2H7ZA

Crystal structure of irditoxin
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
75
structure length
75
Chain Sequence
QAVGPPYTLCFECNRMTSSDCSTALRCYRGSCYTLYRPDENCELKWAVKGCAETCPTAGPNERVKCCRSPRCNDD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Irditoxin subunit A
publication title Irditoxin, a novel covalently linked heterodimeric three-finger toxin with high taxon-specific neurotoxicity.
pubmed doi rcsb
molecule tags Toxin
total genus 12
structure length 75
sequence length 75
ec nomenclature
pdb deposition date 2006-06-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00087 Toxin_TOLIP Snake toxin and toxin-like protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.60.10 Mainly Beta Ribbon CD59 CD59 2h7zA00
1M9ZA 4HQPF 1IDIA 4BDTB 4EY8B 2HLRA 1COEA 2QJ9C 1HOYA 1IJCA 1CHVS 2UX2A 4UY2C 2CRSA 3EBXA 4IYEA 1I02A 5IMTD 1LSIA 1IKCA 2HLQA 1NYSA 2CDXA 3BT2U 1NEAA 3EVSC 1FASA 2MJYA 3NH7A 2BTXA 1JE9A 1IK8A 3FEVA 2PJYB 2CRTA 2H8UA 2UWRA 4FAOE 1FF4A 5DO6A 1TGXA 1CDSA 5IMYC 2J8BA 1CTXA 4OM5A 1LJZA 1KXIA 2PJYC 1JGKA 2GOOB 2X8BB 1CREA 1ES7B 1BXPA 2I9BE 1NTNA 1KBTA 1CDQA 1KTZB 2H62C 2L03A 3NDSA 1CRFA 1TXAA 1HAJA 2ERAA 1QKEA 3U74U 1KC4A 1REWC 2GOOC 1KL8A 3PLCA 1ERGA 1IDGA 4QTIU 2QJBC 1CDTA 1CXNA 1NXBA 1XT3A 2QC1A 1JBDA 2JVEA 4RUDA 1G6MA 4BIKB 2CTXA 3KFDI 1CXOA 2CCXA 1KU6B 1FSCA 1CVOA 1ERAA 4DO8A 1TXBA 2NBTA 1ONJA 3QB4B 1F94A 2N99A 2OFSA 2K3GA 4LFTA 2BHIA 3BT1U 1UG4A 4ZQYA 1NYUA 2LA1A 6EBXA 1LX5B 1CDRA 1V6PA 1YWHA 1BTEA 3HH7A 1VB0A 2H64B 1FRAA 1KS6A 5DU1A 1L4WA 1QKDA 3NEQA 1FFJA 4AEAA 4FAOC 1KFHA 1IDLA 1B41B 2H64C 5DZ5A 2H7ZA 5EBXA 2H62D 1QM7A 2H5FA 1NTXA 2ABXA 2MJ0A 2MUOA 1HC9A 1DRSA 2MJ4A 1KBAA 1W6BA 2MHYA 4P7UA 1NORA 2H7ZB 2JQPA 1FSSB 1RL5A 1MR6A 1H0JA 1HC9B 1LXHA 2L5SA 3LAQU 1LXGA 1CODA 1RGJA 3VTSA 1CCQA 1MAHF 2FD6U 2MFAA 1ZADA 2VLWA 4OM4A 2LCRA 1IQ9A 3KFDE 1F8UB 1PLOA 2QJAC 3ERAA 1KBSA 2MUPA 3U73U 4XJJA 1CB9A 1ABTA 1IDHA 1HAAA 1S4YA 1TFSA
chains in the Genus database with same CATH superfamily
1M9ZA 4HQPF 1IDIA 4BDTB 4EY8B 2HLRA 1COEA 2QJ9C 1HOYA 1IJCA 1CHVS 2UX2A 4UY2C 2CRSA 3EBXA 4IYEA 1I02A 5IMTD 1LSIA 1IKCA 2HLQA 1NYSA 2CDXA 3BT2U 1NEAA 3EVSC 1FASA 2MJYA 3NH7A 2BTXA 1JE9A 1IK8A 3FEVA 2PJYB 2CRTA 2H8UA 2UWRA 4FAOE 1FF4A 5DO6A 1TGXA 1CDSA 5IMYC 2J8BA 1CTXA 4OM5A 1LJZA 1KXIA 2PJYC 1JGKA 2GOOB 2X8BB 1CREA 1ES7B 1BXPA 2I9BE 1NTNA 1KBTA 1CDQA 1KTZB 2H62C 2L03A 3NDSA 1CRFA 1TXAA 1HAJA 2ERAA 1QKEA 3U74U 1KC4A 1REWC 2GOOC 1KL8A 3PLCA 1ERGA 1IDGA 4KSNA 4QTIU 2QJBC 1CDTA 1CXNA 1NXBA 1XT3A 2QC1A 1JBDA 2JVEA 4RUDA 1G6MA 4BIKB 2CTXA 3KFDI 1CXOA 2CCXA 1KU6B 1FSCA 1CVOA 1ERAA 4DO8A 1TXBA 2NBTA 1ONJA 3QB4B 1F94A 2N99A 2OFSA 2K3GA 4LFTA 2BHIA 3BT1U 1UG4A 4ZQYA 1NYUA 2LA1A 6EBXA 1LX5B 1CDRA 1V6PA 1YWHA 1BTEA 3HH7A 1VB0A 2H64B 1FRAA 1KS6A 5DU1A 1L4WA 1QKDA 3NEQA 1FFJA 4AEAA 4FAOC 1KFHA 1IDLA 1B41B 2H64C 5DZ5A 2H7ZA 5EBXA 2H62D 1QM7A 2H5FA 1NTXA 2ABXA 2MJ0A 2MUOA 1HC9A 1DRSA 2MJ4A 1KBAA 1W6BA 2MHYA 4P7UA 1NORA 2H7ZB 2JQPA 1FSSB 1RL5A 1MR6A 1H0JA 1HC9B 1LXHA 2L5SA 3LAQU 1LXGA 1CODA 1RGJA 3VTSA 1CCQA 1MAHF 2FD6U 2MFAA 1ZADA 2VLWA 4OM4A 2LCRA 1IQ9A 3KFDE 1F8UB 1PLOA 2QJAC 3ERAA 1KBSA 2MUPA 3U73U 4XJJA 1CB9A 1ABTA 1IDHA 1HAAA 1S4YA 1TFSA
chains in the Genus database with same CATH topology
1M9ZA 4HQPF 1IDIA 4BDTB 4EY8B 2HLRA 1COEA 2QJ9C 1HOYA 1IJCA 1CHVS 2UX2A 4UY2C 2CRSA 3EBXA 4IYEA 1I02A 5IMTD 1LSIA 1IKCA 2HLQA 1NYSA 2CDXA 3BT2U 1NEAA 3EVSC 1FASA 2MJYA 3NH7A 2BTXA 1JE9A 1IK8A 3FEVA 2PJYB 2CRTA 2H8UA 2UWRA 4FAOE 1FF4A 5DO6A 1TGXA 1CDSA 5IMYC 2J8BA 1CTXA 4OM5A 1LJZA 1KXIA 2PJYC 1JGKA 2GOOB 2X8BB 1CREA 1ES7B 1BXPA 2I9BE 1NTNA 1KBTA 1CDQA 1KTZB 2H62C 2L03A 3NDSA 1CRFA 1TXAA 1HAJA 2ERAA 1QKEA 3U74U 1KC4A 1REWC 2GOOC 1KL8A 3PLCA 1ERGA 1IDGA 4KSNA 4QTIU 2QJBC 1CDTA 1CXNA 1NXBA 1XT3A 2QC1A 1JBDA 2JVEA 4RUDA 1G6MA 4BIKB 2CTXA 3KFDI 1CXOA 2CCXA 1KU6B 1FSCA 1CVOA 1ERAA 4DO8A 1TXBA 2NBTA 1ONJA 3QB4B 1F94A 2N99A 2OFSA 2K3GA 4LFTA 2BHIA 3BT1U 1UG4A 4ZQYA 1NYUA 2LA1A 6EBXA 1LX5B 1CDRA 1V6PA 1YWHA 1BTEA 3HH7A 1VB0A 2H64B 1FRAA 1KS6A 5DU1A 1L4WA 1QKDA 3NEQA 1FFJA 4AEAA 4FAOC 1KFHA 1IDLA 1B41B 2H64C 5DZ5A 2H7ZA 5EBXA 2H62D 1QM7A 2H5FA 1NTXA 2ABXA 2MJ0A 2MUOA 1HC9A 1DRSA 2MJ4A 1KBAA 1W6BA 2MHYA 4P7UA 1NORA 2H7ZB 2JQPA 1FSSB 1RL5A 1MR6A 1H0JA 1HC9B 1LXHA 2L5SA 3LAQU 1LXGA 1CODA 1RGJA 3VTSA 1CCQA 1MAHF 2FD6U 2MFAA 1ZADA 2VLWA 4OM4A 2LCRA 1IQ9A 3KFDE 1F8UB 1PLOA 2QJAC 3ERAA 1KBSA 2MUPA 3U73U 4XJJA 1CB9A 1ABTA 1IDHA 1HAAA 1S4YA 1TFSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1M9Z A;  4HQP F;  1IDI A;  4BDT B;  4EY8 B;  2HLR A;  1COE A;  2QJ9 C;  1HOY A;  1IJC A;  1CHV S;  2UX2 A;  4UY2 C;  2CRS A;  3EBX A;  4IYE A;  1I02 A;  5IMT D;  1LSI A;  1IKC A;  2HLQ A;  1NYS A;  2CDX A;  3BT2 U;  1NEA A;  3EVS C;  1FAS A;  2MJY A;  3NH7 A;  2BTX A;  1JE9 A;  1IK8 A;  3FEV A;  2PJY B;  2CRT A;  2H8U A;  2UWR A;  4FAO E;  1FF4 A;  5DO6 A;  1TGX A;  1CDS A;  5IMY C;  2J8B A;  1CTX A;  4OM5 A;  1LJZ A;  1KXI A;  2PJY C;  1JGK A;  2GOO B;  2X8B B;  1CRE A;  1ES7 B;  1BXP A;  2I9B E;  1NTN A;  1KBT A;  1CDQ A;  1KTZ B;  2H62 C;  2L03 A;  3NDS A;  1CRF A;  1TXA A;  1HAJ A;  2ERA A;  1QKE A;  3U74 U;  1KC4 A;  1REW C;  2GOO C;  1KL8 A;  3PLC A;  1ERG A;  1IDG A;  4QTI U;  2QJB C;  1CDT A;  1CXN A;  1NXB A;  1XT3 A;  2QC1 A;  1JBD A;  2JVE A;  4RUD A;  1G6M A;  4BIK B;  2CTX A;  3KFD I;  1CXO A;  2CCX A;  1KU6 B;  1FSC A;  1CVO A;  1ERA A;  4DO8 A;  1TXB A;  2NBT A;  1ONJ A;  3QB4 B;  1F94 A;  2N99 A;  2OFS A;  2K3G A;  4LFT A;  2BHI A;  3BT1 U;  1UG4 A;  4ZQY A;  1NYU A;  2LA1 A;  6EBX A;  1LX5 B;  1CDR A;  1V6P A;  1YWH A;  1BTE A;  3HH7 A;  1VB0 A;  2H64 B;  1FRA A;  1KS6 A;  5DU1 A;  1L4W A;  1QKD A;  3NEQ A;  1FFJ A;  4AEA A;  4FAO C;  1KFH A;  1IDL A;  1B41 B;  2H64 C;  5DZ5 A;  2H7Z A;  5EBX A;  2H62 D;  1QM7 A;  2H5F A;  1NTX A;  2ABX A;  2MJ0 A;  2MUO A;  1HC9 A;  1DRS A;  2MJ4 A;  1KBA A;  1W6B A;  2MHY A;  4P7U A;  1NOR A;  2H7Z B;  2JQP A;  1FSS B;  1RL5 A;  1MR6 A;  1H0J A;  1HC9 B;  1LXH A;  2L5S A;  3LAQ U;  1LXG A;  1COD A;  1RGJ A;  3VTS A;  1CCQ A;  1MAH F;  2FD6 U;  2MFA A;  1ZAD A;  2VLW A;  4OM4 A;  2LCR A;  1IQ9 A;  3KFD E;  1F8U B;  1PLO A;  2QJA C;  3ERA A;  1KBS A;  2MUP A;  3U73 U;  4XJJ A;  1CB9 A;  1ABT A;  1IDH A;  1HAA A;  1S4Y A;  1TFS A; 
#chains in the Genus database with same CATH topology
 1M9Z A;  4HQP F;  1IDI A;  4BDT B;  4EY8 B;  2HLR A;  1COE A;  2QJ9 C;  1HOY A;  1IJC A;  1CHV S;  2UX2 A;  4UY2 C;  2CRS A;  3EBX A;  4IYE A;  1I02 A;  5IMT D;  1LSI A;  1IKC A;  2HLQ A;  1NYS A;  2CDX A;  3BT2 U;  1NEA A;  3EVS C;  1FAS A;  2MJY A;  3NH7 A;  2BTX A;  1JE9 A;  1IK8 A;  3FEV A;  2PJY B;  2CRT A;  2H8U A;  2UWR A;  4FAO E;  1FF4 A;  5DO6 A;  1TGX A;  1CDS A;  5IMY C;  2J8B A;  1CTX A;  4OM5 A;  1LJZ A;  1KXI A;  2PJY C;  1JGK A;  2GOO B;  2X8B B;  1CRE A;  1ES7 B;  1BXP A;  2I9B E;  1NTN A;  1KBT A;  1CDQ A;  1KTZ B;  2H62 C;  2L03 A;  3NDS A;  1CRF A;  1TXA A;  1HAJ A;  2ERA A;  1QKE A;  3U74 U;  1KC4 A;  1REW C;  2GOO C;  1KL8 A;  3PLC A;  1ERG A;  1IDG A;  4KSN A;  4QTI U;  2QJB C;  1CDT A;  1CXN A;  1NXB A;  1XT3 A;  2QC1 A;  1JBD A;  2JVE A;  4RUD A;  1G6M A;  4BIK B;  2CTX A;  3KFD I;  1CXO A;  2CCX A;  1KU6 B;  1FSC A;  1CVO A;  1ERA A;  4DO8 A;  1TXB A;  2NBT A;  1ONJ A;  3QB4 B;  1F94 A;  2N99 A;  2OFS A;  2K3G A;  4LFT A;  2BHI A;  3BT1 U;  1UG4 A;  4ZQY A;  1NYU A;  2LA1 A;  6EBX A;  1LX5 B;  1CDR A;  1V6P A;  1YWH A;  1BTE A;  3HH7 A;  1VB0 A;  2H64 B;  1FRA A;  1KS6 A;  5DU1 A;  1L4W A;  1QKD A;  3NEQ A;  1FFJ A;  4AEA A;  4FAO C;  1KFH A;  1IDL A;  1B41 B;  2H64 C;  5DZ5 A;  2H7Z A;  5EBX A;  2H62 D;  1QM7 A;  2H5F A;  1NTX A;  2ABX A;  2MJ0 A;  2MUO A;  1HC9 A;  1DRS A;  2MJ4 A;  1KBA A;  1W6B A;  2MHY A;  4P7U A;  1NOR A;  2H7Z B;  2JQP A;  1FSS B;  1RL5 A;  1MR6 A;  1H0J A;  1HC9 B;  1LXH A;  2L5S A;  3LAQ U;  1LXG A;  1COD A;  1RGJ A;  3VTS A;  1CCQ A;  1MAH F;  2FD6 U;  2MFA A;  1ZAD A;  2VLW A;  4OM4 A;  2LCR A;  1IQ9 A;  3KFD E;  1F8U B;  1PLO A;  2QJA C;  3ERA A;  1KBS A;  2MUP A;  3U73 U;  4XJJ A;  1CB9 A;  1ABT A;  1IDH A;  1HAA A;  1S4Y A;  1TFS A; 
#chains in the Genus database with same CATH homology
 1M9Z A;  4HQP F;  1IDI A;  4BDT B;  4EY8 B;  2HLR A;  1COE A;  2QJ9 C;  1HOY A;  1IJC A;  1CHV S;  2UX2 A;  4UY2 C;  2CRS A;  3EBX A;  4IYE A;  1I02 A;  5IMT D;  1LSI A;  1IKC A;  2HLQ A;  1NYS A;  2CDX A;  3BT2 U;  1NEA A;  3EVS C;  1FAS A;  2MJY A;  3NH7 A;  2BTX A;  1JE9 A;  1IK8 A;  3FEV A;  2PJY B;  2CRT A;  2H8U A;  2UWR A;  4FAO E;  1FF4 A;  5DO6 A;  1TGX A;  1CDS A;  5IMY C;  2J8B A;  1CTX A;  4OM5 A;  1LJZ A;  1KXI A;  2PJY C;  1JGK A;  2GOO B;  2X8B B;  1CRE A;  1ES7 B;  1BXP A;  2I9B E;  1NTN A;  1KBT A;  1CDQ A;  1KTZ B;  2H62 C;  2L03 A;  3NDS A;  1CRF A;  1TXA A;  1HAJ A;  2ERA A;  1QKE A;  3U74 U;  1KC4 A;  1REW C;  2GOO C;  1KL8 A;  3PLC A;  1ERG A;  1IDG A;  4KSN A;  4QTI U;  2QJB C;  1CDT A;  1CXN A;  1NXB A;  1XT3 A;  2QC1 A;  1JBD A;  2JVE A;  4RUD A;  1G6M A;  4BIK B;  2CTX A;  3KFD I;  1CXO A;  2CCX A;  1KU6 B;  1FSC A;  1CVO A;  1ERA A;  4DO8 A;  1TXB A;  2NBT A;  1ONJ A;  3QB4 B;  1F94 A;  2N99 A;  2OFS A;  2K3G A;  4LFT A;  2BHI A;  3BT1 U;  1UG4 A;  4ZQY A;  1NYU A;  2LA1 A;  6EBX A;  1LX5 B;  1CDR A;  1V6P A;  1YWH A;  1BTE A;  3HH7 A;  1VB0 A;  2H64 B;  1FRA A;  1KS6 A;  5DU1 A;  1L4W A;  1QKD A;  3NEQ A;  1FFJ A;  4AEA A;  4FAO C;  1KFH A;  1IDL A;  1B41 B;  2H64 C;  5DZ5 A;  2H7Z A;  5EBX A;  2H62 D;  1QM7 A;  2H5F A;  1NTX A;  2ABX A;  2MJ0 A;  2MUO A;  1HC9 A;  1DRS A;  2MJ4 A;  1KBA A;  1W6B A;  2MHY A;  4P7U A;  1NOR A;  2H7Z B;  2JQP A;  1FSS B;  1RL5 A;  1MR6 A;  1H0J A;  1HC9 B;  1LXH A;  2L5S A;  3LAQ U;  1LXG A;  1COD A;  1RGJ A;  3VTS A;  1CCQ A;  1MAH F;  2FD6 U;  2MFA A;  1ZAD A;  2VLW A;  4OM4 A;  2LCR A;  1IQ9 A;  3KFD E;  1F8U B;  1PLO A;  2QJA C;  3ERA A;  1KBS A;  2MUP A;  3U73 U;  4XJJ A;  1CB9 A;  1ABT A;  1IDH A;  1HAA A;  1S4Y A;  1TFS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...