2H89B

Avian respiratory complex ii with malonate bound
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
241
structure length
241
Chain Sequence
ATSRIKKFSIYRWDPDKPGDKPRMQTYEVDLNKCGPMVLDALIKIKNELDSTLTFRRSCREGICGSCAMNIAGGNTLACTKKIDPDLSKTTKIYPLPHMYVVKDLVPDLSNFYAQYKSIEPYLKKKDESKQGKEQYLQSIEDRQKLDGLYECILCACCSTSCPSYWWNGDKYLGPAVLMQAYRWMIDSRDDYTEERLAQLQDPFSLYRCHTIMNCTRTCPKGLNPGKAIAEIKKMMATYKE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystallographic studies of the binding of ligands to the dicarboxylate site of Complex II, and the identity of the ligand in the
pubmed doi rcsb
molecule tags Oxidoreductase
molecule keywords SUCCINATE DEHYDROGENASE FLAVOPROTEIN SUBUNIT
total genus 71
structure length 241
sequence length 241
ec nomenclature ec 1.3.5.1: Succinate dehydrogenase (quinone).
pdb deposition date 2006-06-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF13085 Fer2_3 2Fe-2S iron-sulfur cluster binding domain
B PF13534 Fer4_17 4Fe-4S dicluster domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1060.10 Mainly Alpha Orthogonal Bundle Fumarate Reductase Iron-sulfur Protein; Chain B, domain 2 Alpha-helical ferredoxin 2h89B02
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 2h89B01
4FXCA 2DBYA 1N63A 1XO3A 2WQYB 4YT0B 2K5PA 3P1MA 3NVYA 1FFVA 4C7ZA 2W3SA 5G5GA 1AWDA 1PFDA 1JW9D 1GTEA 1JWBD 1CJEA 1ROEA 4WWMA 4US8A 1RFKA 3SFDB 2WS3B 1H7XA 3B2GA 3P63A 1PDXA 1FO4A 2E3TA 3AB5A 2B76B 3NS1A 4N6EB 2KAJA 1NI3A 5H8YE 3AEFB 1NENB 1ZUD2 1TKEA 1OFFA 3AM9A 1KF6B 1YQ4B 3SFEB 3B9JA 3NVVA 4IDIA 2WLBA 2CJNA 1V8CA 4ITKA 1KRHA 2MJEA 1JALA 2W55A 2Y5CA 1R7SA 2L83A 3AE2B 2PVGC 5MPOA 3AE5B 4A9AA 1EWYC 2BS2B 1JWAD 3AMZA 3SR6A 1E6EB 1QOGA 1TKGA 3VRBB 3RPFC 1RYJA 3CIRB 3HRDD 1J7CA 1TJEA 1NVID 1YJJA 2PKOA 1JRPA 1KFYB 4YSZB 1WYGA 1L5PA 1XLNA 2FBWB 3P4PB 1CZPA 1N5WA 3AEGB 4USAA 5GXGB 4US9A 2ACZB 1ZOYB 1FXAA 1XLPA 3KWLA 1DGJA 1PUTA 4ZOHC 2K9XA 2W3RA 3HVZA 1OQQA 1WXQA 5H92C 3AEDB 3AE9B 2JX5A 2CU3A 1WRIA 5AUKA 3NVWA 4ZHOA 1SIJA 3AE1B 1I7HA 3VR9B 4YXDB 1YQ3B 1L6VA 4P6VF 3AV8A 4C7YA 3AEBB 2WP9B 3P4SB 3P4QB 5G5HA 1AYFA 3AN1A 1FXIA 1N60A 4C80A 2WDQB 1FRRA 3AE4B 2H88B 4KX6B 1DOIA 3ZYYX 1JQ4A 1QOFA 3WCQA 4JWUC 1E9MA 4ZHPA 1FIQA 2CJOA 4JWSC 2BS3B 3AE7B 3ABVB 1F0ZA 3AE3B 3AH7A 1GTHA 1SB3C 1B9RA 4YSYB 1QT9A 3DWMA 5EE9A 2M19A 1VLBA 1SF0A 2WDVB 1VJKA 2MJDA 3LXFA 3NVZA 4HROA 1DOXA 2PVOD 1TYGB 2OHFA 1UWMA 3LB8C 3BIID 1A70A 1RWSA 4N58A 2PIAA 1J7BA 2AX5A 4YTNB 2KMMA 3AEEB 2K22A 4HRSA 3L4PA 2WDRB 1QOAA 1E7PB 3VRAB 3AEAB 1N5XA 1GT8A 3FAHA 2QJLA 3W5VB 1L0VB 3AECB 4YTMB 4YSXB 1GAQB 2L52A 1TKYA 2W54A 1E10A 1RM6C 2H89B 1J7AA 2LEKA 3PO0A 1ZP0B 5EE3A 2BT6A 5C2TB 2DWQA 1WWTA 2G1EA 1OQRA 3AE8B 1N62A 4LTUA 3CF4A 1T3QA 2JQRB 5C3JB 2MH7A 3HUIA 1FFUA 2WU5B 3CWIA 1NYRA 2BS4B 2N0SB 3P4RB 1FM0D 3FC4A 3EUB2 3NRZA 4JX1C 1E0ZA 3B2FA 1DOYA 1V97A 2EKIA 3DWGC 3AE6B 1QOBA 1N61A 1NYQA 1QF6A 1XLOA 1GPXA 2MJ3A 1ZXIA 1QLBB 3VR8B 2Q5WD 3W5UB 1JROA 1IUEA 1FMAD 4N59A 1XLQA 5AUIA 5EE0A 3W9CB 2QIEB 3ETRA 1H7WA 1VDVA 1FRDA 1WGKA 4WQMA 1NEKB 2WU2B 2M56B 5EE1A 1YJIA 2HTME 4YTPB 1L6UA
chains in the Genus database with same CATH superfamily
3P1MA 2AQ2B 1CJEA 1Y56A 1ZKHA 2PEAA 2KJRA 2WX1A 4F1SA 3QWZB 1D6EC 3DQVA 3DVGX 3RNEC 2J52A 3VXWA 2IGHA 2WYQA 3KLSX 4ZRQA 2JXXA 3MJWA 3ZIMA 4OVUA 3P4PB 4USAA 3AEGB 2NS5A 3KQ4A 1SJED 1Q10A 3M62B 2IBIB 2X8XX 1WJNA 4DK5A 5AUKA 4KZCA 2BYFA 1L6VA 3RFZB 5IA7A 2VZKD 2OEDA 1N60A 2WDQB 5TR5A 1R4NB 1V81A 2FCSA 2IO2B 4XWTA 1K53A 3DWMA 2FUHB 3FKYA 1K52A 3RNFC 4XE0A 1SEBD 4WIPA 4II3B 3ZXVA 4E71A 2C7MB 3UINB 4I6LB 3L54A 1L0VB 2KN5A 1FEHA 2KFJA 2H89B 4GDKB 3VFKA 2MHJA 1WMHB 1YN5A 2JQRB 3Q3OC 3KYCD 5D6JB 3L08A 1P3QU 2BWFA 1XD3B 2KO3A 1NYRA 2WXRA 3U2SC 1K8RB 1NI2A 1YX6B 2V3SA 1HE8A 3B2FA 4TSSA 1J19A 3BY4B 1QLBB 2Q5WD 4NAWA 4IM3A 2KTRB 1IUEA 3H7SA 2J42A 2QIEB 2QCZA 2M56B 3SHQA 2MA9B 4W9DA 2PW9A 2W3SA 3QAQA 1S3SG 2LHEA 1AARA 2K8HA 3UQAA 3PZDA 2NBUA 1IGCA 3PZ8A 4N6EB 3KWVA 3RT3B 1WYWB 3AM9A 2KQSA 3PTFC 2WLBA 3RZFA 2QILA 3VUXA 4M01A 2ON8A 3AE2B 4XX5A 2J7QB 4W9GA 2JRIB 3ZLZA 1C4AA 2DYBA 3EC8A 3IAM1 3R66C 5D7GA 2YEPF 4RGMA 4MACA 2WXQA 2JZPA 2C9WB 2BYVE 2C7HA 2V3NA 4AP4C 3TMPB 1PUTA 2K9XA 1GB4A 4CYEA 3S2AA 3WANA 4L1BA 2L76A 3SDLC 4LNKA 1TZ1A 4JWUC 3QHTA 3NZSA 2LRUA 2L8JA 3O13A 2V4LA 3NJTA 3TEZA 4ZRJA 4HVBA 3BIID 1PQSA 4EE2A 4P1BC 4XZ4A 4WWNA 3AECB 1C4PA 2BYEA 2L05A 2D07B 4M8MA 3GS2A 2KMAA 5E6PA 2I1KA 4HPMB 3ZRCA 1WE7A 4GOCA 4DXAB 2NVUI 1I4GA 2LGSA 3H1UA 3ZRFA 3DBHB 1V97A 3UIOB 4IC7B 2BKRB 4S0RA 4PK1A 5BYRA 3GE8C 4HPLB 1JROA 2JVCA 3L0WB 1WGKA 1NEKB 1F2RI 3VQIA 4FXCA 1GC6A 3DHIC 4REZA 1NDDA 4AOFA 1WXSA 2DYOA 1JW9D 4NZLB 1L0XB 5J17A 1IYFA 2KWVB 1WF9A 4P16A 4K7WA 5L83A 3RN9C 4OZBA 2V4IB 2MBBB 3AEFB 4K3CA 1WGRA 3URYA 2K39A 2VRRB 4ITKA 1KRHA 2GI9A 1MG8A 3VVWB 2O6VD 3Q3MC 1JWAD 3NHEB 2IJ0A 1VRAB 3N30A 3RPFC 3ZTCA 5HKHA 1JWMD 4J3OD 4G3XB 1E5WA 3AI5A 3DVNU 4DXGA 4RH6A 1GOZA 3PT2B 2I38A 2JWUA 2KD0A 1MG4A 3QA8A 5AZHA 4MH0E 1UELA 4BKSD 3P4QB 1PYWD 3AN1A 2O6VB 1KOTA 3ZNZB 1L2NA 3AE4B 4HCNB 4WWOA 3ABVB 1LXDA 4LNFA 2M19A 1UF0A 4FN2A 1V2YA 1GC7A 4M00A 2WWZA 1YIWA 1I4XA 3AEAB 1UBIA 1WM2A 4FHKA 3A9KB 3DPDA 2WXHA 3GB1A 2M0XA 5C2TB 3ZJTA 2IZVB 3FILA 4DDGD 2BWES 4KKJA 4KZ0A 2FNJB 4JX1C 3TBLD 4GGQA 2WXNA 5IOIA 3DBSA 2R61A 2WU2B 2KZRA 1N63A 3NVYA 2KOXA 4M02A 1WSPA 3ZXRA 1OTRB 2KDEB 3BVMA 1F77A 5DPWA 2MWSB 1MFWA 1TS3A 2G45B 1PGAA 2IYDB 4OHJA 5LNK1 1LQBA 2WXKA 3MHZA 4JL9A 3VRBB 2UU7A 3JSVB 3TUOA 4JGHB 2D3GA 2KVZA 2ZW1A 4BBNF 3RNGC 1C4CA 1V9JA 4A8XC 2FAZA 5H92C 4FJVB 2W3RA 2IO1B 2DX5B 2M0AA 3Q69A 4K3BA 4JPSA 4C80A 1P7EA 1EF1A 4YWGG 2H88B 1EM7A 3N32A 5BO4B 3V6EB 4OW0A 2NTSA 1YOVB 4BKTA 1YN4A 3UIPB 2JY6A 4GU2A 1H4RA 4KIKA 4KIKB 2WXIA 3NZ3A 2E6XA 1VLBA 4ZYSA 1C79A 2DZJA 1WXAA 2AX5A 3BYTB 2K22A 4GXBA 1STEA 2BKFA 3IVFA 4KDIC 3OAWA 4IUMB 3K9OB 2R2OA 3BK2A 2KJ6A 4RGOS 2G1EA 2L00B 5IP4D 5LXIB 4ICVA 1TS5A 3PREA 2DAJA 2BS4B 2N0SB 3EUB2 3RI7C 2HDEA 1GG3A 5IO9A 3U7DA 1F9JA 3K9PB 1TT5B 1J0GA 1E8YA 4S17A 5E6NA 3ZDTA 1H7WA 3UF8A 4HKQA 4YTPB 2KX0A 1JWUD 3HVDA 4C7ZA 1XQQA 5I4DA 2LGIA 2INNE 1XXGA 2YVCA 2LASA 4M0WB 2A5UA 3BINA 1L4DB 1V8CA 2EMSA 2FIDA 2W55A 4B9KA 3VTWA 4JIOU 1TKGA 4MGYE 2MBEA 4A20A 1JRPA 4EZJA 3WAOA 1WYGA 2KK8A 3R8BA 2MRPA 1LM8B 4BBNC 3AU4A 4EUTA 5BMHA 5D3DA 4KV2A 1WRIA 3X0WA 4C7YA 3T3NA 3C0RB 4WQOB 2B3AA 4KX6B 3R2TA 1SBBB 2GLSA 1UWXA 1IBXB 1I4RA 2GBKA 3ZJVA 3IAS1 2LHDA 1HEZE 3IFWB 1F0ZA 1QT9A 1SF0A 3HM6X 2KYWA 4N58A 2A4ZA 4HRSA 4NAMA 3QIJA 3RNAC 4YTMB 1GAQB 4HDOA 2INPE 1PGXA 1SGHA 3PO0A 3P42A 3SD5A 2GB1A 4NY0A 2CU1A 5EDSA 5C3JB 2MH7A 3AXCA 1YMHE 1FM0D 2LFIA 1T6BX 5HFYA 2BBCA 2EMTA 4G50A 2MJ3A 4KSLC 1V1PA 3LDZE 3CSTA 1ACCA 2L0FA 3PPAA 3ENEA 2J53A 1FFVA 4NJCA 2KFKB 4RCOA 3HM3A 3QARA 1OGWA 4WWMA 2DZIA 3LYYA 3EFUA 3DBLB 4L23A 3JVZX 1ZPSA 3AB5A 2DYMA 2D3AA 1JRUA 1TKEA 1KLUD 4MM3A 3B0AA 4CO7A 3NVVA 5AEKB 1SE4A 2M4NA 1WGGA 4JQWC 3EA6A 5AZFA 3SR6A 5DPRA 3V3XA 4HK2A 1NVID 1YJJA 5KHOA 4J6IA 4ASWC 5JZEB 4BOZB 5CHVC 1ET9A 2ACZB 1FXTB 3FILB 2KWDA 4DXFA 4RGTA 3HVZA 3AE9B 2O2VA 4DDID 3MC8A 5JHBA 5JH5C 1WGDA 2M17A 4PYZA 1ZDVA 2KKCA 3P4SB 2LVQA 2KT7A 2QSDA 3PHXB 2QMTA 4KKIA 4IM2A 2BPSA 2LGXA 5HG2A 4HROA 3H7PA 2MX2A 3LB8C 1J7BA 2OJWA 2RDGA 1E7PB 3ZDMC 2GMIC 4DWFA 2AL3A 3APCA 2CHZA 1HZ5A 4IKGA 2LGYA 2ZNVB 1C77A 3AE8B 1P7FA 4W9EA 4MSMB 2WU5B 2ASQA 2WGSA 1F1HA 5J2RA 3H6NA 2XEWA 3R3MA 2XK5B 2AQ3B 3W1SA 1V49A 2GRIA 2IPKD 5EE0A 3KVFB 1YNTE 1QILA 2PPHA 3ZW3A 2WHIA 1JMLA 4BKGA 4HKZE 5T8IA 4US8A 1RFKA 3V6CB 4HPPA 1WFYA 2EKEC 4B0EA 1WR6E 5H8YE 3N1XC 2NBVB 2N7JA 2PE9A 1YQ4B 4HXDA 1B1ZA 1SE2A 1LFDA 5C23A 2HD5B 4R3DA 2PVGC 3DHHC 3H7PB 1QOGA 3KUDB 2LGDA 2BW2A 1TJEA 4K1RB 4P1CC 2GBMA 1CZPA 5CX3A 3PLUA 2ZPNA 3A4RA 2CHWA 3KWLA 4HJGE 2JX5A 5L95C 1OQYA 2WP9B 2G4DB 3Q3NC 5LLIA 3ML8A 2L32A 2JYTA 1WY8A 3V62A 4DHZB 1QOFA 4A55A 4A3OA 2INDC 2N9LA 1SB3C 1B9RA 2MJDA 3HHMA 4NJ7A 2DHZA 1WX9A 2SAKA 4MT5A 2KANA 5D2MB 4X57B 2KMMA 3RCZA 2ZCCA 1QOAA 3OLMD 3ZQ4A 4MEMA 1OQRA 1VCBA 4LTUA 2CKHB 2LUEA 2N7DA 4ICUA 2RPQA 2KTFA 2PJHA 1RRBA 4W9LA 5C1ZA 1BMLC 4B0MA 3VDZA 3W5UB 1G6JA 2ZEQA 2K6DB 1ZW7A 1TY2A 2JSVX 3BVZA 3BVGA 1OEYA 1YJIA 1WJUA 3W1SC 3WA0A 3PHWB 3U52E 4WJQA 3TEXA 2RR9A 2FIFA 1P9DU 2KXJA 3E9SA 3ZO5B 4AWJA 2N9EB 2KTRA 3BWUD 2BF8B 2KAJA 2RPVA 2MP2A 4LJPB 1HA5A 3B9JA 3UQBA 2MJEA 2JU6X 2O2VB 4MGIE 4I6PA 2TSSA 3A4SC 1M4VA 2WXMA 3QJZA 2MLBA 4BVUC 1TBEA 1UGMA 1VR9A 4ANVA 2V0GA 2WXJA 4MGZE 2WXPA 2CU3A 5D94A 2MSED 4F7ZA 2LD9A 1AYFA 1FCCC 1D4BA 1IGDA 4DHJB 1JQ4A 3TL5A 1EUVB 4WAFA 3L10B 2CJOA 2BS3B 3PV1A 3QC8B 4GDLB 2M1MA 3QCAA 1UNSA 1E8XA 4HEA1 2UYZB 4LNIA 5IN7A 1FNWA 1WXVA 2AEHA 4FJZA 3DBRI 3VRAB 5FR6A 4XC2A 3H8HA 2L7RA 2W54A 3GZNI 1UH6A 2BT6A 4GB9A 5BYSA 1WWTA 3L13A 1GB1A 3RULA 2LUMA 3VTVA 1V80A 4F8CB 4LJOB 2ZVNA 2IO0B 1HTOA 2JPHA 3VUWA 1GPXA 3VR8B 1J8CA 4A90A 3IG3A 3OJ4B 2WQYB 1E8ZA 3IT4B 4XGAB 3U30A 2N1WA 2WNMA 3T3OA 2ZW0A 1ROEA 3SFDB 1H8CA 3IT6B 3P63A 1WZ3A 2E3TA 4PT5A 3IHPC 3U4EG 4W9IA 2KNBA 1ISNA 1R7SA 2Y5PA 4A9AA 2G3QB 4URKA 2OOBB 2PKOA 2IY0B 1KFYB 4Q2JA 1C1YB 2YLMA 2HJ1A 4GIVA 2EELA 2ONQA 3AEDB 1UZXB 5J18A 3ZVVA 2K8CA 3RUIB 1FPYA 3ZTDA 3PRMB 4AS1A 4NQLB 5CHWA 4RNAA 3OJ3A 1HXYD 4RFBA 2ZZPB 4JWSC 1QZEA 3NY5A 4YSYB 3Q8AA 1NBFC 3PSEB 1VJKA 4L2YA 4ANWA 2FCMA 3CF6E 1UWMA 2PIAA 2XBBC 1MVKA 4EKUA 4M8NA 2PMVA 2D3BA 4IWQA 4ZYNA 3FAHA 3EECA 2V3PA 4XYCA 1UUPA 3EFCA 5EE3A 4WH4A 1D5XC 4AJYB 2I2YA 2AYOB 2WX0A 2L1AA 4EZLA 1E0ZA 2LRWA 1K51A 1VD2A 4KVGB 2XK5A 3A9JA 1X1MA 1ZDXA 1VDVA 2QJLA 1LO5D 3NG0A 2KHWB 3Q8BA 4E3CA 3SEBA 4G11A 1GTEA 1EU4A 3Q6BA 3CSFA 4MGKE 5KHQA 1EF5A 1BXTA 2KQ7A 2B76B 3NS1A 1NI3A 2Z59B 2LWPA 2W9NA 3VAWA 1KH0A 2J0KA 1WXMA 1MHHE 3E56A 1L4ZB 3DHGC 4FBJB 2BB5A 5TSSA 4A3PA 3N1ZC 4GMVA 1VZ7A 1XCTL 5GXGB 2JRHA 3WAPA 3GOEA 4EFOA 3PGEA 1WXQA 4PS3A 3M3JA 4NJ6A 1EU3A 3AE1B 1I7HA 1A5RA 4ZRIA 1GNUA 1SE9A 4XDDA 3RZWC 3JSVA 2LMCA 4CQNA 1TS4A 2KVRA 1FIQA 2CR5A 1WI0A 4II2B 3AE3B 4GLSC 1TYGB 2RMMA 3AEEB 1HZ6A 3DBLI 2BTEA 4W9HA 5IKCM 4YSXB 1FD6A 1RM6C 2NPTB 2NTTA 2X38A 2KX3A 1N62A 3CF4A 1V5OA 1C76A 3NRZA 2KMCA 3DCGA 2WXLA 1TGZB 2I1JA 3DWGC 1QOBA 3KW5B 2HTHA 1TTNA 3T9LA 3W9CB 2D5GA 1SJHD 3N9YC 2ZVOA 3OG5A 2Z8LA 1L6UA 2DENB 3TIXA 3MJ5A 1N6ZA 3R7RA 4IWPA 2N9XA 3TJPA 2LXAA 5G5GA 1AWDA 3A1QB 2NBWB 4TV3A 3KYDD 5AZGA 1EWCA 1IBXA 1AW7A 2MW5A 5FKAC 3I5JC 2SEBD 2V9HA 2G4SA 1YX5B 1XCQL 4TQ1A 3PS6A 2MQJA 4UDUC 3KUZA 2LVOA 2CJNA 4ARIA 2GBNA 2M8SA 3AE5B 2WXGA 3NUHB 5FK9C 1J7CA 3CMMB 2LXCA 1I42A 4ZOHC 4ARCA 4HWIB 2MCNB 4HJKA 4P6VF 3AV8A 1YN3A 1V1PB 1BT0A 1T0SC 1L7YA 2PTLA 2R2QA 3N1YC 3ZYYX 2D11A 4NQKE 3TCAA 2QEJC 2RSUA 4TUUA 3A33B 4ACFA 2N4FA 4EZKA 2WDVB 2KDMA 3C8YA 1V1OA 3ML9A 3B08A 2WDRB 2C5LC 1BUIC 1Q0WB 3W5VB 3UI3A 3VHTC 1E10A 1J7AA 4GN1A 4FJYA 1MI0A 1YD8U 5DPTA 2L3ZA 2DZKA 3RYTA 4D2KA 3FC4A 2LJ5A 5FR3A 3AU5A 1DOYA 2YEPB 4I6NB 1OEYJ 1N61A 1NYQA 2D10A 2K0PA 1ZXIA 2JF5A 2NPTA 4MELA 1FMAD 3PRPB 3TEWA 1SXTA 4RM9A 2KWCA 3QX1A 3ZNHB 2C60A 4FULA 4XDCA 3RNCC 4C4VA 4ZRKA 4WWPA 4EOYA 2N7EA 2IGGA 4IWOA 3O65B 3W2DA 4DHZE 3Q8CA 1KF6B 4IDIA 2FUG1 4WURA 3PVLA 1VZ8A 4LCDE 1D5ZC 3AMZA 4WJOA 3PRZA 3CIRB 4H2AA 2KLGA 2AL6A 3RMKC 3ALBA 3MC0B 1FXAA 4RGNA 1I4HA 5CTRC 4ANUA 1SSNA 1SIJA 3AEBB 1I4PA 2VZKB 1C9FA 1V6EA 4ZHPA 1E9MA 1VZ6A 2ICIA 3I57A 1MJDA 1GTHA 5BYQA 1UBQA 3NS8A 1RWSA 2AWTA 3EHVA 3PLVA 5D3IB 4HDQA 4GDKA 2LEKA 4FA6A 1ZP0B 2MBQA 3Q14C 3GP7A 4W9FA 3N20C 2FCQA 1E7VA 2RD0A 3P4RB 2RDHA 3Q8FA 2NMQA 1R4NI 2KLCA 2W82A 2DZMA 4N59A 3HIZA 1XEEA 1GUAB 1WE6A 4GDLA 5EE1A 3MHSD 3GE3C 1GJZA 4LNOA 1WM3A 3W1YA 4PYUA 4W9CA 3J9CA 3SU8X 4RM8A 3U7ZA 2ZPYA 3RNBC 1TIFA 2LJIA 4KGSA 2BGFA 1IP9A 4RF1A 3MP9A 2IGDA 1I35A 1ZUD2 1OFFA 3BYYB 3T8MA 1E7UA 4MDKE 1Z2MA 1Z5SB 2HJ8A 4WAAA 1E6EB 2INCC 3DBRB 4DHJD 1TZOA 5E6OA 3I63C 4PS8A 1R4MB 4US9A 3APFA 2ZNVC 2PLPA 1ZE3D 4ANXA 1YQ3B 1RLFA 4OZCA 1Q1OA 2AQ1B 3DVNV 2D3CA 4MH8A 3MC9A 2GBJA 3A9KA 1XF5L 2LVPA 2RDBC 2J4XA 3BK1A 2V1YA 3P2BA 4NPNA 1Y8RC 3I3TB 2OHFA 2FE8A 4IOIE 1A70A 4C00A 2ZCBA 3L4PA 4AJWA 2L52A 1C78A 4ZDVA 2DWQA 1WGHA 3MFGA 4TMAB 3DVGY 3AULA 4IW0A 3D32A 4K7UA 3HUIA 4W9KA 1FFUA 1ESFA 3HK0A 3CWIA 2WXFA 2PE6B 2D2QA 4TQ0A 2KN4A 2EKIA 4JLCA 2K3UA 2CHXA 1WIAA 2ZJDA 1QF6A 1XLOA 1T5XD 3RD2A 1AN8A 5AUIA 1R4MI 3ETRA 3IXSA 1ENFA 3GZNB 3I9V1 4W9JA 2K5PA 4OZAA 1P0RA 2WDTB 3VH3B 2JUOA 2JWZA 2KFKA 4OVZA 2O6VA 1PFDA 2VH2A 1JWBD 4CHKA 1V86A 3R2IA 3Q3FA 4KDLB 3VUYA 4GSWA 5BMGA 1UGJA 1TS2A 1NENB 3H9DA 1HQRD 2LI5A 3SFEB 3B1LX 1WX7A 4LNNA 1JALA 3N3KB 2BB6A 2Y5CA 3ZGZA 1CQVA 2BS2B 4O1NA 3UGBB 3DBHI 4FHJA 3A9JB 1T0RC 1MHXA 4KSKC 2Z0DB 2GBRA 1WGYA 1QKZA 2UWQA 1L5PA 1PGBA 1WH3A 3MTNB 2K8BA 3WIMA 1KJTA 1I4QA 3NOBA 1CK1A 4JE3B 1E8WA 5G5HA 1DYQA 5G55A 1DOIA 2QHOA 4BOSC 5E6JA 3R7QA 3V05A 4C4VB 2XN9C 1ET6A 1SIFA 5EE9A 2NCNA 3TEYA 3LXFA 3ZNID 1CMXB 2N1VA 2KDBA 1FNVA 1F52A 4BFRA 1XT9B 4G0NB 1WZ0A 5DCNA 3A1QA 3LJ3A 1GT8A 1ZGUB 4IM0A 4WJPA 2GOWA 2CS4A 4KGRA 1D5MC 2N9PC 1P1AA 1RAXA 3BZDB 1WRDB 1E90A 3DDCB 3JYUA 4AQ7A 1WX8A 3L16A 1EO6A 2K25A 3VTUA 4MJSB 2DBYA 3C19A 2MBOA 5DPSA 2K6QA 2QDFA 2WXOA 3ONSA 3Q3JA 1Q5WB 1H7XA 3B2GA 1PDXA 2IDYA 4C56C 4LK0M 4YL8A 2FCNA 3ZKJC 2LZ6A 3APDA 3TSSA 3WALA 1ZXHA 3Q2AC 2KJHB 5G2NA 2L83A 5MPOA 4IG7B 2IO3B 4BKSA 1EWYC 2NR2A 5BMIA 1RYJA 3HRDD 1D3ZA 4TKNA 1XLNA 4N9F4 1N5WA 1FCLA 4NAWB 1ZOYB 1KLGD 1XLPA 1JWSD 1OQQA 2JYEA 4ZHOA 3NVWA 4RMAA 4A6QA 2KWUB 4QAYA 2MEKA 1QQRA 2OJRA 3DOWA 3M95A 1M94A 3WCQA 2KACA 1S1QB 3EGRA 5JXVA 1IPGA 4LDTB 5LXHA 2BVCA 1DOXA 1YQBA 1UD7A 2PVOD 3VH4B 4FLHA 4DBGA 2JZZA 2XNAC 4NNJB 1TKYA 1WJ4A 2IY1B 4EEWA 2HE7A 5GMVA 3V61A 1WJ6A 3ZNGC 2C7NB 3ZUNA 1K50A 1LGRA 3X23A 2Y3AA 3AE6B 2BYTA 4RF0A 2BQQA 2JXTA 4LDTD 1XLQA 1FRDA 4WQMA 5IAAC 4MM3B 1XO3A 4YT0B 3WAMA 4XWWA 2DNFA 3PZ7A 1JCKB 1MPEA 4B6WA 1C3TA 1RFAA 2DAFA 2WS3B 4K81A 1FO4A 3M63B 2KC2A 3OWEB 2KDIA 1T0YA 5HHDG 2MP2B 4BZAA 4MJSA 2RGFA 2REXA 3QK0A 2VH1A 4WJNA 5JHAA 1HTQA 1FNUA 3JW0X 2Y5BB 1U4AA 3NZUA 4YSZB 4AUQC 2FBWB 4BAXA 4K7SA 1P98A 1DGJA 1T0QC 2J0MA 2Z0EB 3Q8EA 1SE3A 4B95A 3VR9B 4YXDB 1KTKA 2QC8A 1FXIA 2L0TA 1FRRA 1KLVA 4FADA 1YJ1A 3ZJUA 4OVVA 3AE7B 2KDFB 3AH7A 4KGTA 1WMHA 3NVZA 3KUCB 4HCPB 4YTNB 3L17A 3U8ZA 1L0YB 4HLEA 1N5XA 2KQ4X 2N9KA 2JZ3B 4M0WA 2JT4B 1T3QA 2K1FA 4ZRPA 4PS7A 1V5TA 3IBEA 1TY0A 3QQ8B 2MBHA 4P7IA 1KM7A 2G9HD 1WR1A 4E74A 5CHFA 5HI1A 4LLGM 4MSQB 3ECIA 3V60A 2DLBA 1F2RC 3KH0A 4DQOC 2HTME 2KC1A 2J0JA
chains in the Genus database with same CATH topology
2WQYB 3IT4B 3P1MA 1JWUD 3HVDA 4C7ZA 2AQ2B 3J9CA 3U7ZA 2WNMA 3T3OA 2ZW0A 1CJEA 1ROEA 1Y56A 5I4DA 3SFDB 2LJIA 4KGSA 3IT6B 3P63A 4RF1A 2LGIA 2INNE 3MP9A 1XXGA 2E3TA 2IGDA 4PT5A 3U4EG 1ZUD2 1OFFA 3BYYB 1L4DB 1V8CA 1D6EC 2J52A 2W55A 1R7SA 2IGHA 2Y5PA 4A9AA 3KLSX 4ZRQA 1E6EB 1TKGA 1TZOA 2PKOA 1JRPA 1KFYB 4Q2JA 1WYGA 3P4PB 4USAA 3AEGB 3R8BA 3KQ4A 4US9A 1SJED 1Q10A 2EELA 2PLPA 2ONQA 1ZE3D 3AEDB 5BMHA 5D3DA 1WRIA 5AUKA 4C7YA 1L6VA 1YQ3B 3RFZB 4OZCA 2VZKD 3T3NA 2AQ1B 2OEDA 1N60A 2WDQB 4MH8A 4AS1A 4KX6B 4RNAA 3R2TA 1SBBB 1UWXA 1IBXB 1I4RA 3ZJVA 3IAS1 1XF5L 1HXYD 4RFBA 4JWSC 4XWTA 2LHDA 1HEZE 1F0ZA 2J4XA 3BK1A 4YSYB 1K53A 1QT9A 3DWMA 3Q8AA 1SF0A 1VJKA 4L2YA 1K52A 2OHFA 2FE8A 1UWMA 4IOIE 4XE0A 1A70A 4N58A 2PIAA 1SEBD 1MVKA 4WIPA 4HRSA 4NAMA 3L4PA 2PMVA 3FAHA 1L0VB 4YTMB 2V3PA 1GAQB 2L52A 1FEHA 1C78A 2INPE 2H89B 1PGXA 1UUPA 3PO0A 4GDKB 5EE3A 3P42A 4WH4A 2DWQA 3MFGA 4TMAB 1D5XC 2GB1A 1YN5A 2JQRB 5C3JB 2MH7A 3HUIA 2I2YA 1FFUA 1ESFA 3CWIA 1NYRA 1YMHE 2L1AA 2WXRA 2WXFA 3U2SC 1FM0D 2LFIA 1E0ZA 1T6BX 3B2FA 2KN4A 4TQ0A 5HFYA 4TSSA 2EKIA 1K51A 2K3UA 2BBCA 1QF6A 1XLOA 1T5XD 2MJ3A 1QLBB 2Q5WD 1V1PA 1AN8A 1ZDXA 1IUEA 5AUIA 1ACCA 2J42A 2QIEB 3ETRA 1VDVA 3IXSA 2M56B 1ENFA 2QJLA 3I9V1 1LO5D 2J53A 2K5PA 3Q8BA 4OZAA 1FFVA 4NJCA 2PW9A 4OVZA 4RCOA 3SEBA 2W3SA 1PFDA 1GTEA 1JWBD 4WWMA 3LYYA 1EU4A 2LHEA 4L23A 3R2IA 1BXTA 3PZ8A 1IGCA 1ZPSA 3AB5A 2B76B 3NS1A 4N6EB 2DYMA 1UGJA 1NI3A 5BMGA 3KWVA 1TS2A 1NENB 1TKEA 1HQRD 1KLUD 3AM9A 3SFEB 3NVVA 1KH0A 2WLBA 2QILA 1MHHE 1SE4A 1JALA 2BB6A 2ON8A 2Y5CA 3AE2B 3E56A 3ZGZA 1CQVA 1L4ZB 2BS2B 3EA6A 3SR6A 4O1NA 1C4AA 1MHXA 2BB5A 5TSSA 3V3XA 1NVID 1YJJA 3IAM1 5D7GA 2YEPF 1QKZA 4RGMA 1L5PA 1PGBA 4MACA 1VZ7A 1XCTL 2JZPA 2WXQA 5GXGB 1ET9A 2ACZB 3FILB 2V3NA 2KWDA 1PUTA 4DXFA 2K9XA 4RGTA 3HVZA 1WXQA 1GB4A 3AE9B 1EU3A 1I4QA 3AE1B 1I7HA 1ZDVA 1CK1A 3P4SB 4JE3B 5G5HA 4XDDA 2QSDA 1DYQA 2QMTA 2LMCA 4L1BA 4CQNA 4KKIA 1DOIA 1TS4A 5E6JA 3V05A 4JWUC 2XN9C 1FIQA 1ET6A 3AE3B 3O13A 5EE9A 5HG2A 4GLSC 4HROA 3TEYA 3LXFA 3TEZA 1TYGB 1FNVA 2RMMA 3LB8C 3BIID 1J7BA 3AEEB 1HZ6A 2RDGA 4EE2A 2BTEA 1E7PB 1GT8A 3AECB 1C4PA 4YSXB 1FD6A 1HZ5A 1RM6C 4IKGA 2NTTA 2X38A 3GS2A 1C77A 3AE8B 1N62A 4KGRA 3CF4A 1D5MC 1P7FA 2WU5B 1C76A 3NRZA 3BZDB 1I4GA 1V97A 2WXLA 3DWGC 1QOBA 4AQ7A 5BYRA 2AQ3B 3W1SA 1JROA 2GRIA 2IPKD 3W9CB 5EE0A 2D5GA 1SJHD 1YNTE 1WGKA 3N9YC 1NEKB 1F2RI 3VQIA 2Z8LA 4FXCA 1QILA 1L6UA 2DBYA 3MJ5A 4REZA 2DYOA 5G5GA 1AWDA 1JMLA 1JW9D 4NZLB 1L0XB 2WXOA 4HKZE 5T8IA 4US8A 1RFKA 1EWCA 1IBXA 1H7XA 1AW7A 3B2GA 4P16A 5FKAC 2SEBD 1PDXA 4OZBA 2IDYA 2V4IB 1XCQL 4B0EA 5H8YE 4LK0M 3AEFB 4C56C 4TQ1A 2N7JA 4UDUC 1YQ4B 3TSSA 3URYA 1B1ZA 1ZXHA 2CJNA 1SE2A 4ARIA 4ITKA 1KRHA 2GI9A 4R3DA 2L83A 2PVGC 5MPOA 3AE5B 1EWYC 1JWAD 2WXGA 5BMIA 2IJ0A 1QOGA 1VRAB 3NUHB 3RPFC 1RYJA 3HRDD 5FK9C 1JWMD 4J3OD 1J7CA 2BW2A 1TJEA 1XLNA 1CZPA 1N5WA 1FCLA 4DXGA 4RH6A 1GOZA 4NAWB 1ZOYB 1KLGD 1XLPA 2I38A 1JWSD 3KWLA 2JWUA 4HJGE 4ZOHC 4ARCA 1OQQA 2JX5A 2JYEA 4ZHOA 3NVWA 4P6VF 3AV8A 3P4QB 2WP9B 4A6QA 1PYWD 1YN3A 3AN1A 1V1PB 2MEKA 2PTLA 1QQRA 2L32A 2JYTA 3AE4B 3ZYYX 1QOFA 2QEJC 3WCQA 2KACA 4A55A 3EGRA 3ABVB 5JXVA 2N9LA 1SB3C 1B9RA 2M19A 2WDVB 2MJDA 2KDMA 1DOXA 2PVOD 3C8YA 1V1OA 2SAKA 4MT5A 2KMMA 1I4XA 2WDRB 1QOAA 3AEAB 1BUIC 3ZQ4A 3W5VB 2XNAC 3UI3A 1TKYA 1E10A 2WXHA 1J7AA 3GB1A 5C2TB 1MI0A 3ZJTA 1OQRA 4LTUA 3FILA 4D2KA 3FC4A 4KKJA 4JX1C 5FR3A 1K50A 1DOYA 2YEPB 2Y3AA 3AE6B 2WXNA 1BMLC 4B0MA 1N61A 1NYQA 2K0PA 2BYTA 4RF0A 1ZXIA 3W5UB 2JXTA 1FMAD 1XLQA 2R61A 1TY2A 2JSVX 1FRDA 4WQMA 2WU2B 3BVZA 3BVGA 3TEWA 1YJIA 1SXTA 4MM3B 1N63A 1XO3A 4YT0B 4XWWA 3NVYA 3PZ7A 3U52E 1JCKB 1MPEA 3TEXA 4XDCA 3E9SA 2WS3B 1WSPA 1FO4A 3BWUD 3OWEB 3BVMA 2KAJA 1F77A 5HHDG 2RPVA 2IGGA 3W2DA 1HA5A 1KF6B 1TS3A 3B9JA 3Q8CA 4IDIA 2FUG1 4WURA 1PGAA 2MJEA 1VZ8A 4OHJA 2JU6X 5LNK1 1D5ZC 2WXKA 2TSSA 1M4VA 3AMZA 3MHZA 1FNUA 3VRBB 3CIRB 4H2AA 2WXMA 3TUOA 4YSZB 1VR9A 2ZW1A 2FBWB 1C4CA 4A8XC 3MC0B 1FXAA 1DGJA 5H92C 2V0GA 2W3RA 4RGNA 1I4HA 1SSNA 2WXJA 2WXPA 3Q8EA 1SE3A 2CU3A 1SIJA 3VR9B 4YXDB 2M0AA 1KTKA 3Q69A 3AEBB 1AYFA 1FCCC 1FXIA 4JPSA 4C80A 1P7EA 4YWGG 1D4BA 1FRRA 1I4PA 2VZKB 2H88B 1EM7A 1IGDA 1C9FA 4OW0A 1JQ4A 2NTSA 3ZJUA 4WAFA 4ZHPA 1E9MA 1YN4A 2CJOA 1VZ6A 2ICIA 2BS3B 3AE7B 3I57A 3AH7A 2WXIA 1GTHA 3NZ3A 2E6XA 5BYQA 4KGTA 4GDLB 3NVZA 1VLBA 1UNSA 4ZYSA 4HEA1 1C79A 1RWSA 1FNWA 2AX5A 4YTNB 3BYTB 2K22A 1L0YB 5D3IB 3VRAB 1N5XA 2KQ4X 1STEA 2N9KA 3H8HA 2W54A 2LEKA 1ZP0B 3BK2A 2BT6A 4M0WA 5BYSA 1WWTA 4RGOS 2G1EA 1GB1A 1T3QA 3GP7A 1TS5A 2LUMA 4ZRPA 2BS4B 2N0SB 3P4RB 1TY0A 3EUB2 2RDHA 3Q8FA 2G9HD 2HDEA 2NMQA 1GPXA 5HI1A 3VR8B 4LLGM 2W82A 4N59A 1XEEA 2DLBA 4A90A 1H7WA 1F2RC 4HKQA 5EE1A 4DQOC 2HTME 4YTPB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4FXC A;  2DBY A;  1N63 A;  1XO3 A;  2WQY B;  4YT0 B;  2K5P A;  3P1M A;  3NVY A;  1FFV A;  4C7Z A;  2W3S A;  5G5G A;  1AWD A;  1PFD A;  1JW9 D;  1GTE A;  1JWB D;  1CJE A;  1ROE A;  4WWM A;  4US8 A;  1RFK A;  3SFD B;  2WS3 B;  1H7X A;  3B2G A;  3P63 A;  1PDX A;  1FO4 A;  2E3T A;  3AB5 A;  2B76 B;  3NS1 A;  4N6E B;  2KAJ A;  1NI3 A;  5H8Y E;  3AEF B;  1NEN B;  1ZUD 2;  1TKE A;  1OFF A;  3AM9 A;  1KF6 B;  1YQ4 B;  3SFE B;  3B9J A;  3NVV A;  4IDI A;  2WLB A;  2CJN A;  1V8C A;  4ITK A;  1KRH A;  2MJE A;  1JAL A;  2W55 A;  2Y5C A;  1R7S A;  2L83 A;  3AE2 B;  2PVG C;  5MPO A;  3AE5 B;  4A9A A;  1EWY C;  2BS2 B;  1JWA D;  3AMZ A;  3SR6 A;  1E6E B;  1QOG A;  1TKG A;  3VRB B;  3RPF C;  1RYJ A;  3CIR B;  3HRD D;  1J7C A;  1TJE A;  1NVI D;  1YJJ A;  2PKO A;  1JRP A;  1KFY B;  4YSZ B;  1WYG A;  1L5P A;  1XLN A;  2FBW B;  3P4P B;  1CZP A;  1N5W A;  3AEG B;  4USA A;  5GXG B;  4US9 A;  2ACZ B;  1ZOY B;  1FXA A;  1XLP A;  3KWL A;  1DGJ A;  1PUT A;  4ZOH C;  2K9X A;  2W3R A;  3HVZ A;  1OQQ A;  1WXQ A;  5H92 C;  3AED B;  3AE9 B;  2JX5 A;  2CU3 A;  1WRI A;  5AUK A;  3NVW A;  4ZHO A;  1SIJ A;  3AE1 B;  1I7H A;  3VR9 B;  4YXD B;  1YQ3 B;  1L6V A;  4P6V F;  3AV8 A;  4C7Y A;  3AEB B;  2WP9 B;  3P4S B;  3P4Q B;  5G5H A;  1AYF A;  3AN1 A;  1FXI A;  1N60 A;  4C80 A;  2WDQ B;  1FRR A;  3AE4 B;  2H88 B;  4KX6 B;  1DOI A;  3ZYY X;  1JQ4 A;  1QOF A;  3WCQ A;  4JWU C;  1E9M A;  4ZHP A;  1FIQ A;  2CJO A;  4JWS C;  2BS3 B;  3AE7 B;  3ABV B;  1F0Z A;  3AE3 B;  3AH7 A;  1GTH A;  1SB3 C;  1B9R A;  4YSY B;  1QT9 A;  3DWM A;  5EE9 A;  2M19 A;  1VLB A;  1SF0 A;  2WDV B;  1VJK A;  2MJD A;  3LXF A;  3NVZ A;  4HRO A;  1DOX A;  2PVO D;  1TYG B;  2OHF A;  1UWM A;  3LB8 C;  3BII D;  1A70 A;  1RWS A;  4N58 A;  2PIA A;  1J7B A;  2AX5 A;  4YTN B;  2KMM A;  3AEE B;  2K22 A;  4HRS A;  3L4P A;  2WDR B;  1QOA A;  1E7P B;  3VRA B;  3AEA B;  1N5X A;  1GT8 A;  3FAH A;  2QJL A;  3W5V B;  1L0V B;  3AEC B;  4YTM B;  4YSX B;  1GAQ B;  2L52 A;  1TKY A;  2W54 A;  1E10 A;  1RM6 C;  2H89 B;  1J7A A;  2LEK A;  3PO0 A;  1ZP0 B;  5EE3 A;  2BT6 A;  5C2T B;  2DWQ A;  1WWT A;  2G1E A;  1OQR A;  3AE8 B;  1N62 A;  4LTU A;  3CF4 A;  1T3Q A;  2JQR B;  5C3J B;  2MH7 A;  3HUI A;  1FFU A;  2WU5 B;  3CWI A;  1NYR A;  2BS4 B;  2N0S B;  3P4R B;  1FM0 D;  3FC4 A;  3EUB 2;  3NRZ A;  4JX1 C;  1E0Z A;  3B2F A;  1DOY A;  1V97 A;  2EKI A;  3DWG C;  3AE6 B;  1QOB A;  1N61 A;  1NYQ A;  1QF6 A;  1XLO A;  1GPX A;  2MJ3 A;  1ZXI A;  1QLB B;  3VR8 B;  2Q5W D;  3W5U B;  1JRO A;  1IUE A;  1FMA D;  4N59 A;  1XLQ A;  5AUI A;  5EE0 A;  3W9C B;  2QIE B;  3ETR A;  1H7W A;  1VDV A;  1FRD A;  1WGK A;  4WQM A;  1NEK B;  2WU2 B;  2M56 B;  5EE1 A;  1YJI A;  2HTM E;  4YTP B;  1L6U A; 
#chains in the Genus database with same CATH topology
 3P1M A;  2AQ2 B;  1CJE A;  1Y56 A;  1ZKH A;  2PEA A;  2KJR A;  2WX1 A;  4F1S A;  3QWZ B;  1D6E C;  3DQV A;  3DVG X;  3RNE C;  2J52 A;  3VXW A;  2IGH A;  2WYQ A;  3KLS X;  4ZRQ A;  2JXX A;  3MJW A;  3ZIM A;  4OVU A;  3P4P B;  4USA A;  3AEG B;  2NS5 A;  3KQ4 A;  1SJE D;  1Q10 A;  3M62 B;  2IBI B;  2X8X X;  1WJN A;  4DK5 A;  5AUK A;  4KZC A;  2BYF A;  1L6V A;  3RFZ B;  5IA7 A;  2VZK D;  2OED A;  1N60 A;  2WDQ B;  5TR5 A;  1R4N B;  1V81 A;  2FCS A;  2IO2 B;  4XWT A;  1K53 A;  3DWM A;  2FUH B;  3FKY A;  1K52 A;  3RNF C;  4XE0 A;  1SEB D;  4WIP A;  4II3 B;  3ZXV A;  4E71 A;  2C7M B;  3UIN B;  4I6L B;  3L54 A;  1L0V B;  2KN5 A;  1FEH A;  2KFJ A;  2H89 B;  4GDK B;  3VFK A;  2MHJ A;  1WMH B;  1YN5 A;  2JQR B;  3Q3O C;  3KYC D;  5D6J B;  3L08 A;  1P3Q U;  2BWF A;  1XD3 B;  2KO3 A;  1NYR A;  2WXR A;  3U2S C;  1K8R B;  1NI2 A;  1YX6 B;  2V3S A;  1HE8 A;  3B2F A;  4TSS A;  1J19 A;  3BY4 B;  1QLB B;  2Q5W D;  4NAW A;  4IM3 A;  2KTR B;  1IUE A;  3H7S A;  2J42 A;  2QIE B;  2QCZ A;  2M56 B;  3SHQ A;  2MA9 B;  4W9D A;  2PW9 A;  2W3S A;  3QAQ A;  1S3S G;  2LHE A;  1AAR A;  2K8H A;  3UQA A;  3PZD A;  2NBU A;  1IGC A;  3PZ8 A;  4N6E B;  3KWV A;  3RT3 B;  1WYW B;  3AM9 A;  2KQS A;  3PTF C;  2WLB A;  3RZF A;  2QIL A;  3VUX A;  4M01 A;  2ON8 A;  3AE2 B;  4XX5 A;  2J7Q B;  4W9G A;  2JRI B;  3ZLZ A;  1C4A A;  2DYB A;  3EC8 A;  3IAM 1;  3R66 C;  5D7G A;  2YEP F;  4RGM A;  4MAC A;  2WXQ A;  2JZP A;  2C9W B;  2BYV E;  2C7H A;  2V3N A;  4AP4 C;  3TMP B;  1PUT A;  2K9X A;  1GB4 A;  4CYE A;  3S2A A;  3WAN A;  4L1B A;  2L76 A;  3SDL C;  4LNK A;  1TZ1 A;  4JWU C;  3QHT A;  3NZS A;  2LRU A;  2L8J A;  3O13 A;  2V4L A;  3NJT A;  3TEZ A;  4ZRJ A;  4HVB A;  3BII D;  1PQS A;  4EE2 A;  4P1B C;  4XZ4 A;  4WWN A;  3AEC B;  1C4P A;  2BYE A;  2L05 A;  2D07 B;  4M8M A;  3GS2 A;  2KMA A;  5E6P A;  2I1K A;  4HPM B;  3ZRC A;  1WE7 A;  4GOC A;  4DXA B;  2NVU I;  1I4G A;  2LGS A;  3H1U A;  3ZRF A;  3DBH B;  1V97 A;  3UIO B;  4IC7 B;  2BKR B;  4S0R A;  4PK1 A;  5BYR A;  3GE8 C;  4HPL B;  1JRO A;  2JVC A;  3L0W B;  1WGK A;  1NEK B;  1F2R I;  3VQI A;  4FXC A;  1GC6 A;  3DHI C;  4REZ A;  1NDD A;  4AOF A;  1WXS A;  2DYO A;  1JW9 D;  4NZL B;  1L0X B;  5J17 A;  1IYF A;  2KWV B;  1WF9 A;  4P16 A;  4K7W A;  5L83 A;  3RN9 C;  4OZB A;  2V4I B;  2MBB B;  3AEF B;  4K3C A;  1WGR A;  3URY A;  2K39 A;  2VRR B;  4ITK A;  1KRH A;  2GI9 A;  1MG8 A;  3VVW B;  2O6V D;  3Q3M C;  1JWA D;  3NHE B;  2IJ0 A;  1VRA B;  3N30 A;  3RPF C;  3ZTC A;  5HKH A;  1JWM D;  4J3O D;  4G3X B;  1E5W A;  3AI5 A;  3DVN U;  4DXG A;  4RH6 A;  1GOZ A;  3PT2 B;  2I38 A;  2JWU A;  2KD0 A;  1MG4 A;  3QA8 A;  5AZH A;  4MH0 E;  1UEL A;  4BKS D;  3P4Q B;  1PYW D;  3AN1 A;  2O6V B;  1KOT A;  3ZNZ B;  1L2N A;  3AE4 B;  4HCN B;  4WWO A;  3ABV B;  1LXD A;  4LNF A;  2M19 A;  1UF0 A;  4FN2 A;  1V2Y A;  1GC7 A;  4M00 A;  2WWZ A;  1YIW A;  1I4X A;  3AEA B;  1UBI A;  1WM2 A;  4FHK A;  3A9K B;  3DPD A;  2WXH A;  3GB1 A;  2M0X A;  5C2T B;  3ZJT A;  2IZV B;  3FIL A;  4DDG D;  2BWE S;  4KKJ A;  4KZ0 A;  2FNJ B;  4JX1 C;  3TBL D;  4GGQ A;  2WXN A;  5IOI A;  3DBS A;  2R61 A;  2WU2 B;  2KZR A;  1N63 A;  3NVY A;  2KOX A;  4M02 A;  1WSP A;  3ZXR A;  1OTR B;  2KDE B;  3BVM A;  1F77 A;  5DPW A;  2MWS B;  1MFW A;  1TS3 A;  2G45 B;  1PGA A;  2IYD B;  4OHJ A;  5LNK 1;  1LQB A;  2WXK A;  3MHZ A;  4JL9 A;  3VRB B;  2UU7 A;  3JSV B;  3TUO A;  4JGH B;  2D3G A;  2KVZ A;  2ZW1 A;  4BBN F;  3RNG C;  1C4C A;  1V9J A;  4A8X C;  2FAZ A;  5H92 C;  4FJV B;  2W3R A;  2IO1 B;  2DX5 B;  2M0A A;  3Q69 A;  4K3B A;  4JPS A;  4C80 A;  1P7E A;  1EF1 A;  4YWG G;  2H88 B;  1EM7 A;  3N32 A;  5BO4 B;  3V6E B;  4OW0 A;  2NTS A;  1YOV B;  4BKT A;  1YN4 A;  3UIP B;  2JY6 A;  4GU2 A;  1H4R A;  4KIK A;  4KIK B;  2WXI A;  3NZ3 A;  2E6X A;  1VLB A;  4ZYS A;  1C79 A;  2DZJ A;  1WXA A;  2AX5 A;  3BYT B;  2K22 A;  4GXB A;  1STE A;  2BKF A;  3IVF A;  4KDI C;  3OAW A;  4IUM B;  3K9O B;  2R2O A;  3BK2 A;  2KJ6 A;  4RGO S;  2G1E A;  2L00 B;  5IP4 D;  5LXI B;  4ICV A;  1TS5 A;  3PRE A;  2DAJ A;  2BS4 B;  2N0S B;  3EUB 2;  3RI7 C;  2HDE A;  1GG3 A;  5IO9 A;  3U7D A;  1F9J A;  3K9P B;  1TT5 B;  1J0G A;  1E8Y A;  4S17 A;  5E6N A;  3ZDT A;  1H7W A;  3UF8 A;  4HKQ A;  4YTP B;  2KX0 A;  1JWU D;  3HVD A;  4C7Z A;  1XQQ A;  5I4D A;  2LGI A;  2INN E;  1XXG A;  2YVC A;  2LAS A;  4M0W B;  2A5U A;  3BIN A;  1L4D B;  1V8C A;  2EMS A;  2FID A;  2W55 A;  4B9K A;  3VTW A;  4JIO U;  1TKG A;  4MGY E;  2MBE A;  4A20 A;  1JRP A;  4EZJ A;  3WAO A;  1WYG A;  2KK8 A;  3R8B A;  2MRP A;  1LM8 B;  4BBN C;  3AU4 A;  4EUT A;  5BMH A;  5D3D A;  4KV2 A;  1WRI A;  3X0W A;  4C7Y A;  3T3N A;  3C0R B;  4WQO B;  2B3A A;  4KX6 B;  3R2T A;  1SBB B;  2GLS A;  1UWX A;  1IBX B;  1I4R A;  2GBK A;  3ZJV A;  3IAS 1;  2LHD A;  1HEZ E;  3IFW B;  1F0Z A;  1QT9 A;  1SF0 A;  3HM6 X;  2KYW A;  4N58 A;  2A4Z A;  4HRS A;  4NAM A;  3QIJ A;  3RNA C;  4YTM B;  1GAQ B;  4HDO A;  2INP E;  1PGX A;  1SGH A;  3PO0 A;  3P42 A;  3SD5 A;  2GB1 A;  4NY0 A;  2CU1 A;  5EDS A;  5C3J B;  2MH7 A;  3AXC A;  1YMH E;  1FM0 D;  2LFI A;  1T6B X;  5HFY A;  2BBC A;  2EMT A;  4G50 A;  2MJ3 A;  4KSL C;  1V1P A;  3LDZ E;  3CST A;  1ACC A;  2L0F A;  3PPA A;  3ENE A;  2J53 A;  1FFV A;  4NJC A;  2KFK B;  4RCO A;  3HM3 A;  3QAR A;  1OGW A;  4WWM A;  2DZI A;  3LYY A;  3EFU A;  3DBL B;  4L23 A;  3JVZ X;  1ZPS A;  3AB5 A;  2DYM A;  2D3A A;  1JRU A;  1TKE A;  1KLU D;  4MM3 A;  3B0A A;  4CO7 A;  3NVV A;  5AEK B;  1SE4 A;  2M4N A;  1WGG A;  4JQW C;  3EA6 A;  5AZF A;  3SR6 A;  5DPR A;  3V3X A;  4HK2 A;  1NVI D;  1YJJ A;  5KHO A;  4J6I A;  4ASW C;  5JZE B;  4BOZ B;  5CHV C;  1ET9 A;  2ACZ B;  1FXT B;  3FIL B;  2KWD A;  4DXF A;  4RGT A;  3HVZ A;  3AE9 B;  2O2V A;  4DDI D;  3MC8 A;  5JHB A;  5JH5 C;  1WGD A;  2M17 A;  4PYZ A;  1ZDV A;  2KKC A;  3P4S B;  2LVQ A;  2KT7 A;  2QSD A;  3PHX B;  2QMT A;  4KKI A;  4IM2 A;  2BPS A;  2LGX A;  5HG2 A;  4HRO A;  3H7P A;  2MX2 A;  3LB8 C;  1J7B A;  2OJW A;  2RDG A;  1E7P B;  3ZDM C;  2GMI C;  4DWF A;  2AL3 A;  3APC A;  2CHZ A;  1HZ5 A;  4IKG A;  2LGY A;  2ZNV B;  1C77 A;  3AE8 B;  1P7F A;  4W9E A;  4MSM B;  2WU5 B;  2ASQ A;  2WGS A;  1F1H A;  5J2R A;  3H6N A;  2XEW A;  3R3M A;  2XK5 B;  2AQ3 B;  3W1S A;  1V49 A;  2GRI A;  2IPK D;  5EE0 A;  3KVF B;  1YNT E;  1QIL A;  2PPH A;  3ZW3 A;  2WHI A;  1JML A;  4BKG A;  4HKZ E;  5T8I A;  4US8 A;  1RFK A;  3V6C B;  4HPP A;  1WFY A;  2EKE C;  4B0E A;  1WR6 E;  5H8Y E;  3N1X C;  2NBV B;  2N7J A;  2PE9 A;  1YQ4 B;  4HXD A;  1B1Z A;  1SE2 A;  1LFD A;  5C23 A;  2HD5 B;  4R3D A;  2PVG C;  3DHH C;  3H7P B;  1QOG A;  3KUD B;  2LGD A;  2BW2 A;  1TJE A;  4K1R B;  4P1C C;  2GBM A;  1CZP A;  5CX3 A;  3PLU A;  2ZPN A;  3A4R A;  2CHW A;  3KWL A;  4HJG E;  2JX5 A;  5L95 C;  1OQY A;  2WP9 B;  2G4D B;  3Q3N C;  5LLI A;  3ML8 A;  2L32 A;  2JYT A;  1WY8 A;  3V62 A;  4DHZ B;  1QOF A;  4A55 A;  4A3O A;  2IND C;  2N9L A;  1SB3 C;  1B9R A;  2MJD A;  3HHM A;  4NJ7 A;  2DHZ A;  1WX9 A;  2SAK A;  4MT5 A;  2KAN A;  5D2M B;  4X57 B;  2KMM A;  3RCZ A;  2ZCC A;  1QOA A;  3OLM D;  3ZQ4 A;  4MEM A;  1OQR A;  1VCB A;  4LTU A;  2CKH B;  2LUE A;  2N7D A;  4ICU A;  2RPQ A;  2KTF A;  2PJH A;  1RRB A;  4W9L A;  5C1Z A;  1BML C;  4B0M A;  3VDZ A;  3W5U B;  1G6J A;  2ZEQ A;  2K6D B;  1ZW7 A;  1TY2 A;  2JSV X;  3BVZ A;  3BVG A;  1OEY A;  1YJI A;  1WJU A;  3W1S C;  3WA0 A;  3PHW B;  3U52 E;  4WJQ A;  3TEX A;  2RR9 A;  2FIF A;  1P9D U;  2KXJ A;  3E9S A;  3ZO5 B;  4AWJ A;  2N9E B;  2KTR A;  3BWU D;  2BF8 B;  2KAJ A;  2RPV A;  2MP2 A;  4LJP B;  1HA5 A;  3B9J A;  3UQB A;  2MJE A;  2JU6 X;  2O2V B;  4MGI E;  4I6P A;  2TSS A;  3A4S C;  1M4V A;  2WXM A;  3QJZ A;  2MLB A;  4BVU C;  1TBE A;  1UGM A;  1VR9 A;  4ANV A;  2V0G A;  2WXJ A;  4MGZ E;  2WXP A;  2CU3 A;  5D94 A;  2MSE D;  4F7Z A;  2LD9 A;  1AYF A;  1FCC C;  1D4B A;  1IGD A;  4DHJ B;  1JQ4 A;  3TL5 A;  1EUV B;  4WAF A;  3L10 B;  2CJO A;  2BS3 B;  3PV1 A;  3QC8 B;  4GDL B;  2M1M A;  3QCA A;  1UNS A;  1E8X A;  4HEA 1;  2UYZ B;  4LNI A;  5IN7 A;  1FNW A;  1WXV A;  2AEH A;  4FJZ A;  3DBR I;  3VRA B;  5FR6 A;  4XC2 A;  3H8H A;  2L7R A;  2W54 A;  3GZN I;  1UH6 A;  2BT6 A;  4GB9 A;  5BYS A;  1WWT A;  3L13 A;  1GB1 A;  3RUL A;  2LUM A;  3VTV A;  1V80 A;  4F8C B;  4LJO B;  2ZVN A;  2IO0 B;  1HTO A;  2JPH A;  3VUW A;  1GPX A;  3VR8 B;  1J8C A;  4A90 A;  3IG3 A;  3OJ4 B;  2WQY B;  1E8Z A;  3IT4 B;  4XGA B;  3U30 A;  2N1W A;  2WNM A;  3T3O A;  2ZW0 A;  1ROE A;  3SFD B;  1H8C A;  3IT6 B;  3P63 A;  1WZ3 A;  2E3T A;  4PT5 A;  3IHP C;  3U4E G;  4W9I A;  2KNB A;  1ISN A;  1R7S A;  2Y5P A;  4A9A A;  2G3Q B;  4URK A;  2OOB B;  2PKO A;  2IY0 B;  1KFY B;  4Q2J A;  1C1Y B;  2YLM A;  2HJ1 A;  4GIV A;  2EEL A;  2ONQ A;  3AED B;  1UZX B;  5J18 A;  3ZVV A;  2K8C A;  3RUI B;  1FPY A;  3ZTD A;  3PRM B;  4AS1 A;  4NQL B;  5CHW A;  4RNA A;  3OJ3 A;  1HXY D;  4RFB A;  2ZZP B;  4JWS C;  1QZE A;  3NY5 A;  4YSY B;  3Q8A A;  1NBF C;  3PSE B;  1VJK A;  4L2Y A;  4ANW A;  2FCM A;  3CF6 E;  1UWM A;  2PIA A;  2XBB C;  1MVK A;  4EKU A;  4M8N A;  2PMV A;  2D3B A;  4IWQ A;  4ZYN A;  3FAH A;  3EEC A;  2V3P A;  4XYC A;  1UUP A;  3EFC A;  5EE3 A;  4WH4 A;  1D5X C;  4AJY B;  2I2Y A;  2AYO B;  2WX0 A;  2L1A A;  4EZL A;  1E0Z A;  2LRW A;  1K51 A;  1VD2 A;  4KVG B;  2XK5 A;  3A9J A;  1X1M A;  1ZDX A;  1VDV A;  2QJL A;  1LO5 D;  3NG0 A;  2KHW B;  3Q8B A;  4E3C A;  3SEB A;  4G11 A;  1GTE A;  1EU4 A;  3Q6B A;  3CSF A;  4MGK E;  5KHQ A;  1EF5 A;  1BXT A;  2KQ7 A;  2B76 B;  3NS1 A;  1NI3 A;  2Z59 B;  2LWP A;  2W9N A;  3VAW A;  1KH0 A;  2J0K A;  1WXM A;  1MHH E;  3E56 A;  1L4Z B;  3DHG C;  4FBJ B;  2BB5 A;  5TSS A;  4A3P A;  3N1Z C;  4GMV A;  1VZ7 A;  1XCT L;  5GXG B;  2JRH A;  3WAP A;  3GOE A;  4EFO A;  3PGE A;  1WXQ A;  4PS3 A;  3M3J A;  4NJ6 A;  1EU3 A;  3AE1 B;  1I7H A;  1A5R A;  4ZRI A;  1GNU A;  1SE9 A;  4XDD A;  3RZW C;  3JSV A;  2LMC A;  4CQN A;  1TS4 A;  2KVR A;  1FIQ A;  2CR5 A;  1WI0 A;  4II2 B;  3AE3 B;  4GLS C;  1TYG B;  2RMM A;  3AEE B;  1HZ6 A;  3DBL I;  2BTE A;  4W9H A;  5IKC M;  4YSX B;  1FD6 A;  1RM6 C;  2NPT B;  2NTT A;  2X38 A;  2KX3 A;  1N62 A;  3CF4 A;  1V5O A;  1C76 A;  3NRZ A;  2KMC A;  3DCG A;  2WXL A;  1TGZ B;  2I1J A;  3DWG C;  1QOB A;  3KW5 B;  2HTH A;  1TTN A;  3T9L A;  3W9C B;  2D5G A;  1SJH D;  3N9Y C;  2ZVO A;  3OG5 A;  2Z8L A;  1L6U A;  2DEN B;  3TIX A;  3MJ5 A;  1N6Z A;  3R7R A;  4IWP A;  2N9X A;  3TJP A;  2LXA A;  5G5G A;  1AWD A;  3A1Q B;  2NBW B;  4TV3 A;  3KYD D;  5AZG A;  1EWC A;  1IBX A;  1AW7 A;  2MW5 A;  5FKA C;  3I5J C;  2SEB D;  2V9H A;  2G4S A;  1YX5 B;  1XCQ L;  4TQ1 A;  3PS6 A;  2MQJ A;  4UDU C;  3KUZ A;  2LVO A;  2CJN A;  4ARI A;  2GBN A;  2M8S A;  3AE5 B;  2WXG A;  3NUH B;  5FK9 C;  1J7C A;  3CMM B;  2LXC A;  1I42 A;  4ZOH C;  4ARC A;  4HWI B;  2MCN B;  4HJK A;  4P6V F;  3AV8 A;  1YN3 A;  1V1P B;  1BT0 A;  1T0S C;  1L7Y A;  2PTL A;  2R2Q A;  3N1Y C;  3ZYY X;  2D11 A;  4NQK E;  3TCA A;  2QEJ C;  2RSU A;  4TUU A;  3A33 B;  4ACF A;  2N4F A;  4EZK A;  2WDV B;  2KDM A;  3C8Y A;  1V1O A;  3ML9 A;  3B08 A;  2WDR B;  2C5L C;  1BUI C;  1Q0W B;  3W5V B;  3UI3 A;  3VHT C;  1E10 A;  1J7A A;  4GN1 A;  4FJY A;  1MI0 A;  1YD8 U;  5DPT A;  2L3Z A;  2DZK A;  3RYT A;  4D2K A;  3FC4 A;  2LJ5 A;  5FR3 A;  3AU5 A;  1DOY A;  2YEP B;  4I6N B;  1OEY J;  1N61 A;  1NYQ A;  2D10 A;  2K0P A;  1ZXI A;  2JF5 A;  2NPT A;  4MEL A;  1FMA D;  3PRP B;  3TEW A;  1SXT A;  4RM9 A;  2KWC A;  3QX1 A;  3ZNH B;  2C60 A;  4FUL A;  4XDC A;  3RNC C;  4C4V A;  4ZRK A;  4WWP A;  4EOY A;  2N7E A;  2IGG A;  4IWO A;  3O65 B;  3W2D A;  4DHZ E;  3Q8C A;  1KF6 B;  4IDI A;  2FUG 1;  4WUR A;  3PVL A;  1VZ8 A;  4LCD E;  1D5Z C;  3AMZ A;  4WJO A;  3PRZ A;  3CIR B;  4H2A A;  2KLG A;  2AL6 A;  3RMK C;  3ALB A;  3MC0 B;  1FXA A;  4RGN A;  1I4H A;  5CTR C;  4ANU A;  1SSN A;  1SIJ A;  3AEB B;  1I4P A;  2VZK B;  1C9F A;  1V6E A;  4ZHP A;  1E9M A;  1VZ6 A;  2ICI A;  3I57 A;  1MJD A;  1GTH A;  5BYQ A;  1UBQ A;  3NS8 A;  1RWS A;  2AWT A;  3EHV A;  3PLV A;  5D3I B;  4HDQ A;  4GDK A;  2LEK A;  4FA6 A;  1ZP0 B;  2MBQ A;  3Q14 C;  3GP7 A;  4W9F A;  3N20 C;  2FCQ A;  1E7V A;  2RD0 A;  3P4R B;  2RDH A;  3Q8F A;  2NMQ A;  1R4N I;  2KLC A;  2W82 A;  2DZM A;  4N59 A;  3HIZ A;  1XEE A;  1GUA B;  1WE6 A;  4GDL A;  5EE1 A;  3MHS D;  3GE3 C;  1GJZ A;  4LNO A;  1WM3 A;  3W1Y A;  4PYU A;  4W9C A;  3J9C A;  3SU8 X;  4RM8 A;  3U7Z A;  2ZPY A;  3RNB C;  1TIF A;  2LJI A;  4KGS A;  2BGF A;  1IP9 A;  4RF1 A;  3MP9 A;  2IGD A;  1I35 A;  1ZUD 2;  1OFF A;  3BYY B;  3T8M A;  1E7U A;  4MDK E;  1Z2M A;  1Z5S B;  2HJ8 A;  4WAA A;  1E6E B;  2INC C;  3DBR B;  4DHJ D;  1TZO A;  5E6O A;  3I63 C;  4PS8 A;  1R4M B;  4US9 A;  3APF A;  2ZNV C;  2PLP A;  1ZE3 D;  4ANX A;  1YQ3 B;  1RLF A;  4OZC A;  1Q1O A;  2AQ1 B;  3DVN V;  2D3C A;  4MH8 A;  3MC9 A;  2GBJ A;  3A9K A;  1XF5 L;  2LVP A;  2RDB C;  2J4X A;  3BK1 A;  2V1Y A;  3P2B A;  4NPN A;  1Y8R C;  3I3T B;  2OHF A;  2FE8 A;  4IOI E;  1A70 A;  4C00 A;  2ZCB A;  3L4P A;  4AJW A;  2L52 A;  1C78 A;  4ZDV A;  2DWQ A;  1WGH A;  3MFG A;  4TMA B;  3DVG Y;  3AUL A;  4IW0 A;  3D32 A;  4K7U A;  3HUI A;  4W9K A;  1FFU A;  1ESF A;  3HK0 A;  3CWI A;  2WXF A;  2PE6 B;  2D2Q A;  4TQ0 A;  2KN4 A;  2EKI A;  4JLC A;  2K3U A;  2CHX A;  1WIA A;  2ZJD A;  1QF6 A;  1XLO A;  1T5X D;  3RD2 A;  1AN8 A;  5AUI A;  1R4M I;  3ETR A;  3IXS A;  1ENF A;  3GZN B;  3I9V 1;  4W9J A;  2K5P A;  4OZA A;  1P0R A;  2WDT B;  3VH3 B;  2JUO A;  2JWZ A;  2KFK A;  4OVZ A;  2O6V A;  1PFD A;  2VH2 A;  1JWB D;  4CHK A;  1V86 A;  3R2I A;  3Q3F A;  4KDL B;  3VUY A;  4GSW A;  5BMG A;  1UGJ A;  1TS2 A;  1NEN B;  3H9D A;  1HQR D;  2LI5 A;  3SFE B;  3B1L X;  1WX7 A;  4LNN A;  1JAL A;  3N3K B;  2BB6 A;  2Y5C A;  3ZGZ A;  1CQV A;  2BS2 B;  4O1N A;  3UGB B;  3DBH I;  4FHJ A;  3A9J B;  1T0R C;  1MHX A;  4KSK C;  2Z0D B;  2GBR A;  1WGY A;  1QKZ A;  2UWQ A;  1L5P A;  1PGB A;  1WH3 A;  3MTN B;  2K8B A;  3WIM A;  1KJT A;  1I4Q A;  3NOB A;  1CK1 A;  4JE3 B;  1E8W A;  5G5H A;  1DYQ A;  5G55 A;  1DOI A;  2QHO A;  4BOS C;  5E6J A;  3R7Q A;  3V05 A;  4C4V B;  2XN9 C;  1ET6 A;  1SIF A;  5EE9 A;  2NCN A;  3TEY A;  3LXF A;  3ZNI D;  1CMX B;  2N1V A;  2KDB A;  1FNV A;  1F52 A;  4BFR A;  1XT9 B;  4G0N B;  1WZ0 A;  5DCN A;  3A1Q A;  3LJ3 A;  1GT8 A;  1ZGU B;  4IM0 A;  4WJP A;  2GOW A;  2CS4 A;  4KGR A;  1D5M C;  2N9P C;  1P1A A;  1RAX A;  3BZD B;  1WRD B;  1E90 A;  3DDC B;  3JYU A;  4AQ7 A;  1WX8 A;  3L16 A;  1EO6 A;  2K25 A;  3VTU A;  4MJS B;  2DBY A;  3C19 A;  2MBO A;  5DPS A;  2K6Q A;  2QDF A;  2WXO A;  3ONS A;  3Q3J A;  1Q5W B;  1H7X A;  3B2G A;  1PDX A;  2IDY A;  4C56 C;  4LK0 M;  4YL8 A;  2FCN A;  3ZKJ C;  2LZ6 A;  3APD A;  3TSS A;  3WAL A;  1ZXH A;  3Q2A C;  2KJH B;  5G2N A;  2L83 A;  5MPO A;  4IG7 B;  2IO3 B;  4BKS A;  1EWY C;  2NR2 A;  5BMI A;  1RYJ A;  3HRD D;  1D3Z A;  4TKN A;  1XLN A;  4N9F 4;  1N5W A;  1FCL A;  4NAW B;  1ZOY B;  1KLG D;  1XLP A;  1JWS D;  1OQQ A;  2JYE A;  4ZHO A;  3NVW A;  4RMA A;  4A6Q A;  2KWU B;  4QAY A;  2MEK A;  1QQR A;  2OJR A;  3DOW A;  3M95 A;  1M94 A;  3WCQ A;  2KAC A;  1S1Q B;  3EGR A;  5JXV A;  1IPG A;  4LDT B;  5LXH A;  2BVC A;  1DOX A;  1YQB A;  1UD7 A;  2PVO D;  3VH4 B;  4FLH A;  4DBG A;  2JZZ A;  2XNA C;  4NNJ B;  1TKY A;  1WJ4 A;  2IY1 B;  4EEW A;  2HE7 A;  5GMV A;  3V61 A;  1WJ6 A;  3ZNG C;  2C7N B;  3ZUN A;  1K50 A;  1LGR A;  3X23 A;  2Y3A A;  3AE6 B;  2BYT A;  4RF0 A;  2BQQ A;  2JXT A;  4LDT D;  1XLQ A;  1FRD A;  4WQM A;  5IAA C;  4MM3 B;  1XO3 A;  4YT0 B;  3WAM A;  4XWW A;  2DNF A;  3PZ7 A;  1JCK B;  1MPE A;  4B6W A;  1C3T A;  1RFA A;  2DAF A;  2WS3 B;  4K81 A;  1FO4 A;  3M63 B;  2KC2 A;  3OWE B;  2KDI A;  1T0Y A;  5HHD G;  2MP2 B;  4BZA A;  4MJS A;  2RGF A;  2REX A;  3QK0 A;  2VH1 A;  4WJN A;  5JHA A;  1HTQ A;  1FNU A;  3JW0 X;  2Y5B B;  1U4A A;  3NZU A;  4YSZ B;  4AUQ C;  2FBW B;  4BAX A;  4K7S A;  1P98 A;  1DGJ A;  1T0Q C;  2J0M A;  2Z0E B;  3Q8E A;  1SE3 A;  4B95 A;  3VR9 B;  4YXD B;  1KTK A;  2QC8 A;  1FXI A;  2L0T A;  1FRR A;  1KLV A;  4FAD A;  1YJ1 A;  3ZJU A;  4OVV A;  3AE7 B;  2KDF B;  3AH7 A;  4KGT A;  1WMH A;  3NVZ A;  3KUC B;  4HCP B;  4YTN B;  3L17 A;  3U8Z A;  1L0Y B;  4HLE A;  1N5X A;  2KQ4 X;  2N9K A;  2JZ3 B;  4M0W A;  2JT4 B;  1T3Q A;  2K1F A;  4ZRP A;  4PS7 A;  1V5T A;  3IBE A;  1TY0 A;  3QQ8 B;  2MBH A;  4P7I A;  1KM7 A;  2G9H D;  1WR1 A;  4E74 A;  5CHF A;  5HI1 A;  4LLG M;  4MSQ B;  3ECI A;  3V60 A;  2DLB A;  1F2R C;  3KH0 A;  4DQO C;  2HTM E;  2KC1 A;  2J0J A; 
#chains in the Genus database with same CATH homology
 2WQY B;  3IT4 B;  3P1M A;  1JWU D;  3HVD A;  4C7Z A;  2AQ2 B;  3J9C A;  3U7Z A;  2WNM A;  3T3O A;  2ZW0 A;  1CJE A;  1ROE A;  1Y56 A;  5I4D A;  3SFD B;  2LJI A;  4KGS A;  3IT6 B;  3P63 A;  4RF1 A;  2LGI A;  2INN E;  3MP9 A;  1XXG A;  2E3T A;  2IGD A;  4PT5 A;  3U4E G;  1ZUD 2;  1OFF A;  3BYY B;  1L4D B;  1V8C A;  1D6E C;  2J52 A;  2W55 A;  1R7S A;  2IGH A;  2Y5P A;  4A9A A;  3KLS X;  4ZRQ A;  1E6E B;  1TKG A;  1TZO A;  2PKO A;  1JRP A;  1KFY B;  4Q2J A;  1WYG A;  3P4P B;  4USA A;  3AEG B;  3R8B A;  3KQ4 A;  4US9 A;  1SJE D;  1Q10 A;  2EEL A;  2PLP A;  2ONQ A;  1ZE3 D;  3AED B;  5BMH A;  5D3D A;  1WRI A;  5AUK A;  4C7Y A;  1L6V A;  1YQ3 B;  3RFZ B;  4OZC A;  2VZK D;  3T3N A;  2AQ1 B;  2OED A;  1N60 A;  2WDQ B;  4MH8 A;  4AS1 A;  4KX6 B;  4RNA A;  3R2T A;  1SBB B;  1UWX A;  1IBX B;  1I4R A;  3ZJV A;  3IAS 1;  1XF5 L;  1HXY D;  4RFB A;  4JWS C;  4XWT A;  2LHD A;  1HEZ E;  1F0Z A;  2J4X A;  3BK1 A;  4YSY B;  1K53 A;  1QT9 A;  3DWM A;  3Q8A A;  1SF0 A;  1VJK A;  4L2Y A;  1K52 A;  2OHF A;  2FE8 A;  1UWM A;  4IOI E;  4XE0 A;  1A70 A;  4N58 A;  2PIA A;  1SEB D;  1MVK A;  4WIP A;  4HRS A;  4NAM A;  3L4P A;  2PMV A;  3FAH A;  1L0V B;  4YTM B;  2V3P A;  1GAQ B;  2L52 A;  1FEH A;  1C78 A;  2INP E;  2H89 B;  1PGX A;  1UUP A;  3PO0 A;  4GDK B;  5EE3 A;  3P42 A;  4WH4 A;  2DWQ A;  3MFG A;  4TMA B;  1D5X C;  2GB1 A;  1YN5 A;  2JQR B;  5C3J B;  2MH7 A;  3HUI A;  2I2Y A;  1FFU A;  1ESF A;  3CWI A;  1NYR A;  1YMH E;  2L1A A;  2WXR A;  2WXF A;  3U2S C;  1FM0 D;  2LFI A;  1E0Z A;  1T6B X;  3B2F A;  2KN4 A;  4TQ0 A;  5HFY A;  4TSS A;  2EKI A;  1K51 A;  2K3U A;  2BBC A;  1QF6 A;  1XLO A;  1T5X D;  2MJ3 A;  1QLB B;  2Q5W D;  1V1P A;  1AN8 A;  1ZDX A;  1IUE A;  5AUI A;  1ACC A;  2J42 A;  2QIE B;  3ETR A;  1VDV A;  3IXS A;  2M56 B;  1ENF A;  2QJL A;  3I9V 1;  1LO5 D;  2J53 A;  2K5P A;  3Q8B A;  4OZA A;  1FFV A;  4NJC A;  2PW9 A;  4OVZ A;  4RCO A;  3SEB A;  2W3S A;  1PFD A;  1GTE A;  1JWB D;  4WWM A;  3LYY A;  1EU4 A;  2LHE A;  4L23 A;  3R2I A;  1BXT A;  3PZ8 A;  1IGC A;  1ZPS A;  3AB5 A;  2B76 B;  3NS1 A;  4N6E B;  2DYM A;  1UGJ A;  1NI3 A;  5BMG A;  3KWV A;  1TS2 A;  1NEN B;  1TKE A;  1HQR D;  1KLU D;  3AM9 A;  3SFE B;  3NVV A;  1KH0 A;  2WLB A;  2QIL A;  1MHH E;  1SE4 A;  1JAL A;  2BB6 A;  2ON8 A;  2Y5C A;  3AE2 B;  3E56 A;  3ZGZ A;  1CQV A;  1L4Z B;  2BS2 B;  3EA6 A;  3SR6 A;  4O1N A;  1C4A A;  1MHX A;  2BB5 A;  5TSS A;  3V3X A;  1NVI D;  1YJJ A;  3IAM 1;  5D7G A;  2YEP F;  1QKZ A;  4RGM A;  1L5P A;  1PGB A;  4MAC A;  1VZ7 A;  1XCT L;  2JZP A;  2WXQ A;  5GXG B;  1ET9 A;  2ACZ B;  3FIL B;  2V3N A;  2KWD A;  1PUT A;  4DXF A;  2K9X A;  4RGT A;  3HVZ A;  1WXQ A;  1GB4 A;  3AE9 B;  1EU3 A;  1I4Q A;  3AE1 B;  1I7H A;  1ZDV A;  1CK1 A;  3P4S B;  4JE3 B;  5G5H A;  4XDD A;  2QSD A;  1DYQ A;  2QMT A;  2LMC A;  4L1B A;  4CQN A;  4KKI A;  1DOI A;  1TS4 A;  5E6J A;  3V05 A;  4JWU C;  2XN9 C;  1FIQ A;  1ET6 A;  3AE3 B;  3O13 A;  5EE9 A;  5HG2 A;  4GLS C;  4HRO A;  3TEY A;  3LXF A;  3TEZ A;  1TYG B;  1FNV A;  2RMM A;  3LB8 C;  3BII D;  1J7B A;  3AEE B;  1HZ6 A;  2RDG A;  4EE2 A;  2BTE A;  1E7P B;  1GT8 A;  3AEC B;  1C4P A;  4YSX B;  1FD6 A;  1HZ5 A;  1RM6 C;  4IKG A;  2NTT A;  2X38 A;  3GS2 A;  1C77 A;  3AE8 B;  1N62 A;  4KGR A;  3CF4 A;  1D5M C;  1P7F A;  2WU5 B;  1C76 A;  3NRZ A;  3BZD B;  1I4G A;  1V97 A;  2WXL A;  3DWG C;  1QOB A;  4AQ7 A;  5BYR A;  2AQ3 B;  3W1S A;  1JRO A;  2GRI A;  2IPK D;  3W9C B;  5EE0 A;  2D5G A;  1SJH D;  1YNT E;  1WGK A;  3N9Y C;  1NEK B;  1F2R I;  3VQI A;  2Z8L A;  4FXC A;  1QIL A;  1L6U A;  2DBY A;  3MJ5 A;  4REZ A;  2DYO A;  5G5G A;  1AWD A;  1JML A;  1JW9 D;  4NZL B;  1L0X B;  2WXO A;  4HKZ E;  5T8I A;  4US8 A;  1RFK A;  1EWC A;  1IBX A;  1H7X A;  1AW7 A;  3B2G A;  4P16 A;  5FKA C;  2SEB D;  1PDX A;  4OZB A;  2IDY A;  2V4I B;  1XCQ L;  4B0E A;  5H8Y E;  4LK0 M;  3AEF B;  4C56 C;  4TQ1 A;  2N7J A;  4UDU C;  1YQ4 B;  3TSS A;  3URY A;  1B1Z A;  1ZXH A;  2CJN A;  1SE2 A;  4ARI A;  4ITK A;  1KRH A;  2GI9 A;  4R3D A;  2L83 A;  2PVG C;  5MPO A;  3AE5 B;  1EWY C;  1JWA D;  2WXG A;  5BMI A;  2IJ0 A;  1QOG A;  1VRA B;  3NUH B;  3RPF C;  1RYJ A;  3HRD D;  5FK9 C;  1JWM D;  4J3O D;  1J7C A;  2BW2 A;  1TJE A;  1XLN A;  1CZP A;  1N5W A;  1FCL A;  4DXG A;  4RH6 A;  1GOZ A;  4NAW B;  1ZOY B;  1KLG D;  1XLP A;  2I38 A;  1JWS D;  3KWL A;  2JWU A;  4HJG E;  4ZOH C;  4ARC A;  1OQQ A;  2JX5 A;  2JYE A;  4ZHO A;  3NVW A;  4P6V F;  3AV8 A;  3P4Q B;  2WP9 B;  4A6Q A;  1PYW D;  1YN3 A;  3AN1 A;  1V1P B;  2MEK A;  2PTL A;  1QQR A;  2L32 A;  2JYT A;  3AE4 B;  3ZYY X;  1QOF A;  2QEJ C;  3WCQ A;  2KAC A;  4A55 A;  3EGR A;  3ABV B;  5JXV A;  2N9L A;  1SB3 C;  1B9R A;  2M19 A;  2WDV B;  2MJD A;  2KDM A;  1DOX A;  2PVO D;  3C8Y A;  1V1O A;  2SAK A;  4MT5 A;  2KMM A;  1I4X A;  2WDR B;  1QOA A;  3AEA B;  1BUI C;  3ZQ4 A;  3W5V B;  2XNA C;  3UI3 A;  1TKY A;  1E10 A;  2WXH A;  1J7A A;  3GB1 A;  5C2T B;  1MI0 A;  3ZJT A;  1OQR A;  4LTU A;  3FIL A;  4D2K A;  3FC4 A;  4KKJ A;  4JX1 C;  5FR3 A;  1K50 A;  1DOY A;  2YEP B;  2Y3A A;  3AE6 B;  2WXN A;  1BML C;  4B0M A;  1N61 A;  1NYQ A;  2K0P A;  2BYT A;  4RF0 A;  1ZXI A;  3W5U B;  2JXT A;  1FMA D;  1XLQ A;  2R61 A;  1TY2 A;  2JSV X;  1FRD A;  4WQM A;  2WU2 B;  3BVZ A;  3BVG A;  3TEW A;  1YJI A;  1SXT A;  4MM3 B;  1N63 A;  1XO3 A;  4YT0 B;  4XWW A;  3NVY A;  3PZ7 A;  3U52 E;  1JCK B;  1MPE A;  3TEX A;  4XDC A;  3E9S A;  2WS3 B;  1WSP A;  1FO4 A;  3BWU D;  3OWE B;  3BVM A;  2KAJ A;  1F77 A;  5HHD G;  2RPV A;  2IGG A;  3W2D A;  1HA5 A;  1KF6 B;  1TS3 A;  3B9J A;  3Q8C A;  4IDI A;  2FUG 1;  4WUR A;  1PGA A;  2MJE A;  1VZ8 A;  4OHJ A;  2JU6 X;  5LNK 1;  1D5Z C;  2WXK A;  2TSS A;  1M4V A;  3AMZ A;  3MHZ A;  1FNU A;  3VRB B;  3CIR B;  4H2A A;  2WXM A;  3TUO A;  4YSZ B;  1VR9 A;  2ZW1 A;  2FBW B;  1C4C A;  4A8X C;  3MC0 B;  1FXA A;  1DGJ A;  5H92 C;  2V0G A;  2W3R A;  4RGN A;  1I4H A;  1SSN A;  2WXJ A;  2WXP A;  3Q8E A;  1SE3 A;  2CU3 A;  1SIJ A;  3VR9 B;  4YXD B;  2M0A A;  1KTK A;  3Q69 A;  3AEB B;  1AYF A;  1FCC C;  1FXI A;  4JPS A;  4C80 A;  1P7E A;  4YWG G;  1D4B A;  1FRR A;  1I4P A;  2VZK B;  2H88 B;  1EM7 A;  1IGD A;  1C9F A;  4OW0 A;  1JQ4 A;  2NTS A;  3ZJU A;  4WAF A;  4ZHP A;  1E9M A;  1YN4 A;  2CJO A;  1VZ6 A;  2ICI A;  2BS3 B;  3AE7 B;  3I57 A;  3AH7 A;  2WXI A;  1GTH A;  3NZ3 A;  2E6X A;  5BYQ A;  4KGT A;  4GDL B;  3NVZ A;  1VLB A;  1UNS A;  4ZYS A;  4HEA 1;  1C79 A;  1RWS A;  1FNW A;  2AX5 A;  4YTN B;  3BYT B;  2K22 A;  1L0Y B;  5D3I B;  3VRA B;  1N5X A;  2KQ4 X;  1STE A;  2N9K A;  3H8H A;  2W54 A;  2LEK A;  1ZP0 B;  3BK2 A;  2BT6 A;  4M0W A;  5BYS A;  1WWT A;  4RGO S;  2G1E A;  1GB1 A;  1T3Q A;  3GP7 A;  1TS5 A;  2LUM A;  4ZRP A;  2BS4 B;  2N0S B;  3P4R B;  1TY0 A;  3EUB 2;  2RDH A;  3Q8F A;  2G9H D;  2HDE A;  2NMQ A;  1GPX A;  5HI1 A;  3VR8 B;  4LLG M;  2W82 A;  4N59 A;  1XEE A;  2DLB A;  4A90 A;  1H7W A;  1F2R C;  4HKQ A;  5EE1 A;  4DQO C;  2HTM E;  4YTP B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...