2H8MA

N-domain of grp94 in complex with the 2-iodo-neca
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
227
structure length
215
Chain Sequence
EKFAFQAEVNRMMKLIINSLYKNKEIFLRELISNASDALDKIRLISLTDENALAGNEELTVKIKCDKEKNLLHVTDTGVGMTREELVKNLGTIGTSEFLNKMTEAQTSELIGQFGVGFYSAFLVADKVIVTSKHNNDTQHIWESDSNEFSVIADPRGNTLGRGTTITLVLKEEASDYLELDTIKNLVKKYSQFINFPIYVWSSKTKTVWDWELMN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title N-Domain Of Grp94 In Complex With the 2-Iodo-NECA
rcsb
source organism Canis lupus familiaris
molecule tags Chaperone
molecule keywords Endoplasmin
total genus 64
structure length 215
sequence length 227
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-06-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02518 HATPase_c Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.565.10 Alpha Beta 2-Layer Sandwich Heat Shock Protein 90 Histidine kinase-like ATPase, C-terminal domain 2h8mA00
1YC3A 2XX2A 3EHGA 5M4MA 5M4PA 1UYFA 4LP0A 1US7A 2O1WA 4O07A 4XC0A 3B28A 3K97A 3OPDA 1YC4A 2YKEA 3FV5A 5L3JA 2YE3A 3G7BA 1KZNA 3EHHA 3VHCA 2CCSA 3VHAA 3HZ5A 3LNUA 4MPNA 1UYEA 4XE2A 2GQPA 1NHJA 3OMUA 2Q8IA 4KP4A 4P8OA 4X9LA 3DGEA 2ZDYA 2YEDA 3R92A 2FWZA 4U7OA 3VADA 4HYPA 1UYHA 4DZYA 5CF0A 1I5AA 1TILA 4WUCA 2Q2EB 5M4EA 2XK2A 5IN9A 4O0BA 1Y8NA 4JQLA 5D7DA 2WI4A 5FNCA 3ZKDA 1UY9A 4O04A 5CTUA 2EXLA 3RLQA 4I5SA 3K98A 1THNA 2JKIA 4GQTA 5BODA 4EM7A 2XCMA 4JASA 3ZXOA 4P7AA 2FWYA 3G75A 4JAUA 4R3MA 4EMVA 2CG9A 1UY6A 4HXZA 1YERA 2BU8A 1MX0A 1YT2A 4KSHA 2YEIA 4EGIA 2YEHA 4QPKA 3TZ4A 4UROA 4XTJA 2YEJA 2CH4A 2WI6A 1H7SA 3CGZA 2JJCA 4HZ0A 2CCUA 4LPBA 3A0ZA 4AS9A 4L8ZA 2BRCA 2XHXA 3TTZA 4ZKIA 1BGQA 1GKXA 1ID0A 5CTYA 4GCZA 1AM1A 1TIDA 4V26A 4HY6A 4YKYA 4HY1A 4H81A 3O2FA 3TZ2A 3T10A 4JAVA 3HHUA 3O0IA 3A0TA 3C11A 1UY7A 3GIEA 4WUBA 2HG1A 3ZM7A 2BU2A 3K99A 2BYIA 3FT5A 3B26A 4XIQA 1PVGA 2XD6A 3D0BA 4HYMA 2O1VA 3WHAA 2HKJA 2VW5A 3INWA 4YKWA 2IORA 2UWDA 5J71A 4AWPA 4CWSA 4L94A 2IOPA 1UYDA 2WI5A 3H80A 2BU6A 3CWVA 2YK9A 5D6QA 4I3HA 2XDUA 1B3QA 5F5RA 4XKKA 4XITA 1YESA 2ESAA 2XJJA 1U0ZA 5D7CA 4ASGA 1YSZA 3A0YA 2XDSA 3ZKBA 3Q5KA 2H8MA 1UYKA 4CE3A 3G7EA 4WUDA 4XKAA 2WI1A 4H85A 1YETA 2XX4A 2XDXA 3A0WA 3R4MA 1UYCA 1AH6A 1YSRA 2IWSA 4KSGA 2BSMA 2XDLA 3GIGB 4URMA 2YEBA 4EGKA 3FT8A 1I5BA 4CE1A 1ZW9A 2YE5A 2YEAA 2XHTA 3B27A 2PNRA 3ZXQA 4CWOA 4E01A 1U2OA 1YT0A 1ZWHA 4CWPA 3D36A 3EKRA 3TZ5A 3WQ9A 5BOCA 5FNDA 4U7NA 4E00A 2BTZA 2WI2A 5CTXA 4GFNA 2XABA 3BMYA 3Q5JA 1Y8OA 3A0XA 1H7UA 3TZ0A 1QY8A 4CWTA 2XJGA 1R62A 4FCQA 2YKIA 3T2SA 4YKTA 4U93A 4CE2A 4HXWA 1BKNA 5CPHA 1UYLA 2HCHA 2QF6A 3JZ3A 4XCLA 5FWKA 1S14A 4PRVA 5M4HA 4QPJA 1QZRA 2YK2A 3RKZA 4MB9A 3K60A 2YE8A 3H4LA 4URNA 3B24A 4L91A 2XX5A 4K4OA 2BYHA 1OSFA 2ZBKB 4MP2A 5F3KA 3EKOA 4LWFA 2AKPA 4CWRA 2YKCA 4ZVIA 4V25A 1BXDA 4FCRA 3PEJA 4YKRA 4PL9A 2YE4A 3OWDA 4LWHA 1Y4SA 1TC0A 2BU5A 4H7QA 3BM9A 2Q8FA 4W7TA 2YGAA 1AJ6A 5IDMA 1I59A 3GIFA 4ASAA 2CCTA 1UYIA 4B6CA 1ZXNA 1L0OA 4XKOA 2YKBA 3IEDA 4XDMA 4O05A 4YKQA 1NHHA 4AWQA 4LWEA 3OW6A 4XCJA 4ASFA 1Z5CA 3NMQA 1EA6A 3OWBA 1S16A 2H55A 3HZ1A 3HYYA 3CRLA 4YKZA 4E02A 5M4KA 1ZXMA 2WERA 1Z5AA 4BQJA 1AH8A 4FPPA 3T0ZA 2BREA 3A0RA 1QYEA 3R4NA 2QFOA 2YE7A 2YE9A 3KE6A 4MP7A 2YGFA 2GFDA 3HYZA 3Q5LA 2WI7A 2E0AA 4NH9A 4XIPA 1B62A 3R4PA 2FXSA 1EI1A 1MU5A 4EFTA 4FMTA 3VHDA 1BYQA 3TUHA 2VWCA 3EHJA 3D2RA 4BAEA 2QG2A 2XJXA 2YJXA 2CGFA 4R3AA 4GEEA 1UYMA 2YKJA 2BT0A 2YEFA 1KIJA 1Y4UA 2YI5A 4B7PA 2ZDXA 1YT1A 2YI0A 1A4HA 1GJVA 3RLPA 2Q8HA 5J6AA 5M4NA 4MBCA 4NH7A 1YC1A 1UYGA 4MPCA 4URLA 5C93A 4EEHA 4EFUA 4ASBA 4O09A 2XDKA 2WI3A 1TBWA 3U2DA 4YKUA 3PEHA 4MOTA 5D7RA 4BXIA 2WEQA 4CWQA 3MNRP 3T1KA 4MPEA 3O6OA 4XD8A 3GIGA 3INXA 3CGYA 4LWIA 4PU9A 4KQVA 4YKXA 1I5CA 3R4OA 4XIRA 2Q8GA 4GGLA 4CWNA 4KTNA 2YI6A 4Q20A 1Z5BA 1NHIA 4PRXA 3QTFA 5GGZA 4DUHA 4NH8A 4GT8A 4R1FA 2WEPA 4KFGA 1TC6A 2YGEA 3CRKA 2K5BA 2YE6A 3B25A 2ZKJA 2XHRA 3LPSA 1TH8A 2C2AA 3T0HA 3R91A 3HEKA 4L90A 1JM6A 4LWGA 4HZ5A 5CTWA 2IWUA 1Z59A 2YEGA 1GKZA 5IDJA 2YJWA 2YEEA 2FYPA 4BQGA 4FCPA 1I5DA 2O1UA 3EHFA 5FNFA 2YI7A 2IWXA 4BIZA 3QDDA 5D6PA 2YE2A 4L93A 4CWFA 3RLRA 1B63A 3C0EA 2BZ5A 1AMWA 1I58A 3U2KA 3U67A 2QG0A 3SL2A 1Y8PA 2BU7A 4AWOA 1UY8A 4EGHA 2IOQA 4BIUA 2YECA 2VCIA 1YS3A 2VCJA
chains in the Genus database with same CATH superfamily
1YC3A 2XX2A 3EHGA 5M4MA 5M4PA 1UYFA 3CYGA 4LP0A 1US7A 2O1WA 4O07A 4XC0A 3B28A 3K97A 3OPDA 1YC4A 2YKEA 3FV5A 5L3JA 2YE3A 3G7BA 1KZNA 3EHHA 3VHCA 2CCSA 3VHAA 3HZ5A 3LNUA 4MPNA 1UYEA 4XE2A 2GQPA 1NHJA 3OMUA 2Q8IA 3S5TA 4KP4A 4P8OA 4X9LA 3DGEA 2ZDYA 2YEDA 3R92A 2FWZA 4U7OA 3VADA 4HYPA 1UYHA 4DZYA 5CF0A 1I5AA 1TILA 4WUCA 2Q2EB 5M4EA 2XK2A 5IN9A 4O0BA 1Y8NA 4JQLA 5D7DA 2WI4A 5FNCA 3ZKDA 1UY9A 4O04A 5CTUA 2EXLA 3RLQA 4I5SA 3K98A 1THNA 2JKIA 4GQTA 5BODA 4EM7A 2XCMA 4JASA 4E72A 3ZXOA 4P7AA 2FWYA 3G75A 4JAUA 4R3MA 4EMVA 2CG9A 1UY6A 4HXZA 1YERA 2BU8A 1MX0A 1YT2A 4KSHA 2YEIA 4EGIA 2YEHA 4QPKA 3TZ4A 4UROA 4XTJA 2YEJA 2CH4A 2WI6A 1H7SA 3CGZA 2JJCA 4HZ0A 2CCUA 4LPBA 3A0ZA 4AS9A 2BRCA 2XHXA 4L8ZA 3TTZA 4ZKIA 1BGQA 1GKXA 1ID0A 5CTYA 4GCZA 1AM1A 2HHIA 1TIDA 4V26A 4HY6A 4YKYA 4HY1A 4H81A 3O2FA 3TZ2A 3T10A 4JAVA 3HHUA 3O0IA 3A0TA 3C11A 1UY7A 3GIEA 4WUBA 2HG1A 3ZM7A 2BU2A 3K99A 2BYIA 3FT5A 3B26A 4XIQA 1PVGA 2XD6A 3D0BA 4HYMA 2O1VA 3WHAA 2HKJA 2VW5A 3INWA 4YKWA 2IORA 2UWDA 5J71A 4AWPA 4CWSA 4L94A 2IOPA 1UYDA 2WI5A 3H80A 2BU6A 3CWVA 2YK9A 5D6QA 4I3HA 2XDUA 1B3QA 5F5RA 4XKKA 4XITA 1YESA 2ESAA 2XJJA 1U0ZA 5D7CA 4ASGA 1YSZA 3A0YA 2XDSA 3ZKBA 3Q5KA 2H8MA 1UYKA 4CE3A 3G7EA 4WUDA 4XKAA 2WI1A 4H85A 1YETA 2XX4A 2XDXA 3A0WA 3R4MA 1UYCA 1AH6A 1YSRA 2IWSA 4KSGA 2BSMA 2XDLA 3GIGB 4URMA 2YEBA 1F51A 4EGKA 3FT8A 1I5BA 4CE1A 1ZW9A 2YE5A 2YEAA 2XHTA 3B27A 2PNRA 3ZXQA 4CWOA 4E01A 1U2OA 1YT0A 1ZWHA 4CWPA 3D36A 3EKRA 3TZ5A 3WQ9A 5BOCA 3LMMA 5FNDA 4U7NA 4E00A 2BTZA 1IXMA 2WI2A 5CTXA 4GFNA 2XABA 3BMYA 3Q5JA 1Y8OA 3A0XA 1H7UA 3TZ0A 1QY8A 4CWTA 2XJGA 1R62A 4FCQA 2YKIA 3T2SA 4YKTA 4U93A 4CE2A 4HXWA 1BKNA 5CPHA 1UYLA 2HCHA 2QF6A 3JZ3A 4XCLA 5FWKA 1S14A 4PRVA 5M4HA 4QPJA 1QZRA 2YK2A 3RKZA 4MB9A 3K60A 2YE8A 3H4LA 4URNA 3B24A 4L91A 2XX5A 4K4OA 2BYHA 1OSFA 2ZBKB 4MP2A 5F3KA 3EKOA 4LWFA 2AKPA 4CWRA 2YKCA 4ZVIA 4V25A 1BXDA 4FCRA 3PEJA 4YKRA 4PL9A 2YE4A 3OWDA 4LWHA 1Y4SA 1TC0A 2BU5A 4H7QA 3BM9A 2Q8FA 4W7TA 2YGAA 1AJ6A 5IDMA 1I59A 3GIFA 4ASAA 5JENA 2CCTA 1UYIA 4B6CA 1ZXNA 1L0OA 4XKOA 2YKBA 3IEDA 4XDMA 4O05A 4YKQA 1NHHA 4AWQA 4LWEA 3OW6A 4XCJA 4ASFA 1Z5CA 3NMQA 1EA6A 3OWBA 1S16A 2H55A 3HZ1A 3HYYA 3CRLA 4YKZA 4E02A 5M4KA 1ZXMA 2WERA 1Z5AA 4BQJA 1AH8A 4FPPA 3T0ZA 2BREA 3A0RA 1QYEA 3R4NA 2C1IA 2QFOA 2YE7A 2YE9A 3KE6A 4MP7A 2YGFA 2GFDA 3HYZA 3Q5LA 2FTKA 2WI7A 2E0AA 4NH9A 4XIPA 1B62A 3R4PA 2FXSA 1EI1A 1MU5A 4EFTA 4FMTA 3VHDA 1BYQA 3TUHA 3EHJA 2VWCA 3D2RA 4BAEA 2QG2A 2XJXA 2YJXA 2CGFA 4R3AA 4GEEA 1UYMA 2YKJA 2BT0A 2YEFA 1KIJA 1Y4UA 2YI5A 4B7PA 2ZDXA 1YT1A 2YI0A 1A4HA 1GJVA 3RLPA 2Q8HA 5J6AA 5M4NA 4MBCA 4NH7A 1YC1A 1UYGA 4MPCA 4URLA 5C93A 4EEHA 4EFUA 4ASBA 4O09A 2XDKA 2WI3A 1TBWA 3U2DA 4YKUA 3PEHA 4MOTA 5D7RA 4BXIA 2WEQA 4CWQA 3MNRP 3T1KA 4MPEA 3O6OA 4XD8A 3GIGA 3INXA 3CGYA 4LWIA 4PU9A 4KQVA 4YKXA 1I5CA 3R4OA 4XIRA 2Q8GA 4GGLA 4CWNA 4KTNA 2YI6A 4Q20A 1Z5BA 1NHIA 4PRXA 3QTFA 5GGZA 4DUHA 4NH8A 4GT8A 4R1FA 2WEPA 4KFGA 1TC6A 2YGEA 3CRKA 2K5BA 2YE6A 3B25A 2ZKJA 2XHRA 3LPSA 1TH8A 2C2AA 3T0HA 3R91A 3HEKA 4L90A 1JM6A 4LWGA 4HZ5A 5CTWA 2IWUA 1Z59A 2YEGA 1GKZA 5IDJA 2C1GA 2YJWA 2YEEA 2FYPA 4BQGA 4FCPA 1I5DA 2O1UA 3EHFA 5FNFA 2YI7A 2IWXA 4BIZA 3QDDA 5D6PA 2YE2A 4L93A 4CWFA 3RLRA 1B63A 3C0EA 2BZ5A 1AMWA 1I58A 3U2KA 3U67A 2QG0A 3SL2A 1Y8PA 2BU7A 4AWOA 1UY8A 4EGHA 2IOQA 4BIUA 2YECA 2VCIA 1YS3A 2VCJA
chains in the Genus database with same CATH topology
1YC3A 2XX2A 3EHGA 5M4MA 5M4PA 1UYFA 4LP0A 1US7A 2O1WA 4O07A 4XC0A 3B28A 3K97A 3OPDA 1YC4A 2YKEA 3FV5A 5L3JA 2YE3A 3G7BA 1KZNA 3EHHA 3VHCA 2CCSA 3VHAA 3HZ5A 3LNUA 4MPNA 1UYEA 4XE2A 2GQPA 1NHJA 3OMUA 2Q8IA 4KP4A 4P8OA 4X9LA 3DGEA 2ZDYA 2YEDA 3R92A 2FWZA 4U7OA 3VADA 4HYPA 1UYHA 4DZYA 5CF0A 1I5AA 1TILA 4WUCA 2Q2EB 5M4EA 2XK2A 5IN9A 4O0BA 1Y8NA 4JQLA 5D7DA 2WI4A 5FNCA 3ZKDA 1UY9A 4O04A 5CTUA 2EXLA 3RLQA 4I5SA 3K98A 1THNA 2JKIA 4GQTA 5BODA 4EM7A 2XCMA 4JASA 3ZXOA 4P7AA 2FWYA 3G75A 4JAUA 4R3MA 4EMVA 2CG9A 1UY6A 4HXZA 1YERA 2BU8A 1MX0A 1YT2A 4KSHA 2YEIA 4EGIA 2YEHA 4QPKA 3TZ4A 4UROA 4XTJA 2YEJA 2CH4A 2WI6A 1H7SA 3CGZA 2JJCA 4HZ0A 2CCUA 4LPBA 3A0ZA 4AS9A 4L8ZA 2BRCA 2XHXA 3TTZA 4ZKIA 1BGQA 1GKXA 1ID0A 5CTYA 4GCZA 1AM1A 1TIDA 4V26A 4HY6A 4YKYA 4HY1A 4H81A 3O2FA 3TZ2A 3T10A 4JAVA 3HHUA 3O0IA 3A0TA 3C11A 1UY7A 3GIEA 4WUBA 2HG1A 3ZM7A 2BU2A 3K99A 2BYIA 3FT5A 3B26A 4XIQA 1PVGA 2XD6A 3D0BA 4HYMA 2O1VA 3WHAA 2HKJA 2VW5A 3INWA 4YKWA 2IORA 2UWDA 5J71A 4AWPA 4CWSA 4L94A 2IOPA 1UYDA 2WI5A 3H80A 2BU6A 3CWVA 2YK9A 5D6QA 4I3HA 2XDUA 1B3QA 5F5RA 4XKKA 4XITA 1YESA 2ESAA 2XJJA 1U0ZA 5D7CA 4ASGA 1YSZA 3A0YA 2XDSA 3ZKBA 3Q5KA 2H8MA 1UYKA 4CE3A 3G7EA 4WUDA 4XKAA 2WI1A 4H85A 1YETA 2XX4A 2XDXA 3A0WA 3R4MA 1UYCA 1AH6A 1YSRA 2IWSA 4KSGA 2BSMA 2XDLA 3GIGB 4URMA 2YEBA 4EGKA 3FT8A 1I5BA 4CE1A 1ZW9A 2YE5A 2YEAA 2XHTA 3B27A 2PNRA 3ZXQA 4CWOA 4E01A 1U2OA 1YT0A 1ZWHA 4CWPA 3D36A 3EKRA 3TZ5A 3WQ9A 5BOCA 5FNDA 4U7NA 4E00A 2BTZA 2WI2A 5CTXA 4GFNA 2XABA 3BMYA 3Q5JA 1Y8OA 3A0XA 1H7UA 3TZ0A 1QY8A 4CWTA 2XJGA 1R62A 4FCQA 2YKIA 3T2SA 4YKTA 4U93A 4CE2A 4HXWA 1BKNA 5CPHA 1UYLA 2HCHA 2QF6A 3JZ3A 4XCLA 5FWKA 1S14A 4PRVA 5M4HA 4QPJA 1QZRA 2YK2A 3RKZA 4MB9A 3K60A 2YE8A 3H4LA 4URNA 3B24A 4L91A 2XX5A 4K4OA 2BYHA 1OSFA 2ZBKB 4MP2A 5F3KA 3EKOA 4LWFA 2AKPA 4CWRA 2YKCA 4ZVIA 4V25A 1BXDA 4FCRA 3PEJA 4YKRA 4PL9A 2YE4A 3OWDA 4LWHA 1Y4SA 1TC0A 2BU5A 4H7QA 3BM9A 2Q8FA 4W7TA 2YGAA 1AJ6A 5IDMA 1I59A 3GIFA 4ASAA 2CCTA 1UYIA 4B6CA 1ZXNA 1L0OA 4XKOA 2YKBA 3IEDA 4XDMA 4O05A 4YKQA 1NHHA 4AWQA 4LWEA 3OW6A 4XCJA 4ASFA 1Z5CA 3NMQA 1EA6A 3OWBA 1S16A 2H55A 3HZ1A 3HYYA 3CRLA 4YKZA 4E02A 5M4KA 1ZXMA 2WERA 1Z5AA 4BQJA 1AH8A 4FPPA 3T0ZA 2BREA 3A0RA 1QYEA 3R4NA 2QFOA 2YE7A 2YE9A 3KE6A 4MP7A 2YGFA 2GFDA 3HYZA 3Q5LA 2WI7A 2E0AA 4NH9A 4XIPA 1B62A 3R4PA 2FXSA 1EI1A 1MU5A 4EFTA 4FMTA 3VHDA 1BYQA 3TUHA 2VWCA 3EHJA 3D2RA 4BAEA 2QG2A 2XJXA 2YJXA 2CGFA 4R3AA 4GEEA 1UYMA 2YKJA 2BT0A 2YEFA 1KIJA 1Y4UA 2YI5A 4B7PA 2ZDXA 1YT1A 2YI0A 1A4HA 1GJVA 3RLPA 2Q8HA 5J6AA 5M4NA 4MBCA 4NH7A 1YC1A 1UYGA 4MPCA 4URLA 5C93A 4EEHA 4EFUA 4ASBA 4O09A 2XDKA 2WI3A 1TBWA 3U2DA 4YKUA 3PEHA 4MOTA 5D7RA 4BXIA 2WEQA 4CWQA 3MNRP 3T1KA 4MPEA 3O6OA 4XD8A 3GIGA 3INXA 3CGYA 4LWIA 4PU9A 4KQVA 4YKXA 1I5CA 3R4OA 4XIRA 2Q8GA 4GGLA 4CWNA 4KTNA 2YI6A 4Q20A 1Z5BA 1NHIA 4PRXA 3QTFA 5GGZA 4DUHA 4NH8A 4GT8A 4R1FA 2WEPA 4KFGA 1TC6A 2YGEA 3CRKA 2K5BA 2YE6A 3B25A 2ZKJA 2XHRA 3LPSA 1TH8A 2C2AA 3T0HA 3R91A 3HEKA 4L90A 1JM6A 4LWGA 4HZ5A 5CTWA 2IWUA 1Z59A 2YEGA 1GKZA 5IDJA 2YJWA 2YEEA 2FYPA 4BQGA 4FCPA 1I5DA 2O1UA 3EHFA 5FNFA 2YI7A 2IWXA 4BIZA 3QDDA 5D6PA 2YE2A 4L93A 4CWFA 3RLRA 1B63A 3C0EA 2BZ5A 1AMWA 1I58A 3U2KA 3U67A 2QG0A 3SL2A 1Y8PA 2BU7A 4AWOA 1UY8A 4EGHA 2IOQA 4BIUA 2YECA 2VCIA 1YS3A 2VCJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1YC3 A;  2XX2 A;  3EHG A;  5M4M A;  5M4P A;  1UYF A;  4LP0 A;  1US7 A;  2O1W A;  4O07 A;  4XC0 A;  3B28 A;  3K97 A;  3OPD A;  1YC4 A;  2YKE A;  3FV5 A;  5L3J A;  2YE3 A;  3G7B A;  1KZN A;  3EHH A;  3VHC A;  2CCS A;  3VHA A;  3HZ5 A;  3LNU A;  4MPN A;  1UYE A;  4XE2 A;  2GQP A;  1NHJ A;  3OMU A;  2Q8I A;  4KP4 A;  4P8O A;  4X9L A;  3DGE A;  2ZDY A;  2YED A;  3R92 A;  2FWZ A;  4U7O A;  3VAD A;  4HYP A;  1UYH A;  4DZY A;  5CF0 A;  1I5A A;  1TIL A;  4WUC A;  2Q2E B;  5M4E A;  2XK2 A;  5IN9 A;  4O0B A;  1Y8N A;  4JQL A;  5D7D A;  2WI4 A;  5FNC A;  3ZKD A;  1UY9 A;  4O04 A;  5CTU A;  2EXL A;  3RLQ A;  4I5S A;  3K98 A;  1THN A;  2JKI A;  4GQT A;  5BOD A;  4EM7 A;  2XCM A;  4JAS A;  3ZXO A;  4P7A A;  2FWY A;  3G75 A;  4JAU A;  4R3M A;  4EMV A;  2CG9 A;  1UY6 A;  4HXZ A;  1YER A;  2BU8 A;  1MX0 A;  1YT2 A;  4KSH A;  2YEI A;  4EGI A;  2YEH A;  4QPK A;  3TZ4 A;  4URO A;  4XTJ A;  2YEJ A;  2CH4 A;  2WI6 A;  1H7S A;  3CGZ A;  2JJC A;  4HZ0 A;  2CCU A;  4LPB A;  3A0Z A;  4AS9 A;  4L8Z A;  2BRC A;  2XHX A;  3TTZ A;  4ZKI A;  1BGQ A;  1GKX A;  1ID0 A;  5CTY A;  4GCZ A;  1AM1 A;  1TID A;  4V26 A;  4HY6 A;  4YKY A;  4HY1 A;  4H81 A;  3O2F A;  3TZ2 A;  3T10 A;  4JAV A;  3HHU A;  3O0I A;  3A0T A;  3C11 A;  1UY7 A;  3GIE A;  4WUB A;  2HG1 A;  3ZM7 A;  2BU2 A;  3K99 A;  2BYI A;  3FT5 A;  3B26 A;  4XIQ A;  1PVG A;  2XD6 A;  3D0B A;  4HYM A;  2O1V A;  3WHA A;  2HKJ A;  2VW5 A;  3INW A;  4YKW A;  2IOR A;  2UWD A;  5J71 A;  4AWP A;  4CWS A;  4L94 A;  2IOP A;  1UYD A;  2WI5 A;  3H80 A;  2BU6 A;  3CWV A;  2YK9 A;  5D6Q A;  4I3H A;  2XDU A;  1B3Q A;  5F5R A;  4XKK A;  4XIT A;  1YES A;  2ESA A;  2XJJ A;  1U0Z A;  5D7C A;  4ASG A;  1YSZ A;  3A0Y A;  2XDS A;  3ZKB A;  3Q5K A;  2H8M A;  1UYK A;  4CE3 A;  3G7E A;  4WUD A;  4XKA A;  2WI1 A;  4H85 A;  1YET A;  2XX4 A;  2XDX A;  3A0W A;  3R4M A;  1UYC A;  1AH6 A;  1YSR A;  2IWS A;  4KSG A;  2BSM A;  2XDL A;  3GIG B;  4URM A;  2YEB A;  4EGK A;  3FT8 A;  1I5B A;  4CE1 A;  1ZW9 A;  2YE5 A;  2YEA A;  2XHT A;  3B27 A;  2PNR A;  3ZXQ A;  4CWO A;  4E01 A;  1U2O A;  1YT0 A;  1ZWH A;  4CWP A;  3D36 A;  3EKR A;  3TZ5 A;  3WQ9 A;  5BOC A;  5FND A;  4U7N A;  4E00 A;  2BTZ A;  2WI2 A;  5CTX A;  4GFN A;  2XAB A;  3BMY A;  3Q5J A;  1Y8O A;  3A0X A;  1H7U A;  3TZ0 A;  1QY8 A;  4CWT A;  2XJG A;  1R62 A;  4FCQ A;  2YKI A;  3T2S A;  4YKT A;  4U93 A;  4CE2 A;  4HXW A;  1BKN A;  5CPH A;  1UYL A;  2HCH A;  2QF6 A;  3JZ3 A;  4XCL A;  5FWK A;  1S14 A;  4PRV A;  5M4H A;  4QPJ A;  1QZR A;  2YK2 A;  3RKZ A;  4MB9 A;  3K60 A;  2YE8 A;  3H4L A;  4URN A;  3B24 A;  4L91 A;  2XX5 A;  4K4O A;  2BYH A;  1OSF A;  2ZBK B;  4MP2 A;  5F3K A;  3EKO A;  4LWF A;  2AKP A;  4CWR A;  2YKC A;  4ZVI A;  4V25 A;  1BXD A;  4FCR A;  3PEJ A;  4YKR A;  4PL9 A;  2YE4 A;  3OWD A;  4LWH A;  1Y4S A;  1TC0 A;  2BU5 A;  4H7Q A;  3BM9 A;  2Q8F A;  4W7T A;  2YGA A;  1AJ6 A;  5IDM A;  1I59 A;  3GIF A;  4ASA A;  2CCT A;  1UYI A;  4B6C A;  1ZXN A;  1L0O A;  4XKO A;  2YKB A;  3IED A;  4XDM A;  4O05 A;  4YKQ A;  1NHH A;  4AWQ A;  4LWE A;  3OW6 A;  4XCJ A;  4ASF A;  1Z5C A;  3NMQ A;  1EA6 A;  3OWB A;  1S16 A;  2H55 A;  3HZ1 A;  3HYY A;  3CRL A;  4YKZ A;  4E02 A;  5M4K A;  1ZXM A;  2WER A;  1Z5A A;  4BQJ A;  1AH8 A;  4FPP A;  3T0Z A;  2BRE A;  3A0R A;  1QYE A;  3R4N A;  2QFO A;  2YE7 A;  2YE9 A;  3KE6 A;  4MP7 A;  2YGF A;  2GFD A;  3HYZ A;  3Q5L A;  2WI7 A;  2E0A A;  4NH9 A;  4XIP A;  1B62 A;  3R4P A;  2FXS A;  1EI1 A;  1MU5 A;  4EFT A;  4FMT A;  3VHD A;  1BYQ A;  3TUH A;  2VWC A;  3EHJ A;  3D2R A;  4BAE A;  2QG2 A;  2XJX A;  2YJX A;  2CGF A;  4R3A A;  4GEE A;  1UYM A;  2YKJ A;  2BT0 A;  2YEF A;  1KIJ A;  1Y4U A;  2YI5 A;  4B7P A;  2ZDX A;  1YT1 A;  2YI0 A;  1A4H A;  1GJV A;  3RLP A;  2Q8H A;  5J6A A;  5M4N A;  4MBC A;  4NH7 A;  1YC1 A;  1UYG A;  4MPC A;  4URL A;  5C93 A;  4EEH A;  4EFU A;  4ASB A;  4O09 A;  2XDK A;  2WI3 A;  1TBW A;  3U2D A;  4YKU A;  3PEH A;  4MOT A;  5D7R A;  4BXI A;  2WEQ A;  4CWQ A;  3MNR P;  3T1K A;  4MPE A;  3O6O A;  4XD8 A;  3GIG A;  3INX A;  3CGY A;  4LWI A;  4PU9 A;  4KQV A;  4YKX A;  1I5C A;  3R4O A;  4XIR A;  2Q8G A;  4GGL A;  4CWN A;  4KTN A;  2YI6 A;  4Q20 A;  1Z5B A;  1NHI A;  4PRX A;  3QTF A;  5GGZ A;  4DUH A;  4NH8 A;  4GT8 A;  4R1F A;  2WEP A;  4KFG A;  1TC6 A;  2YGE A;  3CRK A;  2K5B A;  2YE6 A;  3B25 A;  2ZKJ A;  2XHR A;  3LPS A;  1TH8 A;  2C2A A;  3T0H A;  3R91 A;  3HEK A;  4L90 A;  1JM6 A;  4LWG A;  4HZ5 A;  5CTW A;  2IWU A;  1Z59 A;  2YEG A;  1GKZ A;  5IDJ A;  2YJW A;  2YEE A;  2FYP A;  4BQG A;  4FCP A;  1I5D A;  2O1U A;  3EHF A;  5FNF A;  2YI7 A;  2IWX A;  4BIZ A;  3QDD A;  5D6P A;  2YE2 A;  4L93 A;  4CWF A;  3RLR A;  1B63 A;  3C0E A;  2BZ5 A;  1AMW A;  1I58 A;  3U2K A;  3U67 A;  2QG0 A;  3SL2 A;  1Y8P A;  2BU7 A;  4AWO A;  1UY8 A;  4EGH A;  2IOQ A;  4BIU A;  2YEC A;  2VCI A;  1YS3 A;  2VCJ A; 
#chains in the Genus database with same CATH topology
 1YC3 A;  2XX2 A;  3EHG A;  5M4M A;  5M4P A;  1UYF A;  3CYG A;  4LP0 A;  1US7 A;  2O1W A;  4O07 A;  4XC0 A;  3B28 A;  3K97 A;  3OPD A;  1YC4 A;  2YKE A;  3FV5 A;  5L3J A;  2YE3 A;  3G7B A;  1KZN A;  3EHH A;  3VHC A;  2CCS A;  3VHA A;  3HZ5 A;  3LNU A;  4MPN A;  1UYE A;  4XE2 A;  2GQP A;  1NHJ A;  3OMU A;  2Q8I A;  3S5T A;  4KP4 A;  4P8O A;  4X9L A;  3DGE A;  2ZDY A;  2YED A;  3R92 A;  2FWZ A;  4U7O A;  3VAD A;  4HYP A;  1UYH A;  4DZY A;  5CF0 A;  1I5A A;  1TIL A;  4WUC A;  2Q2E B;  5M4E A;  2XK2 A;  5IN9 A;  4O0B A;  1Y8N A;  4JQL A;  5D7D A;  2WI4 A;  5FNC A;  3ZKD A;  1UY9 A;  4O04 A;  5CTU A;  2EXL A;  3RLQ A;  4I5S A;  3K98 A;  1THN A;  2JKI A;  4GQT A;  5BOD A;  4EM7 A;  2XCM A;  4JAS A;  4E72 A;  3ZXO A;  4P7A A;  2FWY A;  3G75 A;  4JAU A;  4R3M A;  4EMV A;  2CG9 A;  1UY6 A;  4HXZ A;  1YER A;  2BU8 A;  1MX0 A;  1YT2 A;  4KSH A;  2YEI A;  4EGI A;  2YEH A;  4QPK A;  3TZ4 A;  4URO A;  4XTJ A;  2YEJ A;  2CH4 A;  2WI6 A;  1H7S A;  3CGZ A;  2JJC A;  4HZ0 A;  2CCU A;  4LPB A;  3A0Z A;  4AS9 A;  2BRC A;  2XHX A;  4L8Z A;  3TTZ A;  4ZKI A;  1BGQ A;  1GKX A;  1ID0 A;  5CTY A;  4GCZ A;  1AM1 A;  2HHI A;  1TID A;  4V26 A;  4HY6 A;  4YKY A;  4HY1 A;  4H81 A;  3O2F A;  3TZ2 A;  3T10 A;  4JAV A;  3HHU A;  3O0I A;  3A0T A;  3C11 A;  1UY7 A;  3GIE A;  4WUB A;  2HG1 A;  3ZM7 A;  2BU2 A;  3K99 A;  2BYI A;  3FT5 A;  3B26 A;  4XIQ A;  1PVG A;  2XD6 A;  3D0B A;  4HYM A;  2O1V A;  3WHA A;  2HKJ A;  2VW5 A;  3INW A;  4YKW A;  2IOR A;  2UWD A;  5J71 A;  4AWP A;  4CWS A;  4L94 A;  2IOP A;  1UYD A;  2WI5 A;  3H80 A;  2BU6 A;  3CWV A;  2YK9 A;  5D6Q A;  4I3H A;  2XDU A;  1B3Q A;  5F5R A;  4XKK A;  4XIT A;  1YES A;  2ESA A;  2XJJ A;  1U0Z A;  5D7C A;  4ASG A;  1YSZ A;  3A0Y A;  2XDS A;  3ZKB A;  3Q5K A;  2H8M A;  1UYK A;  4CE3 A;  3G7E A;  4WUD A;  4XKA A;  2WI1 A;  4H85 A;  1YET A;  2XX4 A;  2XDX A;  3A0W A;  3R4M A;  1UYC A;  1AH6 A;  1YSR A;  2IWS A;  4KSG A;  2BSM A;  2XDL A;  3GIG B;  4URM A;  2YEB A;  1F51 A;  4EGK A;  3FT8 A;  1I5B A;  4CE1 A;  1ZW9 A;  2YE5 A;  2YEA A;  2XHT A;  3B27 A;  2PNR A;  3ZXQ A;  4CWO A;  4E01 A;  1U2O A;  1YT0 A;  1ZWH A;  4CWP A;  3D36 A;  3EKR A;  3TZ5 A;  3WQ9 A;  5BOC A;  3LMM A;  5FND A;  4U7N A;  4E00 A;  2BTZ A;  1IXM A;  2WI2 A;  5CTX A;  4GFN A;  2XAB A;  3BMY A;  3Q5J A;  1Y8O A;  3A0X A;  1H7U A;  3TZ0 A;  1QY8 A;  4CWT A;  2XJG A;  1R62 A;  4FCQ A;  2YKI A;  3T2S A;  4YKT A;  4U93 A;  4CE2 A;  4HXW A;  1BKN A;  5CPH A;  1UYL A;  2HCH A;  2QF6 A;  3JZ3 A;  4XCL A;  5FWK A;  1S14 A;  4PRV A;  5M4H A;  4QPJ A;  1QZR A;  2YK2 A;  3RKZ A;  4MB9 A;  3K60 A;  2YE8 A;  3H4L A;  4URN A;  3B24 A;  4L91 A;  2XX5 A;  4K4O A;  2BYH A;  1OSF A;  2ZBK B;  4MP2 A;  5F3K A;  3EKO A;  4LWF A;  2AKP A;  4CWR A;  2YKC A;  4ZVI A;  4V25 A;  1BXD A;  4FCR A;  3PEJ A;  4YKR A;  4PL9 A;  2YE4 A;  3OWD A;  4LWH A;  1Y4S A;  1TC0 A;  2BU5 A;  4H7Q A;  3BM9 A;  2Q8F A;  4W7T A;  2YGA A;  1AJ6 A;  5IDM A;  1I59 A;  3GIF A;  4ASA A;  5JEN A;  2CCT A;  1UYI A;  4B6C A;  1ZXN A;  1L0O A;  4XKO A;  2YKB A;  3IED A;  4XDM A;  4O05 A;  4YKQ A;  1NHH A;  4AWQ A;  4LWE A;  3OW6 A;  4XCJ A;  4ASF A;  1Z5C A;  3NMQ A;  1EA6 A;  3OWB A;  1S16 A;  2H55 A;  3HZ1 A;  3HYY A;  3CRL A;  4YKZ A;  4E02 A;  5M4K A;  1ZXM A;  2WER A;  1Z5A A;  4BQJ A;  1AH8 A;  4FPP A;  3T0Z A;  2BRE A;  3A0R A;  1QYE A;  3R4N A;  2C1I A;  2QFO A;  2YE7 A;  2YE9 A;  3KE6 A;  4MP7 A;  2YGF A;  2GFD A;  3HYZ A;  3Q5L A;  2FTK A;  2WI7 A;  2E0A A;  4NH9 A;  4XIP A;  1B62 A;  3R4P A;  2FXS A;  1EI1 A;  1MU5 A;  4EFT A;  4FMT A;  3VHD A;  1BYQ A;  3TUH A;  3EHJ A;  2VWC A;  3D2R A;  4BAE A;  2QG2 A;  2XJX A;  2YJX A;  2CGF A;  4R3A A;  4GEE A;  1UYM A;  2YKJ A;  2BT0 A;  2YEF A;  1KIJ A;  1Y4U A;  2YI5 A;  4B7P A;  2ZDX A;  1YT1 A;  2YI0 A;  1A4H A;  1GJV A;  3RLP A;  2Q8H A;  5J6A A;  5M4N A;  4MBC A;  4NH7 A;  1YC1 A;  1UYG A;  4MPC A;  4URL A;  5C93 A;  4EEH A;  4EFU A;  4ASB A;  4O09 A;  2XDK A;  2WI3 A;  1TBW A;  3U2D A;  4YKU A;  3PEH A;  4MOT A;  5D7R A;  4BXI A;  2WEQ A;  4CWQ A;  3MNR P;  3T1K A;  4MPE A;  3O6O A;  4XD8 A;  3GIG A;  3INX A;  3CGY A;  4LWI A;  4PU9 A;  4KQV A;  4YKX A;  1I5C A;  3R4O A;  4XIR A;  2Q8G A;  4GGL A;  4CWN A;  4KTN A;  2YI6 A;  4Q20 A;  1Z5B A;  1NHI A;  4PRX A;  3QTF A;  5GGZ A;  4DUH A;  4NH8 A;  4GT8 A;  4R1F A;  2WEP A;  4KFG A;  1TC6 A;  2YGE A;  3CRK A;  2K5B A;  2YE6 A;  3B25 A;  2ZKJ A;  2XHR A;  3LPS A;  1TH8 A;  2C2A A;  3T0H A;  3R91 A;  3HEK A;  4L90 A;  1JM6 A;  4LWG A;  4HZ5 A;  5CTW A;  2IWU A;  1Z59 A;  2YEG A;  1GKZ A;  5IDJ A;  2C1G A;  2YJW A;  2YEE A;  2FYP A;  4BQG A;  4FCP A;  1I5D A;  2O1U A;  3EHF A;  5FNF A;  2YI7 A;  2IWX A;  4BIZ A;  3QDD A;  5D6P A;  2YE2 A;  4L93 A;  4CWF A;  3RLR A;  1B63 A;  3C0E A;  2BZ5 A;  1AMW A;  1I58 A;  3U2K A;  3U67 A;  2QG0 A;  3SL2 A;  1Y8P A;  2BU7 A;  4AWO A;  1UY8 A;  4EGH A;  2IOQ A;  4BIU A;  2YEC A;  2VCI A;  1YS3 A;  2VCJ A; 
#chains in the Genus database with same CATH homology
 1YC3 A;  2XX2 A;  3EHG A;  5M4M A;  5M4P A;  1UYF A;  4LP0 A;  1US7 A;  2O1W A;  4O07 A;  4XC0 A;  3B28 A;  3K97 A;  3OPD A;  1YC4 A;  2YKE A;  3FV5 A;  5L3J A;  2YE3 A;  3G7B A;  1KZN A;  3EHH A;  3VHC A;  2CCS A;  3VHA A;  3HZ5 A;  3LNU A;  4MPN A;  1UYE A;  4XE2 A;  2GQP A;  1NHJ A;  3OMU A;  2Q8I A;  4KP4 A;  4P8O A;  4X9L A;  3DGE A;  2ZDY A;  2YED A;  3R92 A;  2FWZ A;  4U7O A;  3VAD A;  4HYP A;  1UYH A;  4DZY A;  5CF0 A;  1I5A A;  1TIL A;  4WUC A;  2Q2E B;  5M4E A;  2XK2 A;  5IN9 A;  4O0B A;  1Y8N A;  4JQL A;  5D7D A;  2WI4 A;  5FNC A;  3ZKD A;  1UY9 A;  4O04 A;  5CTU A;  2EXL A;  3RLQ A;  4I5S A;  3K98 A;  1THN A;  2JKI A;  4GQT A;  5BOD A;  4EM7 A;  2XCM A;  4JAS A;  3ZXO A;  4P7A A;  2FWY A;  3G75 A;  4JAU A;  4R3M A;  4EMV A;  2CG9 A;  1UY6 A;  4HXZ A;  1YER A;  2BU8 A;  1MX0 A;  1YT2 A;  4KSH A;  2YEI A;  4EGI A;  2YEH A;  4QPK A;  3TZ4 A;  4URO A;  4XTJ A;  2YEJ A;  2CH4 A;  2WI6 A;  1H7S A;  3CGZ A;  2JJC A;  4HZ0 A;  2CCU A;  4LPB A;  3A0Z A;  4AS9 A;  4L8Z A;  2BRC A;  2XHX A;  3TTZ A;  4ZKI A;  1BGQ A;  1GKX A;  1ID0 A;  5CTY A;  4GCZ A;  1AM1 A;  1TID A;  4V26 A;  4HY6 A;  4YKY A;  4HY1 A;  4H81 A;  3O2F A;  3TZ2 A;  3T10 A;  4JAV A;  3HHU A;  3O0I A;  3A0T A;  3C11 A;  1UY7 A;  3GIE A;  4WUB A;  2HG1 A;  3ZM7 A;  2BU2 A;  3K99 A;  2BYI A;  3FT5 A;  3B26 A;  4XIQ A;  1PVG A;  2XD6 A;  3D0B A;  4HYM A;  2O1V A;  3WHA A;  2HKJ A;  2VW5 A;  3INW A;  4YKW A;  2IOR A;  2UWD A;  5J71 A;  4AWP A;  4CWS A;  4L94 A;  2IOP A;  1UYD A;  2WI5 A;  3H80 A;  2BU6 A;  3CWV A;  2YK9 A;  5D6Q A;  4I3H A;  2XDU A;  1B3Q A;  5F5R A;  4XKK A;  4XIT A;  1YES A;  2ESA A;  2XJJ A;  1U0Z A;  5D7C A;  4ASG A;  1YSZ A;  3A0Y A;  2XDS A;  3ZKB A;  3Q5K A;  2H8M A;  1UYK A;  4CE3 A;  3G7E A;  4WUD A;  4XKA A;  2WI1 A;  4H85 A;  1YET A;  2XX4 A;  2XDX A;  3A0W A;  3R4M A;  1UYC A;  1AH6 A;  1YSR A;  2IWS A;  4KSG A;  2BSM A;  2XDL A;  3GIG B;  4URM A;  2YEB A;  4EGK A;  3FT8 A;  1I5B A;  4CE1 A;  1ZW9 A;  2YE5 A;  2YEA A;  2XHT A;  3B27 A;  2PNR A;  3ZXQ A;  4CWO A;  4E01 A;  1U2O A;  1YT0 A;  1ZWH A;  4CWP A;  3D36 A;  3EKR A;  3TZ5 A;  3WQ9 A;  5BOC A;  5FND A;  4U7N A;  4E00 A;  2BTZ A;  2WI2 A;  5CTX A;  4GFN A;  2XAB A;  3BMY A;  3Q5J A;  1Y8O A;  3A0X A;  1H7U A;  3TZ0 A;  1QY8 A;  4CWT A;  2XJG A;  1R62 A;  4FCQ A;  2YKI A;  3T2S A;  4YKT A;  4U93 A;  4CE2 A;  4HXW A;  1BKN A;  5CPH A;  1UYL A;  2HCH A;  2QF6 A;  3JZ3 A;  4XCL A;  5FWK A;  1S14 A;  4PRV A;  5M4H A;  4QPJ A;  1QZR A;  2YK2 A;  3RKZ A;  4MB9 A;  3K60 A;  2YE8 A;  3H4L A;  4URN A;  3B24 A;  4L91 A;  2XX5 A;  4K4O A;  2BYH A;  1OSF A;  2ZBK B;  4MP2 A;  5F3K A;  3EKO A;  4LWF A;  2AKP A;  4CWR A;  2YKC A;  4ZVI A;  4V25 A;  1BXD A;  4FCR A;  3PEJ A;  4YKR A;  4PL9 A;  2YE4 A;  3OWD A;  4LWH A;  1Y4S A;  1TC0 A;  2BU5 A;  4H7Q A;  3BM9 A;  2Q8F A;  4W7T A;  2YGA A;  1AJ6 A;  5IDM A;  1I59 A;  3GIF A;  4ASA A;  2CCT A;  1UYI A;  4B6C A;  1ZXN A;  1L0O A;  4XKO A;  2YKB A;  3IED A;  4XDM A;  4O05 A;  4YKQ A;  1NHH A;  4AWQ A;  4LWE A;  3OW6 A;  4XCJ A;  4ASF A;  1Z5C A;  3NMQ A;  1EA6 A;  3OWB A;  1S16 A;  2H55 A;  3HZ1 A;  3HYY A;  3CRL A;  4YKZ A;  4E02 A;  5M4K A;  1ZXM A;  2WER A;  1Z5A A;  4BQJ A;  1AH8 A;  4FPP A;  3T0Z A;  2BRE A;  3A0R A;  1QYE A;  3R4N A;  2QFO A;  2YE7 A;  2YE9 A;  3KE6 A;  4MP7 A;  2YGF A;  2GFD A;  3HYZ A;  3Q5L A;  2WI7 A;  2E0A A;  4NH9 A;  4XIP A;  1B62 A;  3R4P A;  2FXS A;  1EI1 A;  1MU5 A;  4EFT A;  4FMT A;  3VHD A;  1BYQ A;  3TUH A;  2VWC A;  3EHJ A;  3D2R A;  4BAE A;  2QG2 A;  2XJX A;  2YJX A;  2CGF A;  4R3A A;  4GEE A;  1UYM A;  2YKJ A;  2BT0 A;  2YEF A;  1KIJ A;  1Y4U A;  2YI5 A;  4B7P A;  2ZDX A;  1YT1 A;  2YI0 A;  1A4H A;  1GJV A;  3RLP A;  2Q8H A;  5J6A A;  5M4N A;  4MBC A;  4NH7 A;  1YC1 A;  1UYG A;  4MPC A;  4URL A;  5C93 A;  4EEH A;  4EFU A;  4ASB A;  4O09 A;  2XDK A;  2WI3 A;  1TBW A;  3U2D A;  4YKU A;  3PEH A;  4MOT A;  5D7R A;  4BXI A;  2WEQ A;  4CWQ A;  3MNR P;  3T1K A;  4MPE A;  3O6O A;  4XD8 A;  3GIG A;  3INX A;  3CGY A;  4LWI A;  4PU9 A;  4KQV A;  4YKX A;  1I5C A;  3R4O A;  4XIR A;  2Q8G A;  4GGL A;  4CWN A;  4KTN A;  2YI6 A;  4Q20 A;  1Z5B A;  1NHI A;  4PRX A;  3QTF A;  5GGZ A;  4DUH A;  4NH8 A;  4GT8 A;  4R1F A;  2WEP A;  4KFG A;  1TC6 A;  2YGE A;  3CRK A;  2K5B A;  2YE6 A;  3B25 A;  2ZKJ A;  2XHR A;  3LPS A;  1TH8 A;  2C2A A;  3T0H A;  3R91 A;  3HEK A;  4L90 A;  1JM6 A;  4LWG A;  4HZ5 A;  5CTW A;  2IWU A;  1Z59 A;  2YEG A;  1GKZ A;  5IDJ A;  2YJW A;  2YEE A;  2FYP A;  4BQG A;  4FCP A;  1I5D A;  2O1U A;  3EHF A;  5FNF A;  2YI7 A;  2IWX A;  4BIZ A;  3QDD A;  5D6P A;  2YE2 A;  4L93 A;  4CWF A;  3RLR A;  1B63 A;  3C0E A;  2BZ5 A;  1AMW A;  1I58 A;  3U2K A;  3U67 A;  2QG0 A;  3SL2 A;  1Y8P A;  2BU7 A;  4AWO A;  1UY8 A;  4EGH A;  2IOQ A;  4BIU A;  2YEC A;  2VCI A;  1YS3 A;  2VCJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...