3R9IA 3N70A 5KO2A 3RVBA 5E7MA 2FEMA 3KTAB 3L8YA 4MKGA 1HQCA 3U5ZB 2CE7A 4A0RA 4BEBA 2IT1A 4PZYA 1WXQA 2FFHA 1GZSA 1KMHA 4ON9A 3BC1A 2QEQA 4JMPA 4N0EA 3LV8A 1RVDA 1G3RA 2Z4RA 3IHLA 5EUMA 4MITA 4FD2A 4CT4B 1JAHA 1HYQA 4CEHA 2ZI3A 3IILA 1W36B 2ZRBA 5F2EA 1N5JA 3RS4A 2IXGA 2ZRMA 4EQ6A 4JLOA 2YV5A 4AURA 1G5PA 1R5NA 3SS8A 1ODFA 4PANA 2AWOA 1XMSA 4MRPA 1L2TA 1JR3E 1E1RD 2W0MA 3LW8A 1S9HA 4BQSA 1UADA 4C0BA 2KI5A 4PPGA 1Z5ZA 3ETLA 1UBCA 4WA7A 1F6BA 5HPYB 5A4JA 121PA 2BJVA 4QGGA 3RSLA 5E3HA 1X8KA 2O0JA 2FSIA 1KI6B 3G5UA 4C30A 1HQYE 4IDNA 1AM4D 2O8DA 4IOJA 3KXIA 5AR1A 3IQXA 2FSGA 1KMHB 1R6BX 2VSFA 4UXJA 1E2KA 3FHCB 3ADKA 1N6NA 2VEDA 4II7A 4B48A 5HTKA 4RD6A 5A0FA 3THXB 1SVSA 2J46A 2LKDA 4RFSB 5LBIA 2H5EA 2ZVQX 3AVOA 3ZH9B 2L0XA 2HXYA 4A8JA 4HB2A 3QE0A 3ZVMA 3NC0C 1TQDA 1FQKA 1P62B 2FPLA 3L0PA 2ZI6A 4Q7KA 2ZRHA 2FDCA 2P6UA 4NL4H 2W2VA 3VTKA 2ZE5A 4DB2A 2QA5A 3FMPB 1XEXB 1RRPA 2WKQA 3BE4A 3LA6A 4DT1B 2DY1A 1EFCA 1D5CA 1GP2A 2VP5A 4NP6A 3K9LA 2G0NA 2C04A 2IWHA 3CF2A 5DO9A 3GEHA 1XD8A 4Q9HA 3TH5A 1A4RA 4NCKA 1XEWY 2N46A 4LSGA 4UXHA 2YC2C 5LD2C 3X1WA 4TYWA 3MWLA 4I99A 1SHZA 4LDJA 5EQTA 2HCBA 3VR5A 4B35A 1AN0A 4CEIA 2B7CA 1QHNA 4B2PA 4DDWA 3SU8A 2YWGA 3THOA 3T06B 3AP2A 2RGBA 2JGNA 4TLAA 1A2BA 2VHJA 1G7RA 3THYA 2FFBA 3TUJC 3IGFA 4M1YA 3LNCA 3TKLA 4UJ5A 1E9EA 3LBNA 5EP1A 3ZLJA 2GILA 2A3RA 5JWHA 5HKKD 3KKNA 3VR6A 4OK5A 4ASUA 5K8IA 3K0AA 5FR2A 1W1WA 4MKFA 1UDXA 3MSXA 4EQ6B 2ZREA 4HAUA 4OJQA 2QTVB 4G5QA 2G1KA 3MD0A 4TQ9A 2PCLA 4ZCIA 3OZXA 4V0NA 3A1VA 4LOAA 3SJZA 4EDHA 1X86B 4BFZA 1TMKA 3AF3A 4L15A 1S1MA 4KSBA 3X1XA 1U0HC 1SVMA 5CDFE 3SZRA 1EFRA 3KKPA 2BMJA 3WXMA 1YHNA 2BBOA 3B85A 2G88A 1ELOA 1W2GA 3BB3A 4NCJA 4XWAA 4P4TA 5K8LA 3DM5A 4CEIB 1KK0A 1M6NA 2JLRA 2ZVPX 4E07A 3WP0A 3B1ZA 3LXXA 4P4SB 1FX0A 4IFEA 3SQWA 2RGNA 4ZCMA 5FUXA 2MSCB 1H8EA 2WPDD 3B82A 2WWYA 1UF9A 4IDHA 4F38A 3AVWA 2R44A 4JT4A 1ZM3A 3GLGE 2PX3A 4Z54A 3EPJA 1AJEA 3TIFA 2JA1A 1E0SA 2NGRA 4NZYA 4ESHA 2PT7A 3NIBA 4X8MA 1AS3A 1Z47A 3R8CA 2RAPA 5IHPA 1KI7A 1XXHA 1LB1B 1E0AA 4QKQA 1X8JA 2A30A 2GHIA 2ZRCA 2EWVA 1ZD8A 3W90A 1BOFA 4DEXA 1LF5A 1KI8A 1NKTA 1YR6A 1DAKA 2H7VA 1OF1A 2VHQA 4JJKA 1F60A 3U60B 1U0LA 3TLXA 4B75A 5FUYA 1U98A 3W6OA 2IYZA 3QI2A 4A1FA 5AK0A 2QROA 2XJ9A 3SYNA 1JB1A 3B1WA 4DT1A 5FOUA 1Z0IA 3NWJA 2PEZA 4ASUD 2G0TA 4TQUS 1J70A 3LFUA 4AKHA 4RSGA 1GNPA 2N42A 4ZO4A 1W4RA 3U7HB 2ODWA 1KZGB 3QQ5A 4GSYA 1ZP6A 3Q8XB 1NBME 1UKVY 3QY0A 1W49A 2HLDD 1DELA 1TQ2A 4JLPA 4Q7MB 3VMFA 5JEEA 4GL2A 2MSEB 5AUQA 2VIIA 3CWQA 2RGNC 1P2VA 2ZI4A 3MLEA 5GJBA 2G1JA 1KDTA 1HUQA 3B1XA 2CCKA 1KI6A 4DXAA 3DMDA 1YVDA 4H1UA 3LO5A 3A1SA 4PHHA 3D8BA 3TR5A 5KOYA 3JZMA 3C7KA 2AKYA 5ELXA 4D4LA 4RFSA 2GTPA 2VHCA 2O8CA 2DPXA 3EA5A 1YZNA 2YJTD 1XWIA 4LJAA 4HATA 4ZI3A 2OCBA 2YNMA 4IEEA 3T12A 4BRUA 4YDSA 4R71A 4V0OA 3Q9LA 1Z0DA 4N0DA 4Z1MA 2IUTA 3A4LA 4AG6A 4FWTA 2B21A 2ZAMA 2FA9A 3KJEA 4DRZA 4BGDA 1YQTA 3EZ6A 2JLWA 3EZ7A 4HLUC 4QM6A 1SVLA 4NE2A 1OSNA 1BIFA 5KPDA 2QP4A 1VCIA 2KBFA 3AKEA 4BUJA 3R20A 4S2EA 3EW9A 4PHGA 5DSZA 5FOXA 4R7ZA 4P33A 2FX3A 2F3RA 1D6JA 1WMSA 3CRW1 5EP4A 4B3BA 2JLQA 1RRFA 4GRAA 4XVQA 1W5SA 2ZUDA 5TXGA 1KJWA 1XEFA 1NVWQ 2YVUA 5IK2A 2XOKA 1NLFA 3MWYW 1DEKA 1NIJA 4BFYA 5CB6A 2ZR0A 2EYUA 2YWFA 5FTLA 1MRSA 2P3SA 4K8OA 3KQKA 3Q85A 2FN4A 4LHYA 3E70C 3FTQA 3FVQA 2ZRDA 2GBLC 1F5NA 3D31A 4EIWA 2ZRJA 4IFBA 1CJMA 2RGXA 3MJHA 3TUIC 2MMCA 1RZ3A 5FPKA 3AP1A 5IK2D 3ONWA 1GL6A 5KHOC 1D2EA 5D3MA 1VG0B 4JL8A 1R8SA 2C5LA 3VKHA 1SVIA 1Z6XA 2ZSDA 5C4GB 5L3VA 2QL6A 1IN7A 1QVAA 4JYCA 4D0NA 1RIFA 3KJHA 3TW8B 2AWNA 4M1OA 1XCGB 4PX9A 2AK2A 4JKIA 1KDPA 5CIQA 2GNOA 3RRYA 1TEXA 2VH5R 2XXAB 4B74A 4F4IA 3IIKA 1GNQA 4Q9JA 2FMXA 1VTKA 3TSZA 1Q22A 3SC3A 4B3XA 2GEDA 5CITA 2ZRKA 4XJXA 1E9BA 2GXAA 3ZVRA 1OIVA 1YJ5A 3BAFA 1G4UR 1MO5A 2CL0X 3PR1A 2QAGA 3CLVA 2GJAA 2ORIA 4B3DA 1T91A 3IKJA 4RKFA 4YMVA 2GEUA 3KUDA 4KBGA 621PA 4KVGA 1M2OB 4BFWA 2A9KA 1R2QA 1XMVA 3EA0A 1TUEA 4PO9A 2VQSA 4LHVA 5FPSA 3ZDQA 1M7BA 1RRGA 3AUXA 4HYYA 3SBEA 1E99A 1TPZA 1KY3A 1KK2A 5KPJA 2OILA 5JJIA 2QAJA 1IBRA 2IYXA 1TU3A 1DOAA 1Q1EA 3QVUA 2SHKA 5CLQA 4DSUA 3NBXX 2EFGA 3QF4B 3BRWD 2VSOA 4JLDA 4MGKR 4TN1A 5HCIA 3NHBA 3A1TA 1QHSA 1QHHA 2D7CA 4GP7A 3MFYA 3KTAA 2ZS9A 2ZQ5A 2IUSA 4DLXA 2WWIA 1AS0A 1F2UA 5DHFA 1TF7A 5JI3E 4EPYA 1M34E 3QBTA 5KDDA 3KX2A 1XZPA 4NYMR 2V6JA 2WBLC 5D3MB 2NO0A 2ZITA 3LWNA 3LQQA 1E2PA 4HEJA 5CK4A 4MDFA 1TEVA 5DISB 3VNUA 4HDOB 4JLVA 4GDFA 2ZSEA 3F8TA 3WY9A 3SNHA 2JEOA 1WA5A 2F43A 2WMNB 1KZ7B 4DLUA 3SYKA 3VR1A 5FH9A 3GFPA 4QFMA 1Z63A 3VKGA 1LY1A 2V7QD 3G0HA 1OHHA 2VO1A 2HYDA 4Q4LA 1NJFA 3BFKA 4Q1BA 1FMJA 3B13B 4R2IA 1WB9A 4KI0A 3P4YA 3GLGB 3ICQB 1FNMA 2QRNA 4HLDA 1Y3AA 2Z6VA 1KIMA 3QPWA 3FKQA 1Z3IX 4TL9A 5B58C 4JVMA 1F48A 4QJ5A 2GDJA 2GF9A 3SHFA 2IYYA 2BCJQ 1OIXA 1QHIA 4US2R 3PV0A 3OEED 5FTKA 4CGZA 1G20E 1AS2A 1E2FA 1JPJA 3HYRA 3A1UA 1N6KA 1K8RA 1Q20A 3O8CA 2X77A 4BFXA 1ONBA 5CB8A 4WAUA 4QJ4A 3I3SR 2IYUA 3C16C 3X1DA 1G8FA 1G7CA 3L8ZA 3B6EA 2X2FA 3VNVA 2CJWB 5AUPB 1CTQA 2WJHA 1OFIA 1VCNA 2DWQA 2IF2A 5ANRB 4D4JA 3B2EA 2NO9A 1IY0A 5SZIA 3T35A 2P5TB 1UDWA 3L43A 3I62A 3BB4A 2ZE7A 1G3QA 2R65A 1XD9A 2QG6A 1KHTA 4ITRC 5L8VA 1J99A 3PVSA 3W3AA 1AKYA 5EE5B 2C03A 3MCAA 1NRJB 5F9HA 5JJKA 2FFAA 1UKZA 1T6NA 3B1YA 5HKKA 4JL6A 4LRWA 1KO8A 2AX4A 3AP3A 3PEWA 2CMKA 3I4LA 4EJSC 4D80A 3VU9A 1Q44A 1LVGA 1XNJA 1U81A 4HAWA 2FE4A 2I3BA 2Q21A 2FG5A 2WICA 3WNCA 5LD2B 2AFHE 2EFDB 1IXRC 4H9GA 4LBWA 4TMXA 4M8NE 4UNQA 2GK7A 2W00A 4NCHA 3EC2A 2J1LA 3LX5A 4WBSA 4HUQA 4NYJR 1XJCA 2OSBA 4FWIB 2OESA 1II8B 2WAYA 4FCTA 4ZDWA 2OLJA 5EZ6B 2ONJA 1W7AA 1ESMA 2BEJA 5DI3B 1TU4A 4TYPA 1II0A 2DCUA 1E4VA 3RNLA 2O8EA 5JI2E 4A8JC 4DKXA 1GKUB 2ZXUA 4AG5A 2W2XA 2WJVA 1QHGA 2R8RA 5K8TA 3FHTA 4JLAA 5TDHA 5JRJA 3T5DA 3X1YA 1C1YA 1OT3A 2D2EA 3KL4A 2OFXA 4LJ6A 1E4YA 1NN3A 4B73A 2QPAA 4QHTA 2ZJZA 3OEEA 4KFUA 1J8YF 2HLDA 4YMUA 1EGAA 2GAOA 1G8PA 3WMFA 3BK7A 3I32A 4D82A 1U8ZA 5G40A 4CT5A 3C8UA 1Z22A 2IBMA 3C5HA 4O3MA 4JBWA 2RHDA 4M9XA 1I4DD 5JFGA 1R0XA 2OLKA 1H8HA 4B71A 1M8PA 1VYTA 1P73A 4PO1A 3ZQ6A 1FL9A 3BBPA 1KY2A 2N1BA 4OHVA 5LPNA 2GCNA 4QG7A 1DARA 1LS6A 3QXXA 1L8QA 3BJIC 4JIMA 2IW3A 3W6PA 1N2CE 4KLZA 2WTUA 1O3YA 2TMKA 3SI7A 4OI1A 1JECA 3IDQA 2ORVA 4QL3A 3BH7A 3CX8A 3LW7A 3IBYA 3GJ6A 4D26A 3RWMB 1IY1A 1G5RA 3WYGA 2H16A 1R0YA 2BCGY 3NVAA 4H1VA 1FNNA 1T5IA 1CR2A 4Q1DA 1D8TA 3T1TA 2C99A 2NOAA 1JI0A 2VL7A 4S35A 4DJTA 3KQNA 3LVRE 1XTQA 1XJQA 2DHRA 2R6DA 1P9RA 3T1OA 5JCZA 4ERNA 1RPZA 4PXAA 3FDIA 2XNDD 4GZMA 2W6ID 4LX0A 4RCYA 2ODEA 4X8OA 3AEZA 5C1BA 5H68A 4PHFA 5L3QA 2KJQA 1E9SA 4AKIA 3CX6A 3R9WA 2ORWA 1ZIPA 3OFNA 1HTWA 1XP8A 2J7PD 3BH0A 4CEHB 3CF6R 1YRBA 3EXAA 1U8YA 2Q3FA 5BWMA 1W4BA 1XRJA 4FCWA 4KYUA 4AYXA 3PJRA 3IO5A 3AVTA 3KQLA 2XITA 1IQPA 3H84A 4G0NA 3TR0A 2ZRAA 2E1RA 4M21A 4LV6A 4C7OB 2FWRA 1UBEA 4UNPA 4JLNA 1G64A 2IXFA 1BS1A 1JPNA 3HJNA 2GVZC 1SKYB 2QT0A 4RVCA 3TGPA 1DVRA 4F93B 3SBDA 3ZVNA 1HURA 5EJEA 4NYMQ 2VTKA 3LX8A 1ZVQA 2IYTA 3ADBA 3PEUA 1OXXK 2DFKB 4NYIQ 2D74A 2WWXA 2ERXA 2QENA 1LF0A 2Z83A 5FBRB 4CEJA 1KI3A 2NZ8A 3PUVA 4PC1A 3VQTA 1L4UA 4M1SA 2JLUA 2J45A 4DLVA 4ZKDA 4PHTA 5AUNB 2ZIAA 2WIBA 4A0HA 3UANA 5KSPA 2F1JA 1IN5A 1FMLA 4B6FA 2EW1A 2ASEA 4V03A 4FMCF 3GJ5A 3CRVA 4HUQB 2CJWA 1U0JA 4Q18A
chains in the Genus database with same CATH superfamily
5KSZA 3ZU5A 4AY4A 5IANA 5AJTA 4CQMA 1NW9B 1PUXA 4X20B 1WF6A 3KR1A 1NN1A 4AXXA 3I01M 4XIJA 1OQAA 4TVBA 4C0QC 2FW6A 3OLXA 3A28A 2QTGA 4TXLA 4B8YA 3CZMA 5G1OA 4UNIA 1CK4A 1KDRA 5CFOA 2VPPA 2Y68A 2P6RA 4Q7JB 2JJ2D 5IASA 1HDOA 4LN1A 1TECE 4LMBA 1URPA 2WU4A 3OM0A 3NHAA 3NKVA 3Q87B 5HE9A 4KQEA 2FMUA 3D1VA 3KD3A 2JLYA 2EOAA 2X6RA 3R0XA 3ZZ0A 1H23A 1G55A 6CHYA 3SF0A 3ADDA 3AFHA 3G1UA 4NU0A 5AJZA 1NQAO 1YB7A 1NC3A 4I3HA 4Q6WA 5EWLA 1XZHA 1LWOA 4MKRA 2FW8A 3CY6A 3QG5A 4EHLA 4GVPA 1WCIA 3D8TA 3RYTC 4Y0AA 1KO7A 2O2CA 2WLSA 3CURA 1M2JA 2VT3A 4D4IA 4AMUA 1W1UA 4Y1RB 1OXKB 1T6YA 5FA5A 3S2SA 1Y1PA 4RTRA 1RAFA 4OYRA 4N3CA 3C7TA 1QVWA 2OO5A 1H1TA 4D4KA 1Y7LA 4KO4S 2H1SA 1UAGA 5H8WA 1GR1A 3Q7IA 3T5AA 2ZWMA 1GEGA 4FGUA 4MPJA 2ZIEA 3H1FA 1WBJB 5D2CA 3QJYA 2BC9A 2DFDA 3DTTA 4BO0A 2OM6A 3AHEA 4A2CA 1DWOA 4IDQA 4Y2RA 1UOOA 3BXFA 1U1FA 3COWA 2BFWA 2HDOA 2Q0SA 2X58A 4OFWA 1YCFA 1VGRA 3JX9A 1O9GA 1YK0A 2CDRA 3VUEA 2YFKA 4OCZA 1G2IA 4PAGA 6REQA 3L8MA 4G1BA 4RBNA 3WWEA 4EPRA 2P9JA 4OUDA 4D99A 3JALA 1NVKA 2N3ZA 2OYCA 5DEIA 2HIGA 3QKUA 2YYZA 1IK4A 1IK6A 1LPOA 1L5SA 3AWIA 1L5FA 3CUTA 1GKYA 3K16A 4KGVA 4QO8A 4UW9A 3QOWA 2C7QA 1CBUA 2XTNA 4MTLA 2HDHA 1P33A 2HIMA 2QSUA 3D02A 2EKLA 1DZ3A 1NNSA 1FXWA 1SJ9A 1ZK1A 2IF0A 3CNLA 4HG2A 4LGMA 1M33A 4RKWA 2CNDA 5GGXA 4OI0A 3GLFA 1BH6A 1L3CA 1IRXA 1ZBDA 2FPUA 4NYJQ 4OK6A 3GFOA 1IUKA 5E7IA 3PITA 4G37A 1OYYA 4UUMA 1F5SA 2YXDA 4WZAE 4MP8A 2ATEA 3WBFA 1A71A 2L17A 4OMCA 1BD4A 2L69A 3AFOA 3SZMA 3SQXA 5BN5A 1MO3A 1OFVA 1PT7A 1NVVQ 2HYIC 2Y2UA 2G9NA 4HDQB 2E4XA 3HKCA 5DLEA 4CM6A 3BGWA 3O4VA 1N6LA 2XB4A 1FLNA 1UKCA 3TZLA 1SN7A 3A31A 5IT5A 4C7KA 3DH0A 2Q9CA 1JHZA 1C8LA 3NG1A 5HCNA 3G2IA 4R9NA 2H5JA 4CM1A 2IV3A 1A9YA 4MCJA 1J5PA 1B73A 1KR2A 2FJUA 3GZJA 4WN3A 4WVFA 3ISTA 3ZJYA 3MMPA 4A10A 2OA0A 4UQLA 4LYFA 2R7NA 1VPTA 2QXTA 3CNQS 4B76A 2OBMA 1J56A 1RKUA 3EGDB 3IJRA 2VNAA 3PKJA 4ZIRB 4B6GA 4P4GA 4TOIA 3KBBA 1BCSA 2K87A 3KPYA 2C7BA 3MRXA 2EEZA 3KKEA 3QPUA 4HDSB 2FN3A 3C3AA 3E5MA 3LC2O 4G8DA 4LVUA 2ZI9A 3P2OA 1PR0A 1YE8A 1Z7EA 2JGDA 2WKSA 2YIJA 4MO9A 2CJPA 5D01A 1IM8A 1C3VA 1GLGA 3BGVA 3IESA 4FHGA 4WXPA 1FSSA 4AWXA 1S7CA 1JT2A 2I4TA 3ZVLA 1YRQA 2ZAGA 1IN6A 2JCSA 4C5CA 1R0ZA 5HM6A 4FYYA 2R1UA 4TMVA 3SR4A 3IIJA 5M29A 5MGNA 1G18A 4O33A 5F1OA 5FTJA 1GR0A 1AKEA 3COPA 1WW3A 2YUTA 4R40A 5FQOA 3DV2A 4CN8A 1GUAA 1K27A 2ERYA 4UMEA 2RGCA 5LOVB 4PYKA 1TK3A 1N8KA 1Y9EA 3D4PA 4PS1A 3UTDA 2QRGA 3ROQA 5B2FA 5EIXA 2AW3A 1Z28A 1TOAA 2NSDA 1YIDA 3ZXYA 2YRFA 5IUNC 1B6GA 4QC2A 2I7VA 3TRIA 4HSEA 1KYYA 3UFXB 4UOQA 3WLTA 2BYTA 4Z3DA 3V7NA 1LLUA 3NDBB 4AIRA 2WFZA 3TZBA 1FPQA 4WKCA 1Z4PX 1PK9A 5FPQA 1P80A 1JWBB 1VL0A 3U3XA 3P9CA 2I29A 1SKQA 1L8XA 2DFTA 3N2GB 3Q5EA 3MIIA 3QUTA 1PSWA 4HDRA 6Q21A 2AC2A 3TTXA 3QUSA 1Q1QA 2OXTA 4UJ3A 3SVTA 2VZEA 3N0TA 1YZLA 2WD7B 3D8SA 3GGOA 2A7XA 2XVYA 3MPUA 5LCXA 3K9FC 1P2UA 4PQFA 4IUYA 4BKRA 4QU9A 2HA0A 2UYQA 4NCBA 1R6DA 1XFAA 3HKBB 1ZONA 1ZOPA 4LZLA 2ZW9A 3HRHA 4A8HA 1SCKA 2BEVB 3DBHA 2XCLA 2A1TS 4N9WA 4QBHA 1S2GA 2GOYA 1XZEA 1THTA 1IDN1 2J0VA 4P3OA 4EKIA 4DV3B 2P4UA 4KC0A 1E2LA 3AF1A 5JZ9A 3RTGA 2QRMA 1GKIA 1Y9AA 2AVNA 1SRRA 4KYIB 2Z1DA 3LPNA 4PZDA 1GRCA 4TKVB 4RH1A 5CLLA 3WWOA 4QXMA 3FHOA 2F3TA 2H1OA 2ENUA 4BB0A 1HA3A 1QZXA 3F6BX 1W4ZA 5DLPA 4YFVA 1VHQA 3RSOA 2WJYA 4E15A 4EG3A 3OIUA 4M8IA 2ODAA 1C7RA 1B6RA 1JHVA 2IIVA 2XAAA 2PYIA 4MRRA 4MB0A 1Q21A 4HXFB 4JJFA 5A04A 2WEKA 3GT3A 5EPUA 5K8CA 3RYCA 3K5WA 4NZPA 5LA6A 4X65B 1IYZA 1WPGA 2JJ1A 5F5XA 4ZMSA 2WSSA 1DOHA 4DIMA 4PLZA 1OMOA 3NHSA 3LL4A 1PDWA 1ZK4A 1C4OA 2POQX 2VDWA 4L28A 1RE1A 4LZNA 3SYTA 3K0SA 4TXMA 3WMRA 1GU1A 2V45A 3K70D 5U4XA 4DMCA 2ZUFA 4MWTA 4FUQA 4M9ZA 1DXOA 2FQYA 1C2YA 4LTNA 2QQFA 3U62A 1TADA 2DFNA 1U3UA 1TRHA 1KARA 1KI1A 4TZKA 3OJOA 4P5EA 3KT8A 5IHXA 3WMEA 1UINA 2VS1A 4RY9A 3R6WA 1EQ2A 3V7UA 1E0KA 2IQ5A 2QU8A 3KT3A 2YYYA 2QRPA 4XX0A 3HA2A 3ZWOA 4DIUA 2J8ZA 3ZYCA 1XMQB 1VLJA 3G2NA 1E8DA 3NGLA 3TNJA 1V71A 2FG7C 3EX7C 2IVFA 3D5EA 4DLRA 3O2NA 4BP3A 1TA0A 2XOEA 3VSDA 4DDTA 1NRXA 3NIGB 1JHAA 4HADA 4WADA 1LW7A 3QEOA 1E61A 3VH3A 2CVFA 4EPVA 4RTLA 3SK0A 2I6XA 1KGSA 3GMSA 1A8UA 3RF6A 1II9A 1U3VA 2GVNA 1H2HA 4NCNA 2CLHB 5KTNA 2CHQA 1W2HA 3T34A 3DZ8A 4J2TA 1E2NA 2HBQA 3Q2KA 4D92A 4YC7A 1Q3KA 3FFTA 1IXYA 3CE6A 3EUWA 2FCAA 4QGFA 4XQCA 3VJMA 1EDZA 2XKAA 3ZKAA 3NP7A 4CUKA 1IBKB 3KR9A 5ICMA 3KQMA 4YRDA 1BSVA 1PFGA 4TSKA 2IH2A 3QKRA 3HDGA 1C0IA 1C30B 5DM0A 4MMZB 5KQRA 4JSTA 1E2IA 1B16A 1UZLA 1DMSA 2JIMA 1DRVA 4ZOEA 3RFFA 4CPDA 4RTKA 3GB9A 1E6WA 3IDOA 1JL3A 1I4EB 4HFRA 1FFAA 2EL7A 3C1OA 3HE3A 2JFPA 4RD1A 1AU9A 4DMMA 3QIVA 4EJ6A 2Y9PB 3HV2A 2CL6X 3EGCA 3R7AA 2NUPB 4ZV4A 5K9ZA 5AKJA 2HSGA 2OCLA 1PWYE 2OE2A 4EB6A 5BYBA 2QIOA 5JDIC 1ULUA 2QHXA 2C0PA 1KIFA 3F7OA 3P2MA 3INRA 3K70C 2YVKA 1TM7E 1I5EA 4XSVA 4MIOA 4ZZ3A 3TEMA 1LSJA 1NE2A 3UWPA 1KDYA 4B4VA 3T7SA 4CM5A 1YTUA 3RIHA 1KFEB 4JXJA 2JZCA 4KZKA 3K6SB 2CVHA 3CR8A 4FS3A 1E3LA 4I9FA 1MF7A 3AI3A 4MUGA 4Q0MA 5BVGB 3VPHA 5KOJA 4BMDA 4M22A 3D2LA 3UTCA 3L93A 2WD8A 1MRNA 4UCQA 3W1WA 2F4NA 3ESDA 4CIVA 1WSWA 5FUWA 2CDNA 1E7SA 3S7TA 1NZJA 3JQAD 3M1LA 1Z2NX 2P9FA 4PCAA 3DW1X 5FWXB 1CR1A 1V3QE 3TIXB 1HDXA 4RC9A 1LW6E 1QFXA 2RI0A 3OIVA 3GX1A 4O2BF 2Q3CA 4YLGA 3V7YA 3WK8A 4CEJB 4I6JA 1FPMA 1AQYA 3WGHA 4IVRA 5FP0A 5FEUA 5JD4A 5I7HA 2XZOA 1T8UA 4P3XA 3EVGA 1R7RA 2JFGA 4LAFA 1RXYA 2GYWA 5CVVA 1NSTA 2GZDA 1E6LA 5CJPA 4MB6A 3RYCB 2RHWA 2EDCA 1L9KA 1EA7A 1RMTA 2I2CA 2XEXA 3CG4A 2O59A 3GRYA 4J0DA 4N1AA 2NUAA 3MGAA 4M38A 1K8YB 4NOMA 5IM5A 2Z5FA 1SUDA 2G80A 3SE0A 2ZSFA 1O6FA 4TV8B 3U6BA 2VSQA 2IYOA 4YMSA 3GGPA 4CLEA 1G5HA 5BWNA 4UFOA 1JAYA 4KN9S 3HC7A 5JDCC 1QX3A 1OX4A 4I4LA 3M9WA 1XCMA 4GWKA 5CNMA 1O96A 4ZALA 5GY7A 3PEFA 2WTBA 5EP3A 5A5VA 2UVDA 5F4ZA 1ARZA 3RGWS 2Z6AA 2HC9A 4IXMA 4BTEA 2CZCA 3M9LA 1Y4UA 1CX9B 3CLRC 4GOXA 2WNIA 1DWPA 4EF4A 3W6ZA 4P3NA 5EHXA 1JZSA 1LDYA 2PMDA 3I6QA 3KSRA 4Z4IA 3PQ7A 3H1TA 3DG9A 5JZOA 3C74A 4R0MA 1CE8A 4D9KA 4QE3A 2ZFUA 2G0AA 4OQXA 2QM7A 2YZKA 4RPCA 3UJAA 3UKJA 5EWLB 1GLNA 5CA1B 2W2KA 3PFIA 5IEJA 5AOBA 4YV1A 5M04A 2R47A 4AUMA 4FB4A 1D2HA 4MWOA 3P0IA 4Y1GA 3N8GA 4KX5A 2DF8A 2NXCA 2YXNA 4RQTA 4UQOA 3GLFE 1HPLA 1NJ8A 1S4MA 2H52A 3ABRB 4QU0A 1GRVA 2B8WA 4Y0VA 5DHRA 2ZWOA 3UVEA 1JQEA 2QY9A 1IULA 4U00A 3P4XA 1EFTA 4UREA 4IKPA 2G08A 4DAOA 2MDTA 3LQ4A 4GPTA 4ZYYA 1N8NA 1PTKA 3TFOA 1P61B 2GYYA 3T9BA 3C1UA 4FGSA 1Y4DE 3VAAA 3TTWA 1IE3A 2G04A 4DMKA 3IALA 1HR0B 1R0RE 5THQA 2BZSA 3R24A 4L7VA 1U28C 1QRAA 1PNQA 3N0RA 4K2HA 4LVNA 5CVDA 5ERYA 3WMGA 1O95D 3GMDA 3CISA 2REBA 3P2JA 2Q0XA 3GK3A 4JEMA 1Y6QA 1K89A 2QP9X 4L85A 3QVMA 1T0UA 2VYVA 1PDOA 5EJFA 4DV2B 3BORA 1E96A 1GCAA 3X1KA 3MJ4A 2AFVA 2ZWVA 4F3NA 2PVPA 3PX2A 1DPFA 3GXBA 2GNAA 1O5IA 5J59A 4EEZA 3ASYA 1SVKA 3C14C 2BR5A 1FYWA 3DDNA 1TKCA 1ZLXA 4PX5A 2XW6A 1QS0B 4YDQA 4G0WA 5AM1A 4PLCA 4EHBA 1J90A 3RJ9A 2QT9A 4BMPB 1A5SB 4MW1A 1Q2XA 2NTYC 4UCWA 4R8MA 1N6RA 3OEHD 1F8UA 3G02A 5J43A 4FSHA 4AT1A 1N0IA 1TW3A 3SYMA 4II2A 4YIKA 1UUFA 4Q3OA 2ZS7A 5IBCA 5K5EA 1UBTS 1EFLA 1V1JA 3K0HA 1JLKA 1JXAA 2QYOA 4FXOA 2C82A 3ZHXA 3AZOA 1BMFA 3IE1A 4MYUA 1FX0B 5LLSA 4B3GA 1JI3A 4BPRA 3DFFA 4ZOLF 3EMVA 4OHBA 5J4VA 3UQZA 2WR8A 3NT2A 1BA3A 1JG6A 1FFSA 2CFSA 3PGA1 2D5BA 1Q91A 4HB0A 3FPAA 5FPTA 1LH0A 4Y9RA 4KHPB 1IVYA 3W5BA 1JUDA 3WC4A 2WNSA 2XV1A 2YJGA 1EX9A 1OT5A 3NP9A 2ZTHA 1MJNA 2QTMA 4M0CA 3W05A 4CDGA 4D4GA 5K3EA 3ZW7A 3TW0A 2H18A 6GPBA 1KTVA 3P2IA 3R7BA 3AHCA 1AMNA 2UZ3A 4WNCA 4C9BA 5BMOA 4A0GA 1C7QA 4LBZA 4NY1A 2Z2JA 3ORQA 3NTUA 3TZ6A 3T5PA 3AB8A 5JO9A 3V2HA 2C9BA 3AC0A 4YRCA 3U9TA 3KDPA 4JCCA 4Z0NA 4ENTA 4DV1B 3TLZA 1EWKA 1WMFA 3I39X 1LDBA 1VECA 1YA4A 3UA4A 2OBLA 2LE0A 1PQUA 2B35A 3NONA 1CYDA 2PR2A 4G0XA 5EWMA 5TMEA 1VHLA 1BCSB 2H11A 4RTJA 3PLRA 4IM7A 1YZGA 2X14A 3AM5A 3RIGA 2BE9A 1IAVA 1EP9A 2PSFA 2GERA 1DTEA 1YVEI 2ACEA 2IDJA 2OO5C 2VRNA 2QGNA 3JWPA 4FDMA 4HL6A 3X2EA 4ESVA 3MOSA 1ZVJA 2BIFA 2DC1A 3NEJA 1VRWA 5K0NA 3SKVA 1XZJA 2J0UA 5JXHA 1W34A 4P3YA 1RWVA 1ULBA 1CDDA 4LZJA 3M2TA 4RJLA 1DO8A 1D6MA 3TN7A 1JHOA 3IR6A 5JAOA 2G7ZA 2YV1A 1UXOA 1WJGA 2QMHA 5B7QA 1CQIB 3RFCA 4WNAA 4A91A 2CBZA 2CHVA 3ZD7A 2VK1A 1Y3BE 3PL5A 1A3CA 2FSHA 4IQ4A 4DV4B 2QN2A 3P32A 2P8SA 3IP9A 2SKEA 9GPBA 3P0HA 3V2IA 4RLHA 4R2WA 5C53B 3SC4A 2PQMA 2XRZA 2B8TA 3O2SB 3EFEA 2HX1A 2DT5A 5D7BA 5L4SA 4QIHA 4M9QA 1TO6A 5CX4A 5HA5A 1L4MA 1K98A 4YA6A 1ZW6A 1F8GA 1ICEA 3HHPA 4RX1A 2OXRA 4JHXA 5FAXA 1MTOA 4W7HA 1E4OA 3ZOZA 3DMTC 4E94A 2NP6A 4PN7A 4HLQB 3GP8A 1N5IA 3A6FA 3E8XA 2EJBA 4MWEA 2GPBA 5EQJB 3UAOA 4ALIA 4EZIA 4MUEA 1LZLA 4OQDA 4ABTA 1D2NA 3V9PA 3LY9A 4UFNA 4BB5A 4GVLA 2ADOA 1PJQA 4KFTA 5DGIA 2RE8A 4DV5B 4Q39A 5ARDA 3ESYA 1BXGA 4UZEA 1M6HA 5D3ZA 3RSHA 1AHNA 1DKUA 2XB9A 2Q1YA 2GCGA 1A1VA 4GQIA 3BE5A 4C78A 1OKKD 1SBQA 4PEVA 1OC2A 1LLFA 2NQ2C 4JUCA 2I1QA 1LXCA 2AMLA 1E32A 3E9YA 4HNAB 4I55F 3B1JA 4POOA 1W1IA 4TWIA 2WWWA 1E79A 1W4LA 4R8RA 5AW6A 3WYNA 4DSNA 3RU7A 2R751 3LBYA 2GCIA 4K46A 4IIBA 4U6QA 3KPUA 1DO0A 2WAXA 4ZI7A 4V02A 1QZ3A 3N6VA 1Z17A 5D51S 4LMRA 4EA9A 2VJQA 4FGZA 1V6AA 4MI1A 3SF8B 4Z2AA 5ITZB 3FSGD 4KREA 4LS3A 5H70A 3CW2A 1Q1BA 2XT0A 3IQEA 4MWZA 2J85A 2JJMA 3WJ1A 2CE2X 4EB8A 1IY8A 1Y3IA 1EWRA 2O48X 4ARAA 4YXWD 5K6AA 3ML1A 1CU1A 2XYVA 2VBFA 5C51B 1UKYA 3QBEA 5HIJA 3SXPA 2PA0A 4JI5B 1W0JA 1BFKA 1ENYA 2I8CA 3SKYA 4X8LA 4AP9A 1KOGA 2NMVA 1AJEA 2M1XA 5HKBA 2R84A 3OJ0A 2E4ZA 5LMZA 1JJIA 2AEFA 5B1HA 3B9RA 2QMEA 4UTVA 1IN8A 1JPUA 4IDFA 1NQUA 2P0EA 3BXGA 4ZK6A 1LV7A 1Z62A 4TSFD 2J41A 2FWIA 3TX2A 2ZG6A 4KR2A 4I8DA 4X1KA 1HYGA 1EESA 3EEYA 1VIYA 4X1KB 1Z08A 4KMSA 4BQEA 5ALVA 4BMOB 3DJYA 1C4WA 4YRMA 4FGKA 1XEAA 4RV9A 3G3EA 1W85A 3GPCA 1IHYA 3AY0A 4ZAYA 4B5KA 5BQFA 2ZYIA 2X76A 3JQCA 2HW8A 2IJGX 1ZGJA 2BMFA 4FFBA 4FINA 5B7GA 5KHLB 4JJAA 4R1SA 2CUTA 5F78A 2EYQA 4XGNA 1P5FA 2JARA 3WXBA 3PQ8A 1PEAA 1RM4A 1USKA 3DV9A 4NDZA 4IGKA 1UK8A 3PFCA 5KJEA 3UW1A 1T1JA 1I4TD 2IHUA 2Z9BA 2IUUA 4KIWA 3IQWA 1J09A 2VR1A 5BSEA 1U99A 3S28A 1IY2A 1E98A 4I50F 4IRUB 4BMVA 2GJ8A 4GWLA 5JYCA 1ORDA 2EW8A 3BJEA 3C45A 3T7RA 2P2DA 3D7NA 3RR2A 5JY6A 2EKQA 2ONCA 3G7SA 4JBLA 5C18A 4RABA 3TLCA 1NF8A 4F3TA 2PLNA 5IBPA 1I24A 1YZTA 3CLTD 3SIXA 3WK5A 2FGKA 4Z1OA 2ZETA 4WECA 3OE7D 1SUAA 2HBRA 1FNDA 2R00C 2BM8A 1B7GO 2ZAYA 2EWWA 2PUGA 2FH5B 2VQDA 3KG2A 1T9CA 1P8JA 3HPQA 3DMNA 4MVJP 3MJFA 2PZGA 5BY2A 2YHIB 3ZCQA 3R4VA 1UBUS 1FP4B 1YDHA 1DTSA 1C1HA 2OAGA 5JCXA 1X1EA 1A96A 2PH1A 2PXXA 2X5OA 3GGJA 3QX8A 4NJMB 4YMWA 5ES3A 2HQBA 3V3KA 2CK3D 3GEGA 4JVOA 3GLIA 3AGPA 4QUBA 1O94A 1W96A 3GN2A 5A05A 4PNEA 4PX3A 5JQWA 3IDSA 2R7AA 1LC3A 3W5UA 4AJEA 3V8EA 1S2NA 1WRBA 4O4JA 4DHWA 3GCGA 1V9SA 2Z4SA 2PJRA 3ST7A 4E30A 4F0JA 3PX7A 4R5HA 4CWAA 3QE4A 1TMYA 5DN9A 1WOYA 4JSYA 2PXAA 3HP4A 2RMKA 5BW8A 2ZRLA 3PUZA 4OHPA 3CVYA 1WMAA 1O77A 3CRQA 2QSYA 4C4OA 1YNSA 5E8RA 1PDVA 2I03A 3HFRA 2FYTA 1UMDA 3KHSA 4YJ2A 1XZQA 2VP4A 2E18A 3A7DA 3SOPA 1M8FA 2J32A 2YJ5A 2ZYWX 3CZ4A 4FBLA 1N0WA 4FYKA 4KO3S 4AX4A 4DQKA 1S8FA 2SECE 3THWA 1XTJA 4G3XA 1SK8A 1DQSA 1G8YA 4QATA 4BLUA 2PRJA 4NKRA 1CFZA 3A9WA 1RXEA 2NU6B 1C3OA 2J9XB 1NLZA 3E2PA 4KYVA 1H2YA 3TG8A 4QA9A 1PWEA 5FL7A 1X1SA 3A10A 1HZJA 4NK4A 2LDXA 3ICPA 5AI9A 4EY6A 1LJ8A 2EX1A 2KBEA 1L4NA 1IQRA 2C78A 1Z4LA 2B83A 3ASZA 2OORC 4B33A 1SULA 4PYJA 5FXMA 3OE1A 3VZPA 1N36B 4KODA 4PZPA 2WIJA 3ASUA 3JCZA 4QUJA 5BSMA 1XRQA 4RYLA 3ZWCA 4BZXA 5CYGA 4H4DA 4MQBA 2VQEB 1AZSC 3NFYA 4ZA2A 5KYYA 3BXZA 2DX7A 4UC0A 3QX9A 1RR6A 4QT0A 1NU6A 1V45E 1YB6A 4JQOA 2C9OA 3ETHA 4IWXA 3JR3A 1ORTA 2BMEA 2DQZA 4MWSA 4ZC1A 4F2PA 5KNCH 1T9HA 5DGXA 4XM0A 4F5WA 2JAPA 2RGGA 2WSLA 3EBPA 3MGKA 1X9GA 1KJ8A 4C4SA 6ABPA 1CR0A 1OZGA 1MIOB 5EL0A 1NY6A 4BWVA 2Y3IA 4KQXA 2NZXA 3O8OB 4UTRA 5M2QA 4TTPA 4XZ3A 5LIPA 2J6CA 3Q9UA 3C5EA 2PX0A 3WBJA 2GRJA 5L3SB 3NEPX 3LS2A 1P72A 2VNHA 3I2GA 3B9PA 5M34A 1JTVA 5LZ9A 3AG5A 2YWRA 2HDNB 5DLQC 1TUBB 1JKFA 1XTIA 2UYCA 1G19A 2C5BA 2I2XB 3NU1A 3DDWA 3PIRA 1WZUA 2VF4X 4G4GA 5EG5A 3ETNA 4BBPA 4BNVA 4QOGA 2FX2A 1BCRA 2D4HA 3BWXA 1U7XA 2QR5A 1NPYA 4G8JA 2GH1A 3C0KA 4BVGA 1Q0SA 2XQFA 3FMIA 3FOCA 5AW9A 2Y67A 2ZAIA 3MB8A 1YL6A 2JZNA 1ZG3A 2LZ0A 3PXXA 3W8NA 3WNQA 1G9XA 3I6BA 1Q77A 5DNVA 4B79A 4DA0A 2P3LA 3PEVA 5J58A 1I6MA 2XGOA 2ZK7A 4S2UA 4R2LA 2C97A 5F5LA 3KOMA 3RRMA 4ZI2A 5DK6A 4GD3Q 4HFMA 4PFJA 5AJVB 1HZZA 4GOJA 5KCZA 4ADSG 4WLUA 5CR9A 4RTQA 1ECFA 1JIVA 5K0GA 3EQZA 5KTSA 4PSVA 4C6SA 1NMZA 4UEJA 1MORA 4WCFB 2WKRA 2HLNA 4XTCS 5DSTA 2JIZA 3ITNA 4KNYA 1QHHB 3DZKA 4O4IA 4ZRMA 5TB5A 4E1VA 4HUTA 2PUFA 5E8JA 1NUSA 3PVCA 4EBBA 3EQ9A 3DYBA 4XGQA 3ZTYA 4K6GA 5A6VA 1DC5A 1OFUX 2PYZA 3KLOA 3NOOA 3SMVA 4C2BA 5EWMB 3ZGVA 3EGEA 2Q2WA 1QKIA 1B1CA 1B2LA 4JP8A 2PA3A 3K1ZA 5D5PA 1AOXA 1G3MA 2C77A 4JVSB 5EE0A 4RXUA 2Y6VA 3UMRA 2V6BA 4IJMA 5LDDC 4ZJUA 3VKVA 4YRKA 1L7DA 1YI0A 4UUPA 3UYLA 2NZUG 2Z8XA 3W1EA 2WMOB 3GF4A 3K0EA 1JHDA 3B6MA 4R6XA 4W4TA 4ZEOA 3U3RA 5KMGA 1LTQA 6AT1A 3ICWA 4K87A 5K99A 3DD5A 5FPYA 4MV6A 1BG6A 3OZDA 4Q82A 3EBLA 5B57C 3QMWA 3R75A 3F9CA 4HI0E 3FG9A 1KVTA 1GWNA 1OLXB 3L41A 1T5LA 3ZQUA 4X1OA 1W59A 3T5GA 4EHKA 1DNPA 3GLGA 1BYUA 1GILA 1XTZA 1MT0A 2ZYTX 3AKDA 2H2HA 3HL4A 4EX7A 1QHXA 4MR8B 4ZU1X 1L5GB 2O4UX 1FFEA 2G70A 3HB9A 4MR8A 1VSBA 5LLDA 3OP1A 1AVTA 1NSYA 4G23A 5L40A 3NIWA 1X1BA 3ZHQA 2FSSA 3UXHA 5MHTA 4RK6A 1RP7A 1POWA 2I91A 3LZDA 1NYQA 4A92A 3EIUA 3H2SA 4YK7A 2ECPA 2MTBA 4NU6A 5IBRA 5HRCA 4RMHA 4QLAA 2O3UA 2POCA 4MHSA 2UU9B 1TM4E 3DDCA 4O8CA 4ZAZA 3OCYA 3WZMA 3SQOA 2IPLA 3HR7A 4X97A 1A77A 1ATZA 2FW9A 4B17A 4WOJA 2OQIA 2QMYA 4XR4A 3JQQA 1D03A 2XJ4A 5A9SB 5A06A 3RYIB 3I64A 4Z0TA 3WP1B 4PTZA 2D0PB 4DDHA 3BIWA 1D6SA 4MGYR 3CUKA 4NMHA 1MV8A 1ECGA 4X45A 1FRFS 1BN7A 3DHYA 1A76A 1CUSA 1T8WA 2HFJA 2JIZD 1A4UA 3E27A 2RFLA 4E51A 2H00A 2C5FA 5CP8A 5AKLA 2XDYA 4C2UA 9LDTA 1PJZA 3M6AA 4MW2A 5AVQA 1GGHA 1RQNA 1OXBB 1N3YA 1U7WA 2VEOA 4LVOA 1JQ5A 4KAJA 4P4UA 5M5BA 2QBYA 3QF7A 5TX7A 4D9FA 1I6KA 1P5ZB 1VBKA 4RA9B 4RHCA 3S8YA 1WSDA 1ZHHA 1ZVKA 2ICAA 1KZHA 1G8MA 1OWLA 1RHUA 2VBGA 3GRZA 1RWNA 2H1LA 2H57A 3KEMA 1YS2X 4R4JA 1RWKA 4XWTA 4JQCA 4DSOA 5CEJA 1ZGZA 4G26A 2CXHA 1FRNA 2PDAA 1V4NA 2NIPA 3OU7A 4DM7A 3GQBA 4J4BA 5IM4F 2ZSAA 3M34A 4GLOA 2WJAA 3REGA 3IUJA 4RIFA 3CNNA 2DUJA 3GD5A 2PGOA 3PB3A 3NDRA 1UMCA 3JW8A 4HWRA 3OD5A 3VYRB 4O4HF 2WF7A 5CT6A 1CRPA 4BDTA 1AIPA 2XUJA 4AY2A 3RKSA 1C30A 4JU9A 1T4DA 1ZCZA 4KU4A 3DWEX 1XTKA 5H3CA 1UMBA 3M6LA 1HE1C 4EVSA 1UEJA 3R3VA 2HJSA 1QZZA 1Z8FA 5B30A 1M74A 1GPWB 2KW5A 4O2AB 4AMGA 3ZDDA 3MELA 4B83A 2HF9A 1TLTA 1LPSA 2PX2A 3DAPA 3OPMA 2FR8A 5CLHA 5EQFA 3ZDZB 2VDWB 3ILVA 4GI3A 4HQKA 3B70A 3RVOA 4PGGA 3VR2A 3WV5A 7REQB 1X14A 3KCQA 2ISSD 4Y0NA 2M2IA 3PUIA 1CXZA 2Z0MA 4D45A 4RV5A 4C22A 4HB4A 2Y1EA 3RBZA 3PLNA 1DBIA 3AY6A 3KUXA 4WXHA 1KYTA 4BPBA 3PGXA 2WDPA 4Q7LA 1R64A 1Z0AA 1KZYC 2MINA 3N74A 3RIMA 3BX1A 3CTPA 1QIJA 4C6HA 5IAKA 5KB3A 1V26A 8AT1A 5KVQA 4BV2A 5J2TA 2WU1A 1XKTA 3FRHA 1JS1X 3H9EO 2QE7A 2QK4A 3NANA 4TM7A 4DREA 3HO1A 2H65A 2ZZMA 5I7EA 4MZXA 2IYRA 4QGSA 3DZIA 2J0SA 4X62B 3R5SA 3JYHA 3SM3A 3QHPA 3WLPA 4Y6OA 4FP9A 3D0OA 4RMGA 4D9CA 3MMNA 3E05A 1ONOA 2O57A 4C3ZA 2PTGA 1KJYA 1E94E 2VHTA 1U9ZA 1G60A 4MV8A 4TMYA 1T5OA 2MR5A 1UPXA 4BZPA 5CM2Z 3WRXC 4C07A 2BGNA 2YTZA 5I8WA 3UXEA 1GUYA 1TVEA 4N7RA 1R5JA 3I1FA 5FOSA 4B8ZA 2AN4A 3UV6A 1QQBA 2YWHA 1Z0UA 1YB4A 5BR1A 5BWLA 1J7JA 4BN0A 4NLLA 2V7TA 2Y1DA 3WSTA 1UAAA 4UM5A 1PCXA 1QR2A 4I36A 5T8KC 1OGJA 3H5WA 1WCYA 3BB1A 4E2ZA 2WYUA 2V55B 1PX0A 3HKEA 3V8NA 1VKZA 4ONEA 4Q4DA 4RHUA 1V4BA 4JI8B 3AJ8A 2FP4A 3H9GA 4BCDA 4I1UA 2V4MA 1LSSA 5ESDA 4RKRA 2OFOA 3PFGA 4B6PA 3ITEA 1TZ2A 4MAFA 1EJBA 1Z4QA 3ORHA 3QW4B 4PGMA 1OYWA 3CZQA 4N01A 3ZQ4A 1S4QA 1V8OA 2JK0A 2FDXA 4PR3A 5JAUA 2OHGA 2PCJA 4XFJA 1V3TA 3ZGZA 3VHXA 2V3WA 1J6UA 2XVAA 2EZTA 3BWDD 1ZITA 2NYAA 1SVWA 2YMQA 3P9PA 4M6WB 4OJYA 4XOUA 3MWKA 3C3EA 3QUBA 1IBSA 1TQ6A 3LPMA 3OCJA 4N3NA 4BJ6A 4TM8A 4YAKA 5A02A 2O3JA 1T9AA 3FIJA 1R4AA 3IEMA 4MR9A 3QK7A 4G24A 2B98A 2FMKA 2XMSA 4UDNA 4YPVA 2XVMA 2H07A 4XUDA 4QFCA 4ZCRA 4JJIA 1Z0JA 2P5UA 1NW4A 4BEBA 4EMBA 4XLZA 5IULC 2GPNA 1TF5A 1D4FA 4QPJC 3EOAI 3UT6A 2PUBA 2VYVD 3L1IA 1Q1ZA 1S3SA 3CMCO 3GPBA 3PFBA 3RVRA 1G6HA 3CMMA 3DNFA 4O2RA 5TVKA 3R74A 2UXBB 1W6UA 1YOBA 4BKPA 1LCIA 4A36A 1JAZA 1EFDN 2OY0A 1B6SA 1VA4A 1T5DX 1USGA 3NPMA 1BEUB 4M7WA 4I5FA 5AK5A 3ZDYB 2ESRA 3VR6H 3RSGA 5FYDA 1CKEA 1N9GB 3GJYA 1RM5A 2JVJA 3OIYA 2PKXA 1FOEB 1JR3A 3GLQA 1DMRA 3HY6A 3EF3A 2FFQA 3ZJTA 4EYKA 1CULC 2E4YA 1H22A 2O1XA 1M2OA 4GPZA 4OYLA 5IDVA 2QLFA 4YJGB 2C3OA 3TJMA 3CN7A 1W0JD 1IG0A 2VF2A 2WG1A 4GLJA 1IOZA 4OI4A 2JS7A 2QVBA 1DKRA 2ZEJA 5AI5A 4UZFA 3RUCA 4Y2JA 4N8SA 1T3LA 4OXIA 2PAAA 3OETA 1TJYA 4BMSA 1MV5A 3GA0A 3I2FA 1N0VC 3UJ6A 5TMPA 1GN9A 1ZKMA 3UCEA 2A58A 4MV4A 1FUKA 2R60A 3IV6A 3LCRA 4LJ9A 5C7LO 4TLEA 5KNCD 1T6BY 3WICA 2HHLA 1EX6A 4KBYA 1H3FA 1L5RA 3IOMA 4MVJM 4N65A 1T9KA 1WF3A 1IU9A 1XNQB 1IEQA 4F84A 4LHSA 4N8EA 4WCVA 2GUWA 2BBSA 4DLLA 5HIIA 1X7YB 3LPLA 2GHRA 3FBWA 1YB1A 2QD4A 3ZH2A 1XPRA 4RA6A 2VSXA 2WOJA 2P9ZA 3SQLA 1CIVA 1XDWA 2OMEA 4ZYUA 1DC4A 4UMVA 1R4NA 1V6CA 5ULLA 1YQUA 1YDEA 4D98A 4KIFA 3NAZA 5EXTA 1NI5A 1QHFA 3AKYA 5B6PA 3L7IA 4M0LA 5DYWA 1BKDR 1OZFA 4V0KA 4KB5A 2ZYVX 3QF4A 1YQQA 1R6AA 1D3AA 3GVPA 4UU8A 5FOTA 1UC4B 1E6EA 3GLIE 2XB2A 2GWHA 1YMVA 4RQAA 2VQ6A 1UJ2A 3TGLA 1GTRA 2R68A 2DQKA 2VP2A 3FTDA 3IS3A 3TQRA 1BWSA 5AKIA 4GC5A 1WTAA 4LRQA 2ZBPA 4M4SA 1XA3A 3W7AA 4IEIA 1JEDA 3BFVA 2GZ1A 1JJ7A 1IN4A 4X24A 4MGHA 4FZ5A 4WRRA 2H9AA 4YUWA 5HQTA 2FETA 1JEEA 3D4IA 2JJ1D 1QP8A 3M5CA 1SXIA 2XA2A 3PI7A 4LOKA 3TTTA 4WBNB 4ZMBA 2RONA 3SN6A 1Z3CA 3Q88A 1H6BA 1KC3A 1RAEA 2RHLA 2CK3A 1EFRD 1HTTA 2QIPA 1ABFA 3LLVA 5B1YA 2HQRA 2N0SA 3GRUA 3VX4A 1DV1A 4DV6B 2JFQA 4J1SA 5GMOA 3A6ZA 4D0GA 1HEUA 2X0RA 2XCIA 4OL9A 1EM8A 2NU6A 2VK2A 3CINA 4REQA 5FD8A 3SC6A 3WDSA 1RFGE 4EHNA 4CIAA 3LSYA 4Q3AA 3TPCA 3CW8X 2IYQA 1RJ9B 2B3TA 2OV6A 2JF0A 2VYND 2HNKA 3IEPA 3O1IC 3P1JA 2YJ4A 4LE2A 3FDJA 4UMDA 5I7OA 5JH7F</