2H89B

Avian respiratory complex ii with malonate bound
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
241
structure length
241
Chain Sequence
b'ATSRIKKFSIYRWDPDKPGDKPRMQTYEVDLNKCGPMVLDALIKIKNELDSTLTFRRSCREGICGSCAMNIAGGNTLACTKKIDPDLSKTTKIYPLPHMYVVKDLVPDLSNFYAQYKSIEPYLKKKDESKQGKEQYLQSIEDRQKLDGLYECILCACCSTSCPSYWWNGDKYLGPAVLMQAYRWMIDSRDDYTEERLAQLQDPFSLYRCHTIMNCTRTCPKGLNPGKAIAEIKKMMATYKE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SUCCINATE DEHYDROGENASE FLAVOPROTEIN SUBUNIT
publication title Crystallographic studies of the binding of ligands to the dicarboxylate site of Complex II, and the identity of the ligand in the
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 71
structure length 241
sequence length 241
ec nomenclature ec 1.3.5.1: Succinate dehydrogenase (quinone).
pdb deposition date 2006-06-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF13085 Fer2_3 2Fe-2S iron-sulfur cluster binding domain
B PF13534 Fer4_17 4Fe-4S dicluster domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1060.10 Mainly Alpha Orthogonal Bundle Fumarate Reductase Iron-sulfur Protein; Chain B, domain 2 Alpha-helical ferredoxin 2h89B02
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 2h89B01
5G5HA 3AE9B 4YTNB 3HVZA 3B2GA 1E0ZA 1DOXA 3AE3B 1ZOYB 1FM0D 1CZPA 4IDIA 1FXAA 1WXQA 1T3QA 1JRPA 1XO3A 1OQQA 1QOFA 2H88B 5GXGB 3SFDB 1GPXA 2K5PA 2CJOA 1NYQA 1KRHA 5G5GA 1WYGA 4YSXB 1RYJA 3AV8A 3P4SB 5C2TB 2BS2B 4YTMB 1TYGB 3NS1A 3NRZA 1ZP0B 1H7XA 1N5WA 4ZHOA 2AX5A 2MH7A 3KWLA 1I7HA 1J7BA 1IUEA 1JALA 2PIAA 3ABVB 1E9MA 3FC4A 5H8YE 3AB5A 1NEKB 2Q5WD 4N59A 1WRIA 3P4RB 4C7ZA 5AUIA 2FBWB 3AE6B 4HROA 1JQ4A 1RWSA 1F0ZA 3CWIA 1B9RA 1XLPA 1FFVA 1RFKA 2L52A 2QIEB 3BIID 2B76B 1J7CA 3HUIA 3AEFB 3NVWA 3P4PB 4FXCA 4N58A 5EE9A 1UWMA 1XLOA 2BT6A 1JROA 1DGJA 1JWAD 1E6EB 4USAA 3LB8C 2HTME 3AN1A 1QF6A 3P63A 1V97A 2WDVB 1NYRA 1FIQA 2G1EA 2PVOD 1J7AA 1E10A 1N60A 1L0VB 1YJJA 1A70A 3W9CB 5MPOA 1QLBB 3AECB 1L6UA 1FMAD 1FRRA 2N0SB 2W3RA 3B9JA 2WP9B 1QT9A 2DBYA 2K9XA 4US9A 4YT0B 1VLBA 1NVID 1E7PB 1VDVA 1FFUA 2W3SA 2EKIA 4JWSC 1FRDA 4JX1C 4YSYB 1SB3C 3WCQA 1GTEA 2W54A 3CIRB 2CU3A 2MJDA 3AEEB 1OFFA 2WLBA 2ACZB 1DOIA 3PO0A 3VRBB 1CJEA 1NI3A 3FAHA 4YSZB 2Y5CA 3ZYYX 2KMMA 4ZOHC 1KF6B 3LXFA 4JWUC 1L5PA 1AWDA 3P1MA 3VR9B 3NVYA 1AYFA 1RM6C 3NVVA 1NENB 2WQYB 4HRSA 1L6VA 3AMZA 3HRDD 4US8A 3NVZA 3W5UB 3AE2B 1QOAA 2W55A 1XLQA 2L83A 1XLNA 3B2FA 3AEGB 2MJEA 3L4PA 5AUKA 1TKEA 1PUTA 3EUB2 2WDRB 4ZHPA 1PDXA 1SF0A 3AEAB 2MJ3A 2WU2B 1YQ3B 3AE7B 1TKGA 1V8CA 2LEKA 2QJLA 4WQMA 3AE1B 2WU5B 2WDQB 3AE4B 5EE1A 2K22A 3AH7A 1WWTA 1H7WA 1ZUD2 3SR6A 2KAJA 1WGKA 3AE5B 3VRAB 1N5XA 4P6VF 1DOYA 3DWMA 1FO4A 1TKYA 2WS3B 1JW9D 1VJKA 5C3JB 1FXIA 5EE3A 1JWBD 3AE8B 3CF4A 1GTHA 1N63A 2BS3B 3DWGC 4WWMA 2DWQA 1QOBA 1YQ4B 1R7SA 4YXDB 5EE0A 4LTUA 3AEBB 2BS4B 5H92C 1PFDA 2JQRB 2PVGC 2JX5A 2OHFA 1TJEA 1N62A 1KFYB 1N61A 1GAQB 3AEDB 2M56B 1GT8A 2H89B 1OQRA 1ROEA 3P4QB 1SIJA 1YJIA 2CJNA 3VR8B 4C80A 1QOGA 4YTPB 4A9AA 3SFEB 1ZXIA 2PKOA 4ITKA 4C7YA 3ETRA 3AM9A 2E3TA 4N6EB 3RPFC 1EWYC 2M19A 4KX6B 3W5VB
chains in the Genus database with same CATH superfamily
2NBVB 1Q5WB 1R4NB 4BAXA 3ZJVA 3B1LX 3IXSA 2IY0B 2OJRA 4ZDVA 2HDEA 2G45B 3MJ5A 2M0XA 2KQSA 3MC8A 4K7WA 3U2SC 2BKFA 1S1QB 2KDIA 3P2BA 4E3CA 5CTRC 3Q3NC 3VXWA 1AW7A 3TJPA 5CX3A 4ZYNA 3ML8A 1C9FA 3CWIA 2B76B 4WJNA 1P9DU 3A9JB 4RF0A 4HKZE 4KGSA 4BBNF 4EE2A 4MJSB 3OAWA 3W9CB 1AN8A 1PGXA 3FILB 2PJHA 1L6UA 3ZO5B 4W9EA 2M8SA 1HQRD 4ARIA 2V4IB 1WM3A 1VR9A 2KXJA 4G50A 3VAWA 1GTEA 3CIRB 1Z2MA 2KWDA 5HFYA 3MHSD 3CSTA 3WAPA 3A9KB 4ICVA 3RNFC 4GIVA 1KJTA 1TZ1A 3RFZB 3B2FA 2PE6B 2KQ7A 1J19A 3AE7B 3KH0A 4W9GA 3NZUA 1D4BA 1ESFA 4P6VF 4ZRPA 4RGNA 2FE8A 1JW9D 4URKA 2MHJA 3WA0A 1V5OA 3R7RA 4JE3B 1QOBA 2WXQA 4HLEA 2WX0A 1WJUA 1GB4A 3Q3OC 3LYYA 4B95A 2MA9B 2XK5A 1L0YB 2BB5A 5I4DA 2QSDA 5AZHA 2EMTA 4PS3A 2GMIC 1WXQA 2DZIA 2WXKA 2GBRA 1GPXA 1BT0A 4X57B 3ZIMA 3EC8A 2JZPA 3IHPC 1SE4A 3FC4A 4PS8A 3DVNU 5TSSA 3SU8X 2N4FA 4IWOA 2RGFA 2D10A 3D32A 1JWAD 3NOBA 3RI7C 1V5TA 4EZKA 1NYRA 3UQBA 4MM3A 2Y3AA 3H9DA 5DPRA 2CKHB 3V6EB 2K9XA 4US9A 1FFUA 4JX1C 2IO3B 4MT5A 2CHZA 4TMAB 3PO0A 3L08A 5IOIA 2LUEA 1KF6B 2CU1A 4GN1A 4K3CA 1KLVA 4HK2A 3L16A 1UGJA 4B0EA 2KKCA 3JSVB 3PZ8A 5AUKA 2NS5A 4W9KA 4AQ7A 1OEYA 4BKTA 4BVUC 4K81A 2B3AA 1K53A 2WXJA 2O6VA 3Q3JA 1C79A 1MFWA 1VJKA 2ZCBA 3DHGC 3R7QA 1UUPA 3N3KB 4WWMA 3NJTA 3RNBC 1IP9A 4NQKE 2LGIA 2G4DB 2PPHA 4PK1A 1N61A 2LUMA 1IBXA 2WX1A 2R2QA 1F2RC 1M94A 1V49A 2V9HA 2ZEQA 4XDDA 1KOTA 3VDZA 4OVVA 3H6NA 1R4NI 4LLGM 5BMHA 2HJ8A 3PLVA 2INDC 1ZOYB 2IGHA 4IDIA 1SJED 1UZXB 3PZ7A 1QOFA 3QWZB 4BZAA 1WJ6A 5FR3A 5G5GA 2MBHA 4YSXB 2WWZA 3P4SB 1TYGB 5AZGA 1VRAB 2N7JA 1Q1OA 1N5WA 3ZVVA 1J7BA 1IUEA 1YIWA 2M0AA 4FLHA 1ACCA 3QARA 2KO3A 3SHQA 1RFKA 4D2KA 4AWJA 1Z5SB 1YD8U 2O6VD 3AN1A 4EFOA 1MVKA 2JRIB 5IN7A 2J42A 2LRWA 3M95A 1QT9A 2D07B 2KVRA 3RNAC 2WXPA 2K3UA 4S17A 3Q8FA 3MFGA 1ET6A 4ACFA 1K51A 1T0RC 4MM3B 1S3SG 1WI0A 2ZPYA 3W5UB 3R2TA 2K1FA 1BMLC 4J6IA 2BTEA 1YX6B 2LJIA 2VZKB 4PYZA 4GLSC 5J17A 2XNAC 4HCNB 3M63B 3BK2A 3IT4B 3UQAA 4S0RA 1WRDB 3QC8B 3R66C 3Q8EA 3H7SA 4B6WA 2CS4A 3NHEB 1EO6A 1YQ4B 4LCDE 3V3XA 4C4VA 2RD0A 2DHZA 4RGMA 2JPHA 4TV3A 1EU4A 2NPTA 3DHHC 1TTNA 2FIDA 2JZ3B 2NVUI 3AULA 1QOGA 4FBJB 1R4MI 4RFBA 4KX6B 1WJNA 3ZTDA 3GE3C 2MWSB 3BVGA 1D5MC 1T3QA 5BYRA 1L0XB 2K5PA 1KLGD 1HA5A 1NYQA 4BFRA 1V1PB 1SBBB 1WF9A 1C78A 1BUIC 3NS1A 1LGRA 2INPE 4AJWA 3ZJTA 2IZVB 3PREA 4ZRKA 1OGWA 4HPMB 1WRIA 4P1CC 4MH0E 4P16A 1JQ4A 2DZJA 1LO5D 5AEKB 2D3CA 2QIEB 3Q69A 2BWES 4MELA 5HKHA 2YEPF 1A70A 3AECB 1FMAD 3DBSA 1RLFA 3DDCB 2LXCA 5CHVC 3C19A 1D5ZC 3NZSA 4ICUA 1PGAA 2ZW0A 1NI3A 2KFJA 2C9WB 5JXVA 4US8A 2MBBB 2SEBD 3KUZA 5D3DA 2BYFA 4KKIA 3EUB2 2G3QB 3TCAA 3RNCC 2KDEB 2AWTA 3AE4B 2KX0A 2HTHA 4ANUA 4XGAB 1FO4A 5G2NA 5EE3A 4KZCA 3WAOA 3O13A 2D11A 1XT9B 3PV1A 1K8RB 3L13A 4XC2A 2JQRB 4ZRJA 3QA8A 4IW0A 3BZDB 4WIPA 3TL5A 1T5XD 2QHOA 3SFEB 2AL6A 4DHJB 3ETRA 2WHIA 3PRMB 1UBQA 3CF6E 2N7EA 3B2GA 1E8WA 3IAM1 2INCC 4GOCA 4KGTA 4WWNA 3VUYA 2DYBA 2A5UA 4C4VB 4I6LB 5BYQA 3PZDA 2GBKA 2GI9A 2NPTB 2PEAA 3ENEA 1ET9A 4IM2A 5E6PA 3AV8A 3DCGA 2L05A 3NRZA 3KWLA 4EOYA 1QILA 4L2YA 1JALA 4F1SA 2LVQA 3PRZA 4W9CA 5FK9C 4I6PA 2BW2A 1KH0A 3TIXA 3ZLZA 1RWSA 2AQ1B 3BIID 1J7CA 2KJ6A 1UWMA 2NMQA 2JZZA 5DPSA 1JROA 2AYOB 4AJYB 2LVOA 1QF6A 3GB1A 2JXTA 2ONQA 5BO4B 3IG3A 3N30A 3OG5A 4JL9A 4WAFA 1WGHA 1SJHD 2NCNA 4A20A 2W3SA 4IOIE 3I3TB 4YSYB 3WCQA 4DDID 2WLBA 2V3NA 2IY1B 3AU5A 3LXFA 4BKGA 3UI3A 3ZDTA 5AZFA 3NVZA 3RCZA 1CMXB 1Y56A 3I63C 1I4XA 4MGIE 3U30A 2JYTA 1V8CA 1HZ5A 4IM3A 4WQMA 1H7WA 3UF8A 1N5XA 2DNFA 2MBEA 1T0YA 4KIKB 3DWGC 2WXHA 2W9NA 1V80A 5KHOA 4WWPA 3MP9A 2FCMA 3NY5A 1GAQB 1JCKB 5IO9A 2IGGA 1GB1A 1WX8A 1GUAB 3RNGC 3BWUD 1A5RA 1SE3A 4B9KA 1SE9A 2GBNA 4JIOU 3U4EG 1FM0D 1WE7A 4GB9A 2KOXA 1CQVA 2VRRB 1TY2A 4TUUA 2MQJA 2KTRB 2AEHA 3DBHI 2MH7A 4FULA 1KLUD 4NPNA 4H2AA 2JXXA 3V62A 1XLPA 1GG3A 3R2IA 4PS7A 4LDTD 5HHDG 2YVCA 3HIZA 3TUOA 2WDVB 1FIQA 3A4SC 4M0WA 4IUMB 1K52A 3BY4B 1FRRA 3KUCB 4ZRQA 5C1ZA 2IPKD 1E7PB 1H4RA 3Q8BA 2MJDA 2N9PC 2ACZB 1CJEA 2ZVNA 3E56A 4UDUC 2BYEA 4F8CB 2V3PA 5GMVA 2UWQA 4OZCA 2V3SA 3A1QA 3ONSA 1PUTA 2WDRB 1F77A 1KM7A 2ZJDA 1I4GA 3K9PB 2K22A 1WH3A 3SR6A 2KAJA 2XN9C 1M4VA 1LXDA 4DXFA 1FXIA 2BS3B 2WXGA 4ANVA 2KQ4X 1PFDA 2KDMA 4I6NB 4GSWA 2PVGC 1F1HA 3EECA 3APDA 3BINA 1XCTL 3P4QB 5D3IB 1WE6A 3VVWB 1FPYA 2JY6A 1YJ1A 4PT5A 3L17A 1E90A 2X38A 3HK0A 4XYCA 3AE3B 1RRBA 1V2YA 1I4PA 2KX3A 5JZEB 2C7MB 1TS5A 4FN2A 2J52A 4DBGA 4HEA1 3WALA 2ZVOA 2O2VB 4FHJA 3KQ4A 2PIAA 3Q8CA 1E9MA 5HI1A 4YL8A 3VUWA 3GP7A 2HJ1A 2BWFA 2GB1A 4G0NB 1XXGA 1QKZA 1WIAA 3PHXB 1SSNA 4XWTA 4M8MA 3U8ZA 1D3ZA 1YOVB 4KV2A 2K8BA 2FCQA 1XQQA 2GLSA 2QCZA 3VUXA 4IM0A 2KTFA 4XDCA 2ZNVC 3ZYYX 4JWUC 1AWDA 3NVYA 1AYFA 2GBJA 4M0WB 1FNWA 4W9JA 2D3AA 1TS4A 2N9EB 1GC6A 3ZNHB 1YMHE 1TBEA 4LJPB 1WGYA 4RM9A 1PDXA 1WX9A 1VD2A 2PLPA 5BMGA 3UIPB 1ZUD2 3IT6B 3DWMA 2IO0B 2KLGA 2LGDA 1E8ZA 2L0FA 4GXBA 5C23A 1V86A 1I4HA 2AL3A 4HDQA 1R7SA 3APFA 4LTUA 1LM8B 1SGHA 1KFYB 3AEDB 4HCPB 4C80A 1ZKHA 2NTSA 4P1BC 2IGDA 2MSED 1EWYC 2KDFB 2VH2A 2V4LA 1SE2A 3GOEA 4AS1A 2C7HA 2I2YA 2CJOA 2HD5B 2QMTA 3GZNB 3TMPB 3RN9C 4YTMB 1H7XA 4ANWA 4N9F4 1E8XA 2IYDB 3PPAA 2CHXA 4JLCA 2W82A 2WXIA 1TZOA 3H1UA 3ZNID 3T3NA 2L7RA 1E10A 1TT5B 4FJYA 5J18A 1E7UA 5EDSA 2W3RA 4KSLC 1WYWB 3BYYB 4XE0A 4ZYSA 4XZ4A 2MBOA 1KTKA 3SDLC 1C76A 2XK5B 4JWSC 3VFKA 4ARCA 1SB3C 3AEEB 3NS8A 1MHXA 4NAWA 1F52A 3B0AA 3RT3B 1RAXA 1Y8RC 1QOAA 1G6JA 1HTOA 2J0KA 4K7SA 4B0MA 4BBNC 3CSFA 2NR2A 2CR5A 2MJ3A 2WU2B 2WYQA 4KSKC 5BYSA 2WU5B 1C4PA 3PSEB 3AH7A 2DZMA 4LNOA 2JRHA 3TEXA 3EGRA 5D7GA 3U52E 1EUVB 2KNBA 1YNTE 1VCBA 3P42A 2DWQA 4A8XC 1ISNA 2H89B 2LWPA 2CJNA 4OHJA 3EFUA 3U7DA 4LJOB 5D94A 1DOXA 2OEDA 1ZDXA 4IWQA 1PGBA 2K39A 2IBIB 3LJ3A 4HXDA 4W9HA 2JU6X 2DYMA 5FR6A 1ZP0B 5HG2A 4EZLA 3URYA 1FD6A 1NEKB 3I57A 2O6VB 4MGZE 1RFAA 3IAS1 1FFVA 2N1WA 1U4AA 1E7VA 1FCCC 4MDKE 3TEYA 2UYZB 3P63A 4K3BA 5MPOA 1YJJA 4IC7B 1IBXB 3RNEC 4A3OA 2RSUA 3KUDB 3QHTA 2KACA 1K50A 2AQ3B 2EKIA 2LASA 2IDYA 2CU3A 4YWGG 5JH5C 3X0WA 4DK5A 4YSZB 3ZRCA 1RM6C 1NENB 4KKJA 4W9DA 1L6VA 3AMZA 3ZW3A 4HJGE 2N9LA 3ZXRA 3ALBA 3EA6A 4GDKA 2RDHA 3WAMA 1SF0A 1WXSA 1PYWD 3SEBA 4DHZB 3WANA 1ZW7A 4NAWB 2NTTA 1TIFA 2ZZPB 1ZGUB 4E71A 1NBFC 2RMMA 3CF4A 1N63A 2JWUA 2KN5A 2LRUA 2M56B 1OQRA 4C56C 4HKQA 3NZ3A 3L54A 1C3TA 2BYVE 2MCNB 1WSPA 3DVGY 3VTVA 4JPSA 4YTNB 2LJ5A 1FXAA 1WMHA 4WWOA 2FCNA 1UNSA 4ZHOA 4NJ7A 2DX5B 4GU2A 4KVGB 2R2OA 4L23A 5LNK1 3VH3B 1UH6A 5AUIA 4HROA 2GRIA 3N32A 3ZTCA 4O1NA 1B1ZA 3P4PB 2KC2A 3LB8C 2HTME 4CYEA 4GDLA 3MC0B 1L0VB 2BPSA 2N0SB 3LDZE 1EM7A 2K6QA 4RCOA 2KVZA 1VDVA 4Q2JA 1DOIA 1V9JA 3OLMD 2Y5CA 4ZOHC 2KZRA 3OJ4B 2L76A 2KFKA 3HRDD 1MG8A 1UF0A 1OTRB 2DAJA 5FKAC 1L4DB 4II2B 2D5GA 1YQ3B 2QJLA 2JUOA 3DPDA 3GE8C 3RMKC 4LNIA 2KMAA 2LHEA 5LLIA 5D2MB 1DOYA 2M1MA 1TS3A 2JYEA 2QC8A 3E9SA 2DYOA 1MJDA 4A90A 4RM8A 1SIFA 3X23A 3PVLA 4MACA 4WJPA 4KDIC 2WGSA 2V1YA 2KWUB 3BYTB 1P1AA 2BS4B 2SAKA 5D6JB 1TJEA 1LFDA 3FILA 3H7PA 2BVCA 3IBEA 3AXCA 4K7UA 4L1BA 4W9LA 4EZJA 4MGKE 1ZXIA 4N6EB 4M8NA 2K25A 3MTNB 1MHHE 3A9KA 2BKRB 1J8CA 3W1SC 5BMIA 1PQSA 1WYGA 2N7DA 2KWVB 2DAFA 2IJ0A 5C2TB 3N20C 1GC7A 4DWFA 1MG4A 3UGBB 5DPWA 2UU7A 3OWEB 2N1VA 2FBWB 1P7FA 1VZ8A 4WJOA 1F0ZA 2KN4A 3AEFB 4HWIB 2N9XA 1XLOA 3AI5A 1DGJA 3Q14C 4AOFA 1V97A 2IO2B 1V1OA 3Q6BA 1VZ7A 4WH4A 3PS6A 1HXYD 3RULA 1I35A 2KC1A 4YT0B 3V61A 3K9OB 2WXOA 3H8HA 4AUQC 4G3XB 3PRPB 2C7NB 4NY0A 1ENFA 1L5PA 4JQWC 4HRSA 2XBBC 2GBMA 3VQIA 4TKNA 2QEJC 3EFCA 1V6EA 3TBLD 3T8MA 1TKEA 2NBUA 3ZXVA 5LXIB 3AE1B 3ZUNA 2BQQA 4FADA 1TKYA 2KFKB 2WS3B 5C3JB 2EELA 3L10B 2WXNA 3UINB 3SD5A 1L2NA 1JWMD 3ZRFA 4MSMB 1N62A 4ASWC 3QX1A 4IKGA 4YTPB 3HVDA 4LNFA 2JSVX 1YN3A 4NJ6A 1E0ZA 1SXTA 2QILA 1YN4A 3C8YA 3KVFB 3KYDD 2MLBA 3HM3A 3ZDMC 2WXRA 3JVZX 3T9LA 2X8XX 2Y5PA 3H7PB 2REXA 3KLSX 4OW0A 2MBQA 3JSVA 1WR6E 2ICIA 1WJ4A 3Q3FA 1FNUA 4LNNA 3RYTA 2Q5WD 3ZKJC 4TQ1A 3P4RB 2WXFA 4LDTB 4EEWA 4FJZA 2ZNVB 4BOSC 4FXCA 3DBRB 1I4RA 2BT6A 1L7YA 3M62B 3QAQA 4CQNA 3R8BA 1HZ6A 1J7AA 3M3JA 1N60A 4ZRIA 4A55A 4HJKA 1EWCA 1QLBB 1T0SC 2WP9B 2CHWA 2K8HA 4P7IA 5JHBA 3I9V1 2KD0A 3DOWA 1FRDA 3V60A 2I38A 3HM6X 2D3GA 2W54A 3A4RA 3KW5B 2BF8B 1LQBA 4RMAA 2L00B 3VR9B 2ZPNA 3NVVA 1JWSD 1QQRA 5IP4D 2R61A 4M02A 2LGSA 1FXTB 2M17A 1NDDA 2Z0DB 3AEAB 4FA6A 3L0WB 1WGRA 1WWTA 3VRAB 2LVPA 1ZPSA 1R4MB 3ML9A 1Q10A 2DZKA 2L1AA 1JWUD 1CK1A 4OZAA 5EE0A 2OOBB 4F7ZA 1F9JA 2OHFA 2LFIA 2KYWA 3Q3MC 3VH4B 1GT8A 1XF5L 2K6DB 3ZJUA 3RPFC 2FNJB 1NI2A 2RR9A 2JT4B 2Z59B 3AE9B 2I1JA 1CZPA 2C5LC 1XO3A 5GXGB 3SFDB 5KHQA 1OEYJ 3A1QB 3TSSA 5E6NA 1RYJA 1STEA 4NQLB 1N6ZA 1I7HA 2PE9A 3AB5A 1C4AA 1WX7A 3PGEA 4RNAA 2LXAA 1C77A 4K1RB 1WM2A 2VH1A 3HUIA 3U7ZA 4NNJB 4USAA 1E8YA 3ZQ4A 1QZEA 4II3B 1ZE3D 2L32A 5DCNA 4CO7A 1WZ0A 2MEKA 3MC9A 4OVUA 1NVID 4NAMA 1YQBA 4NJCA 5E6JA 1J0GA 3MJWA 3VRBB 3FAHA 3V05A 2KMMA 2JWZA 2RPVA 3PHWB 4EKUA 2KLCA 3QJZA 4KZ0A 4PYUA 3V6CB 2KK8A 3UIOB 5L83A 1XLQA 3B08A 4EUTA 1V1PA 3R3MA 3T3OA 2WXLA 1IYFA 2LEKA 2JVCA 4ANXA 2LGYA 2D2QA 3OJ3A 3AE5B 3FKYA 2VZKD 2Z8LA 1MPEA 1XD3B 3AE8B 1GTHA 4MGYE 1P7EA 3IVFA 3DQVA 3AEBB 2IO1B 2FAZA 2J7QB 5E6OA 2NBWB 2MP2A 4IG7B 1ROEA 3RUIB 4W9IA 3W5VB 5G5HA 4CHKA 3Q8AA 4HPLB 1H8CA 4DXAB 2J4XA 1WY8A 2RDGA 2H88B 4RGOS 4BKSA 2J53A 2HE7A 5IAAC 1KRHA 2A4ZA 1I4QA 2BS2B 4JGHB 3KWVA 4DXGA 2LMCA 2N9KA 2ON8A 1D5XC 3DBLB 4HDOA 2RDBC 2QDFA 1P3QU 3DBRI 3IFWB 1T0QC 3HHMA 4N58A 2OJWA 4WQOB 3JW0X 3ZGZA 1WXVA 1WXMA 2G1EA 2PVOD 3QCAA 1EF5A 4MSQB 3N1YC 2LHDA 5CHWA 1X1MA 4WURA 3BVZA 2DBYA 3O65B 5J2RA 2PMVA 2L3ZA 3W2DA 2TSSA 1D6EC 1GJZA 1YX5B 4R3DA 1HE8A 2MX2A 3P1MA 4LNKA 3Q2AC 4A6QA 3BVMA 3MHZA 1P98A 2KANA 4FJVB 1SEBD 1FCLA 2W55A 2L83A 3W1SA 2K8CA 4BKSD 2J0JA 1YN5A 2BGFA 2FIFA 3DVNV 2WDQB 2D3BA 3WIMA 5DPTA 2WXMA 2BYTA 2INNE 2FUHB 3ECIA 1GNUA 4KDLB 2L8JA 1JRUA 1JWBD 1UWXA 2ZW1A 4YXDB 2MW5A 5H92C 4E74A 3QQ8B 2JX5A 1F2RI 3W1YA 4DDGD 3DBHB 2BBCA 3VR8B 3RZWC 1C4CA 3N1XC 3HVZA 1TY0A 4DHJD 5TR5A 5IA7A 2G4SA 1OQQA 4WAAA 1XEEA 2MP2B 2G9HD 1EF1A 3PT2B 1WGDA 4GGQA 3N9YC 1T6BX 4XX5A 2AX5A 1P0RA 3ABVB 3KYCD 5H8YE 4J3OD 4RH6A 1IPGA 4N59A 2WDTB 4C7ZA 3AE6B 2MRPA 3ZNGC 2L52A 3NVWA 3I5JC 3GS2A 1TGZB 1E6EB 4KIKA 4XWWA 2YLMA 3VTWA 4G11A 4C00A 3GZNI 3BK1A 3TEZA 4W9FA 4TQ0A 3B9JA 1HEZE 1VLBA 1FNVA 3VTUA 1Q0WB 2LGXA 4RGTA 3NG0A 2PTLA 3ZNZB 1ZDVA 1IGCA 3PTFC 2WQYB 2EMSA 3AE2B 2AQ2B 1UBIA 1XLNA 3AEGB 2KTRA 3L4PA 4FHKA 2K0PA 1WR1A 4A3PA 1UGMA 1TS2A 2KHWB 1UELA 1ZXHA 3RD2A 3CMMB 2GOWA 4AP4C 4REZA 4HPPA 4MEMA 5IKCM 4OZBA 1HTQA 2KT7A 2RPQA 1XCQL 2DLBA 1VZ6A 1AARA 1MI0A 4IWPA 3J9CA 1YJIA 4OVZA 2FCSA 1JMLA 1I42A 2PKOA 4ITKA 4C7YA 3AM9A 2ASQA 2E3TA 1OQYA 3DVGX 2M19A 1JRPA 3VHTC 3A9JA 3TEWA 4HVBA 4GDKB 1WGGA 2FUG1 2Z0EB 4MJSA 1IGDA 2LD9A 3APCA 5JHAA 3JYUA 4TSSA 1WXAA 3DBLI 2XEWA 3QIJA 4NZLB 1UD7A 1WFYA 1B9RA 4GMVA 2WNMA 5T8IA 2L0TA 5EE9A 4DHZE 4LK0M 3A33B 1EU3A 4WJQA 2PW9A 4RF1A 1E5WA 2M4NA 4MH8A 2YEPB 4DQOC 5LXHA 4BOZB 2KDBA 3RZFA 1OFFA 2C60A 1FEHA 3DHIC 1WMHB 2ZCCA 2I1KA 2KMCA 2LI5A 4QAYA 1DYQA 2KJRA 1WZ3A 2EKEC 2MJEA 4ZHPA 2Y5BB 1TKGA 2JF5A 5L95C 2O2VA 5EE1A 2E6XA 3PLUA 2KWCA 1WGKA 1L4ZB 3C0RB 4M01A 1C1YB 3NUHB 1BXTA 1GOZA 3EHVA 4GDLB 2DENB 5CHFA 4M00A 2KJHB 4KGRA 3S2AA 2J0MA 2BB6A 1SIJA 3AU4A 3QK0A 4A9AA 2LZ6A 1V81A 5G55A 3N1ZC 2V0GA
chains in the Genus database with same CATH topology
3AE9B 3B2GA 1DOXA 3IAM1 3ZJVA 1CZPA 3IXSA 2OEDA 4KGTA 1XO3A 2HDEA 5GXGB 3SFDB 1ZDXA 5BYQA 1PGBA 3MJ5A 2GI9A 3TSSA 1RYJA 1ET9A 1STEA 3AV8A 3U2SC 2JU6X 3NRZA 2DYMA 5HG2A 1ZP0B 3KWLA 3URYA 1I7HA 1QILA 4L2YA 1FD6A 1JALA 1AW7A 3AB5A 1NEKB 5FK9C 3I57A 1C4AA 2BW2A 1KH0A 1C9FA 4RNAA 1RWSA 3CWIA 1C77A 3IAS1 1FFVA 2AQ1B 3BIID 2B76B 1J7CA 3HUIA 1FCCC 3U7ZA 4RF0A 1UWMA 2NMQA 4HKZE 4KGSA 1JROA 4USAA 3TEYA 3ZQ4A 1QF6A 3GB1A 1ZE3D 2JXTA 2L32A 3P63A 4EE2A 2ONQA 5MPOA 1YJJA 3W9CB 1AN8A 1PGXA 3FILB 4WAFA 1IBXB 1L6UA 2MEKA 1HQRD 1SJHD 2KACA 4ARIA 2V4IB 1NVID 2W3SA 4NAMA 1K50A 4IOIE 4NJCA 2AQ3B 1VR9A 2EKIA 5E6JA 4YSYB 3WCQA 1GTEA 2IDYA 3CIRB 2CU3A 2WLBA 2V3NA 4YWGG 3VRBB 2KWDA 3FAHA 4YSZB 3V05A 5HFYA 2KMMA 2RPVA 3LXFA 3UI3A 1RM6C 1NENB 4KKJA 1L6VA 3AMZA 3NVZA 3RFZB 1Y56A 4HJGE 2N9LA 1XLQA 1I4XA 3EA6A 3B2FA 1V1PA 2RDHA 3T3OA 1SF0A 2WXLA 1PYWD 3SEBA 2JYTA 3AE7B 2LEKA 1V8CA 1HZ5A 4WQMA 4NAWB 1H7WA 1D4BA 1ESFA 2NTTA 3AE5B 1N5XA 4P6VF 4RGNA 4ZRPA 2VZKD 2Z8LA 1MPEA 2FE8A 1JW9D 2RMMA 3AE8B 4JE3B 3CF4A 1GTHA 1N63A 2JWUA 3DWGC 1QOBA 2WXHA 1P7EA 2WXQA 3AEBB 3MP9A 1GAQB 1JCKB 2M56B 1ROEA 1OQRA 4C56C 1GB4A 4HKQA 3NZ3A 3LYYA 1L0YB 2IGGA 1GB1A 1WSPA 3BWUD 1SE3A 3W5VB 5G5HA 2BB5A 4JPSA 4YTNB 2QSDA 3Q8AA 5I4DA 3U4EG 1FM0D 1FXAA 1WXQA 2J4XA 2RDGA 2WXKA 1CQVA 2H88B 4RGOS 1TY2A 1GPXA 2J53A 1KRHA 1I4QA 2BS2B 1UNSA 3KWVA 2MH7A 2JZPA 4DXGA 2LMCA 2N9KA 4ZHOA 2ON8A 1D5XC 1KLUD 1SE4A 3FC4A 4H2AA 4L23A 5LNK1 5TSSA 5AUIA 4HROA 2GRIA 1XLPA 4O1NA 1B1ZA 3P4PB 3R2IA 4N58A 1JWAD 5HHDG 3ZGZA 3LB8C 2HTME 3TUOA 2WDVB 1NYRA 1FIQA 2G1EA 2PVOD 4M0WA 1K52A 2Y3AA 3MC0B 1L0VB 2LHDA 1FRRA 2N0SB 1EM7A 4WURA 4ZRQA 3BVZA 2DBYA 2K9XA 4RCOA 2IPKD 4US9A 1VDVA 1E7PB 3Q8BA 1FFUA 2PMVA 4JX1C 3W2DA 2TSSA 1D6EC 4Q2JA 4MT5A 2MJDA 4TMAB 2ACZB 1DOIA 3PO0A 1CJEA 2Y5CA 3E56A 4ZOHC 4R3DA 1KF6B 3P1MA 4UDUC 3HRDD 4A6QA 3BVMA 3MHZA 1SEBD 1UGJA 4B0EA 1FCLA 5FKAC 2W55A 2V3PA 2L83A 3PZ8A 4OZCA 3W1SA 5AUKA 1L4DB 1PUTA 2WDRB 1F77A 2D5GA 1YN5A 4AQ7A 1YQ3B 2QJLA 2WDQB 1I4GA 2K22A 2WXMA 2BYTA 2LHEA 2INNE 1K53A 3SR6A 2WXJA 2KAJA 1DOYA 2XN9C 1M4VA 1TS3A 2JYEA 3E9SA 2DYOA 4A90A 1C79A 1VJKA 4DXFA 1FXIA 1UUPA 1JWBD 1UWXA 4MACA 2BS3B 2ZW1A 4WWMA 2WXGA 3BYTB 4YXDB 2KQ4X 2LGIA 2BS4B 5H92C 1PFDA 2KDMA 2PVGC 2JX5A 2SAKA 1TJEA 1N61A 1F2RI 3FILA 2LUMA 1IBXA 1XCTL 1F2RC 3P4QB 2BBCA 5D3IB 3VR8B 4L1BA 4XDDA 1ZXIA 4N6EB 1C4CA 4PT5A 4LLGM 3HVZA 2X38A 5BMHA 1MHHE 3AE3B 1ZOYB 1TY0A 2IGHA 4IDIA 1SJED 3PZ7A 1OQQA 1QOFA 1XEEA 5BMIA 5FR3A 2G9HD 5G5GA 1I4PA 4YSXB 1WYGA 2IJ0A 3P4SB 5C2TB 1TS5A 1TYGB 2J52A 3N9YC 1VRAB 1T6BX 2N7JA 4HEA1 1N5WA 2AX5A 3KQ4A 1J7BA 1IUEA 2PIAA 3Q8CA 3ABVB 1E9MA 2M0AA 5HI1A 5H8YE 4J3OD 3OWEB 4RH6A 1ACCA 4N59A 3GP7A 4C7ZA 2FBWB 3AE6B 1P7FA 1VZ8A 1F0ZA 2GB1A 1RFKA 2KN4A 2L52A 3NVWA 4D2KA 3GS2A 3AEFB 1XLOA 1XXGA 1QKZA 1DGJA 1E6EB 3AN1A 1V97A 1SSNA 1V1OA 4XWTA 4XWWA 1MVKA 1VZ7A 2J42A 4WH4A 3BK1A 3TEZA 4TQ0A 1HXYD 3B9JA 1HEZE 1QT9A 4YT0B 1VLBA 1FNVA 2WXOA 3H8HA 2WXPA 4RGTA 2K3UA 2PTLA 3Q8FA 3MFGA 1ET6A 4XDCA 1K51A 3ZYYX 1ZDVA 4JWUC 1IGCA 1ENFA 1L5PA 1AWDA 3NVYA 1AYFA 4MM3B 2WQYB 1FNWA 4HRSA 3W5UB 3R2TA 3AE2B 2AQ2B 3VQIA 2QEJC 1TS4A 1BMLC 1XLNA 1YMHE 3AEGB 3L4PA 1TKEA 2K0PA 1PDXA 2BTEA 2LJIA 2VZKB 2PLPA 1TS2A 3AE1B 4GLSC 2XNAC 5BMGA 3BK2A 1ZXHA 1ZUD2 3IT4B 3IT6B 3DWMA 1TKYA 2WS3B 3Q8EA 4REZA 5C3JB 2EELA 4OZBA 2WXNA 1I4HA 1YQ4B 1R7SA 1JWMD 1XCQL 4LTUA 2DLBA 3V3XA 1VZ6A 1MI0A 4RGMA 1N62A 1KFYB 1EU4A 3AEDB 3J9CA 1YJIA 4OVZA 4C80A 2NTSA 1QOGA 1JMLA 4IKGA 4YTPB 2IGDA 2PKOA 3HVDA 4ITKA 4C7YA 2JSVX 1YN3A 2E3TA 3AM9A 1EWYC 2M19A 4RFBA 4KX6B 1E0ZA 1SXTA 2QILA 1YN4A 3BVGA 3C8YA 1D5MC 1SE2A 1T3QA 1JRPA 5BYRA 1L0XB 4AS1A 3TEWA 2WXRA 2K5PA 4GDKB 1KLGD 2I2YA 2CJOA 2FUG1 1HA5A 1NYQA 2Y5PA 1V1PB 1SBBB 2QMTA 1C78A 1BUIC 1IGDA 3KLSX 3NS1A 4YTMB 4OW0A 2INPE 4TSSA 2ICIA 1H7XA 3ZJTA 4NZLB 1FNUA 2Q5WD 4TQ1A 1WRIA 3P4RB 2WXFA 4P16A 1JQ4A 1B9RA 1LO5D 2QIEB 2W82A 2WNMA 2WXIA 4FXCA 5T8IA 1I4RA 5EE9A 1TZOA 2BT6A 3Q69A 4LK0M 4CQNA 3R8BA 3T3NA 1HZ6A 1J7AA 2YEPF 1N60A 4A55A 1E10A 1A70A 1EU3A 1EWCA 1QLBB 3AECB 2PW9A 4RF1A 1FMAD 2W3RA 4MH8A 2WP9B 3BYYB 4XE0A 2YEPB 4ZYSA 4DQOC 1KTKA 1C76A 3I9V1 4JWSC 4ARCA 1FRDA 1D5ZC 1SB3C 2I38A 2W54A 3AEEB 1OFFA 1PGAA 2ZW0A 1MHXA 1NI3A 1FEHA 3VR9B 3NVVA 1JWSD 5JXVA 4US8A 1QQRA 2R61A 1QOAA 2SEBD 5D3DA 4B0MA 1DYQA 4KKIA 2MJEA 4ZHPA 3EUB2 2MJ3A 3AEAB 2WU2B 1TKGA 5BYSA 2WU5B 1C4PA 3AE4B 5EE1A 2E6XA 3AH7A 1WWTA 1WGKA 3VRAB 1L4ZB 3TEXA 1ZPSA 1FO4A 3EGRA 1Q10A 5D7GA 3U52E 2L1AA 1JWUD 1CK1A 5EE3A 1YNTE 3NUHB 4OZAA 1BXTA 1GOZA 3O13A 4GDLB 3P42A 2DWQA 5EE0A 4KGRA 2JQRB 2OHFA 2LFIA 4A8XC 2BB6A 1GT8A 2H89B 3BZDB 4WIPA 1SIJA 1T5XD 2CJNA 1XF5L 4OHJA 4A9AA 3SFEB 3ETRA 3ZJUA 3RPFC 2V0GA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5G5H A;  3AE9 B;  4YTN B;  3HVZ A;  3B2G A;  1E0Z A;  1DOX A;  3AE3 B;  1ZOY B;  1FM0 D;  1CZP A;  4IDI A;  1FXA A;  1WXQ A;  1T3Q A;  1JRP A;  1XO3 A;  1OQQ A;  1QOF A;  2H88 B;  5GXG B;  3SFD B;  1GPX A;  2K5P A;  2CJO A;  1NYQ A;  1KRH A;  5G5G A;  1WYG A;  4YSX B;  1RYJ A;  3AV8 A;  3P4S B;  5C2T B;  2BS2 B;  4YTM B;  1TYG B;  3NS1 A;  3NRZ A;  1ZP0 B;  1H7X A;  1N5W A;  4ZHO A;  2AX5 A;  2MH7 A;  3KWL A;  1I7H A;  1J7B A;  1IUE A;  1JAL A;  2PIA A;  3ABV B;  1E9M A;  3FC4 A;  5H8Y E;  3AB5 A;  1NEK B;  2Q5W D;  4N59 A;  1WRI A;  3P4R B;  4C7Z A;  5AUI A;  2FBW B;  3AE6 B;  4HRO A;  1JQ4 A;  1RWS A;  1F0Z A;  3CWI A;  1B9R A;  1XLP A;  1FFV A;  1RFK A;  2L52 A;  2QIE B;  3BII D;  2B76 B;  1J7C A;  3HUI A;  3AEF B;  3NVW A;  3P4P B;  4FXC A;  4N58 A;  5EE9 A;  1UWM A;  1XLO A;  2BT6 A;  1JRO A;  1DGJ A;  1JWA D;  1E6E B;  4USA A;  3LB8 C;  2HTM E;  3AN1 A;  1QF6 A;  3P63 A;  1V97 A;  2WDV B;  1NYR A;  1FIQ A;  2G1E A;  2PVO D;  1J7A A;  1E10 A;  1N60 A;  1L0V B;  1YJJ A;  1A70 A;  3W9C B;  5MPO A;  1QLB B;  3AEC B;  1L6U A;  1FMA D;  1FRR A;  2N0S B;  2W3R A;  3B9J A;  2WP9 B;  1QT9 A;  2DBY A;  2K9X A;  4US9 A;  4YT0 B;  1VLB A;  1NVI D;  1E7P B;  1VDV A;  1FFU A;  2W3S A;  2EKI A;  4JWS C;  1FRD A;  4JX1 C;  4YSY B;  1SB3 C;  3WCQ A;  1GTE A;  2W54 A;  3CIR B;  2CU3 A;  2MJD A;  3AEE B;  1OFF A;  2WLB A;  2ACZ B;  1DOI A;  3PO0 A;  3VRB B;  1CJE A;  1NI3 A;  3FAH A;  4YSZ B;  2Y5C A;  3ZYY X;  2KMM A;  4ZOH C;  1KF6 B;  3LXF A;  4JWU C;  1L5P A;  1AWD A;  3P1M A;  3VR9 B;  3NVY A;  1AYF A;  1RM6 C;  3NVV A;  1NEN B;  2WQY B;  4HRS A;  1L6V A;  3AMZ A;  3HRD D;  4US8 A;  3NVZ A;  3W5U B;  3AE2 B;  1QOA A;  2W55 A;  1XLQ A;  2L83 A;  1XLN A;  3B2F A;  3AEG B;  2MJE A;  3L4P A;  5AUK A;  1TKE A;  1PUT A;  3EUB 2;  2WDR B;  4ZHP A;  1PDX A;  1SF0 A;  3AEA B;  2MJ3 A;  2WU2 B;  1YQ3 B;  3AE7 B;  1TKG A;  1V8C A;  2LEK A;  2QJL A;  4WQM A;  3AE1 B;  2WU5 B;  2WDQ B;  3AE4 B;  5EE1 A;  2K22 A;  3AH7 A;  1WWT A;  1H7W A;  1ZUD 2;  3SR6 A;  2KAJ A;  1WGK A;  3AE5 B;  3VRA B;  1N5X A;  4P6V F;  1DOY A;  3DWM A;  1FO4 A;  1TKY A;  2WS3 B;  1JW9 D;  1VJK A;  5C3J B;  1FXI A;  5EE3 A;  1JWB D;  3AE8 B;  3CF4 A;  1GTH A;  1N63 A;  2BS3 B;  3DWG C;  4WWM A;  2DWQ A;  1QOB A;  1YQ4 B;  1R7S A;  4YXD B;  5EE0 A;  4LTU A;  3AEB B;  2BS4 B;  5H92 C;  1PFD A;  2JQR B;  2PVG C;  2JX5 A;  2OHF A;  1TJE A;  1N62 A;  1KFY B;  1N61 A;  1GAQ B;  3AED B;  2M56 B;  1GT8 A;  2H89 B;  1OQR A;  1ROE A;  3P4Q B;  1SIJ A;  1YJI A;  2CJN A;  3VR8 B;  4C80 A;  1QOG A;  4YTP B;  4A9A A;  3SFE B;  1ZXI A;  2PKO A;  4ITK A;  4C7Y A;  3ETR A;  3AM9 A;  2E3T A;  4N6E B;  3RPF C;  1EWY C;  2M19 A;  4KX6 B;  3W5V B; 
#chains in the Genus database with same CATH topology
 2NBV B;  1Q5W B;  1R4N B;  4BAX A;  3ZJV A;  3B1L X;  3IXS A;  2IY0 B;  2OJR A;  4ZDV A;  2HDE A;  2G45 B;  3MJ5 A;  2M0X A;  2KQS A;  3MC8 A;  4K7W A;  3U2S C;  2BKF A;  1S1Q B;  2KDI A;  3P2B A;  4E3C A;  5CTR C;  3Q3N C;  3VXW A;  1AW7 A;  3TJP A;  5CX3 A;  4ZYN A;  3ML8 A;  1C9F A;  3CWI A;  2B76 B;  4WJN A;  1P9D U;  3A9J B;  4RF0 A;  4HKZ E;  4KGS A;  4BBN F;  4EE2 A;  4MJS B;  3OAW A;  3W9C B;  1AN8 A;  1PGX A;  3FIL B;  2PJH A;  1L6U A;  3ZO5 B;  4W9E A;  2M8S A;  1HQR D;  4ARI A;  2V4I B;  1WM3 A;  1VR9 A;  2KXJ A;  4G50 A;  3VAW A;  1GTE A;  3CIR B;  1Z2M A;  2KWD A;  5HFY A;  3MHS D;  3CST A;  3WAP A;  3A9K B;  4ICV A;  3RNF C;  4GIV A;  1KJT A;  1TZ1 A;  3RFZ B;  3B2F A;  2PE6 B;  2KQ7 A;  1J19 A;  3AE7 B;  3KH0 A;  4W9G A;  3NZU A;  1D4B A;  1ESF A;  4P6V F;  4ZRP A;  4RGN A;  2FE8 A;  1JW9 D;  4URK A;  2MHJ A;  3WA0 A;  1V5O A;  3R7R A;  4JE3 B;  1QOB A;  2WXQ A;  4HLE A;  2WX0 A;  1WJU A;  1GB4 A;  3Q3O C;  3LYY A;  4B95 A;  2MA9 B;  2XK5 A;  1L0Y B;  2BB5 A;  5I4D A;  2QSD A;  5AZH A;  2EMT A;  4PS3 A;  2GMI C;  1WXQ A;  2DZI A;  2WXK A;  2GBR A;  1GPX A;  1BT0 A;  4X57 B;  3ZIM A;  3EC8 A;  2JZP A;  3IHP C;  1SE4 A;  3FC4 A;  4PS8 A;  3DVN U;  5TSS A;  3SU8 X;  2N4F A;  4IWO A;  2RGF A;  2D10 A;  3D32 A;  1JWA D;  3NOB A;  3RI7 C;  1V5T A;  4EZK A;  1NYR A;  3UQB A;  4MM3 A;  2Y3A A;  3H9D A;  5DPR A;  2CKH B;  3V6E B;  2K9X A;  4US9 A;  1FFU A;  4JX1 C;  2IO3 B;  4MT5 A;  2CHZ A;  4TMA B;  3PO0 A;  3L08 A;  5IOI A;  2LUE A;  1KF6 B;  2CU1 A;  4GN1 A;  4K3C A;  1KLV A;  4HK2 A;  3L16 A;  1UGJ A;  4B0E A;  2KKC A;  3JSV B;  3PZ8 A;  5AUK A;  2NS5 A;  4W9K A;  4AQ7 A;  1OEY A;  4BKT A;  4BVU C;  4K81 A;  2B3A A;  1K53 A;  2WXJ A;  2O6V A;  3Q3J A;  1C79 A;  1MFW A;  1VJK A;  2ZCB A;  3DHG C;  3R7Q A;  1UUP A;  3N3K B;  4WWM A;  3NJT A;  3RNB C;  1IP9 A;  4NQK E;  2LGI A;  2G4D B;  2PPH A;  4PK1 A;  1N61 A;  2LUM A;  1IBX A;  2WX1 A;  2R2Q A;  1F2R C;  1M94 A;  1V49 A;  2V9H A;  2ZEQ A;  4XDD A;  1KOT A;  3VDZ A;  4OVV A;  3H6N A;  1R4N I;  4LLG M;  5BMH A;  2HJ8 A;  3PLV A;  2IND C;  1ZOY B;  2IGH A;  4IDI A;  1SJE D;  1UZX B;  3PZ7 A;  1QOF A;  3QWZ B;  4BZA A;  1WJ6 A;  5FR3 A;  5G5G A;  2MBH A;  4YSX B;  2WWZ A;  3P4S B;  1TYG B;  5AZG A;  1VRA B;  2N7J A;  1Q1O A;  1N5W A;  3ZVV A;  1J7B A;  1IUE A;  1YIW A;  2M0A A;  4FLH A;  1ACC A;  3QAR A;  2KO3 A;  3SHQ A;  1RFK A;  4D2K A;  4AWJ A;  1Z5S B;  1YD8 U;  2O6V D;  3AN1 A;  4EFO A;  1MVK A;  2JRI B;  5IN7 A;  2J42 A;  2LRW A;  3M95 A;  1QT9 A;  2D07 B;  2KVR A;  3RNA C;  2WXP A;  2K3U A;  4S17 A;  3Q8F A;  3MFG A;  1ET6 A;  4ACF A;  1K51 A;  1T0R C;  4MM3 B;  1S3S G;  1WI0 A;  2ZPY A;  3W5U B;  3R2T A;  2K1F A;  1BML C;  4J6I A;  2BTE A;  1YX6 B;  2LJI A;  2VZK B;  4PYZ A;  4GLS C;  5J17 A;  2XNA C;  4HCN B;  3M63 B;  3BK2 A;  3IT4 B;  3UQA A;  4S0R A;  1WRD B;  3QC8 B;  3R66 C;  3Q8E A;  3H7S A;  4B6W A;  2CS4 A;  3NHE B;  1EO6 A;  1YQ4 B;  4LCD E;  3V3X A;  4C4V A;  2RD0 A;  2DHZ A;  4RGM A;  2JPH A;  4TV3 A;  1EU4 A;  2NPT A;  3DHH C;  1TTN A;  2FID A;  2JZ3 B;  2NVU I;  3AUL A;  1QOG A;  4FBJ B;  1R4M I;  4RFB A;  4KX6 B;  1WJN A;  3ZTD A;  3GE3 C;  2MWS B;  3BVG A;  1D5M C;  1T3Q A;  5BYR A;  1L0X B;  2K5P A;  1KLG D;  1HA5 A;  1NYQ A;  4BFR A;  1V1P B;  1SBB B;  1WF9 A;  1C78 A;  1BUI C;  3NS1 A;  1LGR A;  2INP E;  4AJW A;  3ZJT A;  2IZV B;  3PRE A;  4ZRK A;  1OGW A;  4HPM B;  1WRI A;  4P1C C;  4MH0 E;  4P16 A;  1JQ4 A;  2DZJ A;  1LO5 D;  5AEK B;  2D3C A;  2QIE B;  3Q69 A;  2BWE S;  4MEL A;  5HKH A;  2YEP F;  1A70 A;  3AEC B;  1FMA D;  3DBS A;  1RLF A;  3DDC B;  2LXC A;  5CHV C;  3C19 A;  1D5Z C;  3NZS A;  4ICU A;  1PGA A;  2ZW0 A;  1NI3 A;  2KFJ A;  2C9W B;  5JXV A;  4US8 A;  2MBB B;  2SEB D;  3KUZ A;  5D3D A;  2BYF A;  4KKI A;  3EUB 2;  2G3Q B;  3TCA A;  3RNC C;  2KDE B;  2AWT A;  3AE4 B;  2KX0 A;  2HTH A;  4ANU A;  4XGA B;  1FO4 A;  5G2N A;  5EE3 A;  4KZC A;  3WAO A;  3O13 A;  2D11 A;  1XT9 B;  3PV1 A;  1K8R B;  3L13 A;  4XC2 A;  2JQR B;  4ZRJ A;  3QA8 A;  4IW0 A;  3BZD B;  4WIP A;  3TL5 A;  1T5X D;  2QHO A;  3SFE B;  2AL6 A;  4DHJ B;  3ETR A;  2WHI A;  3PRM B;  1UBQ A;  3CF6 E;  2N7E A;  3B2G A;  1E8W A;  3IAM 1;  2INC C;  4GOC A;  4KGT A;  4WWN A;  3VUY A;  2DYB A;  2A5U A;  4C4V B;  4I6L B;  5BYQ A;  3PZD A;  2GBK A;  2GI9 A;  2NPT B;  2PEA A;  3ENE A;  1ET9 A;  4IM2 A;  5E6P A;  3AV8 A;  3DCG A;  2L05 A;  3NRZ A;  3KWL A;  4EOY A;  1QIL A;  4L2Y A;  1JAL A;  4F1S A;  2LVQ A;  3PRZ A;  4W9C A;  5FK9 C;  4I6P A;  2BW2 A;  1KH0 A;  3TIX A;  3ZLZ A;  1RWS A;  2AQ1 B;  3BII D;  1J7C A;  2KJ6 A;  1UWM A;  2NMQ A;  2JZZ A;  5DPS A;  1JRO A;  2AYO B;  4AJY B;  2LVO A;  1QF6 A;  3GB1 A;  2JXT A;  2ONQ A;  5BO4 B;  3IG3 A;  3N30 A;  3OG5 A;  4JL9 A;  4WAF A;  1WGH A;  1SJH D;  2NCN A;  4A20 A;  2W3S A;  4IOI E;  3I3T B;  4YSY B;  3WCQ A;  4DDI D;  2WLB A;  2V3N A;  2IY1 B;  3AU5 A;  3LXF A;  4BKG A;  3UI3 A;  3ZDT A;  5AZF A;  3NVZ A;  3RCZ A;  1CMX B;  1Y56 A;  3I63 C;  1I4X A;  4MGI E;  3U30 A;  2JYT A;  1V8C A;  1HZ5 A;  4IM3 A;  4WQM A;  1H7W A;  3UF8 A;  1N5X A;  2DNF A;  2MBE A;  1T0Y A;  4KIK B;  3DWG C;  2WXH A;  2W9N A;  1V80 A;  5KHO A;  4WWP A;  3MP9 A;  2FCM A;  3NY5 A;  1GAQ B;  1JCK B;  5IO9 A;  2IGG A;  1GB1 A;  1WX8 A;  1GUA B;  3RNG C;  3BWU D;  1A5R A;  1SE3 A;  4B9K A;  1SE9 A;  2GBN A;  4JIO U;  3U4E G;  1FM0 D;  1WE7 A;  4GB9 A;  2KOX A;  1CQV A;  2VRR B;  1TY2 A;  4TUU A;  2MQJ A;  2KTR B;  2AEH A;  3DBH I;  2MH7 A;  4FUL A;  1KLU D;  4NPN A;  4H2A A;  2JXX A;  3V62 A;  1XLP A;  1GG3 A;  3R2I A;  4PS7 A;  4LDT D;  5HHD G;  2YVC A;  3HIZ A;  3TUO A;  2WDV B;  1FIQ A;  3A4S C;  4M0W A;  4IUM B;  1K52 A;  3BY4 B;  1FRR A;  3KUC B;  4ZRQ A;  5C1Z A;  2IPK D;  1E7P B;  1H4R A;  3Q8B A;  2MJD A;  2N9P C;  2ACZ B;  1CJE A;  2ZVN A;  3E56 A;  4UDU C;  2BYE A;  4F8C B;  2V3P A;  5GMV A;  2UWQ A;  4OZC A;  2V3S A;  3A1Q A;  3ONS A;  1PUT A;  2WDR B;  1F77 A;  1KM7 A;  2ZJD A;  1I4G A;  3K9P B;  2K22 A;  1WH3 A;  3SR6 A;  2KAJ A;  2XN9 C;  1M4V A;  1LXD A;  4DXF A;  1FXI A;  2BS3 B;  2WXG A;  4ANV A;  2KQ4 X;  1PFD A;  2KDM A;  4I6N B;  4GSW A;  2PVG C;  1F1H A;  3EEC A;  3APD A;  3BIN A;  1XCT L;  3P4Q B;  5D3I B;  1WE6 A;  3VVW B;  1FPY A;  2JY6 A;  1YJ1 A;  4PT5 A;  3L17 A;  1E90 A;  2X38 A;  3HK0 A;  4XYC A;  3AE3 B;  1RRB A;  1V2Y A;  1I4P A;  2KX3 A;  5JZE B;  2C7M B;  1TS5 A;  4FN2 A;  2J52 A;  4DBG A;  4HEA 1;  3WAL A;  2ZVO A;  2O2V B;  4FHJ A;  3KQ4 A;  2PIA A;  3Q8C A;  1E9M A;  5HI1 A;  4YL8 A;  3VUW A;  3GP7 A;  2HJ1 A;  2BWF A;  2GB1 A;  4G0N B;  1XXG A;  1QKZ A;  1WIA A;  3PHX B;  1SSN A;  4XWT A;  4M8M A;  3U8Z A;  1D3Z A;  1YOV B;  4KV2 A;  2K8B A;  2FCQ A;  1XQQ A;  2GLS A;  2QCZ A;  3VUX A;  4IM0 A;  2KTF A;  4XDC A;  2ZNV C;  3ZYY X;  4JWU C;  1AWD A;  3NVY A;  1AYF A;  2GBJ A;  4M0W B;  1FNW A;  4W9J A;  2D3A A;  1TS4 A;  2N9E B;  1GC6 A;  3ZNH B;  1YMH E;  1TBE A;  4LJP B;  1WGY A;  4RM9 A;  1PDX A;  1WX9 A;  1VD2 A;  2PLP A;  5BMG A;  3UIP B;  1ZUD 2;  3IT6 B;  3DWM A;  2IO0 B;  2KLG A;  2LGD A;  1E8Z A;  2L0F A;  4GXB A;  5C23 A;  1V86 A;  1I4H A;  2AL3 A;  4HDQ A;  1R7S A;  3APF A;  4LTU A;  1LM8 B;  1SGH A;  1KFY B;  3AED B;  4HCP B;  4C80 A;  1ZKH A;  2NTS A;  4P1B C;  2IGD A;  2MSE D;  1EWY C;  2KDF B;  2VH2 A;  2V4L A;  1SE2 A;  3GOE A;  4AS1 A;  2C7H A;  2I2Y A;  2CJO A;  2HD5 B;  2QMT A;  3GZN B;  3TMP B;  3RN9 C;  4YTM B;  1H7X A;  4ANW A;  4N9F 4;  1E8X A;  2IYD B;  3PPA A;  2CHX A;  4JLC A;  2W82 A;  2WXI A;  1TZO A;  3H1U A;  3ZNI D;  3T3N A;  2L7R A;  1E10 A;  1TT5 B;  4FJY A;  5J18 A;  1E7U A;  5EDS A;  2W3R A;  4KSL C;  1WYW B;  3BYY B;  4XE0 A;  4ZYS A;  4XZ4 A;  2MBO A;  1KTK A;  3SDL C;  1C76 A;  2XK5 B;  4JWS C;  3VFK A;  4ARC A;  1SB3 C;  3AEE B;  3NS8 A;  1MHX A;  4NAW A;  1F52 A;  3B0A A;  3RT3 B;  1RAX A;  1Y8R C;  1QOA A;  1G6J A;  1HTO A;  2J0K A;  4K7S A;  4B0M A;  4BBN C;  3CSF A;  2NR2 A;  2CR5 A;  2MJ3 A;  2WU2 B;  2WYQ A;  4KSK C;  5BYS A;  2WU5 B;  1C4P A;  3PSE B;  3AH7 A;  2DZM A;  4LNO A;  2JRH A;  3TEX A;  3EGR A;  5D7G A;  3U52 E;  1EUV B;  2KNB A;  1YNT E;  1VCB A;  3P42 A;  2DWQ A;  4A8X C;  1ISN A;  2H89 B;  2LWP A;  2CJN A;  4OHJ A;  3EFU A;  3U7D A;  4LJO B;  5D94 A;  1DOX A;  2OED A;  1ZDX A;  4IWQ A;  1PGB A;  2K39 A;  2IBI B;  3LJ3 A;  4HXD A;  4W9H A;  2JU6 X;  2DYM A;  5FR6 A;  1ZP0 B;  5HG2 A;  4EZL A;  3URY A;  1FD6 A;  1NEK B;  3I57 A;  2O6V B;  4MGZ E;  1RFA A;  3IAS 1;  1FFV A;  2N1W A;  1U4A A;  1E7V A;  1FCC C;  4MDK E;  3TEY A;  2UYZ B;  3P63 A;  4K3B A;  5MPO A;  1YJJ A;  4IC7 B;  1IBX B;  3RNE C;  4A3O A;  2RSU A;  3KUD B;  3QHT A;  2KAC A;  1K50 A;  2AQ3 B;  2EKI A;  2LAS A;  2IDY A;  2CU3 A;  4YWG G;  5JH5 C;  3X0W A;  4DK5 A;  4YSZ B;  3ZRC A;  1RM6 C;  1NEN B;  4KKJ A;  4W9D A;  1L6V A;  3AMZ A;  3ZW3 A;  4HJG E;  2N9L A;  3ZXR A;  3ALB A;  3EA6 A;  4GDK A;  2RDH A;  3WAM A;  1SF0 A;  1WXS A;  1PYW D;  3SEB A;  4DHZ B;  3WAN A;  1ZW7 A;  4NAW B;  2NTT A;  1TIF A;  2ZZP B;  1ZGU B;  4E71 A;  1NBF C;  2RMM A;  3CF4 A;  1N63 A;  2JWU A;  2KN5 A;  2LRU A;  2M56 B;  1OQR A;  4C56 C;  4HKQ A;  3NZ3 A;  3L54 A;  1C3T A;  2BYV E;  2MCN B;  1WSP A;  3DVG Y;  3VTV A;  4JPS A;  4YTN B;  2LJ5 A;  1FXA A;  1WMH A;  4WWO A;  2FCN A;  1UNS A;  4ZHO A;  4NJ7 A;  2DX5 B;  4GU2 A;  4KVG B;  2R2O A;  4L23 A;  5LNK 1;  3VH3 B;  1UH6 A;  5AUI A;  4HRO A;  2GRI A;  3N32 A;  3ZTC A;  4O1N A;  1B1Z A;  3P4P B;  2KC2 A;  3LB8 C;  2HTM E;  4CYE A;  4GDL A;  3MC0 B;  1L0V B;  2BPS A;  2N0S B;  3LDZ E;  1EM7 A;  2K6Q A;  4RCO A;  2KVZ A;  1VDV A;  4Q2J A;  1DOI A;  1V9J A;  3OLM D;  2Y5C A;  4ZOH C;  2KZR A;  3OJ4 B;  2L76 A;  2KFK A;  3HRD D;  1MG8 A;  1UF0 A;  1OTR B;  2DAJ A;  5FKA C;  1L4D B;  4II2 B;  2D5G A;  1YQ3 B;  2QJL A;  2JUO A;  3DPD A;  3GE8 C;  3RMK C;  4LNI A;  2KMA A;  2LHE A;  5LLI A;  5D2M B;  1DOY A;  2M1M A;  1TS3 A;  2JYE A;  2QC8 A;  3E9S A;  2DYO A;  1MJD A;  4A90 A;  4RM8 A;  1SIF A;  3X23 A;  3PVL A;  4MAC A;  4WJP A;  4KDI C;  2WGS A;  2V1Y A;  2KWU B;  3BYT B;  1P1A A;  2BS4 B;  2SAK A;  5D6J B;  1TJE A;  1LFD A;  3FIL A;  3H7P A;  2BVC A;  3IBE A;  3AXC A;  4K7U A;  4L1B A;  4W9L A;  4EZJ A;  4MGK E;  1ZXI A;  4N6E B;  4M8N A;  2K25 A;  3MTN B;  1MHH E;  3A9K A;  2BKR B;  1J8C A;  3W1S C;  5BMI A;  1PQS A;  1WYG A;  2N7D A;  2KWV B;  2DAF A;  2IJ0 A;  5C2T B;  3N20 C;  1GC7 A;  4DWF A;  1MG4 A;  3UGB B;  5DPW A;  2UU7 A;  3OWE B;  2N1V A;  2FBW B;  1P7F A;  1VZ8 A;  4WJO A;  1F0Z A;  2KN4 A;  3AEF B;  4HWI B;  2N9X A;  1XLO A;  3AI5 A;  1DGJ A;  3Q14 C;  4AOF A;  1V97 A;  2IO2 B;  1V1O A;  3Q6B A;  1VZ7 A;  4WH4 A;  3PS6 A;  1HXY D;  3RUL A;  1I35 A;  2KC1 A;  4YT0 B;  3V61 A;  3K9O B;  2WXO A;  3H8H A;  4AUQ C;  4G3X B;  3PRP B;  2C7N B;  4NY0 A;  1ENF A;  1L5P A;  4JQW C;  4HRS A;  2XBB C;  2GBM A;  3VQI A;  4TKN A;  2QEJ C;  3EFC A;  1V6E A;  3TBL D;  3T8M A;  1TKE A;  2NBU A;  3ZXV A;  5LXI B;  3AE1 B;  3ZUN A;  2BQQ A;  4FAD A;  1TKY A;  2KFK B;  2WS3 B;  5C3J B;  2EEL A;  3L10 B;  2WXN A;  3UIN B;  3SD5 A;  1L2N A;  1JWM D;  3ZRF A;  4MSM B;  1N62 A;  4ASW C;  3QX1 A;  4IKG A;  4YTP B;  3HVD A;  4LNF A;  2JSV X;  1YN3 A;  4NJ6 A;  1E0Z A;  1SXT A;  2QIL A;  1YN4 A;  3C8Y A;  3KVF B;  3KYD D;  2MLB A;  3HM3 A;  3ZDM C;  2WXR A;  3JVZ X;  3T9L A;  2X8X X;  2Y5P A;  3H7P B;  2REX A;  3KLS X;  4OW0 A;  2MBQ A;  3JSV A;  1WR6 E;  2ICI A;  1WJ4 A;  3Q3F A;  1FNU A;  4LNN A;  3RYT A;  2Q5W D;  3ZKJ C;  4TQ1 A;  3P4R B;  2WXF A;  4LDT B;  4EEW A;  4FJZ A;  2ZNV B;  4BOS C;  4FXC A;  3DBR B;  1I4R A;  2BT6 A;  1L7Y A;  3M62 B;  3QAQ A;  4CQN A;  3R8B A;  1HZ6 A;  1J7A A;  3M3J A;  1N60 A;  4ZRI A;  4A55 A;  4HJK A;  1EWC A;  1QLB B;  1T0S C;  2WP9 B;  2CHW A;  2K8H A;  4P7I A;  5JHB A;  3I9V 1;  2KD0 A;  3DOW A;  1FRD A;  3V60 A;  2I38 A;  3HM6 X;  2D3G A;  2W54 A;  3A4R A;  3KW5 B;  2BF8 B;  1LQB A;  4RMA A;  2L00 B;  3VR9 B;  2ZPN A;  3NVV A;  1JWS D;  1QQR A;  5IP4 D;  2R61 A;  4M02 A;  2LGS A;  1FXT B;  2M17 A;  1NDD A;  2Z0D B;  3AEA B;  4FA6 A;  3L0W B;  1WGR A;  1WWT A;  3VRA B;  2LVP A;  1ZPS A;  1R4M B;  3ML9 A;  1Q10 A;  2DZK A;  2L1A A;  1JWU D;  1CK1 A;  4OZA A;  5EE0 A;  2OOB B;  4F7Z A;  1F9J A;  2OHF A;  2LFI A;  2KYW A;  3Q3M C;  3VH4 B;  1GT8 A;  1XF5 L;  2K6D B;  3ZJU A;  3RPF C;  2FNJ B;  1NI2 A;  2RR9 A;  2JT4 B;  2Z59 B;  3AE9 B;  2I1J A;  1CZP A;  2C5L C;  1XO3 A;  5GXG B;  3SFD B;  5KHQ A;  1OEY J;  3A1Q B;  3TSS A;  5E6N A;  1RYJ A;  1STE A;  4NQL B;  1N6Z A;  1I7H A;  2PE9 A;  3AB5 A;  1C4A A;  1WX7 A;  3PGE A;  4RNA A;  2LXA A;  1C77 A;  4K1R B;  1WM2 A;  2VH1 A;  3HUI A;  3U7Z A;  4NNJ B;  4USA A;  1E8Y A;  3ZQ4 A;  1QZE A;  4II3 B;  1ZE3 D;  2L32 A;  5DCN A;  4CO7 A;  1WZ0 A;  2MEK A;  3MC9 A;  4OVU A;  1NVI D;  4NAM A;  1YQB A;  4NJC A;  5E6J A;  1J0G A;  3MJW A;  3VRB B;  3FAH A;  3V05 A;  2KMM A;  2JWZ A;  2RPV A;  3PHW B;  4EKU A;  2KLC A;  3QJZ A;  4KZ0 A;  4PYU A;  3V6C B;  2KK8 A;  3UIO B;  5L83 A;  1XLQ A;  3B08 A;  4EUT A;  1V1P A;  3R3M A;  3T3O A;  2WXL A;  1IYF A;  2LEK A;  2JVC A;  4ANX A;  2LGY A;  2D2Q A;  3OJ3 A;  3AE5 B;  3FKY A;  2VZK D;  2Z8L A;  1MPE A;  1XD3 B;  3AE8 B;  1GTH A;  4MGY E;  1P7E A;  3IVF A;  3DQV A;  3AEB B;  2IO1 B;  2FAZ A;  2J7Q B;  5E6O A;  2NBW B;  2MP2 A;  4IG7 B;  1ROE A;  3RUI B;  4W9I A;  3W5V B;  5G5H A;  4CHK A;  3Q8A A;  4HPL B;  1H8C A;  4DXA B;  2J4X A;  1WY8 A;  2RDG A;  2H88 B;  4RGO S;  4BKS A;  2J53 A;  2HE7 A;  5IAA C;  1KRH A;  2A4Z A;  1I4Q A;  2BS2 B;  4JGH B;  3KWV A;  4DXG A;  2LMC A;  2N9K A;  2ON8 A;  1D5X C;  3DBL B;  4HDO A;  2RDB C;  2QDF A;  1P3Q U;  3DBR I;  3IFW B;  1T0Q C;  3HHM A;  4N58 A;  2OJW A;  4WQO B;  3JW0 X;  3ZGZ A;  1WXV A;  1WXM A;  2G1E A;  2PVO D;  3QCA A;  1EF5 A;  4MSQ B;  3N1Y C;  2LHD A;  5CHW A;  1X1M A;  4WUR A;  3BVZ A;  2DBY A;  3O65 B;  5J2R A;  2PMV A;  2L3Z A;  3W2D A;  2TSS A;  1D6E C;  1GJZ A;  1YX5 B;  4R3D A;  1HE8 A;  2MX2 A;  3P1M A;  4LNK A;  3Q2A C;  4A6Q A;  3BVM A;  3MHZ A;  1P98 A;  2KAN A;  4FJV B;  1SEB D;  1FCL A;  2W55 A;  2L83 A;  3W1S A;  2K8C A;  4BKS D;  2J0J A;  1YN5 A;  2BGF A;  2FIF A;  3DVN V;  2WDQ B;  2D3B A;  3WIM A;  5DPT A;  2WXM A;  2BYT A;  2INN E;  2FUH B;  3ECI A;  1GNU A;  4KDL B;  2L8J A;  1JRU A;  1JWB D;  1UWX A;  2ZW1 A;  4YXD B;  2MW5 A;  5H92 C;  4E74 A;  3QQ8 B;  2JX5 A;  1F2R I;  3W1Y A;  4DDG D;  3DBH B;  2BBC A;  3VR8 B;  3RZW C;  1C4C A;  3N1X C;  3HVZ A;  1TY0 A;  4DHJ D;  5TR5 A;  5IA7 A;  2G4S A;  1OQQ A;  4WAA A;  1XEE A;  2MP2 B;  2G9H D;  1EF1 A;  3PT2 B;  1WGD A;  4GGQ A;  3N9Y C;  1T6B X;  4XX5 A;  2AX5 A;  1P0R A;  3ABV B;  3KYC D;  5H8Y E;  4J3O D;  4RH6 A;  1IPG A;  4N59 A;  2WDT B;  4C7Z A;  3AE6 B;  2MRP A;  3ZNG C;  2L52 A;  3NVW A;  3I5J C;  3GS2 A;  1TGZ B;  1E6E B;  4KIK A;  4XWW A;  2YLM A;  3VTW A;  4G11 A;  4C00 A;  3GZN I;  3BK1 A;  3TEZ A;  4W9F A;  4TQ0 A;  3B9J A;  1HEZ E;  1VLB A;  1FNV A;  3VTU A;  1Q0W B;  2LGX A;  4RGT A;  3NG0 A;  2PTL A;  3ZNZ B;  1ZDV A;  1IGC A;  3PTF C;  2WQY B;  2EMS A;  3AE2 B;  2AQ2 B;  1UBI A;  1XLN A;  3AEG B;  2KTR A;  3L4P A;  4FHK A;  2K0P A;  1WR1 A;  4A3P A;  1UGM A;  1TS2 A;  2KHW B;  1UEL A;  1ZXH A;  3RD2 A;  3CMM B;  2GOW A;  4AP4 C;  4REZ A;  4HPP A;  4MEM A;  5IKC M;  4OZB A;  1HTQ A;  2KT7 A;  2RPQ A;  1XCQ L;  2DLB A;  1VZ6 A;  1AAR A;  1MI0 A;  4IWP A;  3J9C A;  1YJI A;  4OVZ A;  2FCS A;  1JML A;  1I42 A;  2PKO A;  4ITK A;  4C7Y A;  3AM9 A;  2ASQ A;  2E3T A;  1OQY A;  3DVG X;  2M19 A;  1JRP A;  3VHT C;  3A9J A;  3TEW A;  4HVB A;  4GDK B;  1WGG A;  2FUG 1;  2Z0E B;  4MJS A;  1IGD A;  2LD9 A;  3APC A;  5JHA A;  3JYU A;  4TSS A;  1WXA A;  3DBL I;  2XEW A;  3QIJ A;  4NZL B;  1UD7 A;  1WFY A;  1B9R A;  4GMV A;  2WNM A;  5T8I A;  2L0T A;  5EE9 A;  4DHZ E;  4LK0 M;  3A33 B;  1EU3 A;  4WJQ A;  2PW9 A;  4RF1 A;  1E5W A;  2M4N A;  4MH8 A;  2YEP B;  4DQO C;  5LXH A;  4BOZ B;  2KDB A;  3RZF A;  1OFF A;  2C60 A;  1FEH A;  3DHI C;  1WMH B;  2ZCC A;  2I1K A;  2KMC A;  2LI5 A;  4QAY A;  1DYQ A;  2KJR A;  1WZ3 A;  2EKE C;  2MJE A;  4ZHP A;  2Y5B B;  1TKG A;  2JF5 A;  5L95 C;  2O2V A;  5EE1 A;  2E6X A;  3PLU A;  2KWC A;  1WGK A;  1L4Z B;  3C0R B;  4M01 A;  1C1Y B;  3NUH B;  1BXT A;  1GOZ A;  3EHV A;  4GDL B;  2DEN B;  5CHF A;  4M00 A;  2KJH B;  4KGR A;  3S2A A;  2J0M A;  2BB6 A;  1SIJ A;  3AU4 A;  3QK0 A;  4A9A A;  2LZ6 A;  1V81 A;  5G55 A;  3N1Z C;  2V0G A; 
#chains in the Genus database with same CATH homology
 3AE9 B;  3B2G A;  1DOX A;  3IAM 1;  3ZJV A;  1CZP A;  3IXS A;  2OED A;  4KGT A;  1XO3 A;  2HDE A;  5GXG B;  3SFD B;  1ZDX A;  5BYQ A;  1PGB A;  3MJ5 A;  2GI9 A;  3TSS A;  1RYJ A;  1ET9 A;  1STE A;  3AV8 A;  3U2S C;  2JU6 X;  3NRZ A;  2DYM A;  5HG2 A;  1ZP0 B;  3KWL A;  3URY A;  1I7H A;  1QIL A;  4L2Y A;  1FD6 A;  1JAL A;  1AW7 A;  3AB5 A;  1NEK B;  5FK9 C;  3I57 A;  1C4A A;  2BW2 A;  1KH0 A;  1C9F A;  4RNA A;  1RWS A;  3CWI A;  1C77 A;  3IAS 1;  1FFV A;  2AQ1 B;  3BII D;  2B76 B;  1J7C A;  3HUI A;  1FCC C;  3U7Z A;  4RF0 A;  1UWM A;  2NMQ A;  4HKZ E;  4KGS A;  1JRO A;  4USA A;  3TEY A;  3ZQ4 A;  1QF6 A;  3GB1 A;  1ZE3 D;  2JXT A;  2L32 A;  3P63 A;  4EE2 A;  2ONQ A;  5MPO A;  1YJJ A;  3W9C B;  1AN8 A;  1PGX A;  3FIL B;  4WAF A;  1IBX B;  1L6U A;  2MEK A;  1HQR D;  1SJH D;  2KAC A;  4ARI A;  2V4I B;  1NVI D;  2W3S A;  4NAM A;  1K50 A;  4IOI E;  4NJC A;  2AQ3 B;  1VR9 A;  2EKI A;  5E6J A;  4YSY B;  3WCQ A;  1GTE A;  2IDY A;  3CIR B;  2CU3 A;  2WLB A;  2V3N A;  4YWG G;  3VRB B;  2KWD A;  3FAH A;  4YSZ B;  3V05 A;  5HFY A;  2KMM A;  2RPV A;  3LXF A;  3UI3 A;  1RM6 C;  1NEN B;  4KKJ A;  1L6V A;  3AMZ A;  3NVZ A;  3RFZ B;  1Y56 A;  4HJG E;  2N9L A;  1XLQ A;  1I4X A;  3EA6 A;  3B2F A;  1V1P A;  2RDH A;  3T3O A;  1SF0 A;  2WXL A;  1PYW D;  3SEB A;  2JYT A;  3AE7 B;  2LEK A;  1V8C A;  1HZ5 A;  4WQM A;  4NAW B;  1H7W A;  1D4B A;  1ESF A;  2NTT A;  3AE5 B;  1N5X A;  4P6V F;  4RGN A;  4ZRP A;  2VZK D;  2Z8L A;  1MPE A;  2FE8 A;  1JW9 D;  2RMM A;  3AE8 B;  4JE3 B;  3CF4 A;  1GTH A;  1N63 A;  2JWU A;  3DWG C;  1QOB A;  2WXH A;  1P7E A;  2WXQ A;  3AEB B;  3MP9 A;  1GAQ B;  1JCK B;  2M56 B;  1ROE A;  1OQR A;  4C56 C;  1GB4 A;  4HKQ A;  3NZ3 A;  3LYY A;  1L0Y B;  2IGG A;  1GB1 A;  1WSP A;  3BWU D;  1SE3 A;  3W5V B;  5G5H A;  2BB5 A;  4JPS A;  4YTN B;  2QSD A;  3Q8A A;  5I4D A;  3U4E G;  1FM0 D;  1FXA A;  1WXQ A;  2J4X A;  2RDG A;  2WXK A;  1CQV A;  2H88 B;  4RGO S;  1TY2 A;  1GPX A;  2J53 A;  1KRH A;  1I4Q A;  2BS2 B;  1UNS A;  3KWV A;  2MH7 A;  2JZP A;  4DXG A;  2LMC A;  2N9K A;  4ZHO A;  2ON8 A;  1D5X C;  1KLU D;  1SE4 A;  3FC4 A;  4H2A A;  4L23 A;  5LNK 1;  5TSS A;  5AUI A;  4HRO A;  2GRI A;  1XLP A;  4O1N A;  1B1Z A;  3P4P B;  3R2I A;  4N58 A;  1JWA D;  5HHD G;  3ZGZ A;  3LB8 C;  2HTM E;  3TUO A;  2WDV B;  1NYR A;  1FIQ A;  2G1E A;  2PVO D;  4M0W A;  1K52 A;  2Y3A A;  3MC0 B;  1L0V B;  2LHD A;  1FRR A;  2N0S B;  1EM7 A;  4WUR A;  4ZRQ A;  3BVZ A;  2DBY A;  2K9X A;  4RCO A;  2IPK D;  4US9 A;  1VDV A;  1E7P B;  3Q8B A;  1FFU A;  2PMV A;  4JX1 C;  3W2D A;  2TSS A;  1D6E C;  4Q2J A;  4MT5 A;  2MJD A;  4TMA B;  2ACZ B;  1DOI A;  3PO0 A;  1CJE A;  2Y5C A;  3E56 A;  4ZOH C;  4R3D A;  1KF6 B;  3P1M A;  4UDU C;  3HRD D;  4A6Q A;  3BVM A;  3MHZ A;  1SEB D;  1UGJ A;  4B0E A;  1FCL A;  5FKA C;  2W55 A;  2V3P A;  2L83 A;  3PZ8 A;  4OZC A;  3W1S A;  5AUK A;  1L4D B;  1PUT A;  2WDR B;  1F77 A;  2D5G A;  1YN5 A;  4AQ7 A;  1YQ3 B;  2QJL A;  2WDQ B;  1I4G A;  2K22 A;  2WXM A;  2BYT A;  2LHE A;  2INN E;  1K53 A;  3SR6 A;  2WXJ A;  2KAJ A;  1DOY A;  2XN9 C;  1M4V A;  1TS3 A;  2JYE A;  3E9S A;  2DYO A;  4A90 A;  1C79 A;  1VJK A;  4DXF A;  1FXI A;  1UUP A;  1JWB D;  1UWX A;  4MAC A;  2BS3 B;  2ZW1 A;  4WWM A;  2WXG A;  3BYT B;  4YXD B;  2KQ4 X;  2LGI A;  2BS4 B;  5H92 C;  1PFD A;  2KDM A;  2PVG C;  2JX5 A;  2SAK A;  1TJE A;  1N61 A;  1F2R I;  3FIL A;  2LUM A;  1IBX A;  1XCT L;  1F2R C;  3P4Q B;  2BBC A;  5D3I B;  3VR8 B;  4L1B A;  4XDD A;  1ZXI A;  4N6E B;  1C4C A;  4PT5 A;  4LLG M;  3HVZ A;  2X38 A;  5BMH A;  1MHH E;  3AE3 B;  1ZOY B;  1TY0 A;  2IGH A;  4IDI A;  1SJE D;  3PZ7 A;  1OQQ A;  1QOF A;  1XEE A;  5BMI A;  5FR3 A;  2G9H D;  5G5G A;  1I4P A;  4YSX B;  1WYG A;  2IJ0 A;  3P4S B;  5C2T B;  1TS5 A;  1TYG B;  2J52 A;  3N9Y C;  1VRA B;  1T6B X;  2N7J A;  4HEA 1;  1N5W A;  2AX5 A;  3KQ4 A;  1J7B A;  1IUE A;  2PIA A;  3Q8C A;  3ABV B;  1E9M A;  2M0A A;  5HI1 A;  5H8Y E;  4J3O D;  3OWE B;  4RH6 A;  1ACC A;  4N59 A;  3GP7 A;  4C7Z A;  2FBW B;  3AE6 B;  1P7F A;  1VZ8 A;  1F0Z A;  2GB1 A;  1RFK A;  2KN4 A;  2L52 A;  3NVW A;  4D2K A;  3GS2 A;  3AEF B;  1XLO A;  1XXG A;  1QKZ A;  1DGJ A;  1E6E B;  3AN1 A;  1V97 A;  1SSN A;  1V1O A;  4XWT A;  4XWW A;  1MVK A;  1VZ7 A;  2J42 A;  4WH4 A;  3BK1 A;  3TEZ A;  4TQ0 A;  1HXY D;  3B9J A;  1HEZ E;  1QT9 A;  4YT0 B;  1VLB A;  1FNV A;  2WXO A;  3H8H A;  2WXP A;  4RGT A;  2K3U A;  2PTL A;  3Q8F A;  3MFG A;  1ET6 A;  4XDC A;  1K51 A;  3ZYY X;  1ZDV A;  4JWU C;  1IGC A;  1ENF A;  1L5P A;  1AWD A;  3NVY A;  1AYF A;  4MM3 B;  2WQY B;  1FNW A;  4HRS A;  3W5U B;  3R2T A;  3AE2 B;  2AQ2 B;  3VQI A;  2QEJ C;  1TS4 A;  1BML C;  1XLN A;  1YMH E;  3AEG B;  3L4P A;  1TKE A;  2K0P A;  1PDX A;  2BTE A;  2LJI A;  2VZK B;  2PLP A;  1TS2 A;  3AE1 B;  4GLS C;  2XNA C;  5BMG A;  3BK2 A;  1ZXH A;  1ZUD 2;  3IT4 B;  3IT6 B;  3DWM A;  1TKY A;  2WS3 B;  3Q8E A;  4REZ A;  5C3J B;  2EEL A;  4OZB A;  2WXN A;  1I4H A;  1YQ4 B;  1R7S A;  1JWM D;  1XCQ L;  4LTU A;  2DLB A;  3V3X A;  1VZ6 A;  1MI0 A;  4RGM A;  1N62 A;  1KFY B;  1EU4 A;  3AED B;  3J9C A;  1YJI A;  4OVZ A;  4C80 A;  2NTS A;  1QOG A;  1JML A;  4IKG A;  4YTP B;  2IGD A;  2PKO A;  3HVD A;  4ITK A;  4C7Y A;  2JSV X;  1YN3 A;  2E3T A;  3AM9 A;  1EWY C;  2M19 A;  4RFB A;  4KX6 B;  1E0Z A;  1SXT A;  2QIL A;  1YN4 A;  3BVG A;  3C8Y A;  1D5M C;  1SE2 A;  1T3Q A;  1JRP A;  5BYR A;  1L0X B;  4AS1 A;  3TEW A;  2WXR A;  2K5P A;  4GDK B;  1KLG D;  2I2Y A;  2CJO A;  2FUG 1;  1HA5 A;  1NYQ A;  2Y5P A;  1V1P B;  1SBB B;  2QMT A;  1C78 A;  1BUI C;  1IGD A;  3KLS X;  3NS1 A;  4YTM B;  4OW0 A;  2INP E;  4TSS A;  2ICI A;  1H7X A;  3ZJT A;  4NZL B;  1FNU A;  2Q5W D;  4TQ1 A;  1WRI A;  3P4R B;  2WXF A;  4P16 A;  1JQ4 A;  1B9R A;  1LO5 D;  2QIE B;  2W82 A;  2WNM A;  2WXI A;  4FXC A;  5T8I A;  1I4R A;  5EE9 A;  1TZO A;  2BT6 A;  3Q69 A;  4LK0 M;  4CQN A;  3R8B A;  3T3N A;  1HZ6 A;  1J7A A;  2YEP F;  1N60 A;  4A55 A;  1E10 A;  1A70 A;  1EU3 A;  1EWC A;  1QLB B;  3AEC B;  2PW9 A;  4RF1 A;  1FMA D;  2W3R A;  4MH8 A;  2WP9 B;  3BYY B;  4XE0 A;  2YEP B;  4ZYS A;  4DQO C;  1KTK A;  1C76 A;  3I9V 1;  4JWS C;  4ARC A;  1FRD A;  1D5Z C;  1SB3 C;  2I38 A;  2W54 A;  3AEE B;  1OFF A;  1PGA A;  2ZW0 A;  1MHX A;  1NI3 A;  1FEH A;  3VR9 B;  3NVV A;  1JWS D;  5JXV A;  4US8 A;  1QQR A;  2R61 A;  1QOA A;  2SEB D;  5D3D A;  4B0M A;  1DYQ A;  4KKI A;  2MJE A;  4ZHP A;  3EUB 2;  2MJ3 A;  3AEA B;  2WU2 B;  1TKG A;  5BYS A;  2WU5 B;  1C4P A;  3AE4 B;  5EE1 A;  2E6X A;  3AH7 A;  1WWT A;  1WGK A;  3VRA B;  1L4Z B;  3TEX A;  1ZPS A;  1FO4 A;  3EGR A;  1Q10 A;  5D7G A;  3U52 E;  2L1A A;  1JWU D;  1CK1 A;  5EE3 A;  1YNT E;  3NUH B;  4OZA A;  1BXT A;  1GOZ A;  3O13 A;  4GDL B;  3P42 A;  2DWQ A;  5EE0 A;  4KGR A;  2JQR B;  2OHF A;  2LFI A;  4A8X C;  2BB6 A;  1GT8 A;  2H89 B;  3BZD B;  4WIP A;  1SIJ A;  1T5X D;  2CJN A;  1XF5 L;  4OHJ A;  4A9A A;  3SFE B;  3ETR A;  3ZJU A;  3RPF C;  2V0G A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...