2H8MA

N-domain of grp94 in complex with the 2-iodo-neca
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
227
structure length
215
Chain Sequence
EKFAFQAEVNRMMKLIINSLYKNKEIFLRELISNASDALDKIRLISLTDENALAGNEELTVKIKCDKEKNLLHVTDTGVGMTREELVKNLGTIGTSEFLNKMTEAQTSELIGQFGVGFYSAFLVADKVIVTSKHNNDTQHIWESDSNEFSVIADPRGNTLGRGTTITLVLKEEASDYLELDTIKNLVKKYSQFINFPIYVWSSKTKTVWDWELMN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Endoplasmin
publication title N-Domain Of Grp94 In Complex With the 2-Iodo-NECA
rcsb
source organism Canis lupus familiaris
molecule tags Chaperone
total genus 64
structure length 215
sequence length 227
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-06-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02518 HATPase_c Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.565.10 Alpha Beta 2-Layer Sandwich Heat Shock Protein 90 Histidine kinase-like ATPase, C-terminal domain 2h8mA00
3R4OA 2BU5A 1KZNA 4HXWA 4EGKA 4MPCA 3CGYA 4CWRA 2WI6A 2EXLA 3HHUA 4DZYA 2YEFA 4HYMA 4ASGA 2YI5A 5IDJA 2YI0A 2WEQA 1UYEA 4UROA 3INXA 4CE3A 3VHAA 4P8OA 3JZ3A 3H80A 4O0BA 3ZXOA 5L3JA 4U7OA 2JKIA 1UYGA 4P7AA 5CTWA 4R1FA 4BQJA 2IOQA 4HY1A 2YK9A 3TUHA 2ESAA 4AWQA 1AJ6A 4R3MA 5J71A 2YE7A 3R92A 2YGEA 2FWZA 3ZXQA 5CTUA 1QZRA 3FT8A 4LWGA 2YKJA 3OWDA 4EMVA 3HYYA 3D36A 4YKYA 5C93A 4MP2A 1TIDA 2XABA 5J6AA 2YECA 2YEBA 1YETA 4XC0A 3GIGB 2VWCA 2YI7A 1AH6A 3T10A 3OMUA 1BYQA 3K99A 1UY9A 3Q5LA 4JQLA 5CTXA 2IWUA 2XJXA 3O6OA 1US7A 3B26A 1TILA 2BREA 2XX5A 3C0EA 3WQ9A 4CWSA 3Q5KA 2YEJA 2BRCA 2YE6A 4E00A 5F3KA 4HYPA 4WUCA 3CGZA 4CWQA 4YKTA 2QG0A 1AM1A 2XJJA 3VHCA 4MOTA 1Y8NA 3T0ZA 4DUHA 4EFTA 3O0IA 2H55A 3HEKA 2YJWA 4MBCA 2CCTA 2YGAA 1TBWA 1ZW9A 1ZXMA 3K97A 4KSHA 5IN9A 5BOCA 2IOPA 1PVGA 4PU9A 4QPJA 3WHAA 1JM6A 5FNDA 3R91A 2WEPA 4LWIA 3BMYA 2YKEA 1UYDA 4GEEA 4O05A 4XIPA 4I5SA 1UY8A 4H7QA 3R4PA 2WI1A 4LPBA 3A0WA 3FV5A 3ZKBA 1I5CA 2YE3A 3PEHA 4URNA 1NHJA 2BYHA 2BU8A 4XKAA 3CWVA 3OPDA 1YSRA 4XE2A 2BZ5A 4ASBA 2IWSA 4YKWA 4NH8A 4LWHA 1Y8PA 4HY6A 2XHTA 1UYLA 2O1WA 4AWOA 4EGIA 3QTFA 4QPKA 4XTJA 1Z5CA 5D6QA 2WI7A 2C2AA 4I3HA 3A0ZA 2HG1A 4E01A 1YT1A 2JJCA 2YE5A 1GJVA 3DGEA 1BXDA 3EKOA 1H7SA 4BAEA 4XKOA 3SL2A 2XDKA 4NH9A 4GFNA 4URMA 1S14A 2WI4A 4ZKIA 1B3QA 3U2KA 4B6CA 4YKXA 4CWNA 3TZ5A 4FCQA 1Z59A 3CRKA 3A0TA 2WI3A 2XHRA 2YEDA 4PL9A 4MB9A 4XDMA 4ASAA 2Q2EB 2VCIA 4L91A 4PRXA 2YEHA 3Q5JA 1YSZA 4YKUA 3ZM7A 4ASFA 3A0RA 4WUDA 3T0HA 3TZ2A 4AWPA 3HZ1A 4CE1A 4XCLA 4JASA 1AH8A 2XDUA 4W7TA 3QDDA 1YS3A 1NHHA 4CWTA 1NHIA 4FPPA 4MPEA 5M4HA 2BU6A 2VCJA 2ZDXA 3H4LA 4KSGA 4L93A 3IEDA 5M4NA 3A0XA 3EKRA 3LNUA 1QY8A 1BKNA 1BGQA 3G7BA 2YI6A 4HZ0A 4L90A 5FWKA 5M4KA 4V25A 4YKZA 3TTZA 2QF6A 2YKCA 3ZKDA 2CCUA 3G75A 3EHHA 5IDMA 2BYIA 3B28A 4FCRA 3OWBA 1YC4A 3MNRP 1S16A 2Q8GA 1UY6A 4CE2A 2PNRA 2YEAA 2IWXA 3R4MA 2XX2A 1UY7A 1UYHA 2E0AA 3C11A 5M4EA 2XCMA 2YJXA 5D7RA 4GGLA 2ZKJA 4PRVA 2CH4A 1GKZA 4X9LA 3D2RA 2FXSA 2YKIA 1UYKA 2Q8FA 2Q8HA 2IORA 2GQPA 5M4PA 2QFOA 1EI1A 5FNCA 1Y4UA 4JAUA 4O07A 3RLPA 1I5DA 4GCZA 4MP7A 4O09A 1GKXA 4BXIA 4E02A 3G7EA 2XJGA 4L8ZA 2YEIA 4XKKA 4XCJA 2YE2A 3INWA 5D7CA 3T2SA 1R62A 2HKJA 4HZ5A 3HZ5A 3BM9A 4Q20A 1B63A 1QYEA 4GT8A 4XD8A 1I58A 2YE9A 1UYIA 4H81A 4WUBA 2YGFA 3TZ0A 1UYCA 2XX4A 4H85A 3EHFA 1A4HA 3OW6A 4CWFA 4ZVIA 3R4NA 3GIEA 3B25A 4XITA 2YKBA 1UYFA 4XIRA 1Y8OA 4URLA 3B27A 2BTZA 4LP0A 4HXZA 2AKPA 1YT2A 4MPNA 3EHJA 4AS9A 2XDXA 1KIJA 2O1UA 1U0ZA 4R3AA 2YEGA 2XDLA 3GIFA 2Q8IA 4NH7A 1ID0A 2HCHA 4KP4A 3NMQA 5CTYA 4FMTA 1MX0A 3HYZA 4U93A 1Z5BA 3D0BA 4KTNA 1TC0A 4XIQA 2UWDA 5D7DA 4FCPA 2XHXA 4KFGA 2BU2A 4YKQA 4GQTA 3EHGA 2CCSA 3U2DA 3VADA 5M4MA 1I5AA 1YC1A 2FWYA 2ZBKB 4BQGA 4CWOA 1Y4SA 4JAVA 3RLQA 3GIGA 1THNA 2K5BA 1YT0A 2YE8A 4V26A 1U2OA 3TZ4A 3U67A 4U7NA 3RKZA 1MU5A 4KQVA 1H7UA 4EFUA 3CRLA 4L94A 2WI2A 5FNFA 2CG9A 3B24A 3T1KA 1TH8A 4LWEA 4LWFA 4BIZA 3K98A 1L0OA 5F5RA 1B62A 4O04A 3VHDA 2VW5A 4BIUA 2YEEA 2O1VA 1I59A 2BT0A 4YKRA 2BSMA 2GFDA 1EA6A 2ZDYA 1TC6A 2YK2A 3LPSA 4EM7A 1YC3A 1OSFA 2WI5A 5CPHA 1ZXNA 2CGFA 5D6PA 4K4OA 4EGHA 1I5BA 1UYMA 3PEJA 3K60A 5GGZA 1YERA 3RLRA 4EEHA 2XD6A 1AMWA 1ZWHA 2XK2A 2WERA 2YE4A 1YESA 1Z5AA 5CF0A 2QG2A 3O2FA 2H8MA 5BODA 4B7PA 3KE6A 2FYPA 2BU7A 4CWPA 2XDSA 3FT5A 3A0YA
chains in the Genus database with same CATH superfamily
3R4OA 2BU5A 1KZNA 4HXWA 4EGKA 4MPCA 3CGYA 4CWRA 2WI6A 2EXLA 3HHUA 4DZYA 2YEFA 4HYMA 4ASGA 2YI5A 5IDJA 2YI0A 2WEQA 1UYEA 4UROA 3INXA 3CYGA 3VHAA 4CE3A 4P8OA 3JZ3A 3H80A 4O0BA 3ZXOA 5L3JA 4U7OA 2JKIA 1UYGA 4P7AA 5CTWA 4R1FA 4BQJA 2IOQA 4HY1A 2YK9A 3TUHA 2ESAA 4AWQA 1AJ6A 4R3MA 5J71A 2YE7A 3R92A 2YGEA 2FWZA 3ZXQA 5CTUA 1QZRA 3FT8A 4LWGA 2YKJA 3OWDA 4EMVA 3HYYA 3D36A 4YKYA 5C93A 4MP2A 2C1IA 1TIDA 2XABA 5J6AA 2YECA 2YEBA 1YETA 4XC0A 3GIGB 2VWCA 2YI7A 1AH6A 3T10A 3OMUA 1BYQA 3K99A 1UY9A 3Q5LA 4JQLA 5CTXA 2IWUA 2XJXA 3O6OA 1US7A 3B26A 1TILA 2BREA 2XX5A 3C0EA 3WQ9A 4CWSA 3Q5KA 2YEJA 2BRCA 2YE6A 4E00A 5F3KA 4HYPA 4WUCA 3CGZA 4CWQA 4YKTA 2QG0A 1AM1A 2XJJA 3VHCA 4MOTA 1Y8NA 3T0ZA 4DUHA 4EFTA 3O0IA 2H55A 3HEKA 2YJWA 4MBCA 2CCTA 2YGAA 1TBWA 1ZW9A 1ZXMA 3K97A 4KSHA 5IN9A 5BOCA 2IOPA 1PVGA 4PU9A 4QPJA 3WHAA 1JM6A 5FNDA 3R91A 2WEPA 4LWIA 3BMYA 2YKEA 1UYDA 4GEEA 4O05A 4XIPA 4I5SA 1UY8A 4H7QA 3R4PA 2WI1A 4LPBA 3A0WA 3FV5A 3ZKBA 1I5CA 2YE3A 3PEHA 4URNA 1NHJA 2BYHA 2BU8A 4XKAA 3CWVA 3OPDA 1YSRA 4XE2A 2BZ5A 4ASBA 2IWSA 4YKWA 4NH8A 4LWHA 1Y8PA 2C1GA 4HY6A 2XHTA 1UYLA 2O1WA 4AWOA 4EGIA 3QTFA 4QPKA 4XTJA 1Z5CA 5D6QA 2WI7A 2C2AA 4I3HA 3A0ZA 2HG1A 4E01A 1YT1A 2JJCA 2YE5A 1GJVA 3DGEA 1BXDA 3EKOA 1H7SA 4BAEA 4XKOA 2FTKA 3SL2A 2XDKA 4NH9A 4GFNA 4URMA 1S14A 2WI4A 4ZKIA 1B3QA 3U2KA 4B6CA 4YKXA 4CWNA 3TZ5A 4FCQA 1Z59A 3CRKA 3A0TA 2WI3A 2XHRA 2YEDA 4PL9A 4MB9A 4XDMA 4ASAA 2Q2EB 2VCIA 4L91A 4PRXA 2YEHA 3Q5JA 1YSZA 4YKUA 3ZM7A 4ASFA 3A0RA 4WUDA 3T0HA 3TZ2A 4AWPA 3HZ1A 4CE1A 4XCLA 4JASA 1AH8A 2XDUA 4W7TA 3QDDA 1YS3A 1NHHA 4CWTA 1NHIA 4FPPA 4MPEA 5M4HA 2BU6A 2VCJA 2ZDXA 3H4LA 4E72A 4KSGA 4L93A 3IEDA 5M4NA 1IXMA 3A0XA 3EKRA 3LNUA 1QY8A 1BKNA 1BGQA 3G7BA 2YI6A 4HZ0A 4L90A 5FWKA 5M4KA 4V25A 4YKZA 3TTZA 2QF6A 2YKCA 3ZKDA 2CCUA 3G75A 3EHHA 5IDMA 2BYIA 3B28A 4FCRA 3OWBA 1YC4A 3MNRP 1S16A 2Q8GA 1UY6A 4CE2A 2PNRA 2YEAA 2IWXA 3R4MA 2XX2A 1UY7A 1UYHA 2E0AA 3C11A 5M4EA 2XCMA 2YJXA 5D7RA 4GGLA 2ZKJA 4PRVA 2CH4A 1GKZA 4X9LA 3D2RA 2FXSA 2YKIA 1UYKA 2Q8FA 2Q8HA 2IORA 2GQPA 5M4PA 2QFOA 1EI1A 5FNCA 1Y4UA 4JAUA 4O07A 3LMMA 3RLPA 1I5DA 4GCZA 4MP7A 4O09A 1GKXA 4BXIA 4E02A 3G7EA 2XJGA 4L8ZA 2YEIA 4XKKA 4XCJA 2YE2A 3INWA 5D7CA 3T2SA 1R62A 2HKJA 4HZ5A 3HZ5A 3BM9A 4Q20A 1B63A 1QYEA 4GT8A 4XD8A 1I58A 2YE9A 1UYIA 4H81A 4WUBA 2YGFA 3TZ0A 1UYCA 2XX4A 4H85A 3EHFA 1A4HA 3OW6A 4CWFA 4ZVIA 3R4NA 3GIEA 3B25A 4XITA 2YKBA 1UYFA 4XIRA 1Y8OA 4URLA 3B27A 3S5TA 2BTZA 4LP0A 4HXZA 2AKPA 1YT2A 4MPNA 3EHJA 4AS9A 2XDXA 1KIJA 2O1UA 1U0ZA 4R3AA 2YEGA 2XDLA 3GIFA 2Q8IA 4NH7A 1ID0A 2HCHA 4KP4A 3NMQA 5CTYA 4FMTA 1MX0A 3HYZA 4U93A 1Z5BA 3D0BA 4KTNA 1TC0A 4XIQA 2UWDA 5D7DA 4FCPA 2XHXA 4KFGA 2BU2A 4YKQA 4GQTA 3EHGA 2CCSA 3U2DA 3VADA 5M4MA 1I5AA 1YC1A 2FWYA 2ZBKB 4BQGA 4CWOA 1Y4SA 4JAVA 3RLQA 3GIGA 1THNA 2K5BA 1YT0A 2YE8A 4V26A 1U2OA 3TZ4A 3U67A 4U7NA 1F51A 3RKZA 1MU5A 4KQVA 1H7UA 4EFUA 3CRLA 4L94A 2WI2A 5FNFA 2CG9A 3B24A 3T1KA 1TH8A 4LWEA 4LWFA 4BIZA 3K98A 5JENA 1L0OA 5F5RA 1B62A 4O04A 3VHDA 2HHIA 2VW5A 4BIUA 2YEEA 2O1VA 1I59A 2BT0A 4YKRA 2BSMA 2GFDA 1EA6A 2ZDYA 1TC6A 2YK2A 3LPSA 4EM7A 1YC3A 1OSFA 2WI5A 5CPHA 1ZXNA 2CGFA 5D6PA 4K4OA 4EGHA 1I5BA 1UYMA 3PEJA 3K60A 5GGZA 1YERA 3RLRA 4EEHA 2XD6A 1AMWA 1ZWHA 2XK2A 2WERA 2YE4A 1YESA 1Z5AA 5CF0A 2QG2A 3O2FA 2H8MA 5BODA 4B7PA 3KE6A 2FYPA 2BU7A 4CWPA 2XDSA 3FT5A 3A0YA
chains in the Genus database with same CATH topology
3R4OA 2BU5A 1KZNA 4HXWA 4EGKA 4MPCA 3CGYA 4CWRA 2WI6A 2EXLA 3HHUA 4DZYA 2YEFA 4HYMA 4ASGA 2YI5A 5IDJA 2YI0A 2WEQA 1UYEA 4UROA 3INXA 4CE3A 3VHAA 4P8OA 3JZ3A 3H80A 4O0BA 3ZXOA 5L3JA 4U7OA 2JKIA 1UYGA 4P7AA 5CTWA 4R1FA 4BQJA 2IOQA 4HY1A 2YK9A 3TUHA 2ESAA 4AWQA 1AJ6A 4R3MA 5J71A 2YE7A 3R92A 2YGEA 2FWZA 3ZXQA 5CTUA 1QZRA 3FT8A 4LWGA 2YKJA 3OWDA 4EMVA 3HYYA 3D36A 4YKYA 5C93A 4MP2A 1TIDA 2XABA 5J6AA 2YECA 2YEBA 1YETA 4XC0A 3GIGB 2VWCA 2YI7A 1AH6A 3T10A 3OMUA 1BYQA 3K99A 1UY9A 3Q5LA 4JQLA 5CTXA 2IWUA 2XJXA 3O6OA 1US7A 3B26A 1TILA 2BREA 2XX5A 3C0EA 3WQ9A 4CWSA 3Q5KA 2YEJA 2BRCA 2YE6A 4E00A 5F3KA 4HYPA 4WUCA 3CGZA 4CWQA 4YKTA 2QG0A 1AM1A 2XJJA 3VHCA 4MOTA 1Y8NA 3T0ZA 4DUHA 4EFTA 3O0IA 2H55A 3HEKA 2YJWA 4MBCA 2CCTA 2YGAA 1TBWA 1ZW9A 1ZXMA 3K97A 4KSHA 5IN9A 5BOCA 2IOPA 1PVGA 4PU9A 4QPJA 3WHAA 1JM6A 5FNDA 3R91A 2WEPA 4LWIA 3BMYA 2YKEA 1UYDA 4GEEA 4O05A 4XIPA 4I5SA 1UY8A 4H7QA 3R4PA 2WI1A 4LPBA 3A0WA 3FV5A 3ZKBA 1I5CA 2YE3A 3PEHA 4URNA 1NHJA 2BYHA 2BU8A 4XKAA 3CWVA 3OPDA 1YSRA 4XE2A 2BZ5A 4ASBA 2IWSA 4YKWA 4NH8A 4LWHA 1Y8PA 4HY6A 2XHTA 1UYLA 2O1WA 4AWOA 4EGIA 3QTFA 4QPKA 4XTJA 1Z5CA 5D6QA 2WI7A 2C2AA 4I3HA 3A0ZA 2HG1A 4E01A 1YT1A 2JJCA 2YE5A 1GJVA 3DGEA 1BXDA 3EKOA 1H7SA 4BAEA 4XKOA 3SL2A 2XDKA 4NH9A 4GFNA 4URMA 1S14A 2WI4A 4ZKIA 1B3QA 3U2KA 4B6CA 4YKXA 4CWNA 3TZ5A 4FCQA 1Z59A 3CRKA 3A0TA 2WI3A 2XHRA 2YEDA 4PL9A 4MB9A 4XDMA 4ASAA 2Q2EB 2VCIA 4L91A 4PRXA 2YEHA 3Q5JA 1YSZA 4YKUA 3ZM7A 4ASFA 3A0RA 4WUDA 3T0HA 3TZ2A 4AWPA 3HZ1A 4CE1A 4XCLA 4JASA 1AH8A 2XDUA 4W7TA 3QDDA 1YS3A 1NHHA 4CWTA 1NHIA 4FPPA 4MPEA 5M4HA 2BU6A 2VCJA 2ZDXA 3H4LA 4KSGA 4L93A 3IEDA 5M4NA 3A0XA 3EKRA 3LNUA 1QY8A 1BKNA 1BGQA 3G7BA 2YI6A 4HZ0A 4L90A 5FWKA 5M4KA 4V25A 4YKZA 3TTZA 2QF6A 2YKCA 3ZKDA 2CCUA 3G75A 3EHHA 5IDMA 2BYIA 3B28A 4FCRA 3OWBA 1YC4A 3MNRP 1S16A 2Q8GA 1UY6A 4CE2A 2PNRA 2YEAA 2IWXA 3R4MA 2XX2A 1UY7A 1UYHA 2E0AA 3C11A 5M4EA 2XCMA 2YJXA 5D7RA 4GGLA 2ZKJA 4PRVA 2CH4A 1GKZA 4X9LA 3D2RA 2FXSA 2YKIA 1UYKA 2Q8FA 2Q8HA 2IORA 2GQPA 5M4PA 2QFOA 1EI1A 5FNCA 1Y4UA 4JAUA 4O07A 3RLPA 1I5DA 4GCZA 4MP7A 4O09A 1GKXA 4BXIA 4E02A 3G7EA 2XJGA 4L8ZA 2YEIA 4XKKA 4XCJA 2YE2A 3INWA 5D7CA 3T2SA 1R62A 2HKJA 4HZ5A 3HZ5A 3BM9A 4Q20A 1B63A 1QYEA 4GT8A 4XD8A 1I58A 2YE9A 1UYIA 4H81A 4WUBA 2YGFA 3TZ0A 1UYCA 2XX4A 4H85A 3EHFA 1A4HA 3OW6A 4CWFA 4ZVIA 3R4NA 3GIEA 3B25A 4XITA 2YKBA 1UYFA 4XIRA 1Y8OA 4URLA 3B27A 2BTZA 4LP0A 4HXZA 2AKPA 1YT2A 4MPNA 3EHJA 4AS9A 2XDXA 1KIJA 2O1UA 1U0ZA 4R3AA 2YEGA 2XDLA 3GIFA 2Q8IA 4NH7A 1ID0A 2HCHA 4KP4A 3NMQA 5CTYA 4FMTA 1MX0A 3HYZA 4U93A 1Z5BA 3D0BA 4KTNA 1TC0A 4XIQA 2UWDA 5D7DA 4FCPA 2XHXA 4KFGA 2BU2A 4YKQA 4GQTA 3EHGA 2CCSA 3U2DA 3VADA 5M4MA 1I5AA 1YC1A 2FWYA 2ZBKB 4BQGA 4CWOA 1Y4SA 4JAVA 3RLQA 3GIGA 1THNA 2K5BA 1YT0A 2YE8A 4V26A 1U2OA 3TZ4A 3U67A 4U7NA 3RKZA 1MU5A 4KQVA 1H7UA 4EFUA 3CRLA 4L94A 2WI2A 5FNFA 2CG9A 3B24A 3T1KA 1TH8A 4LWEA 4LWFA 4BIZA 3K98A 1L0OA 5F5RA 1B62A 4O04A 3VHDA 2VW5A 4BIUA 2YEEA 2O1VA 1I59A 2BT0A 4YKRA 2BSMA 2GFDA 1EA6A 2ZDYA 1TC6A 2YK2A 3LPSA 4EM7A 1YC3A 1OSFA 2WI5A 5CPHA 1ZXNA 2CGFA 5D6PA 4K4OA 4EGHA 1I5BA 1UYMA 3PEJA 3K60A 5GGZA 1YERA 3RLRA 4EEHA 2XD6A 1AMWA 1ZWHA 2XK2A 2WERA 2YE4A 1YESA 1Z5AA 5CF0A 2QG2A 3O2FA 2H8MA 5BODA 4B7PA 3KE6A 2FYPA 2BU7A 4CWPA 2XDSA 3FT5A 3A0YA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3R4O A;  2BU5 A;  1KZN A;  4HXW A;  4EGK A;  4MPC A;  3CGY A;  4CWR A;  2WI6 A;  2EXL A;  3HHU A;  4DZY A;  2YEF A;  4HYM A;  4ASG A;  2YI5 A;  5IDJ A;  2YI0 A;  2WEQ A;  1UYE A;  4URO A;  3INX A;  4CE3 A;  3VHA A;  4P8O A;  3JZ3 A;  3H80 A;  4O0B A;  3ZXO A;  5L3J A;  4U7O A;  2JKI A;  1UYG A;  4P7A A;  5CTW A;  4R1F A;  4BQJ A;  2IOQ A;  4HY1 A;  2YK9 A;  3TUH A;  2ESA A;  4AWQ A;  1AJ6 A;  4R3M A;  5J71 A;  2YE7 A;  3R92 A;  2YGE A;  2FWZ A;  3ZXQ A;  5CTU A;  1QZR A;  3FT8 A;  4LWG A;  2YKJ A;  3OWD A;  4EMV A;  3HYY A;  3D36 A;  4YKY A;  5C93 A;  4MP2 A;  1TID A;  2XAB A;  5J6A A;  2YEC A;  2YEB A;  1YET A;  4XC0 A;  3GIG B;  2VWC A;  2YI7 A;  1AH6 A;  3T10 A;  3OMU A;  1BYQ A;  3K99 A;  1UY9 A;  3Q5L A;  4JQL A;  5CTX A;  2IWU A;  2XJX A;  3O6O A;  1US7 A;  3B26 A;  1TIL A;  2BRE A;  2XX5 A;  3C0E A;  3WQ9 A;  4CWS A;  3Q5K A;  2YEJ A;  2BRC A;  2YE6 A;  4E00 A;  5F3K A;  4HYP A;  4WUC A;  3CGZ A;  4CWQ A;  4YKT A;  2QG0 A;  1AM1 A;  2XJJ A;  3VHC A;  4MOT A;  1Y8N A;  3T0Z A;  4DUH A;  4EFT A;  3O0I A;  2H55 A;  3HEK A;  2YJW A;  4MBC A;  2CCT A;  2YGA A;  1TBW A;  1ZW9 A;  1ZXM A;  3K97 A;  4KSH A;  5IN9 A;  5BOC A;  2IOP A;  1PVG A;  4PU9 A;  4QPJ A;  3WHA A;  1JM6 A;  5FND A;  3R91 A;  2WEP A;  4LWI A;  3BMY A;  2YKE A;  1UYD A;  4GEE A;  4O05 A;  4XIP A;  4I5S A;  1UY8 A;  4H7Q A;  3R4P A;  2WI1 A;  4LPB A;  3A0W A;  3FV5 A;  3ZKB A;  1I5C A;  2YE3 A;  3PEH A;  4URN A;  1NHJ A;  2BYH A;  2BU8 A;  4XKA A;  3CWV A;  3OPD A;  1YSR A;  4XE2 A;  2BZ5 A;  4ASB A;  2IWS A;  4YKW A;  4NH8 A;  4LWH A;  1Y8P A;  4HY6 A;  2XHT A;  1UYL A;  2O1W A;  4AWO A;  4EGI A;  3QTF A;  4QPK A;  4XTJ A;  1Z5C A;  5D6Q A;  2WI7 A;  2C2A A;  4I3H A;  3A0Z A;  2HG1 A;  4E01 A;  1YT1 A;  2JJC A;  2YE5 A;  1GJV A;  3DGE A;  1BXD A;  3EKO A;  1H7S A;  4BAE A;  4XKO A;  3SL2 A;  2XDK A;  4NH9 A;  4GFN A;  4URM A;  1S14 A;  2WI4 A;  4ZKI A;  1B3Q A;  3U2K A;  4B6C A;  4YKX A;  4CWN A;  3TZ5 A;  4FCQ A;  1Z59 A;  3CRK A;  3A0T A;  2WI3 A;  2XHR A;  2YED A;  4PL9 A;  4MB9 A;  4XDM A;  4ASA A;  2Q2E B;  2VCI A;  4L91 A;  4PRX A;  2YEH A;  3Q5J A;  1YSZ A;  4YKU A;  3ZM7 A;  4ASF A;  3A0R A;  4WUD A;  3T0H A;  3TZ2 A;  4AWP A;  3HZ1 A;  4CE1 A;  4XCL A;  4JAS A;  1AH8 A;  2XDU A;  4W7T A;  3QDD A;  1YS3 A;  1NHH A;  4CWT A;  1NHI A;  4FPP A;  4MPE A;  5M4H A;  2BU6 A;  2VCJ A;  2ZDX A;  3H4L A;  4KSG A;  4L93 A;  3IED A;  5M4N A;  3A0X A;  3EKR A;  3LNU A;  1QY8 A;  1BKN A;  1BGQ A;  3G7B A;  2YI6 A;  4HZ0 A;  4L90 A;  5FWK A;  5M4K A;  4V25 A;  4YKZ A;  3TTZ A;  2QF6 A;  2YKC A;  3ZKD A;  2CCU A;  3G75 A;  3EHH A;  5IDM A;  2BYI A;  3B28 A;  4FCR A;  3OWB A;  1YC4 A;  3MNR P;  1S16 A;  2Q8G A;  1UY6 A;  4CE2 A;  2PNR A;  2YEA A;  2IWX A;  3R4M A;  2XX2 A;  1UY7 A;  1UYH A;  2E0A A;  3C11 A;  5M4E A;  2XCM A;  2YJX A;  5D7R A;  4GGL A;  2ZKJ A;  4PRV A;  2CH4 A;  1GKZ A;  4X9L A;  3D2R A;  2FXS A;  2YKI A;  1UYK A;  2Q8F A;  2Q8H A;  2IOR A;  2GQP A;  5M4P A;  2QFO A;  1EI1 A;  5FNC A;  1Y4U A;  4JAU A;  4O07 A;  3RLP A;  1I5D A;  4GCZ A;  4MP7 A;  4O09 A;  1GKX A;  4BXI A;  4E02 A;  3G7E A;  2XJG A;  4L8Z A;  2YEI A;  4XKK A;  4XCJ A;  2YE2 A;  3INW A;  5D7C A;  3T2S A;  1R62 A;  2HKJ A;  4HZ5 A;  3HZ5 A;  3BM9 A;  4Q20 A;  1B63 A;  1QYE A;  4GT8 A;  4XD8 A;  1I58 A;  2YE9 A;  1UYI A;  4H81 A;  4WUB A;  2YGF A;  3TZ0 A;  1UYC A;  2XX4 A;  4H85 A;  3EHF A;  1A4H A;  3OW6 A;  4CWF A;  4ZVI A;  3R4N A;  3GIE A;  3B25 A;  4XIT A;  2YKB A;  1UYF A;  4XIR A;  1Y8O A;  4URL A;  3B27 A;  2BTZ A;  4LP0 A;  4HXZ A;  2AKP A;  1YT2 A;  4MPN A;  3EHJ A;  4AS9 A;  2XDX A;  1KIJ A;  2O1U A;  1U0Z A;  4R3A A;  2YEG A;  2XDL A;  3GIF A;  2Q8I A;  4NH7 A;  1ID0 A;  2HCH A;  4KP4 A;  3NMQ A;  5CTY A;  4FMT A;  1MX0 A;  3HYZ A;  4U93 A;  1Z5B A;  3D0B A;  4KTN A;  1TC0 A;  4XIQ A;  2UWD A;  5D7D A;  4FCP A;  2XHX A;  4KFG A;  2BU2 A;  4YKQ A;  4GQT A;  3EHG A;  2CCS A;  3U2D A;  3VAD A;  5M4M A;  1I5A A;  1YC1 A;  2FWY A;  2ZBK B;  4BQG A;  4CWO A;  1Y4S A;  4JAV A;  3RLQ A;  3GIG A;  1THN A;  2K5B A;  1YT0 A;  2YE8 A;  4V26 A;  1U2O A;  3TZ4 A;  3U67 A;  4U7N A;  3RKZ A;  1MU5 A;  4KQV A;  1H7U A;  4EFU A;  3CRL A;  4L94 A;  2WI2 A;  5FNF A;  2CG9 A;  3B24 A;  3T1K A;  1TH8 A;  4LWE A;  4LWF A;  4BIZ A;  3K98 A;  1L0O A;  5F5R A;  1B62 A;  4O04 A;  3VHD A;  2VW5 A;  4BIU A;  2YEE A;  2O1V A;  1I59 A;  2BT0 A;  4YKR A;  2BSM A;  2GFD A;  1EA6 A;  2ZDY A;  1TC6 A;  2YK2 A;  3LPS A;  4EM7 A;  1YC3 A;  1OSF A;  2WI5 A;  5CPH A;  1ZXN A;  2CGF A;  5D6P A;  4K4O A;  4EGH A;  1I5B A;  1UYM A;  3PEJ A;  3K60 A;  5GGZ A;  1YER A;  3RLR A;  4EEH A;  2XD6 A;  1AMW A;  1ZWH A;  2XK2 A;  2WER A;  2YE4 A;  1YES A;  1Z5A A;  5CF0 A;  2QG2 A;  3O2F A;  2H8M A;  5BOD A;  4B7P A;  3KE6 A;  2FYP A;  2BU7 A;  4CWP A;  2XDS A;  3FT5 A;  3A0Y A; 
#chains in the Genus database with same CATH topology
 3R4O A;  2BU5 A;  1KZN A;  4HXW A;  4EGK A;  4MPC A;  3CGY A;  4CWR A;  2WI6 A;  2EXL A;  3HHU A;  4DZY A;  2YEF A;  4HYM A;  4ASG A;  2YI5 A;  5IDJ A;  2YI0 A;  2WEQ A;  1UYE A;  4URO A;  3INX A;  3CYG A;  3VHA A;  4CE3 A;  4P8O A;  3JZ3 A;  3H80 A;  4O0B A;  3ZXO A;  5L3J A;  4U7O A;  2JKI A;  1UYG A;  4P7A A;  5CTW A;  4R1F A;  4BQJ A;  2IOQ A;  4HY1 A;  2YK9 A;  3TUH A;  2ESA A;  4AWQ A;  1AJ6 A;  4R3M A;  5J71 A;  2YE7 A;  3R92 A;  2YGE A;  2FWZ A;  3ZXQ A;  5CTU A;  1QZR A;  3FT8 A;  4LWG A;  2YKJ A;  3OWD A;  4EMV A;  3HYY A;  3D36 A;  4YKY A;  5C93 A;  4MP2 A;  2C1I A;  1TID A;  2XAB A;  5J6A A;  2YEC A;  2YEB A;  1YET A;  4XC0 A;  3GIG B;  2VWC A;  2YI7 A;  1AH6 A;  3T10 A;  3OMU A;  1BYQ A;  3K99 A;  1UY9 A;  3Q5L A;  4JQL A;  5CTX A;  2IWU A;  2XJX A;  3O6O A;  1US7 A;  3B26 A;  1TIL A;  2BRE A;  2XX5 A;  3C0E A;  3WQ9 A;  4CWS A;  3Q5K A;  2YEJ A;  2BRC A;  2YE6 A;  4E00 A;  5F3K A;  4HYP A;  4WUC A;  3CGZ A;  4CWQ A;  4YKT A;  2QG0 A;  1AM1 A;  2XJJ A;  3VHC A;  4MOT A;  1Y8N A;  3T0Z A;  4DUH A;  4EFT A;  3O0I A;  2H55 A;  3HEK A;  2YJW A;  4MBC A;  2CCT A;  2YGA A;  1TBW A;  1ZW9 A;  1ZXM A;  3K97 A;  4KSH A;  5IN9 A;  5BOC A;  2IOP A;  1PVG A;  4PU9 A;  4QPJ A;  3WHA A;  1JM6 A;  5FND A;  3R91 A;  2WEP A;  4LWI A;  3BMY A;  2YKE A;  1UYD A;  4GEE A;  4O05 A;  4XIP A;  4I5S A;  1UY8 A;  4H7Q A;  3R4P A;  2WI1 A;  4LPB A;  3A0W A;  3FV5 A;  3ZKB A;  1I5C A;  2YE3 A;  3PEH A;  4URN A;  1NHJ A;  2BYH A;  2BU8 A;  4XKA A;  3CWV A;  3OPD A;  1YSR A;  4XE2 A;  2BZ5 A;  4ASB A;  2IWS A;  4YKW A;  4NH8 A;  4LWH A;  1Y8P A;  2C1G A;  4HY6 A;  2XHT A;  1UYL A;  2O1W A;  4AWO A;  4EGI A;  3QTF A;  4QPK A;  4XTJ A;  1Z5C A;  5D6Q A;  2WI7 A;  2C2A A;  4I3H A;  3A0Z A;  2HG1 A;  4E01 A;  1YT1 A;  2JJC A;  2YE5 A;  1GJV A;  3DGE A;  1BXD A;  3EKO A;  1H7S A;  4BAE A;  4XKO A;  2FTK A;  3SL2 A;  2XDK A;  4NH9 A;  4GFN A;  4URM A;  1S14 A;  2WI4 A;  4ZKI A;  1B3Q A;  3U2K A;  4B6C A;  4YKX A;  4CWN A;  3TZ5 A;  4FCQ A;  1Z59 A;  3CRK A;  3A0T A;  2WI3 A;  2XHR A;  2YED A;  4PL9 A;  4MB9 A;  4XDM A;  4ASA A;  2Q2E B;  2VCI A;  4L91 A;  4PRX A;  2YEH A;  3Q5J A;  1YSZ A;  4YKU A;  3ZM7 A;  4ASF A;  3A0R A;  4WUD A;  3T0H A;  3TZ2 A;  4AWP A;  3HZ1 A;  4CE1 A;  4XCL A;  4JAS A;  1AH8 A;  2XDU A;  4W7T A;  3QDD A;  1YS3 A;  1NHH A;  4CWT A;  1NHI A;  4FPP A;  4MPE A;  5M4H A;  2BU6 A;  2VCJ A;  2ZDX A;  3H4L A;  4E72 A;  4KSG A;  4L93 A;  3IED A;  5M4N A;  1IXM A;  3A0X A;  3EKR A;  3LNU A;  1QY8 A;  1BKN A;  1BGQ A;  3G7B A;  2YI6 A;  4HZ0 A;  4L90 A;  5FWK A;  5M4K A;  4V25 A;  4YKZ A;  3TTZ A;  2QF6 A;  2YKC A;  3ZKD A;  2CCU A;  3G75 A;  3EHH A;  5IDM A;  2BYI A;  3B28 A;  4FCR A;  3OWB A;  1YC4 A;  3MNR P;  1S16 A;  2Q8G A;  1UY6 A;  4CE2 A;  2PNR A;  2YEA A;  2IWX A;  3R4M A;  2XX2 A;  1UY7 A;  1UYH A;  2E0A A;  3C11 A;  5M4E A;  2XCM A;  2YJX A;  5D7R A;  4GGL A;  2ZKJ A;  4PRV A;  2CH4 A;  1GKZ A;  4X9L A;  3D2R A;  2FXS A;  2YKI A;  1UYK A;  2Q8F A;  2Q8H A;  2IOR A;  2GQP A;  5M4P A;  2QFO A;  1EI1 A;  5FNC A;  1Y4U A;  4JAU A;  4O07 A;  3LMM A;  3RLP A;  1I5D A;  4GCZ A;  4MP7 A;  4O09 A;  1GKX A;  4BXI A;  4E02 A;  3G7E A;  2XJG A;  4L8Z A;  2YEI A;  4XKK A;  4XCJ A;  2YE2 A;  3INW A;  5D7C A;  3T2S A;  1R62 A;  2HKJ A;  4HZ5 A;  3HZ5 A;  3BM9 A;  4Q20 A;  1B63 A;  1QYE A;  4GT8 A;  4XD8 A;  1I58 A;  2YE9 A;  1UYI A;  4H81 A;  4WUB A;  2YGF A;  3TZ0 A;  1UYC A;  2XX4 A;  4H85 A;  3EHF A;  1A4H A;  3OW6 A;  4CWF A;  4ZVI A;  3R4N A;  3GIE A;  3B25 A;  4XIT A;  2YKB A;  1UYF A;  4XIR A;  1Y8O A;  4URL A;  3B27 A;  3S5T A;  2BTZ A;  4LP0 A;  4HXZ A;  2AKP A;  1YT2 A;  4MPN A;  3EHJ A;  4AS9 A;  2XDX A;  1KIJ A;  2O1U A;  1U0Z A;  4R3A A;  2YEG A;  2XDL A;  3GIF A;  2Q8I A;  4NH7 A;  1ID0 A;  2HCH A;  4KP4 A;  3NMQ A;  5CTY A;  4FMT A;  1MX0 A;  3HYZ A;  4U93 A;  1Z5B A;  3D0B A;  4KTN A;  1TC0 A;  4XIQ A;  2UWD A;  5D7D A;  4FCP A;  2XHX A;  4KFG A;  2BU2 A;  4YKQ A;  4GQT A;  3EHG A;  2CCS A;  3U2D A;  3VAD A;  5M4M A;  1I5A A;  1YC1 A;  2FWY A;  2ZBK B;  4BQG A;  4CWO A;  1Y4S A;  4JAV A;  3RLQ A;  3GIG A;  1THN A;  2K5B A;  1YT0 A;  2YE8 A;  4V26 A;  1U2O A;  3TZ4 A;  3U67 A;  4U7N A;  1F51 A;  3RKZ A;  1MU5 A;  4KQV A;  1H7U A;  4EFU A;  3CRL A;  4L94 A;  2WI2 A;  5FNF A;  2CG9 A;  3B24 A;  3T1K A;  1TH8 A;  4LWE A;  4LWF A;  4BIZ A;  3K98 A;  5JEN A;  1L0O A;  5F5R A;  1B62 A;  4O04 A;  3VHD A;  2HHI A;  2VW5 A;  4BIU A;  2YEE A;  2O1V A;  1I59 A;  2BT0 A;  4YKR A;  2BSM A;  2GFD A;  1EA6 A;  2ZDY A;  1TC6 A;  2YK2 A;  3LPS A;  4EM7 A;  1YC3 A;  1OSF A;  2WI5 A;  5CPH A;  1ZXN A;  2CGF A;  5D6P A;  4K4O A;  4EGH A;  1I5B A;  1UYM A;  3PEJ A;  3K60 A;  5GGZ A;  1YER A;  3RLR A;  4EEH A;  2XD6 A;  1AMW A;  1ZWH A;  2XK2 A;  2WER A;  2YE4 A;  1YES A;  1Z5A A;  5CF0 A;  2QG2 A;  3O2F A;  2H8M A;  5BOD A;  4B7P A;  3KE6 A;  2FYP A;  2BU7 A;  4CWP A;  2XDS A;  3FT5 A;  3A0Y A; 
#chains in the Genus database with same CATH homology
 3R4O A;  2BU5 A;  1KZN A;  4HXW A;  4EGK A;  4MPC A;  3CGY A;  4CWR A;  2WI6 A;  2EXL A;  3HHU A;  4DZY A;  2YEF A;  4HYM A;  4ASG A;  2YI5 A;  5IDJ A;  2YI0 A;  2WEQ A;  1UYE A;  4URO A;  3INX A;  4CE3 A;  3VHA A;  4P8O A;  3JZ3 A;  3H80 A;  4O0B A;  3ZXO A;  5L3J A;  4U7O A;  2JKI A;  1UYG A;  4P7A A;  5CTW A;  4R1F A;  4BQJ A;  2IOQ A;  4HY1 A;  2YK9 A;  3TUH A;  2ESA A;  4AWQ A;  1AJ6 A;  4R3M A;  5J71 A;  2YE7 A;  3R92 A;  2YGE A;  2FWZ A;  3ZXQ A;  5CTU A;  1QZR A;  3FT8 A;  4LWG A;  2YKJ A;  3OWD A;  4EMV A;  3HYY A;  3D36 A;  4YKY A;  5C93 A;  4MP2 A;  1TID A;  2XAB A;  5J6A A;  2YEC A;  2YEB A;  1YET A;  4XC0 A;  3GIG B;  2VWC A;  2YI7 A;  1AH6 A;  3T10 A;  3OMU A;  1BYQ A;  3K99 A;  1UY9 A;  3Q5L A;  4JQL A;  5CTX A;  2IWU A;  2XJX A;  3O6O A;  1US7 A;  3B26 A;  1TIL A;  2BRE A;  2XX5 A;  3C0E A;  3WQ9 A;  4CWS A;  3Q5K A;  2YEJ A;  2BRC A;  2YE6 A;  4E00 A;  5F3K A;  4HYP A;  4WUC A;  3CGZ A;  4CWQ A;  4YKT A;  2QG0 A;  1AM1 A;  2XJJ A;  3VHC A;  4MOT A;  1Y8N A;  3T0Z A;  4DUH A;  4EFT A;  3O0I A;  2H55 A;  3HEK A;  2YJW A;  4MBC A;  2CCT A;  2YGA A;  1TBW A;  1ZW9 A;  1ZXM A;  3K97 A;  4KSH A;  5IN9 A;  5BOC A;  2IOP A;  1PVG A;  4PU9 A;  4QPJ A;  3WHA A;  1JM6 A;  5FND A;  3R91 A;  2WEP A;  4LWI A;  3BMY A;  2YKE A;  1UYD A;  4GEE A;  4O05 A;  4XIP A;  4I5S A;  1UY8 A;  4H7Q A;  3R4P A;  2WI1 A;  4LPB A;  3A0W A;  3FV5 A;  3ZKB A;  1I5C A;  2YE3 A;  3PEH A;  4URN A;  1NHJ A;  2BYH A;  2BU8 A;  4XKA A;  3CWV A;  3OPD A;  1YSR A;  4XE2 A;  2BZ5 A;  4ASB A;  2IWS A;  4YKW A;  4NH8 A;  4LWH A;  1Y8P A;  4HY6 A;  2XHT A;  1UYL A;  2O1W A;  4AWO A;  4EGI A;  3QTF A;  4QPK A;  4XTJ A;  1Z5C A;  5D6Q A;  2WI7 A;  2C2A A;  4I3H A;  3A0Z A;  2HG1 A;  4E01 A;  1YT1 A;  2JJC A;  2YE5 A;  1GJV A;  3DGE A;  1BXD A;  3EKO A;  1H7S A;  4BAE A;  4XKO A;  3SL2 A;  2XDK A;  4NH9 A;  4GFN A;  4URM A;  1S14 A;  2WI4 A;  4ZKI A;  1B3Q A;  3U2K A;  4B6C A;  4YKX A;  4CWN A;  3TZ5 A;  4FCQ A;  1Z59 A;  3CRK A;  3A0T A;  2WI3 A;  2XHR A;  2YED A;  4PL9 A;  4MB9 A;  4XDM A;  4ASA A;  2Q2E B;  2VCI A;  4L91 A;  4PRX A;  2YEH A;  3Q5J A;  1YSZ A;  4YKU A;  3ZM7 A;  4ASF A;  3A0R A;  4WUD A;  3T0H A;  3TZ2 A;  4AWP A;  3HZ1 A;  4CE1 A;  4XCL A;  4JAS A;  1AH8 A;  2XDU A;  4W7T A;  3QDD A;  1YS3 A;  1NHH A;  4CWT A;  1NHI A;  4FPP A;  4MPE A;  5M4H A;  2BU6 A;  2VCJ A;  2ZDX A;  3H4L A;  4KSG A;  4L93 A;  3IED A;  5M4N A;  3A0X A;  3EKR A;  3LNU A;  1QY8 A;  1BKN A;  1BGQ A;  3G7B A;  2YI6 A;  4HZ0 A;  4L90 A;  5FWK A;  5M4K A;  4V25 A;  4YKZ A;  3TTZ A;  2QF6 A;  2YKC A;  3ZKD A;  2CCU A;  3G75 A;  3EHH A;  5IDM A;  2BYI A;  3B28 A;  4FCR A;  3OWB A;  1YC4 A;  3MNR P;  1S16 A;  2Q8G A;  1UY6 A;  4CE2 A;  2PNR A;  2YEA A;  2IWX A;  3R4M A;  2XX2 A;  1UY7 A;  1UYH A;  2E0A A;  3C11 A;  5M4E A;  2XCM A;  2YJX A;  5D7R A;  4GGL A;  2ZKJ A;  4PRV A;  2CH4 A;  1GKZ A;  4X9L A;  3D2R A;  2FXS A;  2YKI A;  1UYK A;  2Q8F A;  2Q8H A;  2IOR A;  2GQP A;  5M4P A;  2QFO A;  1EI1 A;  5FNC A;  1Y4U A;  4JAU A;  4O07 A;  3RLP A;  1I5D A;  4GCZ A;  4MP7 A;  4O09 A;  1GKX A;  4BXI A;  4E02 A;  3G7E A;  2XJG A;  4L8Z A;  2YEI A;  4XKK A;  4XCJ A;  2YE2 A;  3INW A;  5D7C A;  3T2S A;  1R62 A;  2HKJ A;  4HZ5 A;  3HZ5 A;  3BM9 A;  4Q20 A;  1B63 A;  1QYE A;  4GT8 A;  4XD8 A;  1I58 A;  2YE9 A;  1UYI A;  4H81 A;  4WUB A;  2YGF A;  3TZ0 A;  1UYC A;  2XX4 A;  4H85 A;  3EHF A;  1A4H A;  3OW6 A;  4CWF A;  4ZVI A;  3R4N A;  3GIE A;  3B25 A;  4XIT A;  2YKB A;  1UYF A;  4XIR A;  1Y8O A;  4URL A;  3B27 A;  2BTZ A;  4LP0 A;  4HXZ A;  2AKP A;  1YT2 A;  4MPN A;  3EHJ A;  4AS9 A;  2XDX A;  1KIJ A;  2O1U A;  1U0Z A;  4R3A A;  2YEG A;  2XDL A;  3GIF A;  2Q8I A;  4NH7 A;  1ID0 A;  2HCH A;  4KP4 A;  3NMQ A;  5CTY A;  4FMT A;  1MX0 A;  3HYZ A;  4U93 A;  1Z5B A;  3D0B A;  4KTN A;  1TC0 A;  4XIQ A;  2UWD A;  5D7D A;  4FCP A;  2XHX A;  4KFG A;  2BU2 A;  4YKQ A;  4GQT A;  3EHG A;  2CCS A;  3U2D A;  3VAD A;  5M4M A;  1I5A A;  1YC1 A;  2FWY A;  2ZBK B;  4BQG A;  4CWO A;  1Y4S A;  4JAV A;  3RLQ A;  3GIG A;  1THN A;  2K5B A;  1YT0 A;  2YE8 A;  4V26 A;  1U2O A;  3TZ4 A;  3U67 A;  4U7N A;  3RKZ A;  1MU5 A;  4KQV A;  1H7U A;  4EFU A;  3CRL A;  4L94 A;  2WI2 A;  5FNF A;  2CG9 A;  3B24 A;  3T1K A;  1TH8 A;  4LWE A;  4LWF A;  4BIZ A;  3K98 A;  1L0O A;  5F5R A;  1B62 A;  4O04 A;  3VHD A;  2VW5 A;  4BIU A;  2YEE A;  2O1V A;  1I59 A;  2BT0 A;  4YKR A;  2BSM A;  2GFD A;  1EA6 A;  2ZDY A;  1TC6 A;  2YK2 A;  3LPS A;  4EM7 A;  1YC3 A;  1OSF A;  2WI5 A;  5CPH A;  1ZXN A;  2CGF A;  5D6P A;  4K4O A;  4EGH A;  1I5B A;  1UYM A;  3PEJ A;  3K60 A;  5GGZ A;  1YER A;  3RLR A;  4EEH A;  2XD6 A;  1AMW A;  1ZWH A;  2XK2 A;  2WER A;  2YE4 A;  1YES A;  1Z5A A;  5CF0 A;  2QG2 A;  3O2F A;  2H8M A;  5BOD A;  4B7P A;  3KE6 A;  2FYP A;  2BU7 A;  4CWP A;  2XDS A;  3FT5 A;  3A0Y A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...