2H8MA

N-domain of grp94 in complex with the 2-iodo-neca
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
227
structure length
215
Chain Sequence
b'EKFAFQAEVNRMMKLIINSLYKNKEIFLRELISNASDALDKIRLISLTDENALAGNEELTVKIKCDKEKNLLHVTDTGVGMTREELVKNLGTIGTSEFLNKMTEAQTSELIGQFGVGFYSAFLVADKVIVTSKHNNDTQHIWESDSNEFSVIADPRGNTLGRGTTITLVLKEEASDYLELDTIKNLVKKYSQFINFPIYVWSSKTKTVWDWELMN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Endoplasmin
publication title N-Domain Of Grp94 In Complex With the 2-Iodo-NECA
rcsb
source organism Canis lupus familiaris
molecule tags Chaperone
total genus 64
structure length 215
sequence length 227
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-06-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02518 HATPase_c Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.565.10 Alpha Beta 2-Layer Sandwich Heat Shock Protein 90 Histidine kinase-like ATPase, C-terminal domain 2h8mA00
4NH9A 2K5BA 1YSZA 4YKUA 4ZVIA 3OW6A 2IOQA 1H7SA 3H80A 5IDMA 1YERA 4L90A 3R4MA 4KTNA 3O2FA 1UYDA 4MP2A 3CGZA 3QTFA 3A0TA 1U0ZA 3EHFA 4O05A 3EHHA 4BQGA 2BSMA 5CPHA 4CE3A 2IWXA 1YC3A 4GGLA 1B63A 4HYPA 1R62A 1YC4A 4HZ0A 4EFTA 2YI0A 4L91A 4O04A 4LP0A 3ZKBA 1B3QA 1TBWA 5CTWA 4LWEA 2YE7A 4W7TA 1YSRA 5CTYA 2YE4A 3TZ5A 2GFDA 3G7EA 1Y4UA 4YKTA 1Z5AA 2XX4A 3C0EA 5D7RA 3GIFA 4PU9A 3K97A 3GIGA 1MU5A 1I5BA 3PEJA 4B6CA 2YKJA 4LWIA 1UY9A 2GQPA 1UYCA 1THNA 3T2SA 2QFOA 2E0AA 3HZ1A 2BU6A 3Q5LA 2O1UA 3RLQA 2Q8FA 4YKXA 4EGKA 2YEHA 3INWA 4BIZA 3WQ9A 4ASAA 1QY8A 3EHGA 1MX0A 2XJXA 3TZ4A 4L8ZA 5BOCA 2XDUA 4CE1A 4BIUA 3O0IA 4EGHA 2CH4A 3RKZA 4CE2A 2BREA 3EHJA 3U2KA 3GIGB 4WUDA 2WI1A 5D6QA 5M4NA 3BMYA 4E02A 4CWQA 2WEPA 1TH8A 2YKIA 2YEAA 4V26A 2YI6A 4LPBA 3ZKDA 5M4EA 4MBCA 2CG9A 2YK2A 2XJJA 3HHUA 3OPDA 2WERA 4NH7A 4XCJA 1AMWA 3HYYA 2H8MA 1Z5CA 4XCLA 3VHAA 4HXZA 4PRVA 3T0ZA 5IN9A 1UYLA 1AH8A 1BGQA 2XDKA 2YI7A 4YKZA 3A0RA 2VW5A 2FXSA 2YJWA 4I3HA 2YEJA 3D0BA 4JAVA 4EEHA 4XIQA 3R4NA 2QG2A 2ZDXA 3Q5JA 4LWGA 3T10A 4XC0A 2H55A 4QPKA 2HG1A 1GKXA 3G7BA 2JKIA 3QDDA 2BTZA 3SL2A 5GGZA 3GIEA 5F3KA 2BU2A 4XIPA 4XKKA 5FNCA 2BYIA 1NHJA 1ZXMA 4GEEA 2YGFA 3O6OA 3DGEA 1UYIA 3B25A 2BYHA 4FPPA 4U93A 4LWFA 5C93A 4YKYA 1EA6A 3R4PA 4HY1A 1BXDA 2YK9A 2YE9A 4K4OA 1QYEA 3PEHA 3C11A 4H85A 3U2DA 4L94A 1UY7A 4Q20A 3ZXQA 5CTUA 1GJVA 1U2OA 2PNRA 3D36A 4KSHA 3A0XA 1BKNA 1QZRA 3ZM7A 1Y8NA 3BM9A 4DZYA 1I5CA 4EGIA 1Z59A 4I5SA 2ZKJA 4ASBA 2XDSA 4R3AA 4MOTA 3VADA 2WI7A 5M4PA 3B27A 4AWQA 1AM1A 4O0BA 3CRLA 1TC0A 2YJXA 3B28A 4E00A 1UYEA 4BXIA 4URLA 2CCUA 2EXLA 4JASA 1YC1A 4PL9A 4XITA 2C2AA 1S16A 1H7UA 1I59A 3VHCA 1Y4SA 3FV5A 4HZ5A 4ASFA 4CWSA 4AWPA 3WHAA 4U7NA 5CTXA 5F5RA 3G75A 5J6AA 5J71A 3FT5A 1BYQA 2HCHA 4JQLA 1ID0A 4MPCA 1YT0A 4BQJA 1UYGA 4MPNA 1YT2A 3D2RA 1Y8OA 4URNA 1Y8PA 1TC6A 1I5DA 3TZ2A 4EMVA 1UY6A 3R4OA 2O1WA 3K99A 3RLRA 4P7AA 4P8OA 1ZXNA 4FMTA 4H7QA 3VHDA 4URMA 4KP4A 3T1KA 2BU7A 2Q2EB 2YECA 3CRKA 4WUBA 3TUHA 4CWOA 2XX2A 3ZXOA 2FWYA 3OWDA 2BU8A 4CWNA 4ZKIA 4O07A 1A4HA 4MPEA 4HYMA 4FCQA 2WI3A 5FNDA 3A0YA 4L93A 3NMQA 2VCJA 2IWUA 4AS9A 2WI2A 3HZ5A 2CGFA 1L0OA 2VCIA 4DUHA 4EM7A 3A0WA 3K60A 4ASGA 4LWHA 3OWBA 2YE5A 4B7PA 5FNFA 1AH6A 1YESA 2ESAA 1KIJA 2YE3A 4GCZA 4CWFA 5M4KA 2YKCA 2YKEA 4EFUA 2BZ5A 4BAEA 3CGYA 2XDXA 4XIRA 5D6PA 5IDJA 3IEDA 4CWRA 4FCRA 1KZNA 2YEBA 1AJ6A 4XKOA 2VWCA 2XHTA 2YEGA 4R3MA 1PVGA 5CF0A 2YE8A 2YEFA 3TTZA 4QPJA 4JAUA 3RLPA 3FT8A 2XJGA 4FCPA 1TILA 4XKAA 3K98A 3LPSA 1TIDA 1GKZA 2Q8GA 1B62A 1I58A 2YGEA 4U7OA 3U67A 2WI6A 1S14A 2XK2A 1NHHA 2BT0A 4KSGA 4HXWA 1YS3A 2Q8HA 4GFNA 1Z5BA 5FWKA 3MNRP 2QG0A 4NH8A 2YKBA 4CWPA 1UYHA 2WI4A 2IWSA 5D7CA 4YKWA 2YE2A 1YETA 4CWTA 2XD6A 5M4HA 2ZDYA 4MP7A 3EKOA 3T0HA 3TZ0A 2ZBKB 2FWZA 4XDMA 2CCSA 1ZW9A 2WEQA 1UYMA 4XD8A 2XX5A 2Q8IA 4O09A 3EKRA 2IOPA 4YKQA 1I5AA 1OSFA 2CCTA 3HEKA 2YEEA 4WUCA 4GT8A 4YKRA 2XDLA 1UYKA 4KFGA 1NHIA 2IORA 2YI5A 4HY6A 4XE2A 2YE6A 1ZWHA 2WI5A 3LNUA 3INXA 1UY8A 1US7A 3JZ3A 4R1FA 4PRXA 2HKJA 3B26A 5D7DA 3CWVA 2XABA 3KE6A 2JJCA 4UROA 3B24A 4X9LA 2BRCA 3HYZA 4XTJA 4H81A 2XHXA 3R92A 2YEDA 3R91A 3H4LA 1JM6A 1YT1A 2XHRA 5M4MA 4MB9A 1UYFA 3Q5KA 2YGAA 2BU5A 5L3JA 2AKPA 1EI1A 5BODA 4AWOA 4V25A 4KQVA 2YEIA 2O1VA 3A0ZA 4GQTA 2UWDA 4E01A 3OMUA 2FYPA 2QF6A 2XCMA
chains in the Genus database with same CATH superfamily
4NH9A 2K5BA 1YSZA 4YKUA 4ZVIA 3OW6A 2IOQA 1H7SA 3H80A 5IDMA 1YERA 4L90A 3R4MA 4KTNA 3O2FA 1UYDA 4MP2A 3CGZA 3QTFA 3A0TA 1U0ZA 3EHFA 4O05A 3EHHA 4BQGA 2BSMA 5CPHA 4CE3A 2IWXA 1YC3A 4GGLA 1B63A 4HYPA 1R62A 1YC4A 4HZ0A 4EFTA 2YI0A 4L91A 4O04A 4LP0A 3ZKBA 1B3QA 1TBWA 5CTWA 4LWEA 2YE7A 4W7TA 1YSRA 5CTYA 2YE4A 3TZ5A 2GFDA 3G7EA 1Y4UA 4YKTA 1Z5AA 2XX4A 3C0EA 5D7RA 3GIFA 4PU9A 3K97A 3GIGA 1MU5A 1I5BA 3PEJA 4B6CA 2C1IA 2YKJA 4LWIA 1UY9A 2GQPA 1UYCA 1THNA 3T2SA 2QFOA 2E0AA 3HZ1A 2BU6A 3Q5LA 2O1UA 3RLQA 2Q8FA 4YKXA 4EGKA 2YEHA 3INWA 4BIZA 3WQ9A 4ASAA 1QY8A 3EHGA 1MX0A 2XJXA 3TZ4A 4L8ZA 5BOCA 2XDUA 4CE1A 4BIUA 3O0IA 4EGHA 2CH4A 3RKZA 4CE2A 2BREA 3EHJA 3U2KA 3GIGB 4WUDA 2WI1A 5D6QA 5M4NA 3BMYA 4E02A 4CWQA 2WEPA 1TH8A 2YKIA 2YEAA 4V26A 2YI6A 4LPBA 3ZKDA 5M4EA 4MBCA 2CG9A 2YK2A 2XJJA 3HHUA 3OPDA 2WERA 4NH7A 4XCJA 1AMWA 3HYYA 2H8MA 1Z5CA 4XCLA 3VHAA 4HXZA 4PRVA 3T0ZA 5IN9A 1UYLA 1AH8A 1BGQA 2XDKA 2YI7A 4YKZA 3A0RA 2VW5A 2FXSA 2YJWA 4I3HA 2YEJA 3D0BA 4JAVA 4EEHA 4XIQA 3R4NA 2QG2A 2ZDXA 3Q5JA 4LWGA 3T10A 4XC0A 2H55A 4QPKA 2HG1A 1GKXA 3G7BA 2JKIA 3QDDA 2BTZA 3SL2A 5GGZA 3GIEA 5F3KA 2BU2A 4XIPA 4XKKA 5FNCA 2BYIA 1NHJA 1ZXMA 4GEEA 2YGFA 3O6OA 3DGEA 1UYIA 3B25A 2BYHA 4FPPA 4U93A 4LWFA 5C93A 4YKYA 1EA6A 3R4PA 4HY1A 1BXDA 2YK9A 2YE9A 4K4OA 1QYEA 3PEHA 3C11A 4H85A 3U2DA 3CYGA 4L94A 1UY7A 4Q20A 3ZXQA 5CTUA 1GJVA 1U2OA 2PNRA 3D36A 4KSHA 3A0XA 1BKNA 1QZRA 3ZM7A 1Y8NA 3BM9A 4DZYA 1I5CA 4EGIA 1Z59A 4I5SA 2ZKJA 4ASBA 2XDSA 4R3AA 4MOTA 3VADA 2WI7A 5M4PA 3B27A 4AWQA 1AM1A 4O0BA 3CRLA 1TC0A 2YJXA 3B28A 4E00A 1UYEA 4BXIA 4URLA 2CCUA 2EXLA 4JASA 1YC1A 4PL9A 4XITA 2C2AA 1S16A 1H7UA 1I59A 3VHCA 1Y4SA 3FV5A 4HZ5A 4ASFA 4CWSA 4AWPA 3WHAA 4U7NA 5CTXA 5F5RA 3G75A 5J6AA 5J71A 3FT5A 1BYQA 2HCHA 4JQLA 1ID0A 4MPCA 1YT0A 4BQJA 1UYGA 4MPNA 1YT2A 3D2RA 1Y8OA 4URNA 1Y8PA 1TC6A 1I5DA 3TZ2A 4EMVA 1UY6A 3R4OA 2O1WA 3K99A 3RLRA 4P7AA 4P8OA 1ZXNA 4FMTA 4H7QA 3VHDA 4URMA 4KP4A 3T1KA 2BU7A 2Q2EB 2YECA 3CRKA 4WUBA 3TUHA 4CWOA 2XX2A 3ZXOA 2FWYA 3OWDA 2BU8A 4CWNA 4ZKIA 4O07A 1A4HA 4MPEA 4HYMA 4FCQA 4E72A 2WI3A 5FNDA 3A0YA 4L93A 3NMQA 2VCJA 2IWUA 1F51A 2WI2A 3HZ5A 4AS9A 2CGFA 1L0OA 2VCIA 4DUHA 4EM7A 3A0WA 3K60A 4ASGA 4LWHA 3OWBA 2YE5A 4B7PA 5FNFA 1AH6A 1YESA 2ESAA 1KIJA 2YE3A 4GCZA 4CWFA 5M4KA 2YKCA 2YKEA 4EFUA 2BZ5A 4BAEA 3CGYA 2XDXA 4XIRA 5D6PA 5IDJA 3IEDA 4CWRA 4FCRA 1KZNA 2YEBA 1AJ6A 4XKOA 2VWCA 2C1GA 2XHTA 2YEGA 4R3MA 1PVGA 5CF0A 2YE8A 2YEFA 3TTZA 4QPJA 4JAUA 3RLPA 3FT8A 2XJGA 4FCPA 1TILA 4XKAA 3K98A 3LPSA 1TIDA 1GKZA 2Q8GA 1B62A 1I58A 2YGEA 4U7OA 5JENA 3U67A 2WI6A 1S14A 2XK2A 1NHHA 2BT0A 4KSGA 4HXWA 1YS3A 2Q8HA 4GFNA 1Z5BA 5FWKA 3MNRP 2QG0A 4NH8A 2YKBA 4CWPA 1UYHA 2WI4A 2IWSA 5D7CA 4YKWA 2YE2A 1YETA 4CWTA 2XD6A 5M4HA 2ZDYA 4MP7A 3EKOA 3T0HA 3TZ0A 2ZBKB 2FWZA 4XDMA 2CCSA 1ZW9A 2WEQA 1UYMA 4XD8A 2XX5A 2Q8IA 4O09A 3EKRA 2IOPA 4YKQA 1I5AA 1OSFA 2CCTA 3HEKA 2YEEA 4WUCA 4GT8A 4YKRA 2XDLA 1UYKA 4KFGA 1NHIA 2IORA 2YI5A 4HY6A 4XE2A 2YE6A 3S5TA 1ZWHA 2WI5A 3LNUA 1IXMA 3INXA 1UY8A 1US7A 3JZ3A 4R1FA 4PRXA 2HKJA 3B26A 5D7DA 3CWVA 2XABA 3KE6A 2JJCA 4UROA 3B24A 4X9LA 2BRCA 3HYZA 2FTKA 4XTJA 4H81A 2XHXA 3R92A 2YEDA 3R91A 3H4LA 1JM6A 1YT1A 2XHRA 5M4MA 4MB9A 1UYFA 3Q5KA 2YGAA 2BU5A 3LMMA 2AKPA 5L3JA 1EI1A 5BODA 4AWOA 4V25A 4KQVA 2YEIA 2O1VA 3A0ZA 4GQTA 2UWDA 4E01A 3OMUA 2FYPA 2QF6A 2HHIA 2XCMA
chains in the Genus database with same CATH topology
4NH9A 2K5BA 1YSZA 4YKUA 4ZVIA 3OW6A 2IOQA 1H7SA 3H80A 5IDMA 1YERA 4L90A 3R4MA 4KTNA 3O2FA 1UYDA 4MP2A 3CGZA 3QTFA 3A0TA 1U0ZA 3EHFA 4O05A 3EHHA 4BQGA 2BSMA 5CPHA 4CE3A 2IWXA 1YC3A 4GGLA 1B63A 4HYPA 1R62A 1YC4A 4HZ0A 4EFTA 2YI0A 4L91A 4O04A 4LP0A 3ZKBA 1B3QA 1TBWA 5CTWA 4LWEA 2YE7A 4W7TA 1YSRA 5CTYA 2YE4A 3TZ5A 2GFDA 3G7EA 1Y4UA 4YKTA 1Z5AA 2XX4A 3C0EA 5D7RA 3GIFA 4PU9A 3K97A 3GIGA 1MU5A 1I5BA 3PEJA 4B6CA 2YKJA 4LWIA 1UY9A 2GQPA 1UYCA 1THNA 3T2SA 2QFOA 2E0AA 3HZ1A 2BU6A 3Q5LA 2O1UA 3RLQA 2Q8FA 4YKXA 4EGKA 2YEHA 3INWA 4BIZA 3WQ9A 4ASAA 1QY8A 3EHGA 1MX0A 2XJXA 3TZ4A 4L8ZA 5BOCA 2XDUA 4CE1A 4BIUA 3O0IA 4EGHA 2CH4A 3RKZA 4CE2A 2BREA 3EHJA 3U2KA 3GIGB 4WUDA 2WI1A 5D6QA 5M4NA 3BMYA 4E02A 4CWQA 2WEPA 1TH8A 2YKIA 2YEAA 4V26A 2YI6A 4LPBA 3ZKDA 5M4EA 4MBCA 2CG9A 2YK2A 2XJJA 3HHUA 3OPDA 2WERA 4NH7A 4XCJA 1AMWA 3HYYA 2H8MA 1Z5CA 4XCLA 3VHAA 4HXZA 4PRVA 3T0ZA 5IN9A 1UYLA 1AH8A 1BGQA 2XDKA 2YI7A 4YKZA 3A0RA 2VW5A 2FXSA 2YJWA 4I3HA 2YEJA 3D0BA 4JAVA 4EEHA 4XIQA 3R4NA 2QG2A 2ZDXA 3Q5JA 4LWGA 3T10A 4XC0A 2H55A 4QPKA 2HG1A 1GKXA 3G7BA 2JKIA 3QDDA 2BTZA 3SL2A 5GGZA 3GIEA 5F3KA 2BU2A 4XIPA 4XKKA 5FNCA 2BYIA 1NHJA 1ZXMA 4GEEA 2YGFA 3O6OA 3DGEA 1UYIA 3B25A 2BYHA 4FPPA 4U93A 4LWFA 5C93A 4YKYA 1EA6A 3R4PA 4HY1A 1BXDA 2YK9A 2YE9A 4K4OA 1QYEA 3PEHA 3C11A 4H85A 3U2DA 4L94A 1UY7A 4Q20A 3ZXQA 5CTUA 1GJVA 1U2OA 2PNRA 3D36A 4KSHA 3A0XA 1BKNA 1QZRA 3ZM7A 1Y8NA 3BM9A 4DZYA 1I5CA 4EGIA 1Z59A 4I5SA 2ZKJA 4ASBA 2XDSA 4R3AA 4MOTA 3VADA 2WI7A 5M4PA 3B27A 4AWQA 1AM1A 4O0BA 3CRLA 1TC0A 2YJXA 3B28A 4E00A 1UYEA 4BXIA 4URLA 2CCUA 2EXLA 4JASA 1YC1A 4PL9A 4XITA 2C2AA 1S16A 1H7UA 1I59A 3VHCA 1Y4SA 3FV5A 4HZ5A 4ASFA 4CWSA 4AWPA 3WHAA 4U7NA 5CTXA 5F5RA 3G75A 5J6AA 5J71A 3FT5A 1BYQA 2HCHA 4JQLA 1ID0A 4MPCA 1YT0A 4BQJA 1UYGA 4MPNA 1YT2A 3D2RA 1Y8OA 4URNA 1Y8PA 1TC6A 1I5DA 3TZ2A 4EMVA 1UY6A 3R4OA 2O1WA 3K99A 3RLRA 4P7AA 4P8OA 1ZXNA 4FMTA 4H7QA 3VHDA 4URMA 4KP4A 3T1KA 2BU7A 2Q2EB 2YECA 3CRKA 4WUBA 3TUHA 4CWOA 2XX2A 3ZXOA 2FWYA 3OWDA 2BU8A 4CWNA 4ZKIA 4O07A 1A4HA 4MPEA 4HYMA 4FCQA 2WI3A 5FNDA 3A0YA 4L93A 3NMQA 2VCJA 2IWUA 4AS9A 2WI2A 3HZ5A 2CGFA 1L0OA 2VCIA 4DUHA 4EM7A 3A0WA 3K60A 4ASGA 4LWHA 3OWBA 2YE5A 4B7PA 5FNFA 1AH6A 1YESA 2ESAA 1KIJA 2YE3A 4GCZA 4CWFA 5M4KA 2YKCA 2YKEA 4EFUA 2BZ5A 4BAEA 3CGYA 2XDXA 4XIRA 5D6PA 5IDJA 3IEDA 4CWRA 4FCRA 1KZNA 2YEBA 1AJ6A 4XKOA 2VWCA 2XHTA 2YEGA 4R3MA 1PVGA 5CF0A 2YE8A 2YEFA 3TTZA 4QPJA 4JAUA 3RLPA 3FT8A 2XJGA 4FCPA 1TILA 4XKAA 3K98A 3LPSA 1TIDA 1GKZA 2Q8GA 1B62A 1I58A 2YGEA 4U7OA 3U67A 2WI6A 1S14A 2XK2A 1NHHA 2BT0A 4KSGA 4HXWA 1YS3A 2Q8HA 4GFNA 1Z5BA 5FWKA 3MNRP 2QG0A 4NH8A 2YKBA 4CWPA 1UYHA 2WI4A 2IWSA 5D7CA 4YKWA 2YE2A 1YETA 4CWTA 2XD6A 5M4HA 2ZDYA 4MP7A 3EKOA 3T0HA 3TZ0A 2ZBKB 2FWZA 4XDMA 2CCSA 1ZW9A 2WEQA 1UYMA 4XD8A 2XX5A 2Q8IA 4O09A 3EKRA 2IOPA 4YKQA 1I5AA 1OSFA 2CCTA 3HEKA 2YEEA 4WUCA 4GT8A 4YKRA 2XDLA 1UYKA 4KFGA 1NHIA 2IORA 2YI5A 4HY6A 4XE2A 2YE6A 1ZWHA 2WI5A 3LNUA 3INXA 1UY8A 1US7A 3JZ3A 4R1FA 4PRXA 2HKJA 3B26A 5D7DA 3CWVA 2XABA 3KE6A 2JJCA 4UROA 3B24A 4X9LA 2BRCA 3HYZA 4XTJA 4H81A 2XHXA 3R92A 2YEDA 3R91A 3H4LA 1JM6A 1YT1A 2XHRA 5M4MA 4MB9A 1UYFA 3Q5KA 2YGAA 2BU5A 5L3JA 2AKPA 1EI1A 5BODA 4AWOA 4V25A 4KQVA 2YEIA 2O1VA 3A0ZA 4GQTA 2UWDA 4E01A 3OMUA 2FYPA 2QF6A 2XCMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4NH9 A;  2K5B A;  1YSZ A;  4YKU A;  4ZVI A;  3OW6 A;  2IOQ A;  1H7S A;  3H80 A;  5IDM A;  1YER A;  4L90 A;  3R4M A;  4KTN A;  3O2F A;  1UYD A;  4MP2 A;  3CGZ A;  3QTF A;  3A0T A;  1U0Z A;  3EHF A;  4O05 A;  3EHH A;  4BQG A;  2BSM A;  5CPH A;  4CE3 A;  2IWX A;  1YC3 A;  4GGL A;  1B63 A;  4HYP A;  1R62 A;  1YC4 A;  4HZ0 A;  4EFT A;  2YI0 A;  4L91 A;  4O04 A;  4LP0 A;  3ZKB A;  1B3Q A;  1TBW A;  5CTW A;  4LWE A;  2YE7 A;  4W7T A;  1YSR A;  5CTY A;  2YE4 A;  3TZ5 A;  2GFD A;  3G7E A;  1Y4U A;  4YKT A;  1Z5A A;  2XX4 A;  3C0E A;  5D7R A;  3GIF A;  4PU9 A;  3K97 A;  3GIG A;  1MU5 A;  1I5B A;  3PEJ A;  4B6C A;  2YKJ A;  4LWI A;  1UY9 A;  2GQP A;  1UYC A;  1THN A;  3T2S A;  2QFO A;  2E0A A;  3HZ1 A;  2BU6 A;  3Q5L A;  2O1U A;  3RLQ A;  2Q8F A;  4YKX A;  4EGK A;  2YEH A;  3INW A;  4BIZ A;  3WQ9 A;  4ASA A;  1QY8 A;  3EHG A;  1MX0 A;  2XJX A;  3TZ4 A;  4L8Z A;  5BOC A;  2XDU A;  4CE1 A;  4BIU A;  3O0I A;  4EGH A;  2CH4 A;  3RKZ A;  4CE2 A;  2BRE A;  3EHJ A;  3U2K A;  3GIG B;  4WUD A;  2WI1 A;  5D6Q A;  5M4N A;  3BMY A;  4E02 A;  4CWQ A;  2WEP A;  1TH8 A;  2YKI A;  2YEA A;  4V26 A;  2YI6 A;  4LPB A;  3ZKD A;  5M4E A;  4MBC A;  2CG9 A;  2YK2 A;  2XJJ A;  3HHU A;  3OPD A;  2WER A;  4NH7 A;  4XCJ A;  1AMW A;  3HYY A;  2H8M A;  1Z5C A;  4XCL A;  3VHA A;  4HXZ A;  4PRV A;  3T0Z A;  5IN9 A;  1UYL A;  1AH8 A;  1BGQ A;  2XDK A;  2YI7 A;  4YKZ A;  3A0R A;  2VW5 A;  2FXS A;  2YJW A;  4I3H A;  2YEJ A;  3D0B A;  4JAV A;  4EEH A;  4XIQ A;  3R4N A;  2QG2 A;  2ZDX A;  3Q5J A;  4LWG A;  3T10 A;  4XC0 A;  2H55 A;  4QPK A;  2HG1 A;  1GKX A;  3G7B A;  2JKI A;  3QDD A;  2BTZ A;  3SL2 A;  5GGZ A;  3GIE A;  5F3K A;  2BU2 A;  4XIP A;  4XKK A;  5FNC A;  2BYI A;  1NHJ A;  1ZXM A;  4GEE A;  2YGF A;  3O6O A;  3DGE A;  1UYI A;  3B25 A;  2BYH A;  4FPP A;  4U93 A;  4LWF A;  5C93 A;  4YKY A;  1EA6 A;  3R4P A;  4HY1 A;  1BXD A;  2YK9 A;  2YE9 A;  4K4O A;  1QYE A;  3PEH A;  3C11 A;  4H85 A;  3U2D A;  4L94 A;  1UY7 A;  4Q20 A;  3ZXQ A;  5CTU A;  1GJV A;  1U2O A;  2PNR A;  3D36 A;  4KSH A;  3A0X A;  1BKN A;  1QZR A;  3ZM7 A;  1Y8N A;  3BM9 A;  4DZY A;  1I5C A;  4EGI A;  1Z59 A;  4I5S A;  2ZKJ A;  4ASB A;  2XDS A;  4R3A A;  4MOT A;  3VAD A;  2WI7 A;  5M4P A;  3B27 A;  4AWQ A;  1AM1 A;  4O0B A;  3CRL A;  1TC0 A;  2YJX A;  3B28 A;  4E00 A;  1UYE A;  4BXI A;  4URL A;  2CCU A;  2EXL A;  4JAS A;  1YC1 A;  4PL9 A;  4XIT A;  2C2A A;  1S16 A;  1H7U A;  1I59 A;  3VHC A;  1Y4S A;  3FV5 A;  4HZ5 A;  4ASF A;  4CWS A;  4AWP A;  3WHA A;  4U7N A;  5CTX A;  5F5R A;  3G75 A;  5J6A A;  5J71 A;  3FT5 A;  1BYQ A;  2HCH A;  4JQL A;  1ID0 A;  4MPC A;  1YT0 A;  4BQJ A;  1UYG A;  4MPN A;  1YT2 A;  3D2R A;  1Y8O A;  4URN A;  1Y8P A;  1TC6 A;  1I5D A;  3TZ2 A;  4EMV A;  1UY6 A;  3R4O A;  2O1W A;  3K99 A;  3RLR A;  4P7A A;  4P8O A;  1ZXN A;  4FMT A;  4H7Q A;  3VHD A;  4URM A;  4KP4 A;  3T1K A;  2BU7 A;  2Q2E B;  2YEC A;  3CRK A;  4WUB A;  3TUH A;  4CWO A;  2XX2 A;  3ZXO A;  2FWY A;  3OWD A;  2BU8 A;  4CWN A;  4ZKI A;  4O07 A;  1A4H A;  4MPE A;  4HYM A;  4FCQ A;  2WI3 A;  5FND A;  3A0Y A;  4L93 A;  3NMQ A;  2VCJ A;  2IWU A;  4AS9 A;  2WI2 A;  3HZ5 A;  2CGF A;  1L0O A;  2VCI A;  4DUH A;  4EM7 A;  3A0W A;  3K60 A;  4ASG A;  4LWH A;  3OWB A;  2YE5 A;  4B7P A;  5FNF A;  1AH6 A;  1YES A;  2ESA A;  1KIJ A;  2YE3 A;  4GCZ A;  4CWF A;  5M4K A;  2YKC A;  2YKE A;  4EFU A;  2BZ5 A;  4BAE A;  3CGY A;  2XDX A;  4XIR A;  5D6P A;  5IDJ A;  3IED A;  4CWR A;  4FCR A;  1KZN A;  2YEB A;  1AJ6 A;  4XKO A;  2VWC A;  2XHT A;  2YEG A;  4R3M A;  1PVG A;  5CF0 A;  2YE8 A;  2YEF A;  3TTZ A;  4QPJ A;  4JAU A;  3RLP A;  3FT8 A;  2XJG A;  4FCP A;  1TIL A;  4XKA A;  3K98 A;  3LPS A;  1TID A;  1GKZ A;  2Q8G A;  1B62 A;  1I58 A;  2YGE A;  4U7O A;  3U67 A;  2WI6 A;  1S14 A;  2XK2 A;  1NHH A;  2BT0 A;  4KSG A;  4HXW A;  1YS3 A;  2Q8H A;  4GFN A;  1Z5B A;  5FWK A;  3MNR P;  2QG0 A;  4NH8 A;  2YKB A;  4CWP A;  1UYH A;  2WI4 A;  2IWS A;  5D7C A;  4YKW A;  2YE2 A;  1YET A;  4CWT A;  2XD6 A;  5M4H A;  2ZDY A;  4MP7 A;  3EKO A;  3T0H A;  3TZ0 A;  2ZBK B;  2FWZ A;  4XDM A;  2CCS A;  1ZW9 A;  2WEQ A;  1UYM A;  4XD8 A;  2XX5 A;  2Q8I A;  4O09 A;  3EKR A;  2IOP A;  4YKQ A;  1I5A A;  1OSF A;  2CCT A;  3HEK A;  2YEE A;  4WUC A;  4GT8 A;  4YKR A;  2XDL A;  1UYK A;  4KFG A;  1NHI A;  2IOR A;  2YI5 A;  4HY6 A;  4XE2 A;  2YE6 A;  1ZWH A;  2WI5 A;  3LNU A;  3INX A;  1UY8 A;  1US7 A;  3JZ3 A;  4R1F A;  4PRX A;  2HKJ A;  3B26 A;  5D7D A;  3CWV A;  2XAB A;  3KE6 A;  2JJC A;  4URO A;  3B24 A;  4X9L A;  2BRC A;  3HYZ A;  4XTJ A;  4H81 A;  2XHX A;  3R92 A;  2YED A;  3R91 A;  3H4L A;  1JM6 A;  1YT1 A;  2XHR A;  5M4M A;  4MB9 A;  1UYF A;  3Q5K A;  2YGA A;  2BU5 A;  5L3J A;  2AKP A;  1EI1 A;  5BOD A;  4AWO A;  4V25 A;  4KQV A;  2YEI A;  2O1V A;  3A0Z A;  4GQT A;  2UWD A;  4E01 A;  3OMU A;  2FYP A;  2QF6 A;  2XCM A; 
#chains in the Genus database with same CATH topology
 4NH9 A;  2K5B A;  1YSZ A;  4YKU A;  4ZVI A;  3OW6 A;  2IOQ A;  1H7S A;  3H80 A;  5IDM A;  1YER A;  4L90 A;  3R4M A;  4KTN A;  3O2F A;  1UYD A;  4MP2 A;  3CGZ A;  3QTF A;  3A0T A;  1U0Z A;  3EHF A;  4O05 A;  3EHH A;  4BQG A;  2BSM A;  5CPH A;  4CE3 A;  2IWX A;  1YC3 A;  4GGL A;  1B63 A;  4HYP A;  1R62 A;  1YC4 A;  4HZ0 A;  4EFT A;  2YI0 A;  4L91 A;  4O04 A;  4LP0 A;  3ZKB A;  1B3Q A;  1TBW A;  5CTW A;  4LWE A;  2YE7 A;  4W7T A;  1YSR A;  5CTY A;  2YE4 A;  3TZ5 A;  2GFD A;  3G7E A;  1Y4U A;  4YKT A;  1Z5A A;  2XX4 A;  3C0E A;  5D7R A;  3GIF A;  4PU9 A;  3K97 A;  3GIG A;  1MU5 A;  1I5B A;  3PEJ A;  4B6C A;  2C1I A;  2YKJ A;  4LWI A;  1UY9 A;  2GQP A;  1UYC A;  1THN A;  3T2S A;  2QFO A;  2E0A A;  3HZ1 A;  2BU6 A;  3Q5L A;  2O1U A;  3RLQ A;  2Q8F A;  4YKX A;  4EGK A;  2YEH A;  3INW A;  4BIZ A;  3WQ9 A;  4ASA A;  1QY8 A;  3EHG A;  1MX0 A;  2XJX A;  3TZ4 A;  4L8Z A;  5BOC A;  2XDU A;  4CE1 A;  4BIU A;  3O0I A;  4EGH A;  2CH4 A;  3RKZ A;  4CE2 A;  2BRE A;  3EHJ A;  3U2K A;  3GIG B;  4WUD A;  2WI1 A;  5D6Q A;  5M4N A;  3BMY A;  4E02 A;  4CWQ A;  2WEP A;  1TH8 A;  2YKI A;  2YEA A;  4V26 A;  2YI6 A;  4LPB A;  3ZKD A;  5M4E A;  4MBC A;  2CG9 A;  2YK2 A;  2XJJ A;  3HHU A;  3OPD A;  2WER A;  4NH7 A;  4XCJ A;  1AMW A;  3HYY A;  2H8M A;  1Z5C A;  4XCL A;  3VHA A;  4HXZ A;  4PRV A;  3T0Z A;  5IN9 A;  1UYL A;  1AH8 A;  1BGQ A;  2XDK A;  2YI7 A;  4YKZ A;  3A0R A;  2VW5 A;  2FXS A;  2YJW A;  4I3H A;  2YEJ A;  3D0B A;  4JAV A;  4EEH A;  4XIQ A;  3R4N A;  2QG2 A;  2ZDX A;  3Q5J A;  4LWG A;  3T10 A;  4XC0 A;  2H55 A;  4QPK A;  2HG1 A;  1GKX A;  3G7B A;  2JKI A;  3QDD A;  2BTZ A;  3SL2 A;  5GGZ A;  3GIE A;  5F3K A;  2BU2 A;  4XIP A;  4XKK A;  5FNC A;  2BYI A;  1NHJ A;  1ZXM A;  4GEE A;  2YGF A;  3O6O A;  3DGE A;  1UYI A;  3B25 A;  2BYH A;  4FPP A;  4U93 A;  4LWF A;  5C93 A;  4YKY A;  1EA6 A;  3R4P A;  4HY1 A;  1BXD A;  2YK9 A;  2YE9 A;  4K4O A;  1QYE A;  3PEH A;  3C11 A;  4H85 A;  3U2D A;  3CYG A;  4L94 A;  1UY7 A;  4Q20 A;  3ZXQ A;  5CTU A;  1GJV A;  1U2O A;  2PNR A;  3D36 A;  4KSH A;  3A0X A;  1BKN A;  1QZR A;  3ZM7 A;  1Y8N A;  3BM9 A;  4DZY A;  1I5C A;  4EGI A;  1Z59 A;  4I5S A;  2ZKJ A;  4ASB A;  2XDS A;  4R3A A;  4MOT A;  3VAD A;  2WI7 A;  5M4P A;  3B27 A;  4AWQ A;  1AM1 A;  4O0B A;  3CRL A;  1TC0 A;  2YJX A;  3B28 A;  4E00 A;  1UYE A;  4BXI A;  4URL A;  2CCU A;  2EXL A;  4JAS A;  1YC1 A;  4PL9 A;  4XIT A;  2C2A A;  1S16 A;  1H7U A;  1I59 A;  3VHC A;  1Y4S A;  3FV5 A;  4HZ5 A;  4ASF A;  4CWS A;  4AWP A;  3WHA A;  4U7N A;  5CTX A;  5F5R A;  3G75 A;  5J6A A;  5J71 A;  3FT5 A;  1BYQ A;  2HCH A;  4JQL A;  1ID0 A;  4MPC A;  1YT0 A;  4BQJ A;  1UYG A;  4MPN A;  1YT2 A;  3D2R A;  1Y8O A;  4URN A;  1Y8P A;  1TC6 A;  1I5D A;  3TZ2 A;  4EMV A;  1UY6 A;  3R4O A;  2O1W A;  3K99 A;  3RLR A;  4P7A A;  4P8O A;  1ZXN A;  4FMT A;  4H7Q A;  3VHD A;  4URM A;  4KP4 A;  3T1K A;  2BU7 A;  2Q2E B;  2YEC A;  3CRK A;  4WUB A;  3TUH A;  4CWO A;  2XX2 A;  3ZXO A;  2FWY A;  3OWD A;  2BU8 A;  4CWN A;  4ZKI A;  4O07 A;  1A4H A;  4MPE A;  4HYM A;  4FCQ A;  4E72 A;  2WI3 A;  5FND A;  3A0Y A;  4L93 A;  3NMQ A;  2VCJ A;  2IWU A;  1F51 A;  2WI2 A;  3HZ5 A;  4AS9 A;  2CGF A;  1L0O A;  2VCI A;  4DUH A;  4EM7 A;  3A0W A;  3K60 A;  4ASG A;  4LWH A;  3OWB A;  2YE5 A;  4B7P A;  5FNF A;  1AH6 A;  1YES A;  2ESA A;  1KIJ A;  2YE3 A;  4GCZ A;  4CWF A;  5M4K A;  2YKC A;  2YKE A;  4EFU A;  2BZ5 A;  4BAE A;  3CGY A;  2XDX A;  4XIR A;  5D6P A;  5IDJ A;  3IED A;  4CWR A;  4FCR A;  1KZN A;  2YEB A;  1AJ6 A;  4XKO A;  2VWC A;  2C1G A;  2XHT A;  2YEG A;  4R3M A;  1PVG A;  5CF0 A;  2YE8 A;  2YEF A;  3TTZ A;  4QPJ A;  4JAU A;  3RLP A;  3FT8 A;  2XJG A;  4FCP A;  1TIL A;  4XKA A;  3K98 A;  3LPS A;  1TID A;  1GKZ A;  2Q8G A;  1B62 A;  1I58 A;  2YGE A;  4U7O A;  5JEN A;  3U67 A;  2WI6 A;  1S14 A;  2XK2 A;  1NHH A;  2BT0 A;  4KSG A;  4HXW A;  1YS3 A;  2Q8H A;  4GFN A;  1Z5B A;  5FWK A;  3MNR P;  2QG0 A;  4NH8 A;  2YKB A;  4CWP A;  1UYH A;  2WI4 A;  2IWS A;  5D7C A;  4YKW A;  2YE2 A;  1YET A;  4CWT A;  2XD6 A;  5M4H A;  2ZDY A;  4MP7 A;  3EKO A;  3T0H A;  3TZ0 A;  2ZBK B;  2FWZ A;  4XDM A;  2CCS A;  1ZW9 A;  2WEQ A;  1UYM A;  4XD8 A;  2XX5 A;  2Q8I A;  4O09 A;  3EKR A;  2IOP A;  4YKQ A;  1I5A A;  1OSF A;  2CCT A;  3HEK A;  2YEE A;  4WUC A;  4GT8 A;  4YKR A;  2XDL A;  1UYK A;  4KFG A;  1NHI A;  2IOR A;  2YI5 A;  4HY6 A;  4XE2 A;  2YE6 A;  3S5T A;  1ZWH A;  2WI5 A;  3LNU A;  1IXM A;  3INX A;  1UY8 A;  1US7 A;  3JZ3 A;  4R1F A;  4PRX A;  2HKJ A;  3B26 A;  5D7D A;  3CWV A;  2XAB A;  3KE6 A;  2JJC A;  4URO A;  3B24 A;  4X9L A;  2BRC A;  3HYZ A;  2FTK A;  4XTJ A;  4H81 A;  2XHX A;  3R92 A;  2YED A;  3R91 A;  3H4L A;  1JM6 A;  1YT1 A;  2XHR A;  5M4M A;  4MB9 A;  1UYF A;  3Q5K A;  2YGA A;  2BU5 A;  3LMM A;  2AKP A;  5L3J A;  1EI1 A;  5BOD A;  4AWO A;  4V25 A;  4KQV A;  2YEI A;  2O1V A;  3A0Z A;  4GQT A;  2UWD A;  4E01 A;  3OMU A;  2FYP A;  2QF6 A;  2HHI A;  2XCM A; 
#chains in the Genus database with same CATH homology
 4NH9 A;  2K5B A;  1YSZ A;  4YKU A;  4ZVI A;  3OW6 A;  2IOQ A;  1H7S A;  3H80 A;  5IDM A;  1YER A;  4L90 A;  3R4M A;  4KTN A;  3O2F A;  1UYD A;  4MP2 A;  3CGZ A;  3QTF A;  3A0T A;  1U0Z A;  3EHF A;  4O05 A;  3EHH A;  4BQG A;  2BSM A;  5CPH A;  4CE3 A;  2IWX A;  1YC3 A;  4GGL A;  1B63 A;  4HYP A;  1R62 A;  1YC4 A;  4HZ0 A;  4EFT A;  2YI0 A;  4L91 A;  4O04 A;  4LP0 A;  3ZKB A;  1B3Q A;  1TBW A;  5CTW A;  4LWE A;  2YE7 A;  4W7T A;  1YSR A;  5CTY A;  2YE4 A;  3TZ5 A;  2GFD A;  3G7E A;  1Y4U A;  4YKT A;  1Z5A A;  2XX4 A;  3C0E A;  5D7R A;  3GIF A;  4PU9 A;  3K97 A;  3GIG A;  1MU5 A;  1I5B A;  3PEJ A;  4B6C A;  2YKJ A;  4LWI A;  1UY9 A;  2GQP A;  1UYC A;  1THN A;  3T2S A;  2QFO A;  2E0A A;  3HZ1 A;  2BU6 A;  3Q5L A;  2O1U A;  3RLQ A;  2Q8F A;  4YKX A;  4EGK A;  2YEH A;  3INW A;  4BIZ A;  3WQ9 A;  4ASA A;  1QY8 A;  3EHG A;  1MX0 A;  2XJX A;  3TZ4 A;  4L8Z A;  5BOC A;  2XDU A;  4CE1 A;  4BIU A;  3O0I A;  4EGH A;  2CH4 A;  3RKZ A;  4CE2 A;  2BRE A;  3EHJ A;  3U2K A;  3GIG B;  4WUD A;  2WI1 A;  5D6Q A;  5M4N A;  3BMY A;  4E02 A;  4CWQ A;  2WEP A;  1TH8 A;  2YKI A;  2YEA A;  4V26 A;  2YI6 A;  4LPB A;  3ZKD A;  5M4E A;  4MBC A;  2CG9 A;  2YK2 A;  2XJJ A;  3HHU A;  3OPD A;  2WER A;  4NH7 A;  4XCJ A;  1AMW A;  3HYY A;  2H8M A;  1Z5C A;  4XCL A;  3VHA A;  4HXZ A;  4PRV A;  3T0Z A;  5IN9 A;  1UYL A;  1AH8 A;  1BGQ A;  2XDK A;  2YI7 A;  4YKZ A;  3A0R A;  2VW5 A;  2FXS A;  2YJW A;  4I3H A;  2YEJ A;  3D0B A;  4JAV A;  4EEH A;  4XIQ A;  3R4N A;  2QG2 A;  2ZDX A;  3Q5J A;  4LWG A;  3T10 A;  4XC0 A;  2H55 A;  4QPK A;  2HG1 A;  1GKX A;  3G7B A;  2JKI A;  3QDD A;  2BTZ A;  3SL2 A;  5GGZ A;  3GIE A;  5F3K A;  2BU2 A;  4XIP A;  4XKK A;  5FNC A;  2BYI A;  1NHJ A;  1ZXM A;  4GEE A;  2YGF A;  3O6O A;  3DGE A;  1UYI A;  3B25 A;  2BYH A;  4FPP A;  4U93 A;  4LWF A;  5C93 A;  4YKY A;  1EA6 A;  3R4P A;  4HY1 A;  1BXD A;  2YK9 A;  2YE9 A;  4K4O A;  1QYE A;  3PEH A;  3C11 A;  4H85 A;  3U2D A;  4L94 A;  1UY7 A;  4Q20 A;  3ZXQ A;  5CTU A;  1GJV A;  1U2O A;  2PNR A;  3D36 A;  4KSH A;  3A0X A;  1BKN A;  1QZR A;  3ZM7 A;  1Y8N A;  3BM9 A;  4DZY A;  1I5C A;  4EGI A;  1Z59 A;  4I5S A;  2ZKJ A;  4ASB A;  2XDS A;  4R3A A;  4MOT A;  3VAD A;  2WI7 A;  5M4P A;  3B27 A;  4AWQ A;  1AM1 A;  4O0B A;  3CRL A;  1TC0 A;  2YJX A;  3B28 A;  4E00 A;  1UYE A;  4BXI A;  4URL A;  2CCU A;  2EXL A;  4JAS A;  1YC1 A;  4PL9 A;  4XIT A;  2C2A A;  1S16 A;  1H7U A;  1I59 A;  3VHC A;  1Y4S A;  3FV5 A;  4HZ5 A;  4ASF A;  4CWS A;  4AWP A;  3WHA A;  4U7N A;  5CTX A;  5F5R A;  3G75 A;  5J6A A;  5J71 A;  3FT5 A;  1BYQ A;  2HCH A;  4JQL A;  1ID0 A;  4MPC A;  1YT0 A;  4BQJ A;  1UYG A;  4MPN A;  1YT2 A;  3D2R A;  1Y8O A;  4URN A;  1Y8P A;  1TC6 A;  1I5D A;  3TZ2 A;  4EMV A;  1UY6 A;  3R4O A;  2O1W A;  3K99 A;  3RLR A;  4P7A A;  4P8O A;  1ZXN A;  4FMT A;  4H7Q A;  3VHD A;  4URM A;  4KP4 A;  3T1K A;  2BU7 A;  2Q2E B;  2YEC A;  3CRK A;  4WUB A;  3TUH A;  4CWO A;  2XX2 A;  3ZXO A;  2FWY A;  3OWD A;  2BU8 A;  4CWN A;  4ZKI A;  4O07 A;  1A4H A;  4MPE A;  4HYM A;  4FCQ A;  2WI3 A;  5FND A;  3A0Y A;  4L93 A;  3NMQ A;  2VCJ A;  2IWU A;  4AS9 A;  2WI2 A;  3HZ5 A;  2CGF A;  1L0O A;  2VCI A;  4DUH A;  4EM7 A;  3A0W A;  3K60 A;  4ASG A;  4LWH A;  3OWB A;  2YE5 A;  4B7P A;  5FNF A;  1AH6 A;  1YES A;  2ESA A;  1KIJ A;  2YE3 A;  4GCZ A;  4CWF A;  5M4K A;  2YKC A;  2YKE A;  4EFU A;  2BZ5 A;  4BAE A;  3CGY A;  2XDX A;  4XIR A;  5D6P A;  5IDJ A;  3IED A;  4CWR A;  4FCR A;  1KZN A;  2YEB A;  1AJ6 A;  4XKO A;  2VWC A;  2XHT A;  2YEG A;  4R3M A;  1PVG A;  5CF0 A;  2YE8 A;  2YEF A;  3TTZ A;  4QPJ A;  4JAU A;  3RLP A;  3FT8 A;  2XJG A;  4FCP A;  1TIL A;  4XKA A;  3K98 A;  3LPS A;  1TID A;  1GKZ A;  2Q8G A;  1B62 A;  1I58 A;  2YGE A;  4U7O A;  3U67 A;  2WI6 A;  1S14 A;  2XK2 A;  1NHH A;  2BT0 A;  4KSG A;  4HXW A;  1YS3 A;  2Q8H A;  4GFN A;  1Z5B A;  5FWK A;  3MNR P;  2QG0 A;  4NH8 A;  2YKB A;  4CWP A;  1UYH A;  2WI4 A;  2IWS A;  5D7C A;  4YKW A;  2YE2 A;  1YET A;  4CWT A;  2XD6 A;  5M4H A;  2ZDY A;  4MP7 A;  3EKO A;  3T0H A;  3TZ0 A;  2ZBK B;  2FWZ A;  4XDM A;  2CCS A;  1ZW9 A;  2WEQ A;  1UYM A;  4XD8 A;  2XX5 A;  2Q8I A;  4O09 A;  3EKR A;  2IOP A;  4YKQ A;  1I5A A;  1OSF A;  2CCT A;  3HEK A;  2YEE A;  4WUC A;  4GT8 A;  4YKR A;  2XDL A;  1UYK A;  4KFG A;  1NHI A;  2IOR A;  2YI5 A;  4HY6 A;  4XE2 A;  2YE6 A;  1ZWH A;  2WI5 A;  3LNU A;  3INX A;  1UY8 A;  1US7 A;  3JZ3 A;  4R1F A;  4PRX A;  2HKJ A;  3B26 A;  5D7D A;  3CWV A;  2XAB A;  3KE6 A;  2JJC A;  4URO A;  3B24 A;  4X9L A;  2BRC A;  3HYZ A;  4XTJ A;  4H81 A;  2XHX A;  3R92 A;  2YED A;  3R91 A;  3H4L A;  1JM6 A;  1YT1 A;  2XHR A;  5M4M A;  4MB9 A;  1UYF A;  3Q5K A;  2YGA A;  2BU5 A;  5L3J A;  2AKP A;  1EI1 A;  5BOD A;  4AWO A;  4V25 A;  4KQV A;  2YEI A;  2O1V A;  3A0Z A;  4GQT A;  2UWD A;  4E01 A;  3OMU A;  2FYP A;  2QF6 A;  2XCM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...