2H7ZA

Crystal structure of irditoxin
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
75
structure length
75
Chain Sequence
b'QAVGPPYTLCFECNRMTSSDCSTALRCYRGSCYTLYRPDENCELKWAVKGCAETCPTAGPNERVKCCRSPRCNDD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Irditoxin, a novel covalently linked heterodimeric three-finger toxin with high taxon-specific neurotoxicity.
pubmed doi rcsb
molecule keywords Irditoxin subunit A
molecule tags Toxin
total genus 12
structure length 75
sequence length 75
ec nomenclature
pdb deposition date 2006-06-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00087 Toxin_TOLIP Snake toxin and toxin-like protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.60.10 Mainly Beta Ribbon CD59 CD59 2h7zA00
1ERGA 1VB0A 5DO6A 1F8UB 1NTXA 1NYSA 1FFJA 1CHVS 4QTIU 2MUOA 2LCRA 1IDIA 1IDGA 2CCXA 1YWHA 1CODA 1PLOA 3PLCA 2UWRA 3NEQA 4IYEA 1NYUA 2JVEA 2JQPA 1ES7B 2VLWA 3BT2U 2ABXA 2OFSA 2MJ4A 2H62C 3HH7A 2UX2A 1B41B 1BXPA 1KFHA 2MJ0A 1CREA 2MUPA 1LX5B 1CDRA 1TFSA 1HAJA 1NXBA 1FSCA 2HLQA 4BIKB 1FF4A 1KTZB 2CTXA 2H7ZB 1IDLA 1TGXA 1KC4A 3NDSA 1F94A 2CRSA 1M9ZA 2PJYB 2MFAA 3U73U 1IJCA 1MR6A 1LXHA 1CB9A 1ABTA 1UG4A 4P7UA 1L4WA 1REWC 1KBTA 1HC9B 1ZADA 2I9BE 4AEAA 1ERAA 1CVOA 1DRSA 2QJ9C 4OM4A 1TXAA 2CRTA 1HAAA 2PJYC 2FD6U 2L03A 5IMYC 1CRFA 1QM7A 2N99A 1BTEA 5DU1A 5EBXA 4BDTB 1FRAA 1JBDA 3KFDI 4RUDA 2H5FA 3NH7A 1CXOA 1QKEA 2LA1A 2K3GA 2CDXA 1FSSB 2GOOB 2J8BA 3BT1U 1CTXA 2HLRA 1IKCA 2X8BB 2MJYA 1KU6B 1KBSA 1IK8A 1KBAA 1G6MA 2QC1A 1I02A 4FAOE 2GOOC 4XJJA 1CCQA 1LXGA 1NTNA 1XT3A 1HOYA 1MAHF 3EBXA 1NORA 4EY8B 2QJAC 1LSIA 3VTSA 3KFDE 1NEAA 3FEVA 3U74U 1JE9A 2MHYA 6EBXA 1JGKA 2ERAA 4DO8A 4OM5A 1RL5A 1TXBA 3ERAA 4ZQYA 2BHIA 2NBTA 1ONJA 2H8UA 1KXIA 1RGJA 4UY2C 1V6PA 1KL8A 1CDTA 1IQ9A 1LJZA 3LAQU 1CDSA 1IDHA 1CDQA 2H7ZA 5IMTD 1KS6A 1S4YA 2BTXA 1H0JA 2H64B 1COEA 2QJBC 4FAOC 1W6BA 4HQPF 1CXNA 1FASA 2H62D 1QKDA 3EVSC 3QB4B 5DZ5A 2L5SA 1HC9A 2H64C 4LFTA
chains in the Genus database with same CATH superfamily
1ERGA 1VB0A 5DO6A 1F8UB 1NTXA 1NYSA 1FFJA 1CHVS 4QTIU 4KSNA 2MUOA 2LCRA 1IDIA 1IDGA 2CCXA 1YWHA 1CODA 1PLOA 3PLCA 2UWRA 3NEQA 4IYEA 1NYUA 2JVEA 2JQPA 1ES7B 2VLWA 3BT2U 2ABXA 2OFSA 2MJ4A 2H62C 3HH7A 2UX2A 1B41B 1BXPA 1KFHA 2MJ0A 1CREA 2MUPA 1LX5B 1CDRA 1TFSA 1HAJA 1NXBA 1FSCA 2HLQA 4BIKB 1FF4A 1KTZB 2CTXA 2H7ZB 1IDLA 1TGXA 1KC4A 3NDSA 1F94A 2CRSA 1M9ZA 2PJYB 2MFAA 3U73U 1IJCA 1MR6A 1LXHA 1CB9A 1ABTA 1UG4A 4P7UA 1L4WA 1REWC 1KBTA 1HC9B 1ZADA 2I9BE 4AEAA 1ERAA 1CVOA 1DRSA 2QJ9C 4OM4A 1TXAA 2CRTA 1HAAA 2PJYC 2FD6U 2L03A 5IMYC 1CRFA 1QM7A 2N99A 1BTEA 5DU1A 5EBXA 4BDTB 1FRAA 1JBDA 3KFDI 4RUDA 2H5FA 3NH7A 1CXOA 1QKEA 2LA1A 2K3GA 2CDXA 1FSSB 2GOOB 2J8BA 3BT1U 1CTXA 2HLRA 1IKCA 2X8BB 2MJYA 1KU6B 1KBSA 1IK8A 1KBAA 1G6MA 2QC1A 1I02A 4FAOE 2GOOC 4XJJA 1CCQA 1LXGA 1NTNA 1XT3A 1HOYA 1MAHF 3EBXA 1NORA 4EY8B 2QJAC 1LSIA 3VTSA 3KFDE 1NEAA 3FEVA 3U74U 1JE9A 2MHYA 6EBXA 1JGKA 2ERAA 4DO8A 4OM5A 1RL5A 1TXBA 3ERAA 4ZQYA 2BHIA 2NBTA 1ONJA 2H8UA 1KXIA 1RGJA 4UY2C 1V6PA 1KL8A 1CDTA 1IQ9A 1LJZA 3LAQU 1CDSA 1IDHA 1CDQA 2H7ZA 5IMTD 1KS6A 1S4YA 2BTXA 1H0JA 2H64B 1COEA 2QJBC 4FAOC 1W6BA 4HQPF 1CXNA 1FASA 2H62D 1QKDA 3EVSC 3QB4B 5DZ5A 2L5SA 1HC9A 2H64C 4LFTA
chains in the Genus database with same CATH topology
1ERGA 1VB0A 5DO6A 1F8UB 1NTXA 1NYSA 1FFJA 1CHVS 4QTIU 4KSNA 2MUOA 2LCRA 1IDIA 1IDGA 2CCXA 1YWHA 1CODA 1PLOA 3PLCA 2UWRA 3NEQA 4IYEA 1NYUA 2JVEA 2JQPA 1ES7B 2VLWA 3BT2U 2ABXA 2OFSA 2MJ4A 2H62C 3HH7A 2UX2A 1B41B 1BXPA 1KFHA 2MJ0A 1CREA 2MUPA 1LX5B 1CDRA 1TFSA 1HAJA 1NXBA 1FSCA 2HLQA 4BIKB 1FF4A 1KTZB 2CTXA 2H7ZB 1IDLA 1TGXA 1KC4A 3NDSA 1F94A 2CRSA 1M9ZA 2PJYB 2MFAA 3U73U 1IJCA 1MR6A 1LXHA 1CB9A 1ABTA 1UG4A 4P7UA 1L4WA 1REWC 1KBTA 1HC9B 1ZADA 2I9BE 4AEAA 1ERAA 1CVOA 1DRSA 2QJ9C 4OM4A 1TXAA 2CRTA 1HAAA 2PJYC 2FD6U 2L03A 5IMYC 1CRFA 1QM7A 2N99A 1BTEA 5DU1A 5EBXA 4BDTB 1FRAA 1JBDA 3KFDI 4RUDA 2H5FA 3NH7A 1CXOA 1QKEA 2LA1A 2K3GA 2CDXA 1FSSB 2GOOB 2J8BA 3BT1U 1CTXA 2HLRA 1IKCA 2X8BB 2MJYA 1KU6B 1KBSA 1IK8A 1KBAA 1G6MA 2QC1A 1I02A 4FAOE 2GOOC 4XJJA 1CCQA 1LXGA 1NTNA 1XT3A 1HOYA 1MAHF 3EBXA 1NORA 4EY8B 2QJAC 1LSIA 3VTSA 3KFDE 1NEAA 3FEVA 3U74U 1JE9A 2MHYA 6EBXA 1JGKA 2ERAA 4DO8A 4OM5A 1RL5A 1TXBA 3ERAA 4ZQYA 2BHIA 2NBTA 1ONJA 2H8UA 1KXIA 1RGJA 4UY2C 1V6PA 1KL8A 1CDTA 1IQ9A 1LJZA 3LAQU 1CDSA 1IDHA 1CDQA 2H7ZA 5IMTD 1KS6A 1S4YA 2BTXA 1H0JA 2H64B 1COEA 2QJBC 4FAOC 1W6BA 4HQPF 1CXNA 1FASA 2H62D 1QKDA 3EVSC 3QB4B 5DZ5A 2L5SA 1HC9A 2H64C 4LFTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ERG A;  1VB0 A;  5DO6 A;  1F8U B;  1NTX A;  1NYS A;  1FFJ A;  1CHV S;  4QTI U;  2MUO A;  2LCR A;  1IDI A;  1IDG A;  2CCX A;  1YWH A;  1COD A;  1PLO A;  3PLC A;  2UWR A;  3NEQ A;  4IYE A;  1NYU A;  2JVE A;  2JQP A;  1ES7 B;  2VLW A;  3BT2 U;  2ABX A;  2OFS A;  2MJ4 A;  2H62 C;  3HH7 A;  2UX2 A;  1B41 B;  1BXP A;  1KFH A;  2MJ0 A;  1CRE A;  2MUP A;  1LX5 B;  1CDR A;  1TFS A;  1HAJ A;  1NXB A;  1FSC A;  2HLQ A;  4BIK B;  1FF4 A;  1KTZ B;  2CTX A;  2H7Z B;  1IDL A;  1TGX A;  1KC4 A;  3NDS A;  1F94 A;  2CRS A;  1M9Z A;  2PJY B;  2MFA A;  3U73 U;  1IJC A;  1MR6 A;  1LXH A;  1CB9 A;  1ABT A;  1UG4 A;  4P7U A;  1L4W A;  1REW C;  1KBT A;  1HC9 B;  1ZAD A;  2I9B E;  4AEA A;  1ERA A;  1CVO A;  1DRS A;  2QJ9 C;  4OM4 A;  1TXA A;  2CRT A;  1HAA A;  2PJY C;  2FD6 U;  2L03 A;  5IMY C;  1CRF A;  1QM7 A;  2N99 A;  1BTE A;  5DU1 A;  5EBX A;  4BDT B;  1FRA A;  1JBD A;  3KFD I;  4RUD A;  2H5F A;  3NH7 A;  1CXO A;  1QKE A;  2LA1 A;  2K3G A;  2CDX A;  1FSS B;  2GOO B;  2J8B A;  3BT1 U;  1CTX A;  2HLR A;  1IKC A;  2X8B B;  2MJY A;  1KU6 B;  1KBS A;  1IK8 A;  1KBA A;  1G6M A;  2QC1 A;  1I02 A;  4FAO E;  2GOO C;  4XJJ A;  1CCQ A;  1LXG A;  1NTN A;  1XT3 A;  1HOY A;  1MAH F;  3EBX A;  1NOR A;  4EY8 B;  2QJA C;  1LSI A;  3VTS A;  3KFD E;  1NEA A;  3FEV A;  3U74 U;  1JE9 A;  2MHY A;  6EBX A;  1JGK A;  2ERA A;  4DO8 A;  4OM5 A;  1RL5 A;  1TXB A;  3ERA A;  4ZQY A;  2BHI A;  2NBT A;  1ONJ A;  2H8U A;  1KXI A;  1RGJ A;  4UY2 C;  1V6P A;  1KL8 A;  1CDT A;  1IQ9 A;  1LJZ A;  3LAQ U;  1CDS A;  1IDH A;  1CDQ A;  2H7Z A;  5IMT D;  1KS6 A;  1S4Y A;  2BTX A;  1H0J A;  2H64 B;  1COE A;  2QJB C;  4FAO C;  1W6B A;  4HQP F;  1CXN A;  1FAS A;  2H62 D;  1QKD A;  3EVS C;  3QB4 B;  5DZ5 A;  2L5S A;  1HC9 A;  2H64 C;  4LFT A; 
#chains in the Genus database with same CATH topology
 1ERG A;  1VB0 A;  5DO6 A;  1F8U B;  1NTX A;  1NYS A;  1FFJ A;  1CHV S;  4QTI U;  4KSN A;  2MUO A;  2LCR A;  1IDI A;  1IDG A;  2CCX A;  1YWH A;  1COD A;  1PLO A;  3PLC A;  2UWR A;  3NEQ A;  4IYE A;  1NYU A;  2JVE A;  2JQP A;  1ES7 B;  2VLW A;  3BT2 U;  2ABX A;  2OFS A;  2MJ4 A;  2H62 C;  3HH7 A;  2UX2 A;  1B41 B;  1BXP A;  1KFH A;  2MJ0 A;  1CRE A;  2MUP A;  1LX5 B;  1CDR A;  1TFS A;  1HAJ A;  1NXB A;  1FSC A;  2HLQ A;  4BIK B;  1FF4 A;  1KTZ B;  2CTX A;  2H7Z B;  1IDL A;  1TGX A;  1KC4 A;  3NDS A;  1F94 A;  2CRS A;  1M9Z A;  2PJY B;  2MFA A;  3U73 U;  1IJC A;  1MR6 A;  1LXH A;  1CB9 A;  1ABT A;  1UG4 A;  4P7U A;  1L4W A;  1REW C;  1KBT A;  1HC9 B;  1ZAD A;  2I9B E;  4AEA A;  1ERA A;  1CVO A;  1DRS A;  2QJ9 C;  4OM4 A;  1TXA A;  2CRT A;  1HAA A;  2PJY C;  2FD6 U;  2L03 A;  5IMY C;  1CRF A;  1QM7 A;  2N99 A;  1BTE A;  5DU1 A;  5EBX A;  4BDT B;  1FRA A;  1JBD A;  3KFD I;  4RUD A;  2H5F A;  3NH7 A;  1CXO A;  1QKE A;  2LA1 A;  2K3G A;  2CDX A;  1FSS B;  2GOO B;  2J8B A;  3BT1 U;  1CTX A;  2HLR A;  1IKC A;  2X8B B;  2MJY A;  1KU6 B;  1KBS A;  1IK8 A;  1KBA A;  1G6M A;  2QC1 A;  1I02 A;  4FAO E;  2GOO C;  4XJJ A;  1CCQ A;  1LXG A;  1NTN A;  1XT3 A;  1HOY A;  1MAH F;  3EBX A;  1NOR A;  4EY8 B;  2QJA C;  1LSI A;  3VTS A;  3KFD E;  1NEA A;  3FEV A;  3U74 U;  1JE9 A;  2MHY A;  6EBX A;  1JGK A;  2ERA A;  4DO8 A;  4OM5 A;  1RL5 A;  1TXB A;  3ERA A;  4ZQY A;  2BHI A;  2NBT A;  1ONJ A;  2H8U A;  1KXI A;  1RGJ A;  4UY2 C;  1V6P A;  1KL8 A;  1CDT A;  1IQ9 A;  1LJZ A;  3LAQ U;  1CDS A;  1IDH A;  1CDQ A;  2H7Z A;  5IMT D;  1KS6 A;  1S4Y A;  2BTX A;  1H0J A;  2H64 B;  1COE A;  2QJB C;  4FAO C;  1W6B A;  4HQP F;  1CXN A;  1FAS A;  2H62 D;  1QKD A;  3EVS C;  3QB4 B;  5DZ5 A;  2L5S A;  1HC9 A;  2H64 C;  4LFT A; 
#chains in the Genus database with same CATH homology
 1ERG A;  1VB0 A;  5DO6 A;  1F8U B;  1NTX A;  1NYS A;  1FFJ A;  1CHV S;  4QTI U;  4KSN A;  2MUO A;  2LCR A;  1IDI A;  1IDG A;  2CCX A;  1YWH A;  1COD A;  1PLO A;  3PLC A;  2UWR A;  3NEQ A;  4IYE A;  1NYU A;  2JVE A;  2JQP A;  1ES7 B;  2VLW A;  3BT2 U;  2ABX A;  2OFS A;  2MJ4 A;  2H62 C;  3HH7 A;  2UX2 A;  1B41 B;  1BXP A;  1KFH A;  2MJ0 A;  1CRE A;  2MUP A;  1LX5 B;  1CDR A;  1TFS A;  1HAJ A;  1NXB A;  1FSC A;  2HLQ A;  4BIK B;  1FF4 A;  1KTZ B;  2CTX A;  2H7Z B;  1IDL A;  1TGX A;  1KC4 A;  3NDS A;  1F94 A;  2CRS A;  1M9Z A;  2PJY B;  2MFA A;  3U73 U;  1IJC A;  1MR6 A;  1LXH A;  1CB9 A;  1ABT A;  1UG4 A;  4P7U A;  1L4W A;  1REW C;  1KBT A;  1HC9 B;  1ZAD A;  2I9B E;  4AEA A;  1ERA A;  1CVO A;  1DRS A;  2QJ9 C;  4OM4 A;  1TXA A;  2CRT A;  1HAA A;  2PJY C;  2FD6 U;  2L03 A;  5IMY C;  1CRF A;  1QM7 A;  2N99 A;  1BTE A;  5DU1 A;  5EBX A;  4BDT B;  1FRA A;  1JBD A;  3KFD I;  4RUD A;  2H5F A;  3NH7 A;  1CXO A;  1QKE A;  2LA1 A;  2K3G A;  2CDX A;  1FSS B;  2GOO B;  2J8B A;  3BT1 U;  1CTX A;  2HLR A;  1IKC A;  2X8B B;  2MJY A;  1KU6 B;  1KBS A;  1IK8 A;  1KBA A;  1G6M A;  2QC1 A;  1I02 A;  4FAO E;  2GOO C;  4XJJ A;  1CCQ A;  1LXG A;  1NTN A;  1XT3 A;  1HOY A;  1MAH F;  3EBX A;  1NOR A;  4EY8 B;  2QJA C;  1LSI A;  3VTS A;  3KFD E;  1NEA A;  3FEV A;  3U74 U;  1JE9 A;  2MHY A;  6EBX A;  1JGK A;  2ERA A;  4DO8 A;  4OM5 A;  1RL5 A;  1TXB A;  3ERA A;  4ZQY A;  2BHI A;  2NBT A;  1ONJ A;  2H8U A;  1KXI A;  1RGJ A;  4UY2 C;  1V6P A;  1KL8 A;  1CDT A;  1IQ9 A;  1LJZ A;  3LAQ U;  1CDS A;  1IDH A;  1CDQ A;  2H7Z A;  5IMT D;  1KS6 A;  1S4Y A;  2BTX A;  1H0J A;  2H64 B;  1COE A;  2QJB C;  4FAO C;  1W6B A;  4HQP F;  1CXN A;  1FAS A;  2H62 D;  1QKD A;  3EVS C;  3QB4 B;  5DZ5 A;  2L5S A;  1HC9 A;  2H64 C;  4LFT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...