2H89B

Avian respiratory complex ii with malonate bound
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
241
structure length
241
Chain Sequence
ATSRIKKFSIYRWDPDKPGDKPRMQTYEVDLNKCGPMVLDALIKIKNELDSTLTFRRSCREGICGSCAMNIAGGNTLACTKKIDPDLSKTTKIYPLPHMYVVKDLVPDLSNFYAQYKSIEPYLKKKDESKQGKEQYLQSIEDRQKLDGLYECILCACCSTSCPSYWWNGDKYLGPAVLMQAYRWMIDSRDDYTEERLAQLQDPFSLYRCHTIMNCTRTCPKGLNPGKAIAEIKKMMATYKE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SUCCINATE DEHYDROGENASE FLAVOPROTEIN SUBUNIT
publication title Crystallographic studies of the binding of ligands to the dicarboxylate site of Complex II, and the identity of the ligand in the
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 71
structure length 241
sequence length 241
ec nomenclature ec 1.3.5.1: Succinate dehydrogenase (quinone).
pdb deposition date 2006-06-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF13085 Fer2_3 2Fe-2S iron-sulfur cluster binding domain
B PF13534 Fer4_17 4Fe-4S dicluster domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1060.10 Mainly Alpha Orthogonal Bundle Fumarate Reductase Iron-sulfur Protein; Chain B, domain 2 Alpha-helical ferredoxin 2h89B02
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 2h89B01
3AE9B 4ZOHC 2Y5CA 1A70A 3W9CB 1DOYA 1WGKA 5EE1A 2WP9B 3CIRB 1E0ZA 2CJNA 5G5HA 1PUTA 1CJEA 5C3JB 2JX5A 3B2GA 3SR6A 4C7YA 2L52A 1FRRA 2WS3B 1GAQB 1JRPA 1N62A 1XLQA 2BS4B 1NI3A 2DBYA 2EKIA 3AMZA 5G5GA 4YSZB 1B9RA 3AEBB 1ZXIA 2QIEB 1PFDA 1FXIA 5H92C 1FXAA 1WRIA 1RFKA 1OQRA 3AEGB 1SF0A 3EUB2 3NS1A 3VR8B 1JROA 5EE0A 1J7AA 1L5PA 3AB5A 3AE1B 4LTUA 3AE5B 1N60A 1N5WA 3AE4B 1KFYB 3LB8C 3ZYYX 1JWAD 4US9A 4JWUC 3NVWA 3P63A 3P4SB 1FM0D 4YT0B 1H7XA 3P4RB 2KMMA 2CJOA 1NYQA 2JQRB 3HVZA 1FMAD 4IDIA 1TKYA 3CWIA 2K22A 4N58A 1E7PB 4ZHOA 4ZHPA 1ZP0B 3AEAB 4YTPB 1FRDA 1JW9D 1TJEA 3NVZA 4US8A 3NRZA 1WYGA 4KX6B 1JWBD 1I7HA 1ROEA 1L0VB 4JWSC 2HTME 4YTMB 1OFFA 1TKEA 2PVOD 1DOXA 2W55A 1GT8A 2BS2B 1VLBA 1H7WA 4N59A 1QT9A 4YSYB 2Q5WD 2FBWB 3AECB 1ZOYB 2DWQA 1SB3C 4P6VF 3DWMA 1N61A 2W54A 5EE3A 3WCQA 1FFVA 3P4PB 3B2FA 3P1MA 1L6VA 3AE7B 1QOFA 1AWDA 1J7CA 4C80A 1XLOA 3AEDB 3NVYA 1T3QA 1NENB 2E3TA 3AE3B 1J7BA 1QF6A 1YJIA 1OQQA 1TYGB 2WDVB 2H88B 1WWTA 5AUKA 2K5PA 2MJ3A 2H89B 3PO0A 1V97A 4FXCA 1VJKA 3LXFA 3AEEB 4YXDB 1KRHA 1RM6C 3SFEB 1DOIA 2OHFA 2CU3A 1NEKB 1XO3A 2BS3B 2KAJA 3L4PA 4HRSA 3W5UB 2ACZB 2W3RA 2WLBA 2B76B 1DGJA 3BIID 2K9XA 5EE9A 1E10A 5GXGB 2MJEA 3VRBB 4WWMA 1E9MA 4C7ZA 3DWGC 1GTHA 3AEFB 1R7SA 3AN1A 3AE6B 2WU5B 3CF4A 3SFDB 1QOGA 1F0ZA 3B9JA 1TKGA 2M19A 3FC4A 4WQMA 4A9AA 1L6UA 3VRAB 2WQYB 1KF6B 2QJLA 3NVVA 1WXQA 1FO4A 1CZPA 2M56B 1QOBA 4HROA 3AH7A 1JALA 3ABVB 1UWMA 1IUEA 1XLPA 3AE2B 2AX5A 2L83A 2W3SA 3AM9A 3KWLA 2PKOA 3ETRA 2WDQB 2BT6A 5AUIA 1NVID 3FAHA 1GTEA 1V8CA 1AYFA 1SIJA 3W5VB 1YJJA 2G1EA 2N0SB 4ITKA 1GPXA 1PDXA 3HUIA 4YSXB 1XLNA 5H8YE 2PIAA 4JX1C 3VR9B 5MPOA 3P4QB 2WDRB 1RYJA 1YQ3B 1NYRA 1N5XA 2MJDA 4N6EB 2PVGC 1ZUD2 1EWYC 3AV8A 5C2TB 1E6EB 1JQ4A 2MH7A 1RWSA 1QLBB 1N63A 3HRDD 3AE8B 4USAA 4YTNB 2WU2B 1VDVA 1QOAA 1YQ4B 3RPFC 2LEKA 1FIQA 1FFUA
chains in the Genus database with same CATH superfamily
1YOVB 4F1SA 1WGKA 2CJNA 1PUTA 1VR9A 3H9DA 4C7YA 2LVPA 3UI3A 4RGMA 3PSEB 2WXNA 3B1LX 1WM2A 1T6BX 4GSWA 1FXAA 2RD0A 3ZO5B 2L32A 1JROA 5HHDG 3SHQA 1L5PA 2REXA 4B0MA 3AE4B 1TS3A 2KWCA 2WXIA 1NYQA 1B1ZA 1UZXB 3Q8AA 4MH8A 2MCNB 2IDYA 4W9JA 1WJUA 4YTPB 4E74A 5E6OA 3QQ8B 2IYDB 2W55A 3NOBA 3N20C 3WAPA 3R8BA 2DWQA 1TZ1A 2W54A 1PQSA 2JY6A 3P1MA 1L4DB 1QOFA 3H6NA 3PGEA 4XGAB 3AEDB 4LNKA 3RD2A 1J7BA 4HPPA 1WWTA 1E7UA 2MJ3A 3PRMB 4FXCA 1UBIA 1GNUA 1UGMA 3BIID 3MC0B 2KMCA 3IT4B 3TEYA 3GZNB 3CSFA 3GE8C 2RR9A 3DWGC 4L23A 1L6UA 2G45B 1CZPA 3ONSA 4RFBA 4XE0A 2AX5A 1GC7A 4WWOA 3SDLC 2PIAA 5I4DA 1EWYC 3I9V1 1Z5SB 2BKFA 2GBNA 4USAA 4YTNB 1F77A 1WH3A 3TCAA 3RPFC 1LM8B 1TTNA 2G9HD 3VAWA 1DOYA 3ZTDA 1TS2A 1EM7A 3L08A 1V1PA 5C23A 2WS3B 1JRPA 2DBYA 3N1ZC 2JZPA 3RNAC 1ZXIA 4FHJA 4RF0A 4LLGM 3NS1A 4AOFA 4G3XB 1WXAA 3ZVVA 4US9A 3NVWA 1SE2A 3N9YC 2EKEC 2FUG1 4EE2A 3RZFA 4IDIA 2K39A 3PPAA 1C76A 3VTUA 4HVBA 1ZP0B 2JRHA 4GIVA 2KLCA 4KIKA 3KQ4A 3N3KB 3RI7C 3KUDB 3QHTA 3AECB 2ICIA 3PLVA 4W9EA 3AE7B 1YJIA 4IC7B 4MEMA 4OVUA 2KDFB 3UINB 1KRHA 1WYWB 3U7DA 1SXTA 2ACZB 1C77A 1C4PA 1WM3A 2RDBC 2GBJA 3OG5A 1FCLA 3Q3FA 2WX0A 3B9JA 1LFDA 4W9CA 3H7PA 2KACA 1VZ6A 3CMMB 4RGNA 2WXPA 2LGDA 2BYVE 3M95A 2BKRB 1JRUA 4OW0A 2J53A 1WMHB 4CQNA 2JXXA 3WAOA 4B0EA 4OZCA 1BUIC 1K52A 2QC8A 4WJNA 1JQ4A 1TIFA 2FIDA 1UF0A 1CK1A 1WX9A 4G50A 3DVNV 1N60A 1ZKHA 4RGTA 1ZXHA 4K81A 2DAFA 2VZKD 2I2YA 4FJYA 2LXCA 4N9F4 3CWIA 3GP7A 4FADA 2XN9C 1XCTL 3DBRI 3AEAB 2LGXA 4TQ1A 2TSSA 5GMVA 2CHZA 4DHJB 1GUAB 1LXDA 2G4SA 1VLBA 2W9NA 2FBWB 2ZVNA 1QILA 2KWUB 4RNAA 2IGDA 2XK5B 4DHZB 3I3TB 4XDCA 2J42A 1QF6A 2MBEA 2KTRA 1V5TA 5D94A 4RMAA 2NBVB 3L4PA 4BBNF 3PZDA 3Q3JA 1D4BA 2B76B 3MFGA 2W82A 2ONQA 3I63C 4WQMA 2L8JA 2K8BA 1Y8RC 4CHKA 1OEYA 2D10A 2O6VD 3RNCC 1R4MI 3R3MA 4ZDVA 4ICUA 4LJOB 1YQBA 2PTLA 1AYFA 2KDIA 2SEBD 3M63B 1PDXA 2V4LA 2A4ZA 4JX1C 2O6VA 3SU8X 1V2YA 2NBWB 4I6NB 3NZ3A 2IGGA 2DNFA 4KGSA 3EHVA 4FJZA 3GE3C 2HDEA 3AMZA 1MFWA 4G11A 5BMGA 1PFDA 1XT9B 5L83A 2WNMA 4REZA 2ZJDA 2LRUA 4MSQB 2WXHA 2N7DA 2PMVA 3UF8A 4JIOU 4JWUC 4JPSA 1MVKA 2NPTA 1D5ZC 1FNUA 1HQRD 3FILA 4ZHPA 2DYBA 2Y5PA 2WHIA 1F9JA 3PRZA 3TSSA 2K8HA 1WYGA 4GXBA 1L0VB 3KVFB 1VCBA 3BK1A 2BBCA 4LNFA 2BS2B 1YD8U 1IYFA 3WALA 2LGIA 2FIFA 1FFVA 1SE4A 1L6VA 1V9JA 2ZPNA 3NVYA 4HDOA 3NY5A 3IBEA 1L4ZB 2L0FA 4XZ4A 1C4CA 4UDUC 4AUQC 4XWTA 2LHEA 1VRAB 4DDID 2N9EB 3ZNZB 3ZJTA 2HJ8A 2Z59B 4ZRPA 2IPKD 1YMHE 3B0AA 2ON8A 2YVCA 1I4XA 1MJDA 4A9AA 1C9FA 2KHWB 1KF6B 3W2DA 1UUPA 3VHTC 3ZRFA 5AUIA 2BT6A 4BOSC 2PEAA 5G2NA 3L13A 5BMHA 4BZAA 2WDRB 2FCNA 4ZYSA 3H7SA 3SEBA 2KX3A 3HRDD 3WANA 4IUMB 4BVUC 1TZOA 1WRDB 3A4SC 2IBIB 1IBXA 2KC1A 1WGGA 3R7QA 2IO1B 1NI3A 5CHWA 1B9RA 4YSZB 2M8SA 1XEEA 3PREA 1RFKA 1OQRA 3IXSA 4PS7A 4B9KA 2AQ2B 2SAKA 2WGSA 3VR8B 3MHSD 2J0MA 4ICVA 4BBNC 2GMIC 4IM3A 1A5RA 3ECIA 1K51A 1L0XB 3AU4A 4E71A 2MBHA 1R4NB 2PJHA 4I6LB 4WJOA 4ANVA 1G6JA 2KX0A 1SE9A 2KMMA 5LNK1 3VQIA 3A4RA 3BYYB 4KV2A 3U2SC 1OEYJ 2N9KA 2K3UA 3NUHB 3A9JB 1RAXA 2QMTA 3HM6X 1M94A 1UWXA 1UELA 3MC8A 2KQ7A 2JZZA 1CQVA 1QT9A 2X8XX 1WX7A 1JWUD 1MG4A 2KK8A 2R2QA 2OJWA 4TQ0A 2MHJA 1VJKA 5CX3A 3L0WB 1TY0A 2FUHB 3NS8A 3PVLA 3SFDB 4MELA 2WX1A 3VUYA 4ZYNA 2RGFA 3VH4B 3ABVB 4URKA 3QARA 3APCA 3RNGC 1FXTB 4ITKA 1D5MC 2ZPYA 2PVGC 1P9DU 1MHXA 3K9OB 3QC8B 3T3NA 3AE8B 4GOCA 1QOAA 2WXRA 2L00B 4DXGA 2JX5A 1ENFA 3ZJVA 2BW2A 2B3AA 3VUXA 3EGRA 3LDZE 2KDBA 2VH1A 5EE0A 3AB5A 2M0XA 4NJ7A 1ZW7A 1RLFA 3VVWB 2MWSB 1FM0D 4PYZA 4YT0B 3P4RB 4BKTA 4RH6A 1EU4A 1WGHA 5FR3A 3HVZA 3R2IA 2ZCCA 2K1FA 1E8XA 2R2OA 4ZRJA 4LK0M 1ESFA 5IOIA 1FCCC 3RUIB 3PZ8A 3BYTB 3RT3B 1SB3C 1ISNA 1JWSD 1YX5B 2BYFA 3B2FA 3URYA 2INNE 2XEWA 3NHEB 1WGRA 1L7YA 4EFOA 3B08A 2JWUA 2IO0B 1L2NA 4KZCA 4TMAB 3GZNI 4YXDB 1SIFA 4WAFA 5D3IB 2K6QA 5GXGB 5IAAC 2MBOA 3EA6A 4OHJA 1WJNA 1QZEA 1WXQA 4JGHB 1PGAA 4HJKA 2JF5A 1JALA 4KKJA 1GTEA 2QSDA 1SIJA 2G1EA 2KZRA 1RYJA 3MHZA 2BVCA 1LO5D 2HD5B 2LXAA 5E6PA 2L7RA 5D3DA 3MC9A 1TBEA 3BVZA 4J3OD 2NS5A 3B2GA 1GG3A 4WIPA 2BYTA 3RN9C 5TR5A 3E9SA 3DVGY 1WRIA 4MH0E 2DZJA 4ZRKA 2GB1A 2C7NB 4NQKE 5EDSA 2Y3AA 4KZ0A 4GLSC 1KLVA 4W9IA 4HPMB 3LB8C 2LJIA 1MPEA 2BPSA 1J8CA 4WQOB 3WIMA 4W9GA 1SE3A 1V1PB 1TKEA 2V1YA 5IO9A 5BYSA 4DBGA 2JRIB 5LLIA 3W1SA 2ZNVC 4LDTD 2J4XA 2V0GA 2FCQA 1V81A 1OQQA 2IO3B 2FE8A 1BXTA 2I38A 4HRSA 1XO3A 4JE3B 1E10A 2QCZA 3R66C 4C00A 2INDC 1YX6B 2LASA 1AN8A 4KIKB 1UD7A 3DDCB 2WU5B 3PTFC 3EFCA 2KC2A 4EZKA 5KHOA 4M0WA 4GDKA 5DPSA 3QIJA 1QOBA 3AE2B 3IG3A 1E8ZA 4PK1A 4DXFA 3AXCA 2LWPA 4Q2JA 5L95C 3P4QB 2KYWA 3PHXB 2C7HA 4OZAA 5HG2A 1NBFC 2FCMA 2AQ3B 4KVGB 1Q1OA 2LEKA 1S3SG 4OVZA 4GMVA 5EE1A 2EMTA 4A20A 4MT5A 4TKNA 3HIZA 3VTVA 3H7PB 5BO4B 3AEBB 3N1XC 1BMLC 3PT2B 4WURA 1SF0A 4EUTA 3MJ5A 3NJTA 1WJ6A 1SBBB 1WR6E 3A33B 3I5JC 2ZW1A 2WXLA 2NBUA 3L54A 3JSVA 3OAWA 3KUZA 3M3JA 1FMAD 1E7VA 3ZJUA 5TSSA 3ML9A 4IWQA 4US8A 4O1NA 2PVOD 5CHVC 2BF8B 4MM3A 2KN5A 2NVUI 1EO6A 1M4VA 1FNVA 4CO7A 4ASWC 2E3TA 2KVZA 2V3PA 2N4FA 1SJED 3DBLB 1WX8A 2D3CA 2AYOB 4KDLB 2LD9A 4II3B 4G0NB 5DPRA 1RM6C 1NEKB 3W5UB 2WLBA 3QCAA 2VZKB 1GJZA 4WWMA 3PRPB 1Q5WB 3Q2AC 1XD3B 1F0ZA 4B95A 1JMLA 1Y56A 1YNTE 2DAJA 2K0PA 3OLMD 4NJ6A 5AZHA 4IWOA 3TMPB 2Z0EB 2L83A 3AM9A 4K1RB 1WR1A 3KYCD 2LMCA 1P3QU 4GDLA 3U30A 1DYQA 4NPNA 2INPE 3AV8A 3V62A 3WA0A 1E6EB 2N9XA 1RWSA 1PGBA 2KDMA 3Q3NC 1FIQA 3X23A 2V4IB 1A70A 1EF5A 2KQSA 4W9HA 1T0SC 2BS4B 1C3TA 3ZIMA 1ZPSA 2N1VA 3RCZA 5JHAA 1Q0WB 1WJ4A 3EUB2 4P16A 3AI5A 1FD6A 1ACCA 2RSUA 2L1AA 5D7GA 2O6VB 3QJZA 5LXIB 2INCC 1Z2MA 4L1BA 2Z0DB 2GBKA 3WAMA 1E7PB 2J7QB 2KXJA 2XNAC 2V9HA 1I7HA 4JWSC 4HLEA 4X57B 1XCQL 2QILA 3Q8CA 4GU2A 1T5XD 1ZOYB 3DWMA 2PW9A 2O2VB 3P4PB 4RGOS 2JWZA 5AZGA 4C80A 4JL9A 1TYGB 3EECA 5IKCM 2K5PA 3V61A 1STEA 2JSVX 3AEEB 2DZIA 1P7FA 2G3QB 4W9KA 1YN4A 5EE9A 2DX5B 2KJRA 4AS1A 3PV1A 1VD2A 1HA5A 4KSKC 1WF9A 1K50A 3RNEC 3BK2A 3DVNU 3PHWB 3NZUA 2QJLA 3QX1A 3P2BA 3ZKJC 3V6CB 3NG0A 3ZDTA 4HROA 1KM7A 1XLPA 5DPWA 4RCOA 4FLHA 2JYTA 3T3OA 1LQBA 1OGWA 4ANXA 1C1YB 2KFKA 5H8YE 2LGYA 4IW0A 3S2AA 1HTQA 1N5XA 2YLMA 1P98A 2HJ1A 4IM2A 3N30A 4DDGD 3ZDMC 1VDVA 2WU2B 3ZUNA 3ZXRA 5JHBA 2AEHA 4K3BA 4C56C 4K7WA 4XWWA 4BKGA 3CIRB 2KWVB 3BWUD 3PS6A 1UBQA 2L52A 4DWFA 2EKIA 1WE6A 5HI1A 1BT0A 2K8CA 3DHIC 5H92C 1J19A 1R4NI 2RDHA 3Q69A 2C5LC 3OJ3A 2WXOA 3MP9A 4FHKA 2LVOA 1V80A 4KKIA 3VDZA 3P4SB 4E3CA 1H7XA 1Q10A 4HPLB 3LYYA 2KQ4X 2WYQA 4FA6A 4N58A 1KJTA 3VXWA 1EUVB 3TIXA 5IN7A 1IBXB 3KYDD 4YWGG 1ROEA 3RFZB 2HTME 1EF1A 3ENEA 3V60A 1IGDA 4N59A 1PGXA 4YSYB 2OJRA 3Q6BA 1D6EC 3GS2A 1SEBD 1J7CA 4FBJB 2WDTB 1NENB 3ZNID 2BQQA 1HXYD 4EEWA 1ZDXA 4MGIE 5E6JA 2OHFA 3IVFA 4BKSD 2L0TA 2KAJA 3A1QA 2AL6A 2R61A 3TEWA 5FKAC 2E6XA 1R7SA 2XBBC 4BKSA 1HZ6A 1F2RC 1YN3A 4NAWA 1PYWD 3FC4A 3UGBB 3VRAB 1V86A 3DHHC 4W9DA 2GRIA 4C4VA 2KDEB 3MTNB 1GC6A 1KLGD 3HUIA 2LUEA 4AJWA 3RULA 2Z8LA 2MH7A 4EZJA 4ARIA 2M17A 2BWFA 1I4HA 1YQ4B 3W9CB 4DHZE 1FEHA 3K9PB 3IHPC 3U8ZA 1E0ZA 3HHMA 4M01A 4MJSA 4A90A 3VH3B 4DQOC 3IFWB 3SD5A 3AEGB 2WXGA 5HFYA 3GOEA 3UQBA 2GLSA 3AE1B 3ZYYX 2D3BA 3KH0A 4M8MA 2MP2B 4ANUA 3RZWC 4ACFA 3KLSX 3JW0X 4IOIE 1TS5A 4HXDA 1TKYA 4W9LA 2K22A 1VZ7A 1JW9D 2Y5BB 1TJEA 1ET6A 3EC8A 4TUUA 1E90A 1TS4A 1WGYA 3ZGZA 2QEJC 1GT8A 2DHZA 4LNNA 2N7EA 5CTRC 2X38A 1RFAA 4F7ZA 5EE3A 3DVGX 3HVDA 2IGHA 2JUOA 4K7SA 2CS4A 5BYRA 2FCSA 4KSLC 3P42A 3CSTA 3A9KA 1NI2A 2KO3A 2GBRA 4HDQA 2KKCA 1WGDA 2JVCA 4R3DA 3AN1A 2BGFA 1YN5A 1L0YB 2RPQA 3HM3A 1FO4A 2D07B 3FKYA 1F52A 2WXQA 3ML8A 3ETRA 2C7MB 3Q3OC 4MDKE 4ZRIA 3V6EB 1EU3A 1YJJA 4AP4C 4OZBA 5J2RA 2J0JA 3H1UA 4MGKE 4KGRA 1OQYA 3AE9B 2Y5CA 4RM8A 3KW5B 4A3OA 5G5HA 3VFKA 3AU5A 2RMMA 1FRRA 3R2TA 4XX5A 2KOXA 1GAQB 1N62A 3RYTA 1CMXB 3V05A 1AW7A 2KVRA 1GB4A 2CU1A 4HJGE 2V3SA 1IPGA 3TEZA 1XQQA 3W1SC 5BYQA 1P0RA 1YIWA 4DXAB 3P63A 3W1YA 5T8IA 3TEXA 4HKQA 3BVMA 1MG8A 2IZVB 1IGCA 2V3NA 4LNOA 4M8NA 3E56A 4WWPA 4D2KA 3RNFC 2DYOA 2WXKA 3KWVA 2CR5A 4AWJA 3TBLD 2QDFA 4WAAA 1N61A 2CHWA 2LFIA 1ZDVA 2M1MA 2ASQA 1E5WA 1T3QA 2VRRB 2WDVB 2EMSA 4BFRA 2KANA 4YL8A 5AUKA 3QAQA 2H89B 4JLCA 4FN2A 5AZFA 2CU3A 4PT5A 3L16A 1DGJA 4MGZE 2NTTA 2IO2B 4TSSA 3UIOB 1E9MA 4WH4A 4C7ZA 2MEKA 4L2YA 5C1ZA 3BZDB 1TKGA 1YJ1A 3O65B 4NQLB 3NZSA 4PS8A 3RNBC 2DYMA 3NVVA 2LHDA 2WXFA 3I57A 3QK0A 3AH7A 1UWMA 3KWLA 2JZ3B 3N32A 1NVID 4EKUA 3FAHA 1WE7A 4LDTB 1GPXA 1XLNA 3R7RA 3DOWA 2A5UA 1V5OA 1P1AA 1VZ8A 3C19A 2N9LA 3HK0A 2KTFA 1WZ0A 2CKHB 3ZTCA 3UQAA 2I1KA 1CJEA 4S0RA 2K6DB 4M0WB 4GDKB 2GOWA 4NJCA 1I4PA 4BOZB 3U7ZA 5IP4D 4P1CC 1J0GA 2UWQA 2RDGA 2KN4A 3AE5B 2ZZPB 1XXGA 2MSED 2YEPF 2J52A 1WXVA 3C8YA 3OJ4B 4WJPA 3Q3MC 4IWPA 1C79A 1T0QC 4ZHOA 2ZNVB 1KLUD 1F1HA 2LVQA 3NRZA 4KX6B 3ZNGC 1I35A 3H8HA 1I42A 4K3CA 1IP9A 1P7EA 3DBLI 2JPHA 1AWDA 4GB9A 2MW5A 1XLOA 2IY1B 2N1WA 4RF1A 3JSVB 2M0AA 1HE8A 2MX2A 1WY8A 3U52E 4MSMB 3PO0A 5G55A 3LXFA 5LXHA 1DOIA 2BS3B 1WMHA 2K9XA 3D32A 3VRBB 2BB5A 5CHFA 4ARCA 3AE6B 4XC2A 4MM3B 4F8CB 2MBBB 2BTEA 1UGJA 3EFUA 1GOZA 4A3PA 1IUEA 1C78A 1HEZE 4LCDE 4TV3A 2QHOA 1X1MA 1LGRA 2ZW0A 3IAM1 1YQ3B 3RMKC 2N7JA 2NMQA 4DHJD 5FR6A 4ZOHC 1TGZB 3ZLZA 3Q8EA 2ZVOA 5C3JB 4XDDA 3SR6A 5DPTA 4KDIC 3M62B 4I6PA 2KFJA 2L05A 5J17A 2JYEA 2DZKA 2QIEB 1FXIA 2KTRB 1QKZA 1T0RC 1J7AA 2XK5A 4GDLB 3X0WA 3PZ7A 3OWEB 3N1YC 4FJVB 1JWAD 3GB1A 1UNSA 4WJQA 2FNJB 2CJOA 1JWMD 5IA7A 2I1JA 3IAS1 2LGSA 4NNJB 3NVZA 2DENB 1WXSA 2M4NA 1JWBD 2PE6B 2OEDA 1OFFA 4QAYA 3DBRB 2AL3A 2PPHA 3U4EG 1H7WA 4EZLA 2MLBA 4MGYE 3TUOA 4AQ7A 1GB1A 4NY0A 2FAZA 4IM0A 3TJPA 3T9LA 5FK9C 1N6ZA 2KWDA 1K53A 1FNWA 2D11A 4B6WA 3JVZX 1KH0A 2KNBA 2IJ0A 4LNIA 3APFA 4S17A 3J9CA 2D5GA 1V49A 1QOGA 2NCNA 2JT4B 4JQWC 3ZW3A 1WXMA 1MI0A 1TT5B 2NPTB 4HK2A 3FILB 4J6IA 2O2VA 1R4MB 5MPOA 2LZ6A 4KGTA 1I4RA 1ZUD2 5C2TB 4IG7B 2OOBB 1N63A 2CHXA 2J0KA 2EELA 1JCKB 2JXTA 2MRPA 2KD0A 1EWCA 5JH5C 2C9WB 4LJPB 3QWZB 2GI9A 1XLQA 1XF5L 3ZXVA 3C0RB 1AARA 3ZRCA 2BYEA 2PE9A 4A8XC 2KFKB 2UYZB 2LI5A 1RRBA 1HZ5A 4RM9A 3PLUA 3VTWA 4HCNB 5D6JB 5E6NA 1E8YA 2NTSA 2MA9B 4A6QA 3ZQ4A 4FULA 2UU7A 2WXMA 2YEPB 1KTKA 1SJHD 1V6EA 4YTMB 4BAXA 3ZNHB 2KJ6A 2Q5WD 4EOYA 3DBHI 5J18A 3IT6B 3WCQA 1QQRA 4NAMA 2LUMA 2KLGA 2N9PC 3AE3B 4W9FA 2WWZA 4P7IA 2H88B 1NDDA 3Q8BA 1TY2A 1ZE3D 2ZEQA 4CYEA 5D2MB 3AULA 2W3RA 3L10B 3QA8A 4OVVA 2MJEA 5JZEB 2AWTA 4MACA 3ALBA 1GTHA 3AEFB 1S1QB 3CF4A 2KJHB 3BINA 3T8MA 2KMAA 2DLBA 1ET9A 3JYUA 1WSPA 3DBHB 2M56B 2HTHA 5G5GA 5AEKB 2WDQB 2BWES 1V8CA 3W5VB 1D5XC 1K8RB 4PS3A 1NYRA 2D2QA 4N6EB 3L17A 1UH6A 1D3ZA 2D3GA 3A1QB 4A55A 2WXJA 2KT7A 1FFUA 3TL5A 2WP9B 5HKHA 4NAWB 3A9JA 3UIPB 1OTRB 4GGQA 1SGHA 3BVGA 1H8CA 1WZ3A 4ZRQA 3DCGA 2MQJA 4C4VB 4M02A 2VH2A 2K25A 1V1OA 2HE7A 1HTOA 4HKZE 1KOTA 3MJWA 4LTUA 4ANWA 1N5WA 3DHGC 1KFYB 2LJ5A 4II2B 4XYCA 1F2RI 1WIAA 1WI0A 2JQRB 2BB6A 5BMIA 4WWNA 1H4RA 4P1BC 4AJYB 5JXVA 1FRDA 4HEA1 2L3ZA 2LRWA 3APDA 3CF6E 4MJSB 2GBMA 4DK5A 3BY4B 3DPDA 1I4QA 1U4AA 3Q8FA 1DOXA 3V3XA 3DQVA 4P6VF 2G4DB 3LJ3A 4GN1A 2DZMA 3DBSA 1V97A 1SSNA 4M00A 3SFEB 4K7UA 2ZCBA 3KUCB 4HWIB 2PLPA 4H2AA 5DCNA 2C60A 2MP2A 4IKGA 4HCPB 2D3AA 2L76A 5KHQA 1ZGUB 2M19A 2WQYB 4PYUA 2IY0B 3Q14C 1C4AA 1I4GA 4NZLB 1E8WA 2W3SA 2PKOA 1T0YA 2JU6X 2N0SB 4YSXB 2NR2A 3VR9B 2MJDA 2AQ1B 3VUWA 1WFYA 1QLBB 2MBQA 3A9KB 1MHHE 1FPYA 3O13A 2RPVA
chains in the Genus database with same CATH topology
2V4IB 1A70A 1TZOA 1WGKA 1IBXA 2CJNA 1PUTA 1CJEA 1VR9A 4C7YA 3UI3A 4RGMA 2BS4B 1NI3A 2WXNA 4GDKB 1B9RA 4YSZB 1ZPSA 1T6BX 4NJCA 1XEEA 1FXAA 1I4PA 1RFKA 1OQRA 3EUB2 3IXSA 4P16A 2AQ2B 2SAKA 1FD6A 3U7ZA 3VR8B 1ACCA 2L32A 1JROA 5HHDG 2L1AA 1L5PA 2RDGA 1K51A 1L0XB 2KN4A 3AE5B 4B0MA 5D7GA 3AE4B 1XXGA 2YEPF 1TS3A 2J52A 3C8YA 2KMMA 2WXIA 4L1BA 1NYQA 1B1ZA 1C79A 3Q8AA 5LNK1 4MH8A 4ZHOA 1E7PB 2IDYA 3VQIA 3BYYB 4YTPB 1KLUD 2XNAC 3U2SC 3NRZA 2N9KA 2K3UA 3NUHB 4KX6B 1I7HA 2QMTA 4JWSC 1UWXA 2W55A 3H8HA 1XCQL 2QILA 3Q8CA 1CQVA 1QT9A 3R8BA 1T5XD 2DWQA 1ZOYB 1C9FA 3DWMA 2PW9A 1P7EA 2W54A 3P1MA 3P4PB 4RGOS 1JWUD 1L4DB 1QOFA 1AWDA 4C80A 1XLOA 3AEDB 4RF1A 1J7BA 2M0AA 1TYGB 3U52E 1WWTA 2K5PA 2MJ3A 1STEA 3PO0A 4TQ0A 4FXCA 1VJKA 3LXFA 2JSVX 3AEEB 1DOIA 2BS3B 1P7FA 1YN4A 5EE9A 3BIID 2K9XA 3MC0B 4AS1A 3IT4B 3TEYA 1TY0A 3VRBB 1HA5A 2BB5A 4ARCA 3DWGC 1K50A 3AE6B 3BK2A 3SFDB 4MM3B 4L23A 1L6UA 2QJLA 2BTEA 1UGJA 1CZPA 1GOZA 4HROA 3ABVB 1XLPA 1IUEA 2AX5A 4RFBA 4XE0A 4RCOA 3T3OA 2JYTA 1C78A 1HEZE 4ITKA 5H8YE 2PIAA 5I4DA 1D5MC 2ZW0A 3IAM1 1YQ3B 1N5XA 2PVGC 1EWYC 1MHXA 2N7JA 3I9V1 3T3NA 3AE8B 4USAA 4YTNB 2WU2B 1F77A 1VDVA 2NMQA 1QOAA 3RPFC 2G9HD 2WXRA 4ZOHC 1DOYA 4C56C 4XWWA 4DXGA 3CIRB 3BWUD 3Q8EA 2JX5A 5C3JB 1EM7A 1TS2A 4XDDA 3SR6A 1V1PA 2L52A 2WS3B 1JRPA 2DBYA 2EKIA 1ENFA 2JZPA 5HI1A 2JYEA 1ZXIA 2QIEB 3ZJVA 1FXIA 5H92C 2BW2A 4RF0A 2RDHA 4LLGM 3EGRA 3NS1A 3Q69A 1QKZA 5EE0A 1J7AA 2WXOA 3AB5A 4GDLB 3MP9A 3PZ7A 3OWEB 1JWAD 3GB1A 4US9A 4KKIA 1UNSA 3NVWA 3P4SB 1FM0D 4YT0B 1H7XA 1Q10A 1SE2A 3P4RB 3N9YC 2CJOA 1EU4A 3LYYA 1JWMD 4RH6A 2FUG1 3IAS1 5FR3A 3HVZA 2KQ4X 4EE2A 3R2IA 4IDIA 4N58A 1C76A 1ZP0B 3NVZA 1IBXB 4YWGG 1JWBD 1ROEA 3RFZB 2OEDA 2HTME 4LK0M 1OFFA 3KQ4A 1ESFA 1FCCC 3PZ8A 1IGDA 3BYTB 1H7WA 4N59A 3U4EG 1PGXA 4YSYB 3AECB 2ICIA 1SB3C 1JWSD 1D6EC 3TUOA 4AQ7A 1GB1A 3B2FA 3URYA 2INNE 3GS2A 5FK9C 3AE7B 1SEBD 1J7CA 1K53A 2KWDA 1FNWA 1NENB 1YJIA 2JWUA 1HXYD 1KH0A 1ZDXA 2IJ0A 5E6JA 4TMAB 1KRHA 4YXDB 2OHFA 4WAFA 2KAJA 1SXTA 5D3IB 2ACZB 1C77A 3J9CA 1C4PA 5GXGB 2D5GA 2R61A 3EA6A 4OHJA 3TEWA 5FKAC 2E6XA 1FCLA 1R7SA 1HZ6A 1F2RC 1QOGA 1YN3A 3B9JA 1PYWD 3FC4A 2KACA 1VZ6A 3VRAB 1WXQA 4RGNA 1PGAA 1MI0A 2GRIA 1JALA 2WXPA 4KKJA 1KLGD 1GTEA 3FILB 2QSDA 1SIJA 2G1EA 3HUIA 5MPOA 1RYJA 3MHZA 4KGTA 1I4RA 1ZUD2 2Z8LA 5C2TB 4OW0A 2J53A 2MH7A 4ARIA 1N63A 4CQNA 1LO5D 2EELA 1JCKB 1YQ4B 1I4HA 5D3DA 2JXTA 3W9CB 1EWCA 1FEHA 4B0EA 3BVZA 4J3OD 1E0ZA 4A90A 3B2GA 4OZCA 1BUIC 1K52A 2GI9A 4WIPA 4DQOC 2BYTA 1XLQA 1JQ4A 1XF5L 3E9SA 1WRIA 3AEGB 2WXGA 5HFYA 1CK1A 4A8XC 2GB1A 2Y3AA 4GLSC 3AE1B 1N60A 3ZYYX 1HZ5A 3LB8C 4RGTA 1ZXHA 2VZKD 2I2YA 3KLSX 2LJIA 1MPEA 4IOIE 1TS5A 2NTSA 4A6QA 1TKYA 3CWIA 2K22A 3GP7A 3ZQ4A 2XN9C 1XCTL 1VZ7A 3AEAB 1JW9D 1TJEA 1SE3A 2WXMA 2YEPB 4TQ1A 1KTKA 1SJHD 1V1PB 1ET6A 2TSSA 4YTMB 1TS4A 1TKEA 3ZGZA 5BYSA 2QEJC 1GT8A 1VLBA 2Q5WD 2X38A 2FBWB 1QILA 3W1SA 3IT6B 2J4XA 5EE3A 3WCQA 1QQRA 4RNAA 2IGDA 3HVDA 2IGHA 2V0GA 4NAMA 2LUMA 4XDCA 2J42A 1QF6A 3AE3B 1OQQA 5BYRA 2H88B 3Q8BA 1TY2A 2FE8A 1ZE3D 1BXTA 3P42A 3L4PA 2I38A 4HRSA 1XO3A 2W3RA 4JE3B 2B76B 1D4BA 3MFGA 1E10A 2W82A 2MJEA 2ONQA 4MACA 1AN8A 4R3DA 1GTHA 3AEFB 3AN1A 2WU5B 3CF4A 2DLBA 1YN5A 4WQMA 1ET9A 1WSPA 4M0WA 1L0YB 1FO4A 2M56B 1QOBA 2WXQA 3AE2B 5G5GA 3ETRA 2WDQB 2PTLA 1V8CA 1AYFA 1EU3A 3W5VB 1YJJA 2SEBD 4DXFA 1PDXA 4Q2JA 1D5XC 4JX1C 3P4QB 1NYRA 4N6EB 4OZBA 4OZAA 5HG2A 3NZ3A 2IGGA 4A55A 2AQ3B 2LEKA 2WXJA 4KGRA 4OVZA 1FFUA 3AE9B 4KGSA 2Y5CA 5EE1A 2WP9B 5G5HA 4MT5A 4NAWB 2RMMA 1FRRA 3R2TA 1GAQB 1N62A 3V05A 2HDEA 3AMZA 1AW7A 3AEBB 3BVGA 1GB4A 5BMGA 1BMLC 1PFDA 4HJGE 4ZRQA 2WNMA 4WURA 1SF0A 3MJ5A 4REZA 3TEZA 1V1OA 4HKZE 1SBBB 5BYQA 2ZW1A 4LTUA 2WXHA 2WXLA 1N5WA 2PMVA 1KFYB 4JWUC 1F2RI 3P63A 4JPSA 1MVKA 5T8IA 1D5ZC 1FNUA 1HQRD 2JQRB 3TEXA 4HKQA 2BB6A 1FMAD 5BMIA 3FILA 3BVMA 4ZHPA 3ZJUA 5JXVA 1IGCA 5TSSA 2V3NA 2Y5PA 1FRDA 4HEA1 3TSSA 4US8A 3E56A 1WYGA 1I4QA 4O1NA 4D2KA 1L0VB 2DYOA 2WXKA 3KWVA 2PVOD 3BK1A 2BBCA 3Q8FA 1DOXA 2BS2B 3V3XA 4P6VF 1N61A 2LGIA 2LFIA 1ZDVA 1FFVA 1SE4A 1L6VA 1M4VA 1FNVA 3NVYA 1T3QA 2E3TA 2V3PA 2WDVB 1SJED 5AUKA 1L4ZB 2H89B 1V97A 1C4CA 1SSNA 1RM6C 4UDUC 3SFEB 2CU3A 1NEKB 4XWTA 2LHEA 4PT5A 3W5UB 1VRAB 2WLBA 2VZKB 1DGJA 2PLPA 4H2AA 2NTTA 4IKGA 4TSSA 4WWMA 1E9MA 4WH4A 4C7ZA 2MEKA 3ZJTA 4ZRPA 2IPKD 1YMHE 2ON8A 1F0ZA 4L2YA 3BZDB 1I4XA 1TKGA 2M19A 4A9AA 1JMLA 2DYMA 1Y56A 2WQYB 1KF6B 1YNTE 2LHDA 2WXFA 2K0PA 1C4AA 3I57A 3NVVA 3W2DA 1I4GA 1UUPA 4NZLB 3AH7A 1UWMA 3AM9A 2L83A 3KWLA 2W3SA 5AUIA 2PKOA 2BT6A 1NVID 2LMCA 2JU6X 3FAHA 2N0SB 1GPXA 4YSXB 1XLNA 3VR9B 5BMHA 2MJDA 2WDRB 2AQ1B 4ZYSA 1DYQA 2INPE 3AV8A 3SEBA 1E6EB 1RWSA 1QLBB 1VZ8A 3HRDD 1PGBA 1MHHE 2KDMA 2N9LA 3O13A 2RPVA 1FIQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3AE9 B;  4ZOH C;  2Y5C A;  1A70 A;  3W9C B;  1DOY A;  1WGK A;  5EE1 A;  2WP9 B;  3CIR B;  1E0Z A;  2CJN A;  5G5H A;  1PUT A;  1CJE A;  5C3J B;  2JX5 A;  3B2G A;  3SR6 A;  4C7Y A;  2L52 A;  1FRR A;  2WS3 B;  1GAQ B;  1JRP A;  1N62 A;  1XLQ A;  2BS4 B;  1NI3 A;  2DBY A;  2EKI A;  3AMZ A;  5G5G A;  4YSZ B;  1B9R A;  3AEB B;  1ZXI A;  2QIE B;  1PFD A;  1FXI A;  5H92 C;  1FXA A;  1WRI A;  1RFK A;  1OQR A;  3AEG B;  1SF0 A;  3EUB 2;  3NS1 A;  3VR8 B;  1JRO A;  5EE0 A;  1J7A A;  1L5P A;  3AB5 A;  3AE1 B;  4LTU A;  3AE5 B;  1N60 A;  1N5W A;  3AE4 B;  1KFY B;  3LB8 C;  3ZYY X;  1JWA D;  4US9 A;  4JWU C;  3NVW A;  3P63 A;  3P4S B;  1FM0 D;  4YT0 B;  1H7X A;  3P4R B;  2KMM A;  2CJO A;  1NYQ A;  2JQR B;  3HVZ A;  1FMA D;  4IDI A;  1TKY A;  3CWI A;  2K22 A;  4N58 A;  1E7P B;  4ZHO A;  4ZHP A;  1ZP0 B;  3AEA B;  4YTP B;  1FRD A;  1JW9 D;  1TJE A;  3NVZ A;  4US8 A;  3NRZ A;  1WYG A;  4KX6 B;  1JWB D;  1I7H A;  1ROE A;  1L0V B;  4JWS C;  2HTM E;  4YTM B;  1OFF A;  1TKE A;  2PVO D;  1DOX A;  2W55 A;  1GT8 A;  2BS2 B;  1VLB A;  1H7W A;  4N59 A;  1QT9 A;  4YSY B;  2Q5W D;  2FBW B;  3AEC B;  1ZOY B;  2DWQ A;  1SB3 C;  4P6V F;  3DWM A;  1N61 A;  2W54 A;  5EE3 A;  3WCQ A;  1FFV A;  3P4P B;  3B2F A;  3P1M A;  1L6V A;  3AE7 B;  1QOF A;  1AWD A;  1J7C A;  4C80 A;  1XLO A;  3AED B;  3NVY A;  1T3Q A;  1NEN B;  2E3T A;  3AE3 B;  1J7B A;  1QF6 A;  1YJI A;  1OQQ A;  1TYG B;  2WDV B;  2H88 B;  1WWT A;  5AUK A;  2K5P A;  2MJ3 A;  2H89 B;  3PO0 A;  1V97 A;  4FXC A;  1VJK A;  3LXF A;  3AEE B;  4YXD B;  1KRH A;  1RM6 C;  3SFE B;  1DOI A;  2OHF A;  2CU3 A;  1NEK B;  1XO3 A;  2BS3 B;  2KAJ A;  3L4P A;  4HRS A;  3W5U B;  2ACZ B;  2W3R A;  2WLB A;  2B76 B;  1DGJ A;  3BII D;  2K9X A;  5EE9 A;  1E10 A;  5GXG B;  2MJE A;  3VRB B;  4WWM A;  1E9M A;  4C7Z A;  3DWG C;  1GTH A;  3AEF B;  1R7S A;  3AN1 A;  3AE6 B;  2WU5 B;  3CF4 A;  3SFD B;  1QOG A;  1F0Z A;  3B9J A;  1TKG A;  2M19 A;  3FC4 A;  4WQM A;  4A9A A;  1L6U A;  3VRA B;  2WQY B;  1KF6 B;  2QJL A;  3NVV A;  1WXQ A;  1FO4 A;  1CZP A;  2M56 B;  1QOB A;  4HRO A;  3AH7 A;  1JAL A;  3ABV B;  1UWM A;  1IUE A;  1XLP A;  3AE2 B;  2AX5 A;  2L83 A;  2W3S A;  3AM9 A;  3KWL A;  2PKO A;  3ETR A;  2WDQ B;  2BT6 A;  5AUI A;  1NVI D;  3FAH A;  1GTE A;  1V8C A;  1AYF A;  1SIJ A;  3W5V B;  1YJJ A;  2G1E A;  2N0S B;  4ITK A;  1GPX A;  1PDX A;  3HUI A;  4YSX B;  1XLN A;  5H8Y E;  2PIA A;  4JX1 C;  3VR9 B;  5MPO A;  3P4Q B;  2WDR B;  1RYJ A;  1YQ3 B;  1NYR A;  1N5X A;  2MJD A;  4N6E B;  2PVG C;  1ZUD 2;  1EWY C;  3AV8 A;  5C2T B;  1E6E B;  1JQ4 A;  2MH7 A;  1RWS A;  1QLB B;  1N63 A;  3HRD D;  3AE8 B;  4USA A;  4YTN B;  2WU2 B;  1VDV A;  1QOA A;  1YQ4 B;  3RPF C;  2LEK A;  1FIQ A;  1FFU A; 
#chains in the Genus database with same CATH topology
 1YOV B;  4F1S A;  1WGK A;  2CJN A;  1PUT A;  1VR9 A;  3H9D A;  4C7Y A;  2LVP A;  3UI3 A;  4RGM A;  3PSE B;  2WXN A;  3B1L X;  1WM2 A;  1T6B X;  4GSW A;  1FXA A;  2RD0 A;  3ZO5 B;  2L32 A;  1JRO A;  5HHD G;  3SHQ A;  1L5P A;  2REX A;  4B0M A;  3AE4 B;  1TS3 A;  2KWC A;  2WXI A;  1NYQ A;  1B1Z A;  1UZX B;  3Q8A A;  4MH8 A;  2MCN B;  2IDY A;  4W9J A;  1WJU A;  4YTP B;  4E74 A;  5E6O A;  3QQ8 B;  2IYD B;  2W55 A;  3NOB A;  3N20 C;  3WAP A;  3R8B A;  2DWQ A;  1TZ1 A;  2W54 A;  1PQS A;  2JY6 A;  3P1M A;  1L4D B;  1QOF A;  3H6N A;  3PGE A;  4XGA B;  3AED B;  4LNK A;  3RD2 A;  1J7B A;  4HPP A;  1WWT A;  1E7U A;  2MJ3 A;  3PRM B;  4FXC A;  1UBI A;  1GNU A;  1UGM A;  3BII D;  3MC0 B;  2KMC A;  3IT4 B;  3TEY A;  3GZN B;  3CSF A;  3GE8 C;  2RR9 A;  3DWG C;  4L23 A;  1L6U A;  2G45 B;  1CZP A;  3ONS A;  4RFB A;  4XE0 A;  2AX5 A;  1GC7 A;  4WWO A;  3SDL C;  2PIA A;  5I4D A;  1EWY C;  3I9V 1;  1Z5S B;  2BKF A;  2GBN A;  4USA A;  4YTN B;  1F77 A;  1WH3 A;  3TCA A;  3RPF C;  1LM8 B;  1TTN A;  2G9H D;  3VAW A;  1DOY A;  3ZTD A;  1TS2 A;  1EM7 A;  3L08 A;  1V1P A;  5C23 A;  2WS3 B;  1JRP A;  2DBY A;  3N1Z C;  2JZP A;  3RNA C;  1ZXI A;  4FHJ A;  4RF0 A;  4LLG M;  3NS1 A;  4AOF A;  4G3X B;  1WXA A;  3ZVV A;  4US9 A;  3NVW A;  1SE2 A;  3N9Y C;  2EKE C;  2FUG 1;  4EE2 A;  3RZF A;  4IDI A;  2K39 A;  3PPA A;  1C76 A;  3VTU A;  4HVB A;  1ZP0 B;  2JRH A;  4GIV A;  2KLC A;  4KIK A;  3KQ4 A;  3N3K B;  3RI7 C;  3KUD B;  3QHT A;  3AEC B;  2ICI A;  3PLV A;  4W9E A;  3AE7 B;  1YJI A;  4IC7 B;  4MEM A;  4OVU A;  2KDF B;  3UIN B;  1KRH A;  1WYW B;  3U7D A;  1SXT A;  2ACZ B;  1C77 A;  1C4P A;  1WM3 A;  2RDB C;  2GBJ A;  3OG5 A;  1FCL A;  3Q3F A;  2WX0 A;  3B9J A;  1LFD A;  4W9C A;  3H7P A;  2KAC A;  1VZ6 A;  3CMM B;  4RGN A;  2WXP A;  2LGD A;  2BYV E;  3M95 A;  2BKR B;  1JRU A;  4OW0 A;  2J53 A;  1WMH B;  4CQN A;  2JXX A;  3WAO A;  4B0E A;  4OZC A;  1BUI C;  1K52 A;  2QC8 A;  4WJN A;  1JQ4 A;  1TIF A;  2FID A;  1UF0 A;  1CK1 A;  1WX9 A;  4G50 A;  3DVN V;  1N60 A;  1ZKH A;  4RGT A;  1ZXH A;  4K81 A;  2DAF A;  2VZK D;  2I2Y A;  4FJY A;  2LXC A;  4N9F 4;  3CWI A;  3GP7 A;  4FAD A;  2XN9 C;  1XCT L;  3DBR I;  3AEA B;  2LGX A;  4TQ1 A;  2TSS A;  5GMV A;  2CHZ A;  4DHJ B;  1GUA B;  1LXD A;  2G4S A;  1VLB A;  2W9N A;  2FBW B;  2ZVN A;  1QIL A;  2KWU B;  4RNA A;  2IGD A;  2XK5 B;  4DHZ B;  3I3T B;  4XDC A;  2J42 A;  1QF6 A;  2MBE A;  2KTR A;  1V5T A;  5D94 A;  4RMA A;  2NBV B;  3L4P A;  4BBN F;  3PZD A;  3Q3J A;  1D4B A;  2B76 B;  3MFG A;  2W82 A;  2ONQ A;  3I63 C;  4WQM A;  2L8J A;  2K8B A;  1Y8R C;  4CHK A;  1OEY A;  2D10 A;  2O6V D;  3RNC C;  1R4M I;  3R3M A;  4ZDV A;  4ICU A;  4LJO B;  1YQB A;  2PTL A;  1AYF A;  2KDI A;  2SEB D;  3M63 B;  1PDX A;  2V4L A;  2A4Z A;  4JX1 C;  2O6V A;  3SU8 X;  1V2Y A;  2NBW B;  4I6N B;  3NZ3 A;  2IGG A;  2DNF A;  4KGS A;  3EHV A;  4FJZ A;  3GE3 C;  2HDE A;  3AMZ A;  1MFW A;  4G11 A;  5BMG A;  1PFD A;  1XT9 B;  5L83 A;  2WNM A;  4REZ A;  2ZJD A;  2LRU A;  4MSQ B;  2WXH A;  2N7D A;  2PMV A;  3UF8 A;  4JIO U;  4JWU C;  4JPS A;  1MVK A;  2NPT A;  1D5Z C;  1FNU A;  1HQR D;  3FIL A;  4ZHP A;  2DYB A;  2Y5P A;  2WHI A;  1F9J A;  3PRZ A;  3TSS A;  2K8H A;  1WYG A;  4GXB A;  1L0V B;  3KVF B;  1VCB A;  3BK1 A;  2BBC A;  4LNF A;  2BS2 B;  1YD8 U;  1IYF A;  3WAL A;  2LGI A;  2FIF A;  1FFV A;  1SE4 A;  1L6V A;  1V9J A;  2ZPN A;  3NVY A;  4HDO A;  3NY5 A;  3IBE A;  1L4Z B;  2L0F A;  4XZ4 A;  1C4C A;  4UDU C;  4AUQ C;  4XWT A;  2LHE A;  1VRA B;  4DDI D;  2N9E B;  3ZNZ B;  3ZJT A;  2HJ8 A;  2Z59 B;  4ZRP A;  2IPK D;  1YMH E;  3B0A A;  2ON8 A;  2YVC A;  1I4X A;  1MJD A;  4A9A A;  1C9F A;  2KHW B;  1KF6 B;  3W2D A;  1UUP A;  3VHT C;  3ZRF A;  5AUI A;  2BT6 A;  4BOS C;  2PEA A;  5G2N A;  3L13 A;  5BMH A;  4BZA A;  2WDR B;  2FCN A;  4ZYS A;  3H7S A;  3SEB A;  2KX3 A;  3HRD D;  3WAN A;  4IUM B;  4BVU C;  1TZO A;  1WRD B;  3A4S C;  2IBI B;  1IBX A;  2KC1 A;  1WGG A;  3R7Q A;  2IO1 B;  1NI3 A;  5CHW A;  1B9R A;  4YSZ B;  2M8S A;  1XEE A;  3PRE A;  1RFK A;  1OQR A;  3IXS A;  4PS7 A;  4B9K A;  2AQ2 B;  2SAK A;  2WGS A;  3VR8 B;  3MHS D;  2J0M A;  4ICV A;  4BBN C;  2GMI C;  4IM3 A;  1A5R A;  3ECI A;  1K51 A;  1L0X B;  3AU4 A;  4E71 A;  2MBH A;  1R4N B;  2PJH A;  4I6L B;  4WJO A;  4ANV A;  1G6J A;  2KX0 A;  1SE9 A;  2KMM A;  5LNK 1;  3VQI A;  3A4R A;  3BYY B;  4KV2 A;  3U2S C;  1OEY J;  2N9K A;  2K3U A;  3NUH B;  3A9J B;  1RAX A;  2QMT A;  3HM6 X;  1M94 A;  1UWX A;  1UEL A;  3MC8 A;  2KQ7 A;  2JZZ A;  1CQV A;  1QT9 A;  2X8X X;  1WX7 A;  1JWU D;  1MG4 A;  2KK8 A;  2R2Q A;  2OJW A;  4TQ0 A;  2MHJ A;  1VJK A;  5CX3 A;  3L0W B;  1TY0 A;  2FUH B;  3NS8 A;  3PVL A;  3SFD B;  4MEL A;  2WX1 A;  3VUY A;  4ZYN A;  2RGF A;  3VH4 B;  3ABV B;  4URK A;  3QAR A;  3APC A;  3RNG C;  1FXT B;  4ITK A;  1D5M C;  2ZPY A;  2PVG C;  1P9D U;  1MHX A;  3K9O B;  3QC8 B;  3T3N A;  3AE8 B;  4GOC A;  1QOA A;  2WXR A;  2L00 B;  4DXG A;  2JX5 A;  1ENF A;  3ZJV A;  2BW2 A;  2B3A A;  3VUX A;  3EGR A;  3LDZ E;  2KDB A;  2VH1 A;  5EE0 A;  3AB5 A;  2M0X A;  4NJ7 A;  1ZW7 A;  1RLF A;  3VVW B;  2MWS B;  1FM0 D;  4PYZ A;  4YT0 B;  3P4R B;  4BKT A;  4RH6 A;  1EU4 A;  1WGH A;  5FR3 A;  3HVZ A;  3R2I A;  2ZCC A;  2K1F A;  1E8X A;  2R2O A;  4ZRJ A;  4LK0 M;  1ESF A;  5IOI A;  1FCC C;  3RUI B;  3PZ8 A;  3BYT B;  3RT3 B;  1SB3 C;  1ISN A;  1JWS D;  1YX5 B;  2BYF A;  3B2F A;  3URY A;  2INN E;  2XEW A;  3NHE B;  1WGR A;  1L7Y A;  4EFO A;  3B08 A;  2JWU A;  2IO0 B;  1L2N A;  4KZC A;  4TMA B;  3GZN I;  4YXD B;  1SIF A;  4WAF A;  5D3I B;  2K6Q A;  5GXG B;  5IAA C;  2MBO A;  3EA6 A;  4OHJ A;  1WJN A;  1QZE A;  1WXQ A;  4JGH B;  1PGA A;  4HJK A;  2JF5 A;  1JAL A;  4KKJ A;  1GTE A;  2QSD A;  1SIJ A;  2G1E A;  2KZR A;  1RYJ A;  3MHZ A;  2BVC A;  1LO5 D;  2HD5 B;  2LXA A;  5E6P A;  2L7R A;  5D3D A;  3MC9 A;  1TBE A;  3BVZ A;  4J3O D;  2NS5 A;  3B2G A;  1GG3 A;  4WIP A;  2BYT A;  3RN9 C;  5TR5 A;  3E9S A;  3DVG Y;  1WRI A;  4MH0 E;  2DZJ A;  4ZRK A;  2GB1 A;  2C7N B;  4NQK E;  5EDS A;  2Y3A A;  4KZ0 A;  4GLS C;  1KLV A;  4W9I A;  4HPM B;  3LB8 C;  2LJI A;  1MPE A;  2BPS A;  1J8C A;  4WQO B;  3WIM A;  4W9G A;  1SE3 A;  1V1P B;  1TKE A;  2V1Y A;  5IO9 A;  5BYS A;  4DBG A;  2JRI B;  5LLI A;  3W1S A;  2ZNV C;  4LDT D;  2J4X A;  2V0G A;  2FCQ A;  1V81 A;  1OQQ A;  2IO3 B;  2FE8 A;  1BXT A;  2I38 A;  4HRS A;  1XO3 A;  4JE3 B;  1E10 A;  2QCZ A;  3R66 C;  4C00 A;  2IND C;  1YX6 B;  2LAS A;  1AN8 A;  4KIK B;  1UD7 A;  3DDC B;  2WU5 B;  3PTF C;  3EFC A;  2KC2 A;  4EZK A;  5KHO A;  4M0W A;  4GDK A;  5DPS A;  3QIJ A;  1QOB A;  3AE2 B;  3IG3 A;  1E8Z A;  4PK1 A;  4DXF A;  3AXC A;  2LWP A;  4Q2J A;  5L95 C;  3P4Q B;  2KYW A;  3PHX B;  2C7H A;  4OZA A;  5HG2 A;  1NBF C;  2FCM A;  2AQ3 B;  4KVG B;  1Q1O A;  2LEK A;  1S3S G;  4OVZ A;  4GMV A;  5EE1 A;  2EMT A;  4A20 A;  4MT5 A;  4TKN A;  3HIZ A;  3VTV A;  3H7P B;  5BO4 B;  3AEB B;  3N1X C;  1BML C;  3PT2 B;  4WUR A;  1SF0 A;  4EUT A;  3MJ5 A;  3NJT A;  1WJ6 A;  1SBB B;  1WR6 E;  3A33 B;  3I5J C;  2ZW1 A;  2WXL A;  2NBU A;  3L54 A;  3JSV A;  3OAW A;  3KUZ A;  3M3J A;  1FMA D;  1E7V A;  3ZJU A;  5TSS A;  3ML9 A;  4IWQ A;  4US8 A;  4O1N A;  2PVO D;  5CHV C;  2BF8 B;  4MM3 A;  2KN5 A;  2NVU I;  1EO6 A;  1M4V A;  1FNV A;  4CO7 A;  4ASW C;  2E3T A;  2KVZ A;  2V3P A;  2N4F A;  1SJE D;  3DBL B;  1WX8 A;  2D3C A;  2AYO B;  4KDL B;  2LD9 A;  4II3 B;  4G0N B;  5DPR A;  1RM6 C;  1NEK B;  3W5U B;  2WLB A;  3QCA A;  2VZK B;  1GJZ A;  4WWM A;  3PRP B;  1Q5W B;  3Q2A C;  1XD3 B;  1F0Z A;  4B95 A;  1JML A;  1Y56 A;  1YNT E;  2DAJ A;  2K0P A;  3OLM D;  4NJ6 A;  5AZH A;  4IWO A;  3TMP B;  2Z0E B;  2L83 A;  3AM9 A;  4K1R B;  1WR1 A;  3KYC D;  2LMC A;  1P3Q U;  4GDL A;  3U30 A;  1DYQ A;  4NPN A;  2INP E;  3AV8 A;  3V62 A;  3WA0 A;  1E6E B;  2N9X A;  1RWS A;  1PGB A;  2KDM A;  3Q3N C;  1FIQ A;  3X23 A;  2V4I B;  1A70 A;  1EF5 A;  2KQS A;  4W9H A;  1T0S C;  2BS4 B;  1C3T A;  3ZIM A;  1ZPS A;  2N1V A;  3RCZ A;  5JHA A;  1Q0W B;  1WJ4 A;  3EUB 2;  4P16 A;  3AI5 A;  1FD6 A;  1ACC A;  2RSU A;  2L1A A;  5D7G A;  2O6V B;  3QJZ A;  5LXI B;  2INC C;  1Z2M A;  4L1B A;  2Z0D B;  2GBK A;  3WAM A;  1E7P B;  2J7Q B;  2KXJ A;  2XNA C;  2V9H A;  1I7H A;  4JWS C;  4HLE A;  4X57 B;  1XCQ L;  2QIL A;  3Q8C A;  4GU2 A;  1T5X D;  1ZOY B;  3DWM A;  2PW9 A;  2O2V B;  3P4P B;  4RGO S;  2JWZ A;  5AZG A;  4C80 A;  4JL9 A;  1TYG B;  3EEC A;  5IKC M;  2K5P A;  3V61 A;  1STE A;  2JSV X;  3AEE B;  2DZI A;  1P7F A;  2G3Q B;  4W9K A;  1YN4 A;  5EE9 A;  2DX5 B;  2KJR A;  4AS1 A;  3PV1 A;  1VD2 A;  1HA5 A;  4KSK C;  1WF9 A;  1K50 A;  3RNE C;  3BK2 A;  3DVN U;  3PHW B;  3NZU A;  2QJL A;  3QX1 A;  3P2B A;  3ZKJ C;  3V6C B;  3NG0 A;  3ZDT A;  4HRO A;  1KM7 A;  1XLP A;  5DPW A;  4RCO A;  4FLH A;  2JYT A;  3T3O A;  1LQB A;  1OGW A;  4ANX A;  1C1Y B;  2KFK A;  5H8Y E;  2LGY A;  4IW0 A;  3S2A A;  1HTQ A;  1N5X A;  2YLM A;  1P98 A;  2HJ1 A;  4IM2 A;  3N30 A;  4DDG D;  3ZDM C;  1VDV A;  2WU2 B;  3ZUN A;  3ZXR A;  5JHB A;  2AEH A;  4K3B A;  4C56 C;  4K7W A;  4XWW A;  4BKG A;  3CIR B;  2KWV B;  3BWU D;  3PS6 A;  1UBQ A;  2L52 A;  4DWF A;  2EKI A;  1WE6 A;  5HI1 A;  1BT0 A;  2K8C A;  3DHI C;  5H92 C;  1J19 A;  1R4N I;  2RDH A;  3Q69 A;  2C5L C;  3OJ3 A;  2WXO A;  3MP9 A;  4FHK A;  2LVO A;  1V80 A;  4KKI A;  3VDZ A;  3P4S B;  4E3C A;  1H7X A;  1Q10 A;  4HPL B;  3LYY A;  2KQ4 X;  2WYQ A;  4FA6 A;  4N58 A;  1KJT A;  3VXW A;  1EUV B;  3TIX A;  5IN7 A;  1IBX B;  3KYD D;  4YWG G;  1ROE A;  3RFZ B;  2HTM E;  1EF1 A;  3ENE A;  3V60 A;  1IGD A;  4N59 A;  1PGX A;  4YSY B;  2OJR A;  3Q6B A;  1D6E C;  3GS2 A;  1SEB D;  1J7C A;  4FBJ B;  2WDT B;  1NEN B;  3ZNI D;  2BQQ A;  1HXY D;  4EEW A;  1ZDX A;  4MGI E;  5E6J A;  2OHF A;  3IVF A;  4BKS D;  2L0T A;  2KAJ A;  3A1Q A;  2AL6 A;  2R61 A;  3TEW A;  5FKA C;  2E6X A;  1R7S A;  2XBB C;  4BKS A;  1HZ6 A;  1F2R C;  1YN3 A;  4NAW A;  1PYW D;  3FC4 A;  3UGB B;  3VRA B;  1V86 A;  3DHH C;  4W9D A;  2GRI A;  4C4V A;  2KDE B;  3MTN B;  1GC6 A;  1KLG D;  3HUI A;  2LUE A;  4AJW A;  3RUL A;  2Z8L A;  2MH7 A;  4EZJ A;  4ARI A;  2M17 A;  2BWF A;  1I4H A;  1YQ4 B;  3W9C B;  4DHZ E;  1FEH A;  3K9P B;  3IHP C;  3U8Z A;  1E0Z A;  3HHM A;  4M01 A;  4MJS A;  4A90 A;  3VH3 B;  4DQO C;  3IFW B;  3SD5 A;  3AEG B;  2WXG A;  5HFY A;  3GOE A;  3UQB A;  2GLS A;  3AE1 B;  3ZYY X;  2D3B A;  3KH0 A;  4M8M A;  2MP2 B;  4ANU A;  3RZW C;  4ACF A;  3KLS X;  3JW0 X;  4IOI E;  1TS5 A;  4HXD A;  1TKY A;  4W9L A;  2K22 A;  1VZ7 A;  1JW9 D;  2Y5B B;  1TJE A;  1ET6 A;  3EC8 A;  4TUU A;  1E90 A;  1TS4 A;  1WGY A;  3ZGZ A;  2QEJ C;  1GT8 A;  2DHZ A;  4LNN A;  2N7E A;  5CTR C;  2X38 A;  1RFA A;  4F7Z A;  5EE3 A;  3DVG X;  3HVD A;  2IGH A;  2JUO A;  4K7S A;  2CS4 A;  5BYR A;  2FCS A;  4KSL C;  3P42 A;  3CST A;  3A9K A;  1NI2 A;  2KO3 A;  2GBR A;  4HDQ A;  2KKC A;  1WGD A;  2JVC A;  4R3D A;  3AN1 A;  2BGF A;  1YN5 A;  1L0Y B;  2RPQ A;  3HM3 A;  1FO4 A;  2D07 B;  3FKY A;  1F52 A;  2WXQ A;  3ML8 A;  3ETR A;  2C7M B;  3Q3O C;  4MDK E;  4ZRI A;  3V6E B;  1EU3 A;  1YJJ A;  4AP4 C;  4OZB A;  5J2R A;  2J0J A;  3H1U A;  4MGK E;  4KGR A;  1OQY A;  3AE9 B;  2Y5C A;  4RM8 A;  3KW5 B;  4A3O A;  5G5H A;  3VFK A;  3AU5 A;  2RMM A;  1FRR A;  3R2T A;  4XX5 A;  2KOX A;  1GAQ B;  1N62 A;  3RYT A;  1CMX B;  3V05 A;  1AW7 A;  2KVR A;  1GB4 A;  2CU1 A;  4HJG E;  2V3S A;  1IPG A;  3TEZ A;  1XQQ A;  3W1S C;  5BYQ A;  1P0R A;  1YIW A;  4DXA B;  3P63 A;  3W1Y A;  5T8I A;  3TEX A;  4HKQ A;  3BVM A;  1MG8 A;  2IZV B;  1IGC A;  2V3N A;  4LNO A;  4M8N A;  3E56 A;  4WWP A;  4D2K A;  3RNF C;  2DYO A;  2WXK A;  3KWV A;  2CR5 A;  4AWJ A;  3TBL D;  2QDF A;  4WAA A;  1N61 A;  2CHW A;  2LFI A;  1ZDV A;  2M1M A;  2ASQ A;  1E5W A;  1T3Q A;  2VRR B;  2WDV B;  2EMS A;  4BFR A;  2KAN A;  4YL8 A;  5AUK A;  3QAQ A;  2H89 B;  4JLC A;  4FN2 A;  5AZF A;  2CU3 A;  4PT5 A;  3L16 A;  1DGJ A;  4MGZ E;  2NTT A;  2IO2 B;  4TSS A;  3UIO B;  1E9M A;  4WH4 A;  4C7Z A;  2MEK A;  4L2Y A;  5C1Z A;  3BZD B;  1TKG A;  1YJ1 A;  3O65 B;  4NQL B;  3NZS A;  4PS8 A;  3RNB C;  2DYM A;  3NVV A;  2LHD A;  2WXF A;  3I57 A;  3QK0 A;  3AH7 A;  1UWM A;  3KWL A;  2JZ3 B;  3N32 A;  1NVI D;  4EKU A;  3FAH A;  1WE7 A;  4LDT B;  1GPX A;  1XLN A;  3R7R A;  3DOW A;  2A5U A;  1V5O A;  1P1A A;  1VZ8 A;  3C19 A;  2N9L A;  3HK0 A;  2KTF A;  1WZ0 A;  2CKH B;  3ZTC A;  3UQA A;  2I1K A;  1CJE A;  4S0R A;  2K6D B;  4M0W B;  4GDK B;  2GOW A;  4NJC A;  1I4P A;  4BOZ B;  3U7Z A;  5IP4 D;  4P1C C;  1J0G A;  2UWQ A;  2RDG A;  2KN4 A;  3AE5 B;  2ZZP B;  1XXG A;  2MSE D;  2YEP F;  2J52 A;  1WXV A;  3C8Y A;  3OJ4 B;  4WJP A;  3Q3M C;  4IWP A;  1C79 A;  1T0Q C;  4ZHO A;  2ZNV B;  1KLU D;  1F1H A;  2LVQ A;  3NRZ A;  4KX6 B;  3ZNG C;  1I35 A;  3H8H A;  1I42 A;  4K3C A;  1IP9 A;  1P7E A;  3DBL I;  2JPH A;  1AWD A;  4GB9 A;  2MW5 A;  1XLO A;  2IY1 B;  2N1W A;  4RF1 A;  3JSV B;  2M0A A;  1HE8 A;  2MX2 A;  1WY8 A;  3U52 E;  4MSM B;  3PO0 A;  5G55 A;  3LXF A;  5LXH A;  1DOI A;  2BS3 B;  1WMH A;  2K9X A;  3D32 A;  3VRB B;  2BB5 A;  5CHF A;  4ARC A;  3AE6 B;  4XC2 A;  4MM3 B;  4F8C B;  2MBB B;  2BTE A;  1UGJ A;  3EFU A;  1GOZ A;  4A3P A;  1IUE A;  1C78 A;  1HEZ E;  4LCD E;  4TV3 A;  2QHO A;  1X1M A;  1LGR A;  2ZW0 A;  3IAM 1;  1YQ3 B;  3RMK C;  2N7J A;  2NMQ A;  4DHJ D;  5FR6 A;  4ZOH C;  1TGZ B;  3ZLZ A;  3Q8E A;  2ZVO A;  5C3J B;  4XDD A;  3SR6 A;  5DPT A;  4KDI C;  3M62 B;  4I6P A;  2KFJ A;  2L05 A;  5J17 A;  2JYE A;  2DZK A;  2QIE B;  1FXI A;  2KTR B;  1QKZ A;  1T0R C;  1J7A A;  2XK5 A;  4GDL B;  3X0W A;  3PZ7 A;  3OWE B;  3N1Y C;  4FJV B;  1JWA D;  3GB1 A;  1UNS A;  4WJQ A;  2FNJ B;  2CJO A;  1JWM D;  5IA7 A;  2I1J A;  3IAS 1;  2LGS A;  4NNJ B;  3NVZ A;  2DEN B;  1WXS A;  2M4N A;  1JWB D;  2PE6 B;  2OED A;  1OFF A;  4QAY A;  3DBR B;  2AL3 A;  2PPH A;  3U4E G;  1H7W A;  4EZL A;  2MLB A;  4MGY E;  3TUO A;  4AQ7 A;  1GB1 A;  4NY0 A;  2FAZ A;  4IM0 A;  3TJP A;  3T9L A;  5FK9 C;  1N6Z A;  2KWD A;  1K53 A;  1FNW A;  2D11 A;  4B6W A;  3JVZ X;  1KH0 A;  2KNB A;  2IJ0 A;  4LNI A;  3APF A;  4S17 A;  3J9C A;  2D5G A;  1V49 A;  1QOG A;  2NCN A;  2JT4 B;  4JQW C;  3ZW3 A;  1WXM A;  1MI0 A;  1TT5 B;  2NPT B;  4HK2 A;  3FIL B;  4J6I A;  2O2V A;  1R4M B;  5MPO A;  2LZ6 A;  4KGT A;  1I4R A;  1ZUD 2;  5C2T B;  4IG7 B;  2OOB B;  1N63 A;  2CHX A;  2J0K A;  2EEL A;  1JCK B;  2JXT A;  2MRP A;  2KD0 A;  1EWC A;  5JH5 C;  2C9W B;  4LJP B;  3QWZ B;  2GI9 A;  1XLQ A;  1XF5 L;  3ZXV A;  3C0R B;  1AAR A;  3ZRC A;  2BYE A;  2PE9 A;  4A8X C;  2KFK B;  2UYZ B;  2LI5 A;  1RRB A;  1HZ5 A;  4RM9 A;  3PLU A;  3VTW A;  4HCN B;  5D6J B;  5E6N A;  1E8Y A;  2NTS A;  2MA9 B;  4A6Q A;  3ZQ4 A;  4FUL A;  2UU7 A;  2WXM A;  2YEP B;  1KTK A;  1SJH D;  1V6E A;  4YTM B;  4BAX A;  3ZNH B;  2KJ6 A;  2Q5W D;  4EOY A;  3DBH I;  5J18 A;  3IT6 B;  3WCQ A;  1QQR A;  4NAM A;  2LUM A;  2KLG A;  2N9P C;  3AE3 B;  4W9F A;  2WWZ A;  4P7I A;  2H88 B;  1NDD A;  3Q8B A;  1TY2 A;  1ZE3 D;  2ZEQ A;  4CYE A;  5D2M B;  3AUL A;  2W3R A;  3L10 B;  3QA8 A;  4OVV A;  2MJE A;  5JZE B;  2AWT A;  4MAC A;  3ALB A;  1GTH A;  3AEF B;  1S1Q B;  3CF4 A;  2KJH B;  3BIN A;  3T8M A;  2KMA A;  2DLB A;  1ET9 A;  3JYU A;  1WSP A;  3DBH B;  2M56 B;  2HTH A;  5G5G A;  5AEK B;  2WDQ B;  2BWE S;  1V8C A;  3W5V B;  1D5X C;  1K8R B;  4PS3 A;  1NYR A;  2D2Q A;  4N6E B;  3L17 A;  1UH6 A;  1D3Z A;  2D3G A;  3A1Q B;  4A55 A;  2WXJ A;  2KT7 A;  1FFU A;  3TL5 A;  2WP9 B;  5HKH A;  4NAW B;  3A9J A;  3UIP B;  1OTR B;  4GGQ A;  1SGH A;  3BVG A;  1H8C A;  1WZ3 A;  4ZRQ A;  3DCG A;  2MQJ A;  4C4V B;  4M02 A;  2VH2 A;  2K25 A;  1V1O A;  2HE7 A;  1HTO A;  4HKZ E;  1KOT A;  3MJW A;  4LTU A;  4ANW A;  1N5W A;  3DHG C;  1KFY B;  2LJ5 A;  4II2 B;  4XYC A;  1F2R I;  1WIA A;  1WI0 A;  2JQR B;  2BB6 A;  5BMI A;  4WWN A;  1H4R A;  4P1B C;  4AJY B;  5JXV A;  1FRD A;  4HEA 1;  2L3Z A;  2LRW A;  3APD A;  3CF6 E;  4MJS B;  2GBM A;  4DK5 A;  3BY4 B;  3DPD A;  1I4Q A;  1U4A A;  3Q8F A;  1DOX A;  3V3X A;  3DQV A;  4P6V F;  2G4D B;  3LJ3 A;  4GN1 A;  2DZM A;  3DBS A;  1V97 A;  1SSN A;  4M00 A;  3SFE B;  4K7U A;  2ZCB A;  3KUC B;  4HWI B;  2PLP A;  4H2A A;  5DCN A;  2C60 A;  2MP2 A;  4IKG A;  4HCP B;  2D3A A;  2L76 A;  5KHQ A;  1ZGU B;  2M19 A;  2WQY B;  4PYU A;  2IY0 B;  3Q14 C;  1C4A A;  1I4G A;  4NZL B;  1E8W A;  2W3S A;  2PKO A;  1T0Y A;  2JU6 X;  2N0S B;  4YSX B;  2NR2 A;  3VR9 B;  2MJD A;  2AQ1 B;  3VUW A;  1WFY A;  1QLB B;  2MBQ A;  3A9K B;  1MHH E;  1FPY A;  3O13 A;  2RPV A; 
#chains in the Genus database with same CATH homology
 2V4I B;  1A70 A;  1TZO A;  1WGK A;  1IBX A;  2CJN A;  1PUT A;  1CJE A;  1VR9 A;  4C7Y A;  3UI3 A;  4RGM A;  2BS4 B;  1NI3 A;  2WXN A;  4GDK B;  1B9R A;  4YSZ B;  1ZPS A;  1T6B X;  4NJC A;  1XEE A;  1FXA A;  1I4P A;  1RFK A;  1OQR A;  3EUB 2;  3IXS A;  4P16 A;  2AQ2 B;  2SAK A;  1FD6 A;  3U7Z A;  3VR8 B;  1ACC A;  2L32 A;  1JRO A;  5HHD G;  2L1A A;  1L5P A;  2RDG A;  1K51 A;  1L0X B;  2KN4 A;  3AE5 B;  4B0M A;  5D7G A;  3AE4 B;  1XXG A;  2YEP F;  1TS3 A;  2J52 A;  3C8Y A;  2KMM A;  2WXI A;  4L1B A;  1NYQ A;  1B1Z A;  1C79 A;  3Q8A A;  5LNK 1;  4MH8 A;  4ZHO A;  1E7P B;  2IDY A;  3VQI A;  3BYY B;  4YTP B;  1KLU D;  2XNA C;  3U2S C;  3NRZ A;  2N9K A;  2K3U A;  3NUH B;  4KX6 B;  1I7H A;  2QMT A;  4JWS C;  1UWX A;  2W55 A;  3H8H A;  1XCQ L;  2QIL A;  3Q8C A;  1CQV A;  1QT9 A;  3R8B A;  1T5X D;  2DWQ A;  1ZOY B;  1C9F A;  3DWM A;  2PW9 A;  1P7E A;  2W54 A;  3P1M A;  3P4P B;  4RGO S;  1JWU D;  1L4D B;  1QOF A;  1AWD A;  4C80 A;  1XLO A;  3AED B;  4RF1 A;  1J7B A;  2M0A A;  1TYG B;  3U52 E;  1WWT A;  2K5P A;  2MJ3 A;  1STE A;  3PO0 A;  4TQ0 A;  4FXC A;  1VJK A;  3LXF A;  2JSV X;  3AEE B;  1DOI A;  2BS3 B;  1P7F A;  1YN4 A;  5EE9 A;  3BII D;  2K9X A;  3MC0 B;  4AS1 A;  3IT4 B;  3TEY A;  1TY0 A;  3VRB B;  1HA5 A;  2BB5 A;  4ARC A;  3DWG C;  1K50 A;  3AE6 B;  3BK2 A;  3SFD B;  4MM3 B;  4L23 A;  1L6U A;  2QJL A;  2BTE A;  1UGJ A;  1CZP A;  1GOZ A;  4HRO A;  3ABV B;  1XLP A;  1IUE A;  2AX5 A;  4RFB A;  4XE0 A;  4RCO A;  3T3O A;  2JYT A;  1C78 A;  1HEZ E;  4ITK A;  5H8Y E;  2PIA A;  5I4D A;  1D5M C;  2ZW0 A;  3IAM 1;  1YQ3 B;  1N5X A;  2PVG C;  1EWY C;  1MHX A;  2N7J A;  3I9V 1;  3T3N A;  3AE8 B;  4USA A;  4YTN B;  2WU2 B;  1F77 A;  1VDV A;  2NMQ A;  1QOA A;  3RPF C;  2G9H D;  2WXR A;  4ZOH C;  1DOY A;  4C56 C;  4XWW A;  4DXG A;  3CIR B;  3BWU D;  3Q8E A;  2JX5 A;  5C3J B;  1EM7 A;  1TS2 A;  4XDD A;  3SR6 A;  1V1P A;  2L52 A;  2WS3 B;  1JRP A;  2DBY A;  2EKI A;  1ENF A;  2JZP A;  5HI1 A;  2JYE A;  1ZXI A;  2QIE B;  3ZJV A;  1FXI A;  5H92 C;  2BW2 A;  4RF0 A;  2RDH A;  4LLG M;  3EGR A;  3NS1 A;  3Q69 A;  1QKZ A;  5EE0 A;  1J7A A;  2WXO A;  3AB5 A;  4GDL B;  3MP9 A;  3PZ7 A;  3OWE B;  1JWA D;  3GB1 A;  4US9 A;  4KKI A;  1UNS A;  3NVW A;  3P4S B;  1FM0 D;  4YT0 B;  1H7X A;  1Q10 A;  1SE2 A;  3P4R B;  3N9Y C;  2CJO A;  1EU4 A;  3LYY A;  1JWM D;  4RH6 A;  2FUG 1;  3IAS 1;  5FR3 A;  3HVZ A;  2KQ4 X;  4EE2 A;  3R2I A;  4IDI A;  4N58 A;  1C76 A;  1ZP0 B;  3NVZ A;  1IBX B;  4YWG G;  1JWB D;  1ROE A;  3RFZ B;  2OED A;  2HTM E;  4LK0 M;  1OFF A;  3KQ4 A;  1ESF A;  1FCC C;  3PZ8 A;  1IGD A;  3BYT B;  1H7W A;  4N59 A;  3U4E G;  1PGX A;  4YSY B;  3AEC B;  2ICI A;  1SB3 C;  1JWS D;  1D6E C;  3TUO A;  4AQ7 A;  1GB1 A;  3B2F A;  3URY A;  2INN E;  3GS2 A;  5FK9 C;  3AE7 B;  1SEB D;  1J7C A;  1K53 A;  2KWD A;  1FNW A;  1NEN B;  1YJI A;  2JWU A;  1HXY D;  1KH0 A;  1ZDX A;  2IJ0 A;  5E6J A;  4TMA B;  1KRH A;  4YXD B;  2OHF A;  4WAF A;  2KAJ A;  1SXT A;  5D3I B;  2ACZ B;  1C77 A;  3J9C A;  1C4P A;  5GXG B;  2D5G A;  2R61 A;  3EA6 A;  4OHJ A;  3TEW A;  5FKA C;  2E6X A;  1FCL A;  1R7S A;  1HZ6 A;  1F2R C;  1QOG A;  1YN3 A;  3B9J A;  1PYW D;  3FC4 A;  2KAC A;  1VZ6 A;  3VRA B;  1WXQ A;  4RGN A;  1PGA A;  1MI0 A;  2GRI A;  1JAL A;  2WXP A;  4KKJ A;  1KLG D;  1GTE A;  3FIL B;  2QSD A;  1SIJ A;  2G1E A;  3HUI A;  5MPO A;  1RYJ A;  3MHZ A;  4KGT A;  1I4R A;  1ZUD 2;  2Z8L A;  5C2T B;  4OW0 A;  2J53 A;  2MH7 A;  4ARI A;  1N63 A;  4CQN A;  1LO5 D;  2EEL A;  1JCK B;  1YQ4 B;  1I4H A;  5D3D A;  2JXT A;  3W9C B;  1EWC A;  1FEH A;  4B0E A;  3BVZ A;  4J3O D;  1E0Z A;  4A90 A;  3B2G A;  4OZC A;  1BUI C;  1K52 A;  2GI9 A;  4WIP A;  4DQO C;  2BYT A;  1XLQ A;  1JQ4 A;  1XF5 L;  3E9S A;  1WRI A;  3AEG B;  2WXG A;  5HFY A;  1CK1 A;  4A8X C;  2GB1 A;  2Y3A A;  4GLS C;  3AE1 B;  1N60 A;  3ZYY X;  1HZ5 A;  3LB8 C;  4RGT A;  1ZXH A;  2VZK D;  2I2Y A;  3KLS X;  2LJI A;  1MPE A;  4IOI E;  1TS5 A;  2NTS A;  4A6Q A;  1TKY A;  3CWI A;  2K22 A;  3GP7 A;  3ZQ4 A;  2XN9 C;  1XCT L;  1VZ7 A;  3AEA B;  1JW9 D;  1TJE A;  1SE3 A;  2WXM A;  2YEP B;  4TQ1 A;  1KTK A;  1SJH D;  1V1P B;  1ET6 A;  2TSS A;  4YTM B;  1TS4 A;  1TKE A;  3ZGZ A;  5BYS A;  2QEJ C;  1GT8 A;  1VLB A;  2Q5W D;  2X38 A;  2FBW B;  1QIL A;  3W1S A;  3IT6 B;  2J4X A;  5EE3 A;  3WCQ A;  1QQR A;  4RNA A;  2IGD A;  3HVD A;  2IGH A;  2V0G A;  4NAM A;  2LUM A;  4XDC A;  2J42 A;  1QF6 A;  3AE3 B;  1OQQ A;  5BYR A;  2H88 B;  3Q8B A;  1TY2 A;  2FE8 A;  1ZE3 D;  1BXT A;  3P42 A;  3L4P A;  2I38 A;  4HRS A;  1XO3 A;  2W3R A;  4JE3 B;  2B76 B;  1D4B A;  3MFG A;  1E10 A;  2W82 A;  2MJE A;  2ONQ A;  4MAC A;  1AN8 A;  4R3D A;  1GTH A;  3AEF B;  3AN1 A;  2WU5 B;  3CF4 A;  2DLB A;  1YN5 A;  4WQM A;  1ET9 A;  1WSP A;  4M0W A;  1L0Y B;  1FO4 A;  2M56 B;  1QOB A;  2WXQ A;  3AE2 B;  5G5G A;  3ETR A;  2WDQ B;  2PTL A;  1V8C A;  1AYF A;  1EU3 A;  3W5V B;  1YJJ A;  2SEB D;  4DXF A;  1PDX A;  4Q2J A;  1D5X C;  4JX1 C;  3P4Q B;  1NYR A;  4N6E B;  4OZB A;  4OZA A;  5HG2 A;  3NZ3 A;  2IGG A;  4A55 A;  2AQ3 B;  2LEK A;  2WXJ A;  4KGR A;  4OVZ A;  1FFU A;  3AE9 B;  4KGS A;  2Y5C A;  5EE1 A;  2WP9 B;  5G5H A;  4MT5 A;  4NAW B;  2RMM A;  1FRR A;  3R2T A;  1GAQ B;  1N62 A;  3V05 A;  2HDE A;  3AMZ A;  1AW7 A;  3AEB B;  3BVG A;  1GB4 A;  5BMG A;  1BML C;  1PFD A;  4HJG E;  4ZRQ A;  2WNM A;  4WUR A;  1SF0 A;  3MJ5 A;  4REZ A;  3TEZ A;  1V1O A;  4HKZ E;  1SBB B;  5BYQ A;  2ZW1 A;  4LTU A;  2WXH A;  2WXL A;  1N5W A;  2PMV A;  1KFY B;  4JWU C;  1F2R I;  3P63 A;  4JPS A;  1MVK A;  5T8I A;  1D5Z C;  1FNU A;  1HQR D;  2JQR B;  3TEX A;  4HKQ A;  2BB6 A;  1FMA D;  5BMI A;  3FIL A;  3BVM A;  4ZHP A;  3ZJU A;  5JXV A;  1IGC A;  5TSS A;  2V3N A;  2Y5P A;  1FRD A;  4HEA 1;  3TSS A;  4US8 A;  3E56 A;  1WYG A;  1I4Q A;  4O1N A;  4D2K A;  1L0V B;  2DYO A;  2WXK A;  3KWV A;  2PVO D;  3BK1 A;  2BBC A;  3Q8F A;  1DOX A;  2BS2 B;  3V3X A;  4P6V F;  1N61 A;  2LGI A;  2LFI A;  1ZDV A;  1FFV A;  1SE4 A;  1L6V A;  1M4V A;  1FNV A;  3NVY A;  1T3Q A;  2E3T A;  2V3P A;  2WDV B;  1SJE D;  5AUK A;  1L4Z B;  2H89 B;  1V97 A;  1C4C A;  1SSN A;  1RM6 C;  4UDU C;  3SFE B;  2CU3 A;  1NEK B;  4XWT A;  2LHE A;  4PT5 A;  3W5U B;  1VRA B;  2WLB A;  2VZK B;  1DGJ A;  2PLP A;  4H2A A;  2NTT A;  4IKG A;  4TSS A;  4WWM A;  1E9M A;  4WH4 A;  4C7Z A;  2MEK A;  3ZJT A;  4ZRP A;  2IPK D;  1YMH E;  2ON8 A;  1F0Z A;  4L2Y A;  3BZD B;  1I4X A;  1TKG A;  2M19 A;  4A9A A;  1JML A;  2DYM A;  1Y56 A;  2WQY B;  1KF6 B;  1YNT E;  2LHD A;  2WXF A;  2K0P A;  1C4A A;  3I57 A;  3NVV A;  3W2D A;  1I4G A;  1UUP A;  4NZL B;  3AH7 A;  1UWM A;  3AM9 A;  2L83 A;  3KWL A;  2W3S A;  5AUI A;  2PKO A;  2BT6 A;  1NVI D;  2LMC A;  2JU6 X;  3FAH A;  2N0S B;  1GPX A;  4YSX B;  1XLN A;  3VR9 B;  5BMH A;  2MJD A;  2WDR B;  2AQ1 B;  4ZYS A;  1DYQ A;  2INP E;  3AV8 A;  3SEB A;  1E6E B;  1RWS A;  1QLB B;  1VZ8 A;  3HRD D;  1PGB A;  1MHH E;  2KDM A;  2N9L A;  3O13 A;  2RPV A;  1FIQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...