2H89B

Avian respiratory complex ii with malonate bound
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
241
structure length
241
Chain Sequence
ATSRIKKFSIYRWDPDKPGDKPRMQTYEVDLNKCGPMVLDALIKIKNELDSTLTFRRSCREGICGSCAMNIAGGNTLACTKKIDPDLSKTTKIYPLPHMYVVKDLVPDLSNFYAQYKSIEPYLKKKDESKQGKEQYLQSIEDRQKLDGLYECILCACCSTSCPSYWWNGDKYLGPAVLMQAYRWMIDSRDDYTEERLAQLQDPFSLYRCHTIMNCTRTCPKGLNPGKAIAEIKKMMATYKE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystallographic studies of the binding of ligands to the dicarboxylate site of Complex II, and the identity of the ligand in the
pubmed doi rcsb
molecule keywords SUCCINATE DEHYDROGENASE FLAVOPROTEIN SUBUNIT
molecule tags Oxidoreductase
total genus 71
structure length 241
sequence length 241
ec nomenclature ec 1.3.5.1: Succinate dehydrogenase (quinone).
pdb deposition date 2006-06-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF13085 Fer2_3 2Fe-2S iron-sulfur cluster binding domain
B PF13534 Fer4_17 4Fe-4S dicluster domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1060.10 Mainly Alpha Orthogonal Bundle Fumarate Reductase Iron-sulfur Protein; Chain B, domain 2 Alpha-helical ferredoxin 2h89B02
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 2h89B01
3AE1B 3NVWA 3L4PA 1ZXIA 2K9XA 3ETRA 3CIRB 2L83A 1L5PA 1OQRA 2ACZB 1NI3A 3AMZA 3NVVA 5MPOA 1FO4A 5EE3A 4JWSC 4ZHPA 1TKGA 1FXAA 4YSZB 2MJ3A 1XLQA 4US8A 1J7AA 4YT0B 1H7WA 1TJEA 1WRIA 4ZOHC 2JX5A 2FBWB 1YQ4B 3AE6B 4FXCA 4WWMA 1KFYB 1FMAD 1J7CA 1JQ4A 2K22A 1GT8A 1ZOYB 1QOGA 3SFDB 1QOBA 2CJNA 5EE0A 2Q5WD 3DWGC 3LB8C 1DOYA 3AE7B 1KRHA 2WP9B 3VR9B 2KMMA 3P4PB 1L0VB 1ZUD2 2G1EA 3EUB2 3FAHA 5AUKA 3CWIA 3RPFC 1QF6A 4HROA 1DOIA 1CZPA 1WGKA 1FXIA 3W5VB 1E0ZA 5H8YE 1GTEA 1FFVA 1JRPA 2MH7A 3AEGB 3P4SB 1N61A 2B76B 2WU2B 1IUEA 2QIEB 1V8CA 2WU5B 1QT9A 2KAJA 1L6VA 4YTNB 3AE4B 2WDRB 3VR8B 1N62A 3HUIA 1CJEA 3VRAB 1SF0A 3W5UB 3AECB 2BS3B 2OHFA 3P4QB 1EWYC 1WXQA 3ZYYX 2PKOA 4P6VF 5EE9A 3AE9B 1N60A 2MJDA 2W54A 3AE5B 3NS1A 4N6EB 1RFKA 1YJJA 1GTHA 2PIAA 1I7HA 4ITKA 2BT6A 2DBYA 3AM9A 5EE1A 3HVZA 1KF6B 2CJOA 2QJLA 1XO3A 1JALA 2HTME 4A9AA 1QLBB 2AX5A 2W55A 2PVOD 3FC4A 3AE2B 3AEFB 1FM0D 3WCQA 1A70A 5AUIA 2W3RA 5G5HA 2DWQA 1UWMA 2H89B 1PDXA 4C7YA 1TYGB 1VLBA 1VJKA 3B2GA 1QOFA 2M56B 1JWBD 3HRDD 3SR6A 4C80A 5G5GA 1E10A 2PVGC 2LEKA 1NENB 1WWTA 4LTUA 4YSXB 4JX1C 3B2FA 2JQRB 1JW9D 3PO0A 1B9RA 1AWDA 3AH7A 4HRSA 2WQYB 1RYJA 2W3SA 4C7ZA 4N58A 3P63A 1F0ZA 2M19A 3AE3B 3AE8B 1VDVA 4IDIA 1PFDA 4N59A 4US9A 1SB3C 1NYQA 1FIQA 3AEDB 2BS2B 4YTPB 1ROEA 3B9JA 4USAA 3VRBB 2K5PA 4ZHOA 3AV8A 4YXDB 3AN1A 3SFEB 1TKYA 3W9CB 1NEKB 1SIJA 1YJIA 3KWLA 3NVZA 1GPXA 4YTMB 1JROA 1OFFA 1RM6C 1ZP0B 1GAQB 2WDVB 2CU3A 3DWMA 4KX6B 1L6UA 1FRDA 1E7PB 1N5WA 2E3TA 1AYFA 1N63A 2BS4B 4WQMA 1N5XA 2L52A 1E6EB 2Y5CA 1YQ3B 1XLNA 3P1MA 1DOXA 3AB5A 1J7BA 5H92C 4JWUC 1H7XA 2EKIA 1NYRA 1V97A 3P4RB 1RWSA 1OQQA 2WDQB 1FRRA 5C2TB 1PUTA 1TKEA 1R7SA 3AEAB 1FFUA 1NVID 1WYGA 2MJEA 3BIID 3NRZA 2WLBA 5C3JB 5GXGB 2WS3B 1QOAA 1JWAD 4YSYB 2N0SB 3CF4A 3AEBB 1T3QA 2H88B 3NVYA 1XLOA 1E9MA 3AEEB 3LXFA 1DGJA 3ABVB 1XLPA
chains in the Genus database with same CATH superfamily
1G6JA 3W1SC 5IA7A 3N1ZC 4DDID 2LGDA 1FXAA 1UZXB 1VD2A 2PJHA 3OJ4B 3GE3C 2FBWB 4F7ZA 1IGCA 5TR5A 3UQAA 2J4XA 1LM8B 4WIPA 2MA9B 3JSVA 2IDYA 1CZPA 2FCMA 3W5VB 1F2RI 4WAAA 2C5LC 2WGSA 2JSVX 2GBJA 1V9JA 4I6PA 2MWSB 1HQRD 5EE9A 4A20A 5FR3A 1HZ6A 2RSUA 1WGDA 2RDHA 2EMTA 3WAOA 4G11A 1WF9A 3IT4B 4IC7B 1V1OA 1ISNA 1IBXA 4IUMB 3I3TB 2D3CA 4HWIB 1PDXA 4W9HA 1QOFA 2KK8A 4C80A 3RT3B 4B6WA 1E8XA 3A4SC 3IT6B 4HKZE 1WXAA 1RYJA 3ONSA 2XEWA 1PGAA 1D4BA 1UF0A 4US9A 5D94A 2R2QA 2J53A 3HM3A 4WH4A 4JE3B 2UWQA 2WDVB 4W9IA 3TEZA 5HG2A 1ET6A 1N63A 3AI5A 4HK2A 1QZEA 1XXGA 4TQ1A 1NYRA 2OJRA 4FJVB 1NVID 3LYYA 2KYWA 1QQRA 2L05A 2D5GA 5E6JA 2N0SB 4KSLC 4FA6A 2YLMA 1QILA 1HTOA 3NVWA 2B3AA 4XC2A 2N4FA 2JZZA 1WX9A 1OQRA 4JLCA 2KWUB 1FCLA 1FXTB 2UU7A 4URKA 2LZ6A 2Z8LA 1YIWA 1R4MB 4MJSA 3A9KB 2G1EA 2WXMA 2BVCA 2L0TA 1FXIA 4B95A 4JPSA 3NHEB 2DENB 4OVVA 5J18A 1AW7A 1WXQA 1DYQA 3P42A 2L76A 1ET9A 2BWES 2LWPA 4AJWA 3AEFB 1UBIA 2LD9A 5G2NA 1UWMA 1L7YA 3WALA 1VJKA 2BB5A 4WJOA 5IP4D 2KN5A 3Q69A 4BOZB 2ZVOA 2JT4B 1BT0A 1T0QC 4IWPA 3AH7A 2J52A 2KVRA 3P63A 3L17A 4DBGA 5DCNA 2RPVA 1PQSA 3IHPC 4PYZA 3MJWA 2PTLA 2PMVA 3PGEA 1TKYA 4ZRIA 5D6JB 1OFFA 4DDGD 1WGRA 2ZJDA 1WR1A 4A3PA 2MHJA 5FK9C 2FIDA 3L10B 3KYCD 3PS6A 2V9HA 1NDDA 4RF1A 2JYTA 4HKQA 1WI0A 3NUHB 3PTFC 1GNUA 4LTUA 3V3XA 3A33B 2Y3AA 1F52A 2G3QB 4W9CA 3AXCA 3UIPB 4IKGA 5JH5C 2KJHB 1SE9A 4HROA 4GDLA 2KWDA 2FIFA 3PT2B 1GTEA 2KC2A 3CSFA 4TQ0A 4AS1A 3ZO5B 2JYEA 2MBEA 4YTNB 3Q3MC 5CHWA 4EE2A 2O2VA 1C76A 2J42A 1TGZB 4G3XB 4P6VF 3TJPA 3AE9B 3QHTA 1RFKA 4ANVA 1WYWB 1EM7A 4RH6A 4GDKB 5JHAA 2BYVE 1TYGB 2YVCA 4RNAA 4LDTB 2KC1A 4MM3B 1E90A 4EKUA 4K3CA 1FNWA 2KX0A 1KTKA 2DYMA 4NAWA 3Q8CA 4C7ZA 5J17A 4K3BA 3AE3B 2KN4A 2HD5B 3DVGX 1KOTA 1UBQA 3DHHC 1J8CA 3NOBA 4YTMB 1ZP0B 2CU3A 5L95C 4LNIA 2LGYA 4FHJA 1C4CA 4HJKA 2L52A 3SEBA 2LGIA 1NBFC 3V6CB 2JPHA 1RWSA 3WAMA 1ZKHA 2GBRA 3IBEA 1C3TA 2ZW1A 1WY8A 1EO6A 3B2FA 4RFBA 4WJNA 1ZXIA 2KTRA 2N1WA 3QX1A 2VZKD 2L0FA 1F9JA 4GN1A 1V1PA 1TJEA 2QSDA 2WXLA 2C60A 4IM2A 3KVFB 4NAWB 1D5MC 2MH7A 2WU2B 3I9V1 3L0WB 1L6VA 2I1JA 2NBVB 2AEHA 3W5UB 3N9YC 2KXJA 3NS1A 1K51A 2KOXA 2PIAA 1SBBB 5EE1A 2KANA 4A9AA 3KYDD 4BKTA 3R2TA 4KGTA 1FM0D 1FPYA 2INCC 4D2KA 1Y56A 4JQWC 2WX1A 1JWBD 2A4ZA 5BO4B 3PZDA 4W9KA 3KQ4A 3R8BA 3W2DA 2NR2A 2JWUA 3WANA 3L16A 2WQYB 4YL8A 4NZLB 4RCOA 2NPTB 4OZBA 1PFDA 1VZ8A 3MC9A 4ZHOA 1F77A 5HHDG 3AV8A 4L1BA 3FILB 1RAXA 3ZUNA 3SFEB 1YJIA 1CQVA 2KTFA 5D2MB 2G4DB 5C1ZA 3EFUA 1GB1A 2I38A 3VXWA 4DXAB 3T9LA 1ENFA 1P0RA 2FUG1 1OQQA 4P1CC 1FFUA 1UUPA 2PE9A 5BYRA 5J2RA 4FBJB 2WS3B 1E5WA 1QOAA 2KFJA 3GP7A 1T3QA 3ZIMA 3AEEB 1P98A 4X57B 4HEA1 4XWWA 3Q3NC 3H8HA 3CIRB 3VHTC 2V4LA 3IXSA 3NVVA 1E7VA 2AL6A 2KDIA 3L54A 2L8JA 2DZKA 4DQOC 5EE0A 4H2AA 1WZ0A 3VR9B 4XDCA 3BYTB 3QA8A 4W9JA 2LI5A 3U4EG 3ZLZA 3OG5A 3Q3FA 2B76B 3HUIA 2SAKA 1WM2A 4J3OD 5DPWA 2X8XX 5BYSA 4XX5A 3H9DA 3ZVVA 4NAMA 1QLBB 2O6VA 3BY4B 4A8XC 1KLUD 1VLBA 4YSXB 2CKHB 2L3ZA 5KHOA 1WJNA 2TSSA 3DVNV 4A90A 1V86A 2EMSA 1HTQA 3PPAA 1NYQA 3NY5A 4CYEA 1XF5L 3AEDB 4E71A 5LXHA 2BS2B 4YTPB 5HFYA 2L00B 4YXDB 3QJZA 3AN1A 2K8BA 1XT9B 1F2RC 2IYDB 4PS7A 2BB6A 1QKZA 3Q8AA 1FCCC 1WGYA 3A1QA 3O65B 4GOCA 4AUQC 3H7PA 2WXGA 1T6BX 4O1NA 4GXBA 1C79A 2ASQA 4C4VB 1FRRA 1D3ZA 1T0YA 1CMXB 2M8SA 1KH0A 2KD0A 3I57A 2C7MB 3LDZE 4KKJA 3NZ3A 3BVGA 4PS3A 4HJGE 2JF5A 5LNK1 1L5PA 3D32A 3CF6E 3CSTA 2BYEA 2O6VB 1AARA 4XDDA 5KHQA 1FMAD 4II3B 2RGFA 3RD2A 1GT8A 2OEDA 3AE7B 1I35A 2NMQA 1KLGD 1YD8U 4NJCA 3PZ8A 1C78A 2N9PC 1SXTA 2WU5B 2QHOA 4BVUC 5E6NA 3V6EB 2G9HD 1P1AA 3OJ3A 4N6EB 4LJOB 2BYFA 2BT6A 2MP2B 3A1QB 2XNAC 3Q8EA 4PYUA 5AZGA 5BYQA 2PVOD 1VR9A 3Q3OC 4TSSA 4MSMB 1A70A 2W3RA 2BYTA 1SGHA 3ZRCA 5E6PA 1NENB 3QQ8B 4ICUA 1OEYJ 4GU2A 4OVUA 4HRSA 3ZJTA 2Y5BB 3T3OA 2J0MA 2A5UA 2WXOA 4EEWA 1E8WA 1MG4A 2WXIA 2CS4A 1B1ZA 4DHJB 3ZQ4A 4IWQA 2INDC 3W9CB 5CHVC 4LDTD 4LLGM 1GOZA 3X0WA 3DBHI 2JWZA 2W82A 3PRPB 2BS4B 1UNSA 4KIKA 4BOSC 4JWUC 1E8ZA 3QAQA 3A9JA 1XQQA 3Q6BA 2G4SA 4GSWA 3HK0A 1GC7A 2N7DA 2V3NA 4GGQA 1TS4A 3RFZB 3LXFA 1U4AA 4OVZA 4E3CA 4GB9A 2D3BA 2IO1B 3ETRA 3GE8C 4EUTA 2LUEA 3L08A 3DHIC 3RYTA 2WXJA 4BFRA 3KUCB 4YT0B 3JSVB 2JX5A 4CO7A 4WWMA 3U8ZA 3RCZA 4K1RB 4RM8A 4WJQA 4DXFA 3NJTA 2J0JA 2WP9B 1TS3A 3APDA 2JVCA 4M8NA 1N61A 4WJPA 3VR8B 1S1QB 2KMCA 4LCDE 2IGDA 3I63C 4MH0E 4OW0A 1HEZE 1IBXB 3EA6A 4TKNA 3ZRFA 1YJJA 1GTHA 2LHDA 3U52E 1VZ7A 2DZMA 3APFA 2N7EA 3KLSX 1Q1OA 4DWFA 2FUHB 2RPQA 4WWNA 1WR6E 4KIKB 3KW5B 4C7YA 2WWZA 3V61A 4NNJB 2N9XA 5G5GA 3A9JB 4EZJA 1SSNA 3AU4A 2MBOA 4S0RA 1KLVA 1YQBA 1WXVA 3K9PB 3O13A 4L2YA 3HM6X 1V2YA 4WWPA 3PLVA 3Q8BA 3EFCA 1ZW7A 3GB1A 1ZGUB 4KDLB 1IYFA 2LJIA 4AQ7A 1TY0A 2HJ8A 4A3OA 3C0RB 2ZZPB 1XEEA 1FRDA 2R2OA 3URYA 1C1YB 1N5XA 2RMMA 1V80A 1TKEA 5C2TB 4L23A 2LRUA 4YSYB 2D2QA 1FEHA 3NZSA 4IW0A 2K39A 3QIJA 4F8CB 3VTWA 2K9XA 2L83A 1TBEA 2VRRB 2IY1B 2CU1A 1WM3A 5CTRC 4HDOA 4MJSB 2GMIC 3MJ5A 1ZPSA 4FN2A 3E9SA 1KFYB 2L1AA 2Q5WD 3DWGC 4AOFA 1SE4A 1DOIA 4P16A 4IM3A 3C8YA 2VH2A 1PGXA 4BKSA 3QARA 2DAFA 1JRPA 2JRHA 4FJYA 2D11A 4HDQA 1MG8A 3TEXA 1WSPA 1KF6B 1GG3A 2W55A 5IKCM 2GLSA 2K8CA 2WXPA 3Q8FA 3W1SA 3B1LX 1E10A 3VUYA 1D6EC 4RGOS 2G45B 1EWCA 3DBHB 3PO0A 1B9RA 1P3QU 3ML9A 2KNBA 3J9CA 2EKEC 4N58A 4LNFA 1V49A 2NVUI 3C19A 4USAA 3VRBB 2CR5A 5L83A 1WE7A 1JWUD 4BKGA 2LASA 2LXAA 4ACFA 1GAQB 5IO9A 3DWMA 2V0GA 2GRIA 3AULA 1MFWA 5HKHA 1P7FA 2Y5CA 3P1MA 2JRIB 5DPTA 4JGHB 2JZPA 3GZNI 3BVZA 1PUTA 1R7SA 4HXDA 4NJ7A 2KO3A 4EZKA 4PS8A 1JWAD 4BBNF 3AEBB 5I4DA 4FLHA 2K3UA 1Q0WB 4HCPB 3NVYA 1M94A 3ABVB 1XLPA 4AWJA 3KH0A 4MACA 4I6NB 3R3MA 4W9DA 1Z2MA 3ZJVA 1SJED 4JWSC 1YNTE 4XE0A 1WRIA 4ZOHC 3VUWA 4GDLB 3UGBB 4C00A 3SD5A 1JQ4A 2SEBD 3PRMB 3TUOA 1QOBA 4MSQB 2Z0EB 4ARIA 3P4PB 1L0VB 3VH3B 2QCZA 1MVKA 2O2VB 1K8RB 2KDBA 1WMHA 1FFVA 2O6VD 2I2YA 2M17A 5G55A 3JVZX 1EF5A 3DVNU 4XGAB 3QCAA 2OHFA 3QWZB 4W9FA 2LMCA 3PVLA 2BQQA 3L13A 4HPLB 2NCNA 2HTHA 2M4NA 1Z5SB 2OOBB 3W1YA 1XCTL 2KWVB 1L4ZB 3BWUD 3ECIA 2IJ0A 3HIZA 2WDTB 4EFOA 1H4RA 5CHFA 1FNUA 1E7UA 2DLBA 1IP9A 3RULA 1C4AA 4K7SA 2V1YA 2KJ6A 2KX3A 3E56A 3S2AA 1K53A 4OZCA 1E7PB 1I4RA 4OZAA 2KFKA 3GS2A 4DXGA 4TV3A 4RMAA 2KVZA 4DHJD 2N9LA 3P4RB 3U2SC 2WDQB 3RZWC 2MJEA 1TZ1A 2KTRB 1ACCA 4G50A 1MHHE 1N6ZA 3ZXVA 1SE2A 4TMAB 2PLPA 4RF0A 1T0RC 1OGWA 1V1PB 2BBCA 3Q3JA 4KDIC 5HI1A 1UGMA 4P1BC 5EE3A 1TKGA 1ZE3D 4YSZB 5C23A 2AYOB 1D5XC 2KJRA 1H7WA 4FXCA 3V60A 4TUUA 1QOGA 4MGIE 3LB8C 1J19A 1I4PA 3ZJUA 3HHMA 1T0SC 1YX6B 3LJ3A 3ZNHB 5H8YE 2QIEB 4IG7B 1IUEA 4Q2JA 4ZRQA 1V5OA 2BGFA 4HVBA 2LUMA 1N60A 2M0XA 4WQOB 2WXRA 3HVZA 5D3DA 2AX5A 2KFKB 2GBNA 1YN3A 1WJ4A 2KQ7A 1SIFA 2V3PA 4IOIE 3RNAC 1WWTA 3U7ZA 1H8CA 1P7EA 1UGJA 3ENEA 2C9WB 3JW0X 2LVQA 2MQJA 2ZNVB 5IOIA 3HVDA 4IDIA 3VTVA 3DBRI 2K0PA 3T8MA 4DK5A 1JROA 5D7GA 4M0WA 2ZCBA 4LNOA 1HA5A 4KX6B 1AN8A 4OHJA 2E3TA 2QC8A 4WQMA 4K7UA 2PE6B 4KVGB 4IWOA 3DCGA 4ZRPA 3MHSD 1UD7A 2EELA 1WH3A 1I42A 3TMPB 5GXGB 2GBKA 5DPSA 4MDKE 2H88B 1XLOA 2AQ3B 3ZGZA 4CHKA 3VVWB 1FO4A 4NJ6A 3DQVA 4ZHPA 1FD6A 2K6QA 1YQ4B 1L0XB 1ZOYB 3EUB2 5AUKA 1RRBA 4RGNA 3PHWB 3M63B 5DPRA 3ZTCA 2IGHA 1TS5A 3P4SB 2D10A 3VDZA 2WYQA 2N1VA 2JXXA 4QAYA 5D3IB 3A4RA 5TSSA 3RNGC 4HLEA 2DYBA 5LXIB 2LVOA 3QC8B 3RNEC 1YOVB 1XO3A 3R7RA 1PGBA 3Q2AC 2IO0B 2DX5B 3AE2B 1JRUA 2WXFA 4F1SA 4NQKE 1WFYA 5FR6A 4HPPA 3DBSA 1ZDVA 2KZRA 4FULA 3MC0B 1F0ZA 4FJZA 2KT7A 1VDVA 2AQ1B 2PPHA 2KLGA 3B9JA 3UIOB 4DHZE 4E74A 1TIFA 3PHXB 3H7PB 2DHZA 3SDLC 1RFAA 1RM6C 3KWVA 1L6UA 2BKFA 1N5WA 3RNFC 1TT5B 3DBLI 1JWSD 3UF8A 1UH6A 3PRZA 2VH1A 1SE3A 3AEAB 4LNKA 1WXSA 5C3JB 4MGKE 4M00A 1X1MA 3CF4A 4KZ0A 2QEJC 3ZNID 2WXNA 2PEAA 1XCQL 1WX8A 1KM7A 1NI3A 2GOWA 2W9NA 2ZCCA 3N30A 2MBHA 2MJ3A 3APCA 3BVMA 4II2B 4BKSD 2YEPF 4DHZB 5JZEB 3T3NA 2K22A 3SFDB 5AZHA 1KRHA 1YX5B 3U7DA 3RPFC 3VAWA 2V4IB 3PLUA 4ZYNA 3B08A 3TEWA 3RUIB 1M4VA 1VZ6A 3AEGB 3TBLD 3DHGC 5E6OA 1L2NA 3A9KA 3AE4B 2R61A 3AU5A 2WXKA 1SF0A 3Q14C 5AEKB 4NQLB 2FCQA 2ZW0A 2PKOA 3OAWA 2MJDA 2W54A 2CHXA 3K9OB 1A5RA 2D3AA 3AM9A 4RM9A 1TTNA 4LK0M 3V05A 1OTRB 2H89B 3VTUA 4GIVA 3B2GA 4A6QA 3DBRB 2QILA 3VFKA 2FNJB 3WAPA 4B9KA 2M19A 2ZVNA 5AZFA 2MRPA 1GB4A 2NBWB 2KDEB 1YMHE 3BK1A 1ROEA 1C9FA 3OWEB 5IAAC 1FNVA 3NVZA 1GPXA 1ZDXA 1WX7A 2IY0B 3IFWB 3RI7C 2AL3A 4ZDVA 3PV1A 5JXVA 1JWMD 4S17A 4B0EA 1E6EB 4JL9A 2UYZB 3NG0A 2WNMA 1L0YB 3RMKC 3R66C 1R4NI 3ZKJC 2ZEQA 1L4DB 3BIID 3TEYA 4MT5A 2J0KA 1HZ5A 4KGRA 5T8IA 4W9LA 5BMGA 3RN9C 4ICVA 3M62B 3VUXA 4EOYA 3AMZA 2N9KA 2KKCA 3MTNB 3I5JC 5LLIA 1J7AA 2N9EB 1ESFA 2PW9A 1I4HA 2GB1A 2WHIA 2LJ5A 3TCAA 4R3DA 4G0NB 2HDEA 2KMMA 3FAHA 3MFGA 1E8YA 2ZNVC 2MX2A 3RNCC 2Z59B 2KAJA 1QT9A 5IN7A 2KQ4X 1CJEA 3PREA 4M01A 2BS3B 1EWYC 1V6EA 1WIAA 1I7HA 4ZRJA 1I4GA 2CJOA 3DVGY 3EECA 4AP4C 2LRWA 3FC4A 3ZW3A 4N9F4 2IZVB 2KMAA 2BF8B 1CK1A 2M56B 3SR6A 4MEMA 3MHZA 3CMMB 4GDKA 1XD3B 1J0GA 1RLFA 3DBLB 4GLSC 1LFDA 2INNE 2NTTA 3WA0A 1STEA 4MM3A 4N59A 1FIQA 2JXTA 4BZAA 1VRAB 2BW2A 1JCKB 3ML8A 3DDCB 4KSKC 2NS5A 4YWGG 4PK1A 1K52A 2ONQA 1WE6A 2ICIA 1TZOA 2KHWB 2RR9A 2AQ2B 2D3GA 1YN4A 2EKIA 1V97A 3N1XC 1EF1A 2RDGA 3NRZA 3ZDMC 3MC8A 1JMLA 2WLBA 2ON8A 4LJPB 2LHEA 4WAFA 2XBBC 1OEYA 3ZNGC 2BKRB 2V3SA 3BINA 1DGJA 4AJYB 3AE1B 3IVFA 3OLMD 1WGGA 2K1FA 2ACZB 3MP9A 2KWCA 5MPOA 1BXTA 4RGTA 2C7HA 1WJUA 2INPE 2D07B 1T5XD 3PZ7A 1Y8RC 4ZRKA 1ZUD2 5CX3A 3CWIA 3EGRA 2NBUA 4A55A 3BYYB 2N7JA 1OQYA 1N62A 2WDRB 2BWFA 3M3JA 1SJHD 2FAZA 4MH8A 3U30A 3AECB 1WGHA 2JUOA 2XK5A 1WJ6A 3SU8X 2K6DB 4B0MA 4ITKA 2HTME 1JALA 4MGZE 2KQSA 2BPSA 3P2BA 4FADA 2PVGC 4ZYSA 4JX1C 4REZA 1JW9D 4XWTA 4MELA 3V62A 2W3SA 4ANUA 1SB3C 4EZLA 2DAJA 1EUVB 2K5PA 1R4NB 2C7NB 1HXYD 2NPTA 4KGSA 4W9EA 4ARCA 2X38A 2KACA 1UWXA 1LO5D 3FILA 2LFIA 3DPDA 3TSSA 1MI0A 4WURA 1AYFA 4P7IA 3NZUA 3RNBC 1YQ3B 2M1MA 3AB5A 3DOWA 5H92C 1C4PA 1H7XA 2IGGA 3UINB 5BMIA 2IPKD 2I1KA 1I4QA 2Y5PA 4W9GA 1EU4A 2FCNA 2NTSA 3ZDTA 1E9MA 3ZYYX 3R7QA 2XK5B 4PT5A 2MBBB 1MHXA 4GMVA 1Q5WB 4XZ4A 3N32A 1NI2A 2E6XA 2LGXA 2BTEA 4KZCA 3AE6B 5FKAC 1J7CA 4M02A 1WMHB 3EC8A 3JYUA 3WIMA 2MBQA 3R2IA 3UI3A 1WGKA 3FKYA 4BBNC 1E0ZA 2REXA 1EU3A 3B0AA 1ZXHA 2CHWA 2M0AA 3ZXRA 4KV2A 2RD0A 1PYWD 2XN9C 2DBYA 3TIXA 2QJLA 2DNFA 3VQIA 3BZDB 4NPNA 1K50A 2JZ3B 3HRDD 5JHBA 1LQBA 1WZ3A 3IAS1 1IGDA 3EHVA 2KLCA 2OJWA 2K25A 3H6NA 3AE8B 1IPGA 1MJDA 1WRDB 4M8MA 3N3KB 1SEBD 2MLBA 1LXDA 1NEKB 3KWLA 2KDFB 4J6IA 3RZFA 1V5TA 4I6LB 4K81A 3NS8A 4ANWA 4FHKA 2YEPB 1YN5A 2MEKA 1LGRA 1XLNA 2ZPYA 2AWTA 4K7WA 1MPEA 3KUZA 2J7QB 2IO2B 4IM0A 5GMVA 4ANXA 3GZNB 1VCBA 1BUIC 2Z0DB 2WX0A 3H7SA 1TS2A 2FE8A 2ZPNA 3GOEA 4C4VA 2MCNB 3TL5A 2DWQA 2KDMA 3L4PA 3ZTDA 1GUAB 2MSED 5BMHA 1XLQA 4US8A 1DOYA 2CJNA 1V81A 4KKIA 1QF6A 5EDSA 4LNNA 1GJZA 4JIOU 2FCSA 1V8CA 5AUIA 3VRAB 2DZJA 1KJTA 3N20C 3ALBA 3P4QB 1R4MI 3AE5B 2LVPA 1C77A 2K8HA 3QK0A 2HE7A 3WCQA 2DYOA 2DZIA 1D5ZC 5G5HA 3M95A 4HPMB 4ASWC 2MP2A 4BAXA 2WXQA 2LEKA 1YJ1A 1UELA 3UQBA 2JQRB 4XYCA 1GC6A 3IAM1 4CQNA 2GBMA 1HE8A 1AWDA 2IO3B 3IG3A 2LXCA 1BMLC 2L32A 1I4XA 3KUDB 1P9DU 1WXMA 4M0WB 4C56C 3BK2A 4MGYE 1SIJA 3SHQA 4UDUC 2JY6A 3X23A 2QMTA 2GI9A 2IBIB 3PSEB 2L7RA 2MW5A 1DOXA 1J7BA 1F1HA 2JU6X 4WWOA 2HJ1A 2VZKB 1S3SG 2QDFA 3ZNZB 1WYGA 3VH4B 2WXHA 2LGSA 3H1UA 1TY2A 3N1YC 4HCNB 1Q10A 2RDBC 2CHZA 4RGMA 4NY0A
chains in the Genus database with same CATH topology
4HEA1 4XWWA 3H8HA 4MACA 3CIRB 3AMZA 2N9KA 3IXSA 3NVVA 3ZJVA 1SJED 4JWSC 1FXAA 1YNTE 1J7AA 1WRIA 4XE0A 4ZOHC 1ESFA 2PW9A 2FBWB 4GDLB 1I4HA 2GB1A 1JQ4A 2SEBD 3TUOA 1IGCA 2J4XA 1QOBA 5EE0A 4H2AA 4DQOC 4R3DA 4WIPA 3VR9B 2HDEA 2KMMA 3P4PB 1L0VB 3FAHA 3MFGA 3BYTB 4XDCA 4ARIA 2IDYA 1MVKA 3U4EG 1CZPA 3W5VB 1F2RI 1FFVA 2B76B 2I2YA 2KAJA 1QT9A 3HUIA 2JSVX 2SAKA 2KQ4X 4J3OD 1CJEA 2BS3B 2OHFA 1EWYC 5BYSA 1HQRD 2LMCA 5EE9A 5FR3A 1HZ6A 2RDHA 1I7HA 4NAMA 3IT4B 1I4GA 2CJOA 1V1OA 1QLBB 3FC4A 1IBXA 1PDXA 4A8XC 1KLUD 1VLBA 1QOFA 1CK1A 1XCTL 2M56B 3SR6A 4C80A 3BWUD 1L4ZB 3MHZA 2IJ0A 4YSXB 3IT6B 2TSSA 4A90A 4HKZE 4GLSC 1RYJA 2NTTA 2INNE 1STEA 1FNUA 1PGAA 1D4BA 4N59A 4US9A 2J53A 1NYQA 1FIQA 2DLBA 1XF5L 3AEDB 2JXTA 4WH4A 2BS2B 4YTPB 1VRAB 5HFYA 1C4AA 2BW2A 4YXDB 1JCKB 3AN1A 1F2RC 2BB6A 1QKZA 4JE3B 3Q8AA 3E56A 2WDVB 3TEZA 1K53A 1FCCC 4OZCA 1E7PB 4YWGG 5HG2A 1I4RA 1K52A 4OZAA 2ONQA 1ET6A 1N63A 3GS2A 2ICIA 1TZOA 4DXGA 2WXGA 1T6BX 1XXGA 2AQ2B 4O1NA 4TQ1A 1C79A 1YN4A 2EKIA 1NYRA 1V97A 2N9LA 3P4RB 3U2SC 2WDQB 1FRRA 2RDGA 2MJEA 1NVID 3LYYA 3NRZA 1QQRA 1JMLA 1ACCA 1MHHE 1KH0A 2LHEA 2ON8A 2WLBA 4WAFA 2D5GA 5E6JA 2N0SB 3I57A 1SE2A 4KKJA 3NZ3A 3BVGA 1QILA 1DGJA 4TMAB 2PLPA 4RF0A 3AE1B 3NVWA 4HJGE 1V1PB 2BBCA 5LNK1 5HI1A 1L5PA 1OQRA 2ACZB 3MP9A 1FCLA 5MPOA 1BXTA 4RGTA 5EE3A 1TKGA 1ZE3D 4YSZB 2INPE 1D5XC 4XDDA 2Z8LA 1H7WA 4FXCA 1T5XD 3PZ7A 1FMAD 1GT8A 1QOGA 2OEDA 3LB8C 3AE7B 2NMQA 1KLGD 1I4PA 1ZUD2 2G1EA 3ZJUA 3CWIA 2WXMA 4NJCA 3EGRA 1FXIA 5H8YE 4JPSA 4A55A 2QIEB 3PZ8A 1C78A 1IUEA 4Q2JA 3BYYB 1SXTA 4ZRQA 2WU5B 2N7JA 1N62A 2WDRB 1SJHD 4MH8A 3AECB 2LUMA 1AW7A 1WXQA 2G9HD 1N60A 1DYQA 4N6EB 4B0MA 3P42A 4ITKA 2BT6A 2WXRA 3HVZA 2HTME 1JALA 2XNAC 3Q8EA 5D3DA 2AX5A 5BYQA 1ET9A 2PVOD 1VR9A 3AEFB 4TSSA 1YN3A 1A70A 2W3RA 1UWMA 2BYTA 2V3PA 1VJKA 2BB5A 4IOIE 2PVGC 3Q69A 1NENB 1WWTA 3U7ZA 1P7EA 4JX1C 4REZA 4ZYSA 1JW9D 4XWTA 1UGJA 3AH7A 2J52A 4HRSA 3ZJTA 3T3OA 2W3SA 3P63A 3HVDA 2WXOA 4IDIA 2RPVA 1SB3C 2WXIA 1B1ZA 3ZQ4A 2K5PA 2PTLA 2PMVA 2K0PA 1HXYD 1TKYA 3W9CB 4KGSA 4LLGM 1JROA 1OFFA 1GOZA 5D7GA 2X38A 4M0WA 2KACA 4ARCA 1HA5A 4KX6B 1UWXA 1LO5D 1AN8A 3FILA 2LFIA 2W82A 4OHJA 1MI0A 2E3TA 4WURA 1AYFA 3TSSA 4WQMA 2BS4B 5FK9C 1UNSA 1YQ3B 3AB5A 4ZRPA 5H92C 1C4PA 4JWUC 1H7XA 2EELA 2IGGA 5BMIA 2IPKD 1I4QA 2Y5PA 5GXGB 4RF1A 2JYTA 2H88B 1EU4A 4HKQA 3NUHB 1XLOA 2NTSA 1TS4A 2V3NA 3RFZB 1E9MA 3ZYYX 3LXFA 4LTUA 3V3XA 4OVZA 2AQ3B 4PT5A 3ETRA 1MHXA 3ZGZA 2Y3AA 2E6XA 1FO4A 2BTEA 4ZHPA 1FD6A 2WXJA 4YT0B 2JX5A 1YQ4B 3AE6B 1L0XB 4WWMA 5FKAC 1J7CA 1ZOYB 4IKGA 4DXFA 2WP9B 3EUB2 5AUKA 1TS3A 4HROA 4RGNA 2KWDA 3R2IA 3UI3A 1WGKA 1E0ZA 2IGHA 1GTEA 1TS5A 1EU3A 4TQ0A 3P4SB 1N61A 4AS1A 1ZXHA 2JYEA 4YTNB 3VR8B 4EE2A 2M0AA 2IGDA 1C76A 4OW0A 5D3IB 2J42A 5TSSA 1HEZE 1IBXB 4P6VF 3AE9B 3EA6A 1RFKA 1YJJA 1GTHA 1PYWD 2XN9C 2DBYA 2LHDA 1EM7A 3U52E 2QJLA 1VZ7A 1XO3A 4RH6A 4GDKB 3VQIA 3KLSX 1PGBA 3BZDB 3AE2B 2WXFA 1K50A 4C7YA 1TYGB 4RNAA 3HRDD 5G5GA 1SSNA 4MM3B 3IAS1 1IGDA 1ZDVA 3O13A 1FNWA 1KTKA 2DYMA 3MC0B 3Q8CA 4L2YA 4C7ZA 1F0ZA 3AE3B 3AE8B 2AQ1B 1VDVA 2KN4A 3Q8BA 3B9JA 3GB1A 1SEBD 2LJIA 4AQ7A 1NEKB 1TY0A 3KWLA 4YTMB 1RM6C 3KWVA 1ZP0B 2CU3A 1L6UA 1XEEA 1FRDA 1N5WA 1JWSD 3URYA 2YEPB 1C4CA 1YN5A 1N5XA 2L52A 2LGIA 2MEKA 3SEBA 1XLNA 2RMMA 1MPEA 1RWSA 1TKEA 5C2TB 1SE3A 4L23A 3AEAB 2ZW1A 5C3JB 1BUIC 4YSYB 1TS2A 3CF4A 2FE8A 1FEHA 2QEJC 3B2FA 4RFBA 2DWQA 2KDMA 3L4PA 2WXNA 1XCQL 1ZXIA 2K9XA 2L83A 1NI3A 5BMHA 2VZKD 2MJ3A 1XLQA 3BVMA 1V1PA 4US8A 2YEPF 1TJEA 3MJ5A 1ZPSA 3T3NA 2QSDA 3E9SA 1KFYB 2WXLA 2K22A 2L1AA 3SFDB 1DOYA 2CJNA 2Q5WD 3DWGC 1KRHA 4KKIA 1QF6A 4NAWB 3RPFC 1SE4A 1DOIA 2V4IB 4P16A 3C8YA 3TEWA 1D5MC 1M4VA 1PGXA 1VZ6A 2MH7A 1JRPA 3AEGB 2WU2B 1V8CA 3I9V1 5AUIA 1L6VA 3AE4B 2R61A 2WXKA 3VRAB 1SF0A 3W5UB 3P4QB 2ZW0A 2PKOA 3N9YC 2MJDA 1K51A 2W54A 3AE5B 3NS1A 3TEXA 2PIAA 1SBBB 5EE1A 3AM9A 1WSPA 1KF6B 1C77A 4A9AA 2W55A 3R2TA 4KGTA 4LK0M 3WCQA 1FM0D 2DYOA 3V05A 1D5ZC 5G5HA 4D2KA 1Y56A 2H89B 2WXPA 3Q8FA 3B2GA 3W1SA 4A6QA 1JWBD 1E10A 2QILA 2WXQA 2LEKA 3KQ4A 1D6EC 4RGOS 3R8BA 3W2DA 1EWCA 2JQRB 2JWUA 3IAM1 4CQNA 3PO0A 1B9RA 1AWDA 2WQYB 3J9CA 4N58A 1BMLC 2L32A 1I4XA 4NZLB 4RCOA 2M19A 4OZBA 1PFDA 1GB4A 1VZ8A 1YMHE 4C56C 3BK1A 1ROEA 3BK2A 1C9FA 4USAA 3VRBB 4ZHOA 1F77A 5HHDG 3AV8A 4L1BA 3FILB 3OWEB 3SFEB 1FNVA 3NVZA 1JWUD 1SIJA 1YJIA 1GPXA 4UDUC 1ZDXA 1CQVA 1GAQB 2QMTA 3DWMA 2V0GA 2GI9A 5JXVA 2GRIA 1JWMD 4B0EA 1GB1A 1E6EB 1P7FA 2I38A 2Y5CA 3P1MA 1DOXA 2WNMA 1J7BA 1L0YB 2JZPA 2JU6X 1ENFA 2FUG1 2VZKB 1OQQA 3BVZA 1PUTA 1WYGA 1L4DB 1R7SA 1FFUA 3BIID 1UUPA 2WXHA 3TEYA 5BYRA 4MT5A 2WS3B 1TY2A 1QOAA 1JWAD 1HZ5A 3GP7A 3AEBB 1T3QA 1Q10A 5I4DA 2K3UA 4KGRA 5T8IA 3NVYA 5BMGA 4RGMA 3AEEB 3ABVB 1XLPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3AE1 B;  3NVW A;  3L4P A;  1ZXI A;  2K9X A;  3ETR A;  3CIR B;  2L83 A;  1L5P A;  1OQR A;  2ACZ B;  1NI3 A;  3AMZ A;  3NVV A;  5MPO A;  1FO4 A;  5EE3 A;  4JWS C;  4ZHP A;  1TKG A;  1FXA A;  4YSZ B;  2MJ3 A;  1XLQ A;  4US8 A;  1J7A A;  4YT0 B;  1H7W A;  1TJE A;  1WRI A;  4ZOH C;  2JX5 A;  2FBW B;  1YQ4 B;  3AE6 B;  4FXC A;  4WWM A;  1KFY B;  1FMA D;  1J7C A;  1JQ4 A;  2K22 A;  1GT8 A;  1ZOY B;  1QOG A;  3SFD B;  1QOB A;  2CJN A;  5EE0 A;  2Q5W D;  3DWG C;  3LB8 C;  1DOY A;  3AE7 B;  1KRH A;  2WP9 B;  3VR9 B;  2KMM A;  3P4P B;  1L0V B;  1ZUD 2;  2G1E A;  3EUB 2;  3FAH A;  5AUK A;  3CWI A;  3RPF C;  1QF6 A;  4HRO A;  1DOI A;  1CZP A;  1WGK A;  1FXI A;  3W5V B;  1E0Z A;  5H8Y E;  1GTE A;  1FFV A;  1JRP A;  2MH7 A;  3AEG B;  3P4S B;  1N61 A;  2B76 B;  2WU2 B;  1IUE A;  2QIE B;  1V8C A;  2WU5 B;  1QT9 A;  2KAJ A;  1L6V A;  4YTN B;  3AE4 B;  2WDR B;  3VR8 B;  1N62 A;  3HUI A;  1CJE A;  3VRA B;  1SF0 A;  3W5U B;  3AEC B;  2BS3 B;  2OHF A;  3P4Q B;  1EWY C;  1WXQ A;  3ZYY X;  2PKO A;  4P6V F;  5EE9 A;  3AE9 B;  1N60 A;  2MJD A;  2W54 A;  3AE5 B;  3NS1 A;  4N6E B;  1RFK A;  1YJJ A;  1GTH A;  2PIA A;  1I7H A;  4ITK A;  2BT6 A;  2DBY A;  3AM9 A;  5EE1 A;  3HVZ A;  1KF6 B;  2CJO A;  2QJL A;  1XO3 A;  1JAL A;  2HTM E;  4A9A A;  1QLB B;  2AX5 A;  2W55 A;  2PVO D;  3FC4 A;  3AE2 B;  3AEF B;  1FM0 D;  3WCQ A;  1A70 A;  5AUI A;  2W3R A;  5G5H A;  2DWQ A;  1UWM A;  2H89 B;  1PDX A;  4C7Y A;  1TYG B;  1VLB A;  1VJK A;  3B2G A;  1QOF A;  2M56 B;  1JWB D;  3HRD D;  3SR6 A;  4C80 A;  5G5G A;  1E10 A;  2PVG C;  2LEK A;  1NEN B;  1WWT A;  4LTU A;  4YSX B;  4JX1 C;  3B2F A;  2JQR B;  1JW9 D;  3PO0 A;  1B9R A;  1AWD A;  3AH7 A;  4HRS A;  2WQY B;  1RYJ A;  2W3S A;  4C7Z A;  4N58 A;  3P63 A;  1F0Z A;  2M19 A;  3AE3 B;  3AE8 B;  1VDV A;  4IDI A;  1PFD A;  4N59 A;  4US9 A;  1SB3 C;  1NYQ A;  1FIQ A;  3AED B;  2BS2 B;  4YTP B;  1ROE A;  3B9J A;  4USA A;  3VRB B;  2K5P A;  4ZHO A;  3AV8 A;  4YXD B;  3AN1 A;  3SFE B;  1TKY A;  3W9C B;  1NEK B;  1SIJ A;  1YJI A;  3KWL A;  3NVZ A;  1GPX A;  4YTM B;  1JRO A;  1OFF A;  1RM6 C;  1ZP0 B;  1GAQ B;  2WDV B;  2CU3 A;  3DWM A;  4KX6 B;  1L6U A;  1FRD A;  1E7P B;  1N5W A;  2E3T A;  1AYF A;  1N63 A;  2BS4 B;  4WQM A;  1N5X A;  2L52 A;  1E6E B;  2Y5C A;  1YQ3 B;  1XLN A;  3P1M A;  1DOX A;  3AB5 A;  1J7B A;  5H92 C;  4JWU C;  1H7X A;  2EKI A;  1NYR A;  1V97 A;  3P4R B;  1RWS A;  1OQQ A;  2WDQ B;  1FRR A;  5C2T B;  1PUT A;  1TKE A;  1R7S A;  3AEA B;  1FFU A;  1NVI D;  1WYG A;  2MJE A;  3BII D;  3NRZ A;  2WLB A;  5C3J B;  5GXG B;  2WS3 B;  1QOA A;  1JWA D;  4YSY B;  2N0S B;  3CF4 A;  3AEB B;  1T3Q A;  2H88 B;  3NVY A;  1XLO A;  1E9M A;  3AEE B;  3LXF A;  1DGJ A;  3ABV B;  1XLP A; 
#chains in the Genus database with same CATH topology
 1G6J A;  3W1S C;  5IA7 A;  3N1Z C;  4DDI D;  2LGD A;  1FXA A;  1UZX B;  1VD2 A;  2PJH A;  3OJ4 B;  3GE3 C;  2FBW B;  4F7Z A;  1IGC A;  5TR5 A;  3UQA A;  2J4X A;  1LM8 B;  4WIP A;  2MA9 B;  3JSV A;  2IDY A;  1CZP A;  2FCM A;  3W5V B;  1F2R I;  4WAA A;  2C5L C;  2WGS A;  2JSV X;  2GBJ A;  1V9J A;  4I6P A;  2MWS B;  1HQR D;  5EE9 A;  4A20 A;  5FR3 A;  1HZ6 A;  2RSU A;  1WGD A;  2RDH A;  2EMT A;  3WAO A;  4G11 A;  1WF9 A;  3IT4 B;  4IC7 B;  1V1O A;  1ISN A;  1IBX A;  4IUM B;  3I3T B;  2D3C A;  4HWI B;  1PDX A;  4W9H A;  1QOF A;  2KK8 A;  4C80 A;  3RT3 B;  4B6W A;  1E8X A;  3A4S C;  3IT6 B;  4HKZ E;  1WXA A;  1RYJ A;  3ONS A;  2XEW A;  1PGA A;  1D4B A;  1UF0 A;  4US9 A;  5D94 A;  2R2Q A;  2J53 A;  3HM3 A;  4WH4 A;  4JE3 B;  2UWQ A;  2WDV B;  4W9I A;  3TEZ A;  5HG2 A;  1ET6 A;  1N63 A;  3AI5 A;  4HK2 A;  1QZE A;  1XXG A;  4TQ1 A;  1NYR A;  2OJR A;  4FJV B;  1NVI D;  3LYY A;  2KYW A;  1QQR A;  2L05 A;  2D5G A;  5E6J A;  2N0S B;  4KSL C;  4FA6 A;  2YLM A;  1QIL A;  1HTO A;  3NVW A;  2B3A A;  4XC2 A;  2N4F A;  2JZZ A;  1WX9 A;  1OQR A;  4JLC A;  2KWU B;  1FCL A;  1FXT B;  2UU7 A;  4URK A;  2LZ6 A;  2Z8L A;  1YIW A;  1R4M B;  4MJS A;  3A9K B;  2G1E A;  2WXM A;  2BVC A;  2L0T A;  1FXI A;  4B95 A;  4JPS A;  3NHE B;  2DEN B;  4OVV A;  5J18 A;  1AW7 A;  1WXQ A;  1DYQ A;  3P42 A;  2L76 A;  1ET9 A;  2BWE S;  2LWP A;  4AJW A;  3AEF B;  1UBI A;  2LD9 A;  5G2N A;  1UWM A;  1L7Y A;  3WAL A;  1VJK A;  2BB5 A;  4WJO A;  5IP4 D;  2KN5 A;  3Q69 A;  4BOZ B;  2ZVO A;  2JT4 B;  1BT0 A;  1T0Q C;  4IWP A;  3AH7 A;  2J52 A;  2KVR A;  3P63 A;  3L17 A;  4DBG A;  5DCN A;  2RPV A;  1PQS A;  3IHP C;  4PYZ A;  3MJW A;  2PTL A;  2PMV A;  3PGE A;  1TKY A;  4ZRI A;  5D6J B;  1OFF A;  4DDG D;  1WGR A;  2ZJD A;  1WR1 A;  4A3P A;  2MHJ A;  5FK9 C;  2FID A;  3L10 B;  3KYC D;  3PS6 A;  2V9H A;  1NDD A;  4RF1 A;  2JYT A;  4HKQ A;  1WI0 A;  3NUH B;  3PTF C;  1GNU A;  4LTU A;  3V3X A;  3A33 B;  2Y3A A;  1F52 A;  2G3Q B;  4W9C A;  3AXC A;  3UIP B;  4IKG A;  5JH5 C;  2KJH B;  1SE9 A;  4HRO A;  4GDL A;  2KWD A;  2FIF A;  3PT2 B;  1GTE A;  2KC2 A;  3CSF A;  4TQ0 A;  4AS1 A;  3ZO5 B;  2JYE A;  2MBE A;  4YTN B;  3Q3M C;  5CHW A;  4EE2 A;  2O2V A;  1C76 A;  2J42 A;  1TGZ B;  4G3X B;  4P6V F;  3TJP A;  3AE9 B;  3QHT A;  1RFK A;  4ANV A;  1WYW B;  1EM7 A;  4RH6 A;  4GDK B;  5JHA A;  2BYV E;  1TYG B;  2YVC A;  4RNA A;  4LDT B;  2KC1 A;  4MM3 B;  1E90 A;  4EKU A;  4K3C A;  1FNW A;  2KX0 A;  1KTK A;  2DYM A;  4NAW A;  3Q8C A;  4C7Z A;  5J17 A;  4K3B A;  3AE3 B;  2KN4 A;  2HD5 B;  3DVG X;  1KOT A;  1UBQ A;  3DHH C;  1J8C A;  3NOB A;  4YTM B;  1ZP0 B;  2CU3 A;  5L95 C;  4LNI A;  2LGY A;  4FHJ A;  1C4C A;  4HJK A;  2L52 A;  3SEB A;  2LGI A;  1NBF C;  3V6C B;  2JPH A;  1RWS A;  3WAM A;  1ZKH A;  2GBR A;  3IBE A;  1C3T A;  2ZW1 A;  1WY8 A;  1EO6 A;  3B2F A;  4RFB A;  4WJN A;  1ZXI A;  2KTR A;  2N1W A;  3QX1 A;  2VZK D;  2L0F A;  1F9J A;  4GN1 A;  1V1P A;  1TJE A;  2QSD A;  2WXL A;  2C60 A;  4IM2 A;  3KVF B;  4NAW B;  1D5M C;  2MH7 A;  2WU2 B;  3I9V 1;  3L0W B;  1L6V A;  2I1J A;  2NBV B;  2AEH A;  3W5U B;  3N9Y C;  2KXJ A;  3NS1 A;  1K51 A;  2KOX A;  2PIA A;  1SBB B;  5EE1 A;  2KAN A;  4A9A A;  3KYD D;  4BKT A;  3R2T A;  4KGT A;  1FM0 D;  1FPY A;  2INC C;  4D2K A;  1Y56 A;  4JQW C;  2WX1 A;  1JWB D;  2A4Z A;  5BO4 B;  3PZD A;  4W9K A;  3KQ4 A;  3R8B A;  3W2D A;  2NR2 A;  2JWU A;  3WAN A;  3L16 A;  2WQY B;  4YL8 A;  4NZL B;  4RCO A;  2NPT B;  4OZB A;  1PFD A;  1VZ8 A;  3MC9 A;  4ZHO A;  1F77 A;  5HHD G;  3AV8 A;  4L1B A;  3FIL B;  1RAX A;  3ZUN A;  3SFE B;  1YJI A;  1CQV A;  2KTF A;  5D2M B;  2G4D B;  5C1Z A;  3EFU A;  1GB1 A;  2I38 A;  3VXW A;  4DXA B;  3T9L A;  1ENF A;  1P0R A;  2FUG 1;  1OQQ A;  4P1C C;  1FFU A;  1UUP A;  2PE9 A;  5BYR A;  5J2R A;  4FBJ B;  2WS3 B;  1E5W A;  1QOA A;  2KFJ A;  3GP7 A;  1T3Q A;  3ZIM A;  3AEE B;  1P98 A;  4X57 B;  4HEA 1;  4XWW A;  3Q3N C;  3H8H A;  3CIR B;  3VHT C;  2V4L A;  3IXS A;  3NVV A;  1E7V A;  2AL6 A;  2KDI A;  3L54 A;  2L8J A;  2DZK A;  4DQO C;  5EE0 A;  4H2A A;  1WZ0 A;  3VR9 B;  4XDC A;  3BYT B;  3QA8 A;  4W9J A;  2LI5 A;  3U4E G;  3ZLZ A;  3OG5 A;  3Q3F A;  2B76 B;  3HUI A;  2SAK A;  1WM2 A;  4J3O D;  5DPW A;  2X8X X;  5BYS A;  4XX5 A;  3H9D A;  3ZVV A;  4NAM A;  1QLB B;  2O6V A;  3BY4 B;  4A8X C;  1KLU D;  1VLB A;  4YSX B;  2CKH B;  2L3Z A;  5KHO A;  1WJN A;  2TSS A;  3DVN V;  4A90 A;  1V86 A;  2EMS A;  1HTQ A;  3PPA A;  1NYQ A;  3NY5 A;  4CYE A;  1XF5 L;  3AED B;  4E71 A;  5LXH A;  2BS2 B;  4YTP B;  5HFY A;  2L00 B;  4YXD B;  3QJZ A;  3AN1 A;  2K8B A;  1XT9 B;  1F2R C;  2IYD B;  4PS7 A;  2BB6 A;  1QKZ A;  3Q8A A;  1FCC C;  1WGY A;  3A1Q A;  3O65 B;  4GOC A;  4AUQ C;  3H7P A;  2WXG A;  1T6B X;  4O1N A;  4GXB A;  1C79 A;  2ASQ A;  4C4V B;  1FRR A;  1D3Z A;  1T0Y A;  1CMX B;  2M8S A;  1KH0 A;  2KD0 A;  3I57 A;  2C7M B;  3LDZ E;  4KKJ A;  3NZ3 A;  3BVG A;  4PS3 A;  4HJG E;  2JF5 A;  5LNK 1;  1L5P A;  3D32 A;  3CF6 E;  3CST A;  2BYE A;  2O6V B;  1AAR A;  4XDD A;  5KHQ A;  1FMA D;  4II3 B;  2RGF A;  3RD2 A;  1GT8 A;  2OED A;  3AE7 B;  1I35 A;  2NMQ A;  1KLG D;  1YD8 U;  4NJC A;  3PZ8 A;  1C78 A;  2N9P C;  1SXT A;  2WU5 B;  2QHO A;  4BVU C;  5E6N A;  3V6E B;  2G9H D;  1P1A A;  3OJ3 A;  4N6E B;  4LJO B;  2BYF A;  2BT6 A;  2MP2 B;  3A1Q B;  2XNA C;  3Q8E A;  4PYU A;  5AZG A;  5BYQ A;  2PVO D;  1VR9 A;  3Q3O C;  4TSS A;  4MSM B;  1A70 A;  2W3R A;  2BYT A;  1SGH A;  3ZRC A;  5E6P A;  1NEN B;  3QQ8 B;  4ICU A;  1OEY J;  4GU2 A;  4OVU A;  4HRS A;  3ZJT A;  2Y5B B;  3T3O A;  2J0M A;  2A5U A;  2WXO A;  4EEW A;  1E8W A;  1MG4 A;  2WXI A;  2CS4 A;  1B1Z A;  4DHJ B;  3ZQ4 A;  4IWQ A;  2IND C;  3W9C B;  5CHV C;  4LDT D;  4LLG M;  1GOZ A;  3X0W A;  3DBH I;  2JWZ A;  2W82 A;  3PRP B;  2BS4 B;  1UNS A;  4KIK A;  4BOS C;  4JWU C;  1E8Z A;  3QAQ A;  3A9J A;  1XQQ A;  3Q6B A;  2G4S A;  4GSW A;  3HK0 A;  1GC7 A;  2N7D A;  2V3N A;  4GGQ A;  1TS4 A;  3RFZ B;  3LXF A;  1U4A A;  4OVZ A;  4E3C A;  4GB9 A;  2D3B A;  2IO1 B;  3ETR A;  3GE8 C;  4EUT A;  2LUE A;  3L08 A;  3DHI C;  3RYT A;  2WXJ A;  4BFR A;  3KUC B;  4YT0 B;  3JSV B;  2JX5 A;  4CO7 A;  4WWM A;  3U8Z A;  3RCZ A;  4K1R B;  4RM8 A;  4WJQ A;  4DXF A;  3NJT A;  2J0J A;  2WP9 B;  1TS3 A;  3APD A;  2JVC A;  4M8N A;  1N61 A;  4WJP A;  3VR8 B;  1S1Q B;  2KMC A;  4LCD E;  2IGD A;  3I63 C;  4MH0 E;  4OW0 A;  1HEZ E;  1IBX B;  3EA6 A;  4TKN A;  3ZRF A;  1YJJ A;  1GTH A;  2LHD A;  3U52 E;  1VZ7 A;  2DZM A;  3APF A;  2N7E A;  3KLS X;  1Q1O A;  4DWF A;  2FUH B;  2RPQ A;  4WWN A;  1WR6 E;  4KIK B;  3KW5 B;  4C7Y A;  2WWZ A;  3V61 A;  4NNJ B;  2N9X A;  5G5G A;  3A9J B;  4EZJ A;  1SSN A;  3AU4 A;  2MBO A;  4S0R A;  1KLV A;  1YQB A;  1WXV A;  3K9P B;  3O13 A;  4L2Y A;  3HM6 X;  1V2Y A;  4WWP A;  3PLV A;  3Q8B A;  3EFC A;  1ZW7 A;  3GB1 A;  1ZGU B;  4KDL B;  1IYF A;  2LJI A;  4AQ7 A;  1TY0 A;  2HJ8 A;  4A3O A;  3C0R B;  2ZZP B;  1XEE A;  1FRD A;  2R2O A;  3URY A;  1C1Y B;  1N5X A;  2RMM A;  1V80 A;  1TKE A;  5C2T B;  4L23 A;  2LRU A;  4YSY B;  2D2Q A;  1FEH A;  3NZS A;  4IW0 A;  2K39 A;  3QIJ A;  4F8C B;  3VTW A;  2K9X A;  2L83 A;  1TBE A;  2VRR B;  2IY1 B;  2CU1 A;  1WM3 A;  5CTR C;  4HDO A;  4MJS B;  2GMI C;  3MJ5 A;  1ZPS A;  4FN2 A;  3E9S A;  1KFY B;  2L1A A;  2Q5W D;  3DWG C;  4AOF A;  1SE4 A;  1DOI A;  4P16 A;  4IM3 A;  3C8Y A;  2VH2 A;  1PGX A;  4BKS A;  3QAR A;  2DAF A;  1JRP A;  2JRH A;  4FJY A;  2D11 A;  4HDQ A;  1MG8 A;  3TEX A;  1WSP A;  1KF6 B;  1GG3 A;  2W55 A;  5IKC M;  2GLS A;  2K8C A;  2WXP A;  3Q8F A;  3W1S A;  3B1L X;  1E10 A;  3VUY A;  1D6E C;  4RGO S;  2G45 B;  1EWC A;  3DBH B;  3PO0 A;  1B9R A;  1P3Q U;  3ML9 A;  2KNB A;  3J9C A;  2EKE C;  4N58 A;  4LNF A;  1V49 A;  2NVU I;  3C19 A;  4USA A;  3VRB B;  2CR5 A;  5L83 A;  1WE7 A;  1JWU D;  4BKG A;  2LAS A;  2LXA A;  4ACF A;  1GAQ B;  5IO9 A;  3DWM A;  2V0G A;  2GRI A;  3AUL A;  1MFW A;  5HKH A;  1P7F A;  2Y5C A;  3P1M A;  2JRI B;  5DPT A;  4JGH B;  2JZP A;  3GZN I;  3BVZ A;  1PUT A;  1R7S A;  4HXD A;  4NJ7 A;  2KO3 A;  4EZK A;  4PS8 A;  1JWA D;  4BBN F;  3AEB B;  5I4D A;  4FLH A;  2K3U A;  1Q0W B;  4HCP B;  3NVY A;  1M94 A;  3ABV B;  1XLP A;  4AWJ A;  3KH0 A;  4MAC A;  4I6N B;  3R3M A;  4W9D A;  1Z2M A;  3ZJV A;  1SJE D;  4JWS C;  1YNT E;  4XE0 A;  1WRI A;  4ZOH C;  3VUW A;  4GDL B;  3UGB B;  4C00 A;  3SD5 A;  1JQ4 A;  2SEB D;  3PRM B;  3TUO A;  1QOB A;  4MSQ B;  2Z0E B;  4ARI A;  3P4P B;  1L0V B;  3VH3 B;  2QCZ A;  1MVK A;  2O2V B;  1K8R B;  2KDB A;  1WMH A;  1FFV A;  2O6V D;  2I2Y A;  2M17 A;  5G55 A;  3JVZ X;  1EF5 A;  3DVN U;  4XGA B;  3QCA A;  2OHF A;  3QWZ B;  4W9F A;  2LMC A;  3PVL A;  2BQQ A;  3L13 A;  4HPL B;  2NCN A;  2HTH A;  2M4N A;  1Z5S B;  2OOB B;  3W1Y A;  1XCT L;  2KWV B;  1L4Z B;  3BWU D;  3ECI A;  2IJ0 A;  3HIZ A;  2WDT B;  4EFO A;  1H4R A;  5CHF A;  1FNU A;  1E7U A;  2DLB A;  1IP9 A;  3RUL A;  1C4A A;  4K7S A;  2V1Y A;  2KJ6 A;  2KX3 A;  3E56 A;  3S2A A;  1K53 A;  4OZC A;  1E7P B;  1I4R A;  4OZA A;  2KFK A;  3GS2 A;  4DXG A;  4TV3 A;  4RMA A;  2KVZ A;  4DHJ D;  2N9L A;  3P4R B;  3U2S C;  2WDQ B;  3RZW C;  2MJE A;  1TZ1 A;  2KTR B;  1ACC A;  4G50 A;  1MHH E;  1N6Z A;  3ZXV A;  1SE2 A;  4TMA B;  2PLP A;  4RF0 A;  1T0R C;  1OGW A;  1V1P B;  2BBC A;  3Q3J A;  4KDI C;  5HI1 A;  1UGM A;  4P1B C;  5EE3 A;  1TKG A;  1ZE3 D;  4YSZ B;  5C23 A;  2AYO B;  1D5X C;  2KJR A;  1H7W A;  4FXC A;  3V60 A;  4TUU A;  1QOG A;  4MGI E;  3LB8 C;  1J19 A;  1I4P A;  3ZJU A;  3HHM A;  1T0S C;  1YX6 B;  3LJ3 A;  3ZNH B;  5H8Y E;  2QIE B;  4IG7 B;  1IUE A;  4Q2J A;  4ZRQ A;  1V5O A;  2BGF A;  4HVB A;  2LUM A;  1N60 A;  2M0X A;  4WQO B;  2WXR A;  3HVZ A;  5D3D A;  2AX5 A;  2KFK B;  2GBN A;  1YN3 A;  1WJ4 A;  2KQ7 A;  1SIF A;  2V3P A;  4IOI E;  3RNA C;  1WWT A;  3U7Z A;  1H8C A;  1P7E A;  1UGJ A;  3ENE A;  2C9W B;  3JW0 X;  2LVQ A;  2MQJ A;  2ZNV B;  5IOI A;  3HVD A;  4IDI A;  3VTV A;  3DBR I;  2K0P A;  3T8M A;  4DK5 A;  1JRO A;  5D7G A;  4M0W A;  2ZCB A;  4LNO A;  1HA5 A;  4KX6 B;  1AN8 A;  4OHJ A;  2E3T A;  2QC8 A;  4WQM A;  4K7U A;  2PE6 B;  4KVG B;  4IWO A;  3DCG A;  4ZRP A;  3MHS D;  1UD7 A;  2EEL A;  1WH3 A;  1I42 A;  3TMP B;  5GXG B;  2GBK A;  5DPS A;  4MDK E;  2H88 B;  1XLO A;  2AQ3 B;  3ZGZ A;  4CHK A;  3VVW B;  1FO4 A;  4NJ6 A;  3DQV A;  4ZHP A;  1FD6 A;  2K6Q A;  1YQ4 B;  1L0X B;  1ZOY B;  3EUB 2;  5AUK A;  1RRB A;  4RGN A;  3PHW B;  3M63 B;  5DPR A;  3ZTC A;  2IGH A;  1TS5 A;  3P4S B;  2D10 A;  3VDZ A;  2WYQ A;  2N1V A;  2JXX A;  4QAY A;  5D3I B;  3A4R A;  5TSS A;  3RNG C;  4HLE A;  2DYB A;  5LXI B;  2LVO A;  3QC8 B;  3RNE C;  1YOV B;  1XO3 A;  3R7R A;  1PGB A;  3Q2A C;  2IO0 B;  2DX5 B;  3AE2 B;  1JRU A;  2WXF A;  4F1S A;  4NQK E;  1WFY A;  5FR6 A;  4HPP A;  3DBS A;  1ZDV A;  2KZR A;  4FUL A;  3MC0 B;  1F0Z A;  4FJZ A;  2KT7 A;  1VDV A;  2AQ1 B;  2PPH A;  2KLG A;  3B9J A;  3UIO B;  4DHZ E;  4E74 A;  1TIF A;  3PHX B;  3H7P B;  2DHZ A;  3SDL C;  1RFA A;  1RM6 C;  3KWV A;  1L6U A;  2BKF A;  1N5W A;  3RNF C;  1TT5 B;  3DBL I;  1JWS D;  3UF8 A;  1UH6 A;  3PRZ A;  2VH1 A;  1SE3 A;  3AEA B;  4LNK A;  1WXS A;  5C3J B;  4MGK E;  4M00 A;  1X1M A;  3CF4 A;  4KZ0 A;  2QEJ C;  3ZNI D;  2WXN A;  2PEA A;  1XCQ L;  1WX8 A;  1KM7 A;  1NI3 A;  2GOW A;  2W9N A;  2ZCC A;  3N30 A;  2MBH A;  2MJ3 A;  3APC A;  3BVM A;  4II2 B;  4BKS D;  2YEP F;  4DHZ B;  5JZE B;  3T3N A;  2K22 A;  3SFD B;  5AZH A;  1KRH A;  1YX5 B;  3U7D A;  3RPF C;  3VAW A;  2V4I B;  3PLU A;  4ZYN A;  3B08 A;  3TEW A;  3RUI B;  1M4V A;  1VZ6 A;  3AEG B;  3TBL D;  3DHG C;  5E6O A;  1L2N A;  3A9K A;  3AE4 B;  2R61 A;  3AU5 A;  2WXK A;  1SF0 A;  3Q14 C;  5AEK B;  4NQL B;  2FCQ A;  2ZW0 A;  2PKO A;  3OAW A;  2MJD A;  2W54 A;  2CHX A;  3K9O B;  1A5R A;  2D3A A;  3AM9 A;  4RM9 A;  1TTN A;  4LK0 M;  3V05 A;  1OTR B;  2H89 B;  3VTU A;  4GIV A;  3B2G A;  4A6Q A;  3DBR B;  2QIL A;  3VFK A;  2FNJ B;  3WAP A;  4B9K A;  2M19 A;  2ZVN A;  5AZF A;  2MRP A;  1GB4 A;  2NBW B;  2KDE B;  1YMH E;  3BK1 A;  1ROE A;  1C9F A;  3OWE B;  5IAA C;  1FNV A;  3NVZ A;  1GPX A;  1ZDX A;  1WX7 A;  2IY0 B;  3IFW B;  3RI7 C;  2AL3 A;  4ZDV A;  3PV1 A;  5JXV A;  1JWM D;  4S17 A;  4B0E A;  1E6E B;  4JL9 A;  2UYZ B;  3NG0 A;  2WNM A;  1L0Y B;  3RMK C;  3R66 C;  1R4N I;  3ZKJ C;  2ZEQ A;  1L4D B;  3BII D;  3TEY A;  4MT5 A;  2J0K A;  1HZ5 A;  4KGR A;  5T8I A;  4W9L A;  5BMG A;  3RN9 C;  4ICV A;  3M62 B;  3VUX A;  4EOY A;  3AMZ A;  2N9K A;  2KKC A;  3MTN B;  3I5J C;  5LLI A;  1J7A A;  2N9E B;  1ESF A;  2PW9 A;  1I4H A;  2GB1 A;  2WHI A;  2LJ5 A;  3TCA A;  4R3D A;  4G0N B;  2HDE A;  2KMM A;  3FAH A;  3MFG A;  1E8Y A;  2ZNV C;  2MX2 A;  3RNC C;  2Z59 B;  2KAJ A;  1QT9 A;  5IN7 A;  2KQ4 X;  1CJE A;  3PRE A;  4M01 A;  2BS3 B;  1EWY C;  1V6E A;  1WIA A;  1I7H A;  4ZRJ A;  1I4G A;  2CJO A;  3DVG Y;  3EEC A;  4AP4 C;  2LRW A;  3FC4 A;  3ZW3 A;  4N9F 4;  2IZV B;  2KMA A;  2BF8 B;  1CK1 A;  2M56 B;  3SR6 A;  4MEM A;  3MHZ A;  3CMM B;  4GDK A;  1XD3 B;  1J0G A;  1RLF A;  3DBL B;  4GLS C;  1LFD A;  2INN E;  2NTT A;  3WA0 A;  1STE A;  4MM3 A;  4N59 A;  1FIQ A;  2JXT A;  4BZA A;  1VRA B;  2BW2 A;  1JCK B;  3ML8 A;  3DDC B;  4KSK C;  2NS5 A;  4YWG G;  4PK1 A;  1K52 A;  2ONQ A;  1WE6 A;  2ICI A;  1TZO A;  2KHW B;  2RR9 A;  2AQ2 B;  2D3G A;  1YN4 A;  2EKI A;  1V97 A;  3N1X C;  1EF1 A;  2RDG A;  3NRZ A;  3ZDM C;  3MC8 A;  1JML A;  2WLB A;  2ON8 A;  4LJP B;  2LHE A;  4WAF A;  2XBB C;  1OEY A;  3ZNG C;  2BKR B;  2V3S A;  3BIN A;  1DGJ A;  4AJY B;  3AE1 B;  3IVF A;  3OLM D;  1WGG A;  2K1F A;  2ACZ B;  3MP9 A;  2KWC A;  5MPO A;  1BXT A;  4RGT A;  2C7H A;  1WJU A;  2INP E;  2D07 B;  1T5X D;  3PZ7 A;  1Y8R C;  4ZRK A;  1ZUD 2;  5CX3 A;  3CWI A;  3EGR A;  2NBU A;  4A55 A;  3BYY B;  2N7J A;  1OQY A;  1N62 A;  2WDR B;  2BWF A;  3M3J A;  1SJH D;  2FAZ A;  4MH8 A;  3U30 A;  3AEC B;  1WGH A;  2JUO A;  2XK5 A;  1WJ6 A;  3SU8 X;  2K6D B;  4B0M A;  4ITK A;  2HTM E;  1JAL A;  4MGZ E;  2KQS A;  2BPS A;  3P2B A;  4FAD A;  2PVG C;  4ZYS A;  4JX1 C;  4REZ A;  1JW9 D;  4XWT A;  4MEL A;  3V62 A;  2W3S A;  4ANU A;  1SB3 C;  4EZL A;  2DAJ A;  1EUV B;  2K5P A;  1R4N B;  2C7N B;  1HXY D;  2NPT A;  4KGS A;  4W9E A;  4ARC A;  2X38 A;  2KAC A;  1UWX A;  1LO5 D;  3FIL A;  2LFI A;  3DPD A;  3TSS A;  1MI0 A;  4WUR A;  1AYF A;  4P7I A;  3NZU A;  3RNB C;  1YQ3 B;  2M1M A;  3AB5 A;  3DOW A;  5H92 C;  1C4P A;  1H7X A;  2IGG A;  3UIN B;  5BMI A;  2IPK D;  2I1K A;  1I4Q A;  2Y5P A;  4W9G A;  1EU4 A;  2FCN A;  2NTS A;  3ZDT A;  1E9M A;  3ZYY X;  3R7Q A;  2XK5 B;  4PT5 A;  2MBB B;  1MHX A;  4GMV A;  1Q5W B;  4XZ4 A;  3N32 A;  1NI2 A;  2E6X A;  2LGX A;  2BTE A;  4KZC A;  3AE6 B;  5FKA C;  1J7C A;  4M02 A;  1WMH B;  3EC8 A;  3JYU A;  3WIM A;  2MBQ A;  3R2I A;  3UI3 A;  1WGK A;  3FKY A;  4BBN C;  1E0Z A;  2REX A;  1EU3 A;  3B0A A;  1ZXH A;  2CHW A;  2M0A A;  3ZXR A;  4KV2 A;  2RD0 A;  1PYW D;  2XN9 C;  2DBY A;  3TIX A;  2QJL A;  2DNF A;  3VQI A;  3BZD B;  4NPN A;  1K50 A;  2JZ3 B;  3HRD D;  5JHB A;  1LQB A;  1WZ3 A;  3IAS 1;  1IGD A;  3EHV A;  2KLC A;  2OJW A;  2K25 A;  3H6N A;  3AE8 B;  1IPG A;  1MJD A;  1WRD B;  4M8M A;  3N3K B;  1SEB D;  2MLB A;  1LXD A;  1NEK B;  3KWL A;  2KDF B;  4J6I A;  3RZF A;  1V5T A;  4I6L B;  4K81 A;  3NS8 A;  4ANW A;  4FHK A;  2YEP B;  1YN5 A;  2MEK A;  1LGR A;  1XLN A;  2ZPY A;  2AWT A;  4K7W A;  1MPE A;  3KUZ A;  2J7Q B;  2IO2 B;  4IM0 A;  5GMV A;  4ANX A;  3GZN B;  1VCB A;  1BUI C;  2Z0D B;  2WX0 A;  3H7S A;  1TS2 A;  2FE8 A;  2ZPN A;  3GOE A;  4C4V A;  2MCN B;  3TL5 A;  2DWQ A;  2KDM A;  3L4P A;  3ZTD A;  1GUA B;  2MSE D;  5BMH A;  1XLQ A;  4US8 A;  1DOY A;  2CJN A;  1V81 A;  4KKI A;  1QF6 A;  5EDS A;  4LNN A;  1GJZ A;  4JIO U;  2FCS A;  1V8C A;  5AUI A;  3VRA B;  2DZJ A;  1KJT A;  3N20 C;  3ALB A;  3P4Q B;  1R4M I;  3AE5 B;  2LVP A;  1C77 A;  2K8H A;  3QK0 A;  2HE7 A;  3WCQ A;  2DYO A;  2DZI A;  1D5Z C;  5G5H A;  3M95 A;  4HPM B;  4ASW C;  2MP2 A;  4BAX A;  2WXQ A;  2LEK A;  1YJ1 A;  1UEL A;  3UQB A;  2JQR B;  4XYC A;  1GC6 A;  3IAM 1;  4CQN A;  2GBM A;  1HE8 A;  1AWD A;  2IO3 B;  3IG3 A;  2LXC A;  1BML C;  2L32 A;  1I4X A;  3KUD B;  1P9D U;  1WXM A;  4M0W B;  4C56 C;  3BK2 A;  4MGY E;  1SIJ A;  3SHQ A;  4UDU C;  2JY6 A;  3X23 A;  2QMT A;  2GI9 A;  2IBI B;  3PSE B;  2L7R A;  2MW5 A;  1DOX A;  1J7B A;  1F1H A;  2JU6 X;  4WWO A;  2HJ1 A;  2VZK B;  1S3S G;  2QDF A;  3ZNZ B;  1WYG A;  3VH4 B;  2WXH A;  2LGS A;  3H1U A;  1TY2 A;  3N1Y C;  4HCN B;  1Q10 A;  2RDB C;  2CHZ A;  4RGM A;  4NY0 A; 
#chains in the Genus database with same CATH homology
 4HEA 1;  4XWW A;  3H8H A;  4MAC A;  3CIR B;  3AMZ A;  2N9K A;  3IXS A;  3NVV A;  3ZJV A;  1SJE D;  4JWS C;  1FXA A;  1YNT E;  1J7A A;  1WRI A;  4XE0 A;  4ZOH C;  1ESF A;  2PW9 A;  2FBW B;  4GDL B;  1I4H A;  2GB1 A;  1JQ4 A;  2SEB D;  3TUO A;  1IGC A;  2J4X A;  1QOB A;  5EE0 A;  4H2A A;  4DQO C;  4R3D A;  4WIP A;  3VR9 B;  2HDE A;  2KMM A;  3P4P B;  1L0V B;  3FAH A;  3MFG A;  3BYT B;  4XDC A;  4ARI A;  2IDY A;  1MVK A;  3U4E G;  1CZP A;  3W5V B;  1F2R I;  1FFV A;  2B76 B;  2I2Y A;  2KAJ A;  1QT9 A;  3HUI A;  2JSV X;  2SAK A;  2KQ4 X;  4J3O D;  1CJE A;  2BS3 B;  2OHF A;  1EWY C;  5BYS A;  1HQR D;  2LMC A;  5EE9 A;  5FR3 A;  1HZ6 A;  2RDH A;  1I7H A;  4NAM A;  3IT4 B;  1I4G A;  2CJO A;  1V1O A;  1QLB B;  3FC4 A;  1IBX A;  1PDX A;  4A8X C;  1KLU D;  1VLB A;  1QOF A;  1CK1 A;  1XCT L;  2M56 B;  3SR6 A;  4C80 A;  3BWU D;  1L4Z B;  3MHZ A;  2IJ0 A;  4YSX B;  3IT6 B;  2TSS A;  4A90 A;  4HKZ E;  4GLS C;  1RYJ A;  2NTT A;  2INN E;  1STE A;  1FNU A;  1PGA A;  1D4B A;  4N59 A;  4US9 A;  2J53 A;  1NYQ A;  1FIQ A;  2DLB A;  1XF5 L;  3AED B;  2JXT A;  4WH4 A;  2BS2 B;  4YTP B;  1VRA B;  5HFY A;  1C4A A;  2BW2 A;  4YXD B;  1JCK B;  3AN1 A;  1F2R C;  2BB6 A;  1QKZ A;  4JE3 B;  3Q8A A;  3E56 A;  2WDV B;  3TEZ A;  1K53 A;  1FCC C;  4OZC A;  1E7P B;  4YWG G;  5HG2 A;  1I4R A;  1K52 A;  4OZA A;  2ONQ A;  1ET6 A;  1N63 A;  3GS2 A;  2ICI A;  1TZO A;  4DXG A;  2WXG A;  1T6B X;  1XXG A;  2AQ2 B;  4O1N A;  4TQ1 A;  1C79 A;  1YN4 A;  2EKI A;  1NYR A;  1V97 A;  2N9L A;  3P4R B;  3U2S C;  2WDQ B;  1FRR A;  2RDG A;  2MJE A;  1NVI D;  3LYY A;  3NRZ A;  1QQR A;  1JML A;  1ACC A;  1MHH E;  1KH0 A;  2LHE A;  2ON8 A;  2WLB A;  4WAF A;  2D5G A;  5E6J A;  2N0S B;  3I57 A;  1SE2 A;  4KKJ A;  3NZ3 A;  3BVG A;  1QIL A;  1DGJ A;  4TMA B;  2PLP A;  4RF0 A;  3AE1 B;  3NVW A;  4HJG E;  1V1P B;  2BBC A;  5LNK 1;  5HI1 A;  1L5P A;  1OQR A;  2ACZ B;  3MP9 A;  1FCL A;  5MPO A;  1BXT A;  4RGT A;  5EE3 A;  1TKG A;  1ZE3 D;  4YSZ B;  2INP E;  1D5X C;  4XDD A;  2Z8L A;  1H7W A;  4FXC A;  1T5X D;  3PZ7 A;  1FMA D;  1GT8 A;  1QOG A;  2OED A;  3LB8 C;  3AE7 B;  2NMQ A;  1KLG D;  1I4P A;  1ZUD 2;  2G1E A;  3ZJU A;  3CWI A;  2WXM A;  4NJC A;  3EGR A;  1FXI A;  5H8Y E;  4JPS A;  4A55 A;  2QIE B;  3PZ8 A;  1C78 A;  1IUE A;  4Q2J A;  3BYY B;  1SXT A;  4ZRQ A;  2WU5 B;  2N7J A;  1N62 A;  2WDR B;  1SJH D;  4MH8 A;  3AEC B;  2LUM A;  1AW7 A;  1WXQ A;  2G9H D;  1N60 A;  1DYQ A;  4N6E B;  4B0M A;  3P42 A;  4ITK A;  2BT6 A;  2WXR A;  3HVZ A;  2HTM E;  1JAL A;  2XNA C;  3Q8E A;  5D3D A;  2AX5 A;  5BYQ A;  1ET9 A;  2PVO D;  1VR9 A;  3AEF B;  4TSS A;  1YN3 A;  1A70 A;  2W3R A;  1UWM A;  2BYT A;  2V3P A;  1VJK A;  2BB5 A;  4IOI E;  2PVG C;  3Q69 A;  1NEN B;  1WWT A;  3U7Z A;  1P7E A;  4JX1 C;  4REZ A;  4ZYS A;  1JW9 D;  4XWT A;  1UGJ A;  3AH7 A;  2J52 A;  4HRS A;  3ZJT A;  3T3O A;  2W3S A;  3P63 A;  3HVD A;  2WXO A;  4IDI A;  2RPV A;  1SB3 C;  2WXI A;  1B1Z A;  3ZQ4 A;  2K5P A;  2PTL A;  2PMV A;  2K0P A;  1HXY D;  1TKY A;  3W9C B;  4KGS A;  4LLG M;  1JRO A;  1OFF A;  1GOZ A;  5D7G A;  2X38 A;  4M0W A;  2KAC A;  4ARC A;  1HA5 A;  4KX6 B;  1UWX A;  1LO5 D;  1AN8 A;  3FIL A;  2LFI A;  2W82 A;  4OHJ A;  1MI0 A;  2E3T A;  4WUR A;  1AYF A;  3TSS A;  4WQM A;  2BS4 B;  5FK9 C;  1UNS A;  1YQ3 B;  3AB5 A;  4ZRP A;  5H92 C;  1C4P A;  4JWU C;  1H7X A;  2EEL A;  2IGG A;  5BMI A;  2IPK D;  1I4Q A;  2Y5P A;  5GXG B;  4RF1 A;  2JYT A;  2H88 B;  1EU4 A;  4HKQ A;  3NUH B;  1XLO A;  2NTS A;  1TS4 A;  2V3N A;  3RFZ B;  1E9M A;  3ZYY X;  3LXF A;  4LTU A;  3V3X A;  4OVZ A;  2AQ3 B;  4PT5 A;  3ETR A;  1MHX A;  3ZGZ A;  2Y3A A;  2E6X A;  1FO4 A;  2BTE A;  4ZHP A;  1FD6 A;  2WXJ A;  4YT0 B;  2JX5 A;  1YQ4 B;  3AE6 B;  1L0X B;  4WWM A;  5FKA C;  1J7C A;  1ZOY B;  4IKG A;  4DXF A;  2WP9 B;  3EUB 2;  5AUK A;  1TS3 A;  4HRO A;  4RGN A;  2KWD A;  3R2I A;  3UI3 A;  1WGK A;  1E0Z A;  2IGH A;  1GTE A;  1TS5 A;  1EU3 A;  4TQ0 A;  3P4S B;  1N61 A;  4AS1 A;  1ZXH A;  2JYE A;  4YTN B;  3VR8 B;  4EE2 A;  2M0A A;  2IGD A;  1C76 A;  4OW0 A;  5D3I B;  2J42 A;  5TSS A;  1HEZ E;  1IBX B;  4P6V F;  3AE9 B;  3EA6 A;  1RFK A;  1YJJ A;  1GTH A;  1PYW D;  2XN9 C;  2DBY A;  2LHD A;  1EM7 A;  3U52 E;  2QJL A;  1VZ7 A;  1XO3 A;  4RH6 A;  4GDK B;  3VQI A;  3KLS X;  1PGB A;  3BZD B;  3AE2 B;  2WXF A;  1K50 A;  4C7Y A;  1TYG B;  4RNA A;  3HRD D;  5G5G A;  1SSN A;  4MM3 B;  3IAS 1;  1IGD A;  1ZDV A;  3O13 A;  1FNW A;  1KTK A;  2DYM A;  3MC0 B;  3Q8C A;  4L2Y A;  4C7Z A;  1F0Z A;  3AE3 B;  3AE8 B;  2AQ1 B;  1VDV A;  2KN4 A;  3Q8B A;  3B9J A;  3GB1 A;  1SEB D;  2LJI A;  4AQ7 A;  1NEK B;  1TY0 A;  3KWL A;  4YTM B;  1RM6 C;  3KWV A;  1ZP0 B;  2CU3 A;  1L6U A;  1XEE A;  1FRD A;  1N5W A;  1JWS D;  3URY A;  2YEP B;  1C4C A;  1YN5 A;  1N5X A;  2L52 A;  2LGI A;  2MEK A;  3SEB A;  1XLN A;  2RMM A;  1MPE A;  1RWS A;  1TKE A;  5C2T B;  1SE3 A;  4L23 A;  3AEA B;  2ZW1 A;  5C3J B;  1BUI C;  4YSY B;  1TS2 A;  3CF4 A;  2FE8 A;  1FEH A;  2QEJ C;  3B2F A;  4RFB A;  2DWQ A;  2KDM A;  3L4P A;  2WXN A;  1XCQ L;  1ZXI A;  2K9X A;  2L83 A;  1NI3 A;  5BMH A;  2VZK D;  2MJ3 A;  1XLQ A;  3BVM A;  1V1P A;  4US8 A;  2YEP F;  1TJE A;  3MJ5 A;  1ZPS A;  3T3N A;  2QSD A;  3E9S A;  1KFY B;  2WXL A;  2K22 A;  2L1A A;  3SFD B;  1DOY A;  2CJN A;  2Q5W D;  3DWG C;  1KRH A;  4KKI A;  1QF6 A;  4NAW B;  3RPF C;  1SE4 A;  1DOI A;  2V4I B;  4P16 A;  3C8Y A;  3TEW A;  1D5M C;  1M4V A;  1PGX A;  1VZ6 A;  2MH7 A;  1JRP A;  3AEG B;  2WU2 B;  1V8C A;  3I9V 1;  5AUI A;  1L6V A;  3AE4 B;  2R61 A;  2WXK A;  3VRA B;  1SF0 A;  3W5U B;  3P4Q B;  2ZW0 A;  2PKO A;  3N9Y C;  2MJD A;  1K51 A;  2W54 A;  3AE5 B;  3NS1 A;  3TEX A;  2PIA A;  1SBB B;  5EE1 A;  3AM9 A;  1WSP A;  1KF6 B;  1C77 A;  4A9A A;  2W55 A;  3R2T A;  4KGT A;  4LK0 M;  3WCQ A;  1FM0 D;  2DYO A;  3V05 A;  1D5Z C;  5G5H A;  4D2K A;  1Y56 A;  2H89 B;  2WXP A;  3Q8F A;  3B2G A;  3W1S A;  4A6Q A;  1JWB D;  1E10 A;  2QIL A;  2WXQ A;  2LEK A;  3KQ4 A;  1D6E C;  4RGO S;  3R8B A;  3W2D A;  1EWC A;  2JQR B;  2JWU A;  3IAM 1;  4CQN A;  3PO0 A;  1B9R A;  1AWD A;  2WQY B;  3J9C A;  4N58 A;  1BML C;  2L32 A;  1I4X A;  4NZL B;  4RCO A;  2M19 A;  4OZB A;  1PFD A;  1GB4 A;  1VZ8 A;  1YMH E;  4C56 C;  3BK1 A;  1ROE A;  3BK2 A;  1C9F A;  4USA A;  3VRB B;  4ZHO A;  1F77 A;  5HHD G;  3AV8 A;  4L1B A;  3FIL B;  3OWE B;  3SFE B;  1FNV A;  3NVZ A;  1JWU D;  1SIJ A;  1YJI A;  1GPX A;  4UDU C;  1ZDX A;  1CQV A;  1GAQ B;  2QMT A;  3DWM A;  2V0G A;  2GI9 A;  5JXV A;  2GRI A;  1JWM D;  4B0E A;  1GB1 A;  1E6E B;  1P7F A;  2I38 A;  2Y5C A;  3P1M A;  1DOX A;  2WNM A;  1J7B A;  1L0Y B;  2JZP A;  2JU6 X;  1ENF A;  2FUG 1;  2VZK B;  1OQQ A;  3BVZ A;  1PUT A;  1WYG A;  1L4D B;  1R7S A;  1FFU A;  3BII D;  1UUP A;  2WXH A;  3TEY A;  5BYR A;  4MT5 A;  2WS3 B;  1TY2 A;  1QOA A;  1JWA D;  1HZ5 A;  3GP7 A;  3AEB B;  1T3Q A;  1Q10 A;  5I4D A;  2K3U A;  4KGR A;  5T8I A;  3NVY A;  5BMG A;  4RGM A;  3AEE B;  3ABV B;  1XLP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...