2H8MA

N-domain of grp94 in complex with the 2-iodo-neca
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
227
structure length
215
Chain Sequence
EKFAFQAEVNRMMKLIINSLYKNKEIFLRELISNASDALDKIRLISLTDENALAGNEELTVKIKCDKEKNLLHVTDTGVGMTREELVKNLGTIGTSEFLNKMTEAQTSELIGQFGVGFYSAFLVADKVIVTSKHNNDTQHIWESDSNEFSVIADPRGNTLGRGTTITLVLKEEASDYLELDTIKNLVKKYSQFINFPIYVWSSKTKTVWDWELMN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title N-Domain Of Grp94 In Complex With the 2-Iodo-NECA
rcsb
molecule keywords Endoplasmin
molecule tags Chaperone
source organism Canis lupus familiaris
total genus 64
structure length 215
sequence length 227
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-06-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02518 HATPase_c Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.565.10 Alpha Beta 2-Layer Sandwich Heat Shock Protein 90 Histidine kinase-like ATPase, C-terminal domain 2h8mA00
1YT0A 2XDLA 2XK2A 3Q5JA 2YE9A 1TC0A 2IORA 1BXDA 4E01A 4MBCA 4O04A 2WI6A 3GIEA 5F3KA 2ZBKB 2BU6A 1KZNA 2VCJA 2WI4A 2O1VA 1TIDA 2ESAA 4ZVIA 3OW6A 3GIFA 4YKXA 4V26A 1MX0A 3CRKA 2XDXA 3LPSA 2IWSA 1UYCA 3TZ4A 1YSRA 3C0EA 2CG9A 5C93A 2ZDXA 2C2AA 1YSZA 2BTZA 3B25A 4JAVA 5FNCA 2BYIA 3K60A 4BXIA 3VHDA 3CGYA 4EMVA 4FCQA 1I59A 5FNDA 5M4HA 4CE2A 2YEDA 2YKCA 4AS9A 3O6OA 4R3MA 5GGZA 2XHXA 4U93A 4KSHA 2QG2A 4FCPA 4HY6A 4XTJA 5IDMA 4URLA 1UY7A 1TH8A 4JQLA 4XCJA 4R3AA 2E0AA 2YI0A 3LNUA 3VHAA 4O0BA 1UYDA 3VADA 4LWGA 4AWPA 3INXA 1EA6A 1UY6A 4YKRA 1Y4SA 4EEHA 4HY1A 3RKZA 1UYKA 3A0ZA 4EGKA 4EFTA 3R4MA 2O1UA 1ZXNA 2YKBA 5J6AA 5CTYA 5CTUA 4GFNA 2XX2A 4LWFA 3U67A 1S16A 2Q8IA 2YE5A 2YE8A 4O05A 3ZM7A 4BQJA 2YEIA 2XHRA 5M4MA 4MB9A 4ASBA 4KSGA 4PRXA 2Q8GA 3OPDA 3QTFA 3A0XA 1YS3A 2YI5A 3D2RA 5F5RA 2JKIA 3B28A 3TUHA 1B3QA 2XD6A 4GEEA 3G7BA 3A0RA 4L94A 1JM6A 4GGLA 2YKJA 3K99A 5M4NA 4NH7A 1B63A 4CWRA 3MNRP 2YEJA 2YEFA 4U7NA 4DZYA 2WI2A 2Q8FA 1US7A 3A0WA 2YE6A 1QZRA 4CWFA 2YI6A 3T0ZA 5BODA 5M4KA 5IN9A 4EGIA 3T0HA 4V25A 4MPNA 1PVGA 4CWOA 2BU8A 1THNA 3Q5LA 2FXSA 4EFUA 4L93A 2IOQA 2CH4A 2YE2A 1ID0A 1GJVA 1UYIA 2GQPA 4KTNA 2YGFA 3OMUA 5J71A 4GQTA 3R4PA 4CWTA 4W7TA 4L91A 4XIQA 3VHCA 3TZ2A 4B7PA 2BU7A 4KQVA 1NHJA 1Y4UA 3T2SA 1H7SA 2BREA 2XX4A 2QG0A 5CTXA 3WQ9A 2XDKA 2YKEA 3QDDA 3GIGB 2YE3A 3BM9A 2YE4A 3NMQA 3PEJA 1U0ZA 2IWXA 2VWCA 4E00A 4URNA 4XCLA 3RLQA 2XCMA 4CE3A 3A0YA 2YEHA 4MP2A 4CWQA 2QF6A 4WUDA 3B26A 3C11A 2HG1A 1H7UA 3T1KA 4ZKIA 1MU5A 4GCZA 3R91A 2XDUA 4URMA 1YT2A 2CGFA 2O1WA 4MPEA 1TBWA 3R4OA 1ZXMA 4JAUA 2VCIA 2PNRA 2HKJA 2UWDA 4LWEA 4P7AA 5L3JA 2BT0A 3Q5KA 3ZXOA 2VW5A 2AKPA 3CGZA 4XDMA 1AM1A 3CRLA 3CWVA 3ZKBA 2IWUA 4LWHA 2Q8HA 2K5BA 3FV5A 2YEAA 2WI1A 1Y8PA 2BU2A 2FYPA 2FWZA 2XDSA 5BOCA 2CCUA 4CWPA 1B62A 4GT8A 1NHIA 4HXWA 3HZ5A 2BRCA 3EHJA 4LPBA 1Y8NA 3FT8A 2YI7A 3DGEA 1A4HA 1TC6A 2QFOA 4Q20A 1AJ6A 2YE7A 4L8ZA 1UYEA 4YKQA 5CF0A 4XKKA 2XJXA 1UYLA 3EKRA 3T10A 4ASFA 1EI1A 1UYMA 2XJGA 3HYZA 4XIPA 1Z59A 5CPHA 4HYPA 4O09A 3R4NA 2WEPA 4R1FA 1UY8A 4MPCA 2ZDYA 5D6QA 4XITA 2YK2A 1ZW9A 4EGHA 4QPKA 5IDJA 5D7RA 1QY8A 5M4PA 3FT5A 4PL9A 1KIJA 3EKOA 2IOPA 5D7DA 1R62A 2BZ5A 2BU5A 1UY9A 1YT1A 1GKZA 3PEHA 2CCTA 2H8MA 3B24A 2CCSA 3K97A 3OWDA 4XKOA 3D36A 4XD8A 4X9LA 4FMTA 2YKIA 1BGQA 4XKAA 4BIZA 3O0IA 4JASA 3B27A 4I3HA 3KE6A 3ZXQA 1I58A 5D7CA 3WHAA 3INWA 3R92A 4I5SA 1U2OA 4XC0A 1Z5BA 1YC4A 3O2FA 2YGAA 2FWYA 2YEGA 4H7QA 1S14A 1AMWA 4BIUA 3RLPA 4PU9A 2YK9A 3HHUA 1I5CA 1AH8A 3HEKA 1TILA 4ASGA 4H81A 2HCHA 1I5DA 4ASAA 3G75A 3U2KA 2YECA 1YETA 2XABA 4DUHA 4XE2A 1UYGA 1Z5AA 2WI3A 4L90A 1AH6A 3EHGA 4YKTA 4HXZA 3EHFA 1YC1A 3H4LA 3U2DA 4XIRA 2EXLA 1QYEA 4WUCA 5FWKA 2Q2EB 1Y8OA 3HYYA 2WEQA 1NHHA 3IEDA 2XX5A 2ZKJA 1Z5CA 5CTWA 1I5BA 2XJJA 5D6PA 3GIGA 4BQGA 4MOTA 5M4EA 4PRVA 4AWOA 4CWNA 1UYHA 2JJCA 4U7OA 2XHTA 4YKWA 2YJXA 1L0OA 4HZ5A 4KP4A 3G7EA 3SL2A 4E02A 1ZWHA 1BYQA 1I5AA 3K98A 4O07A 5FNFA 2H55A 2YEBA 3OWBA 4K4OA 4MP7A 3TTZA 1GKXA 1YESA 4HZ0A 1YC3A 2YJWA 3A0TA 4EM7A 2GFDA 4WUBA 4LWIA 4BAEA 4CWSA 4KFGA 1UYFA 3BMYA 4CE1A 3D0BA 3EHHA 4HYMA 4B6CA 4FCRA 4UROA 2WI7A 4LP0A 2YEEA 3TZ0A 4NH9A 4NH8A 3H80A 3HZ1A 2WI5A 1OSFA 4QPJA 3RLRA 4H85A 1YERA 4YKUA 2BYHA 2YGEA 3ZKDA 1BKNA 4YKYA 2WERA 4YKZA 4FPPA 3TZ5A 3JZ3A 4P8OA 4AWQA 2BSMA
chains in the Genus database with same CATH superfamily
1YT0A 2XDLA 2XK2A 3Q5JA 2YE9A 1TC0A 2IORA 1BXDA 4E01A 4MBCA 4O04A 3CYGA 2WI6A 3GIEA 5F3KA 2ZBKB 2BU6A 1KZNA 2VCJA 2WI4A 2O1VA 1TIDA 2ESAA 4ZVIA 3OW6A 3GIFA 4E72A 4YKXA 4V26A 1MX0A 3CRKA 2XDXA 3LPSA 2IWSA 1UYCA 3TZ4A 1YSRA 3C0EA 2CG9A 5C93A 2ZDXA 2C2AA 1YSZA 2BTZA 3B25A 4JAVA 5FNCA 2BYIA 3K60A 4BXIA 3VHDA 3CGYA 4EMVA 4FCQA 1I59A 5FNDA 5M4HA 4CE2A 2YEDA 2YKCA 4AS9A 2FTKA 3O6OA 4R3MA 5GGZA 2XHXA 4U93A 4KSHA 2QG2A 4FCPA 4HY6A 4XTJA 5IDMA 4URLA 1UY7A 1TH8A 4JQLA 4XCJA 4R3AA 2E0AA 2YI0A 3LNUA 3VHAA 4O0BA 1UYDA 3VADA 4LWGA 4AWPA 3INXA 1EA6A 1UY6A 4YKRA 1Y4SA 4EEHA 4HY1A 3RKZA 1UYKA 3A0ZA 4EGKA 4EFTA 3R4MA 2O1UA 1ZXNA 2YKBA 5J6AA 5CTYA 5CTUA 4GFNA 2XX2A 4LWFA 3U67A 1S16A 2Q8IA 2YE5A 2YE8A 4O05A 3ZM7A 4BQJA 2YEIA 2XHRA 5M4MA 4MB9A 4ASBA 4KSGA 4PRXA 2Q8GA 3OPDA 3QTFA 3A0XA 1YS3A 2YI5A 3D2RA 5F5RA 2JKIA 2C1GA 3B28A 3TUHA 1B3QA 2XD6A 4GEEA 3G7BA 3A0RA 4L94A 1JM6A 4GGLA 2YKJA 3K99A 5M4NA 4NH7A 1B63A 4CWRA 3MNRP 2YEJA 2YEFA 4U7NA 4DZYA 2WI2A 2Q8FA 1US7A 3A0WA 2YE6A 1QZRA 4CWFA 2YI6A 3T0ZA 5BODA 5M4KA 5IN9A 4EGIA 3T0HA 4V25A 2HHIA 4MPNA 1PVGA 4CWOA 2BU8A 1THNA 3Q5LA 2FXSA 4EFUA 4L93A 2IOQA 2CH4A 2YE2A 1ID0A 1GJVA 1UYIA 2GQPA 4KTNA 2YGFA 3OMUA 5J71A 4GQTA 3R4PA 4CWTA 4W7TA 4L91A 4XIQA 3VHCA 3TZ2A 4B7PA 2BU7A 4KQVA 1NHJA 1Y4UA 3T2SA 1H7SA 2BREA 2XX4A 2QG0A 5CTXA 3WQ9A 2XDKA 2YKEA 3QDDA 3GIGB 2YE3A 3BM9A 2YE4A 3NMQA 3PEJA 1U0ZA 2IWXA 2VWCA 4E00A 4URNA 4XCLA 3RLQA 2XCMA 4CE3A 3A0YA 3S5TA 2YEHA 4MP2A 4CWQA 2QF6A 4WUDA 3B26A 3C11A 2HG1A 1H7UA 3T1KA 4ZKIA 1MU5A 4GCZA 3R91A 2XDUA 4URMA 1YT2A 2CGFA 2O1WA 4MPEA 1TBWA 3R4OA 1ZXMA 4JAUA 2VCIA 2PNRA 2HKJA 2UWDA 4LWEA 4P7AA 5L3JA 2BT0A 3Q5KA 3ZXOA 2VW5A 2AKPA 3CGZA 4XDMA 1AM1A 3CRLA 3CWVA 3ZKBA 2IWUA 4LWHA 2Q8HA 2K5BA 3FV5A 2YEAA 2WI1A 1Y8PA 2BU2A 2FYPA 2FWZA 2XDSA 5BOCA 2CCUA 4CWPA 1B62A 4GT8A 1NHIA 4HXWA 3HZ5A 2BRCA 3EHJA 4LPBA 1Y8NA 3FT8A 2YI7A 3DGEA 1A4HA 1TC6A 2QFOA 4Q20A 1AJ6A 2YE7A 4L8ZA 1UYEA 4YKQA 5CF0A 4XKKA 2XJXA 1UYLA 3EKRA 3T10A 4ASFA 1EI1A 1UYMA 2XJGA 3HYZA 4XIPA 1Z59A 5CPHA 4HYPA 4O09A 3R4NA 2WEPA 4R1FA 1UY8A 4MPCA 2ZDYA 5D6QA 4XITA 2YK2A 1ZW9A 4EGHA 4QPKA 5IDJA 5D7RA 1QY8A 5M4PA 3FT5A 4PL9A 1KIJA 1F51A 3EKOA 2IOPA 5D7DA 1R62A 2BZ5A 2BU5A 1UY9A 1YT1A 1GKZA 3PEHA 2CCTA 2H8MA 3B24A 2CCSA 3K97A 3OWDA 4XKOA 3D36A 4XD8A 2C1IA 4X9LA 4FMTA 2YKIA 1BGQA 4XKAA 4BIZA 3O0IA 4JASA 3B27A 4I3HA 3KE6A 5JENA 3ZXQA 1I58A 5D7CA 3WHAA 3INWA 3R92A 4I5SA 1U2OA 4XC0A 1Z5BA 1YC4A 3O2FA 2YGAA 2FWYA 2YEGA 4H7QA 1S14A 1AMWA 4BIUA 3RLPA 3LMMA 4PU9A 2YK9A 3HHUA 1I5CA 1AH8A 3HEKA 1TILA 4ASGA 4H81A 2HCHA 1I5DA 4ASAA 3G75A 3U2KA 2YECA 1YETA 2XABA 4DUHA 4XE2A 1UYGA 1Z5AA 2WI3A 4L90A 1AH6A 3EHGA 4YKTA 4HXZA 3EHFA 1YC1A 3H4LA 3U2DA 4XIRA 2EXLA 1QYEA 4WUCA 5FWKA 2Q2EB 1Y8OA 3HYYA 2WEQA 1NHHA 3IEDA 2XX5A 2ZKJA 1Z5CA 5CTWA 1I5BA 2XJJA 5D6PA 3GIGA 4BQGA 4MOTA 5M4EA 1IXMA 4PRVA 4AWOA 4CWNA 1UYHA 2JJCA 4U7OA 2XHTA 4YKWA 2YJXA 1L0OA 4HZ5A 4KP4A 3G7EA 3SL2A 4E02A 1ZWHA 1BYQA 1I5AA 3K98A 4O07A 5FNFA 2H55A 2YEBA 3OWBA 4K4OA 4MP7A 3TTZA 1GKXA 1YESA 4HZ0A 1YC3A 2YJWA 3A0TA 4EM7A 2GFDA 4WUBA 4LWIA 4BAEA 4CWSA 4KFGA 1UYFA 3BMYA 4CE1A 3D0BA 3EHHA 4HYMA 4B6CA 4FCRA 4UROA 2WI7A 4LP0A 2YEEA 3TZ0A 4NH9A 4NH8A 3H80A 3HZ1A 2WI5A 1OSFA 4QPJA 3RLRA 4H85A 1YERA 4YKUA 2BYHA 2YGEA 3ZKDA 1BKNA 4YKYA 2WERA 4YKZA 4FPPA 3TZ5A 3JZ3A 4P8OA 4AWQA 2BSMA
chains in the Genus database with same CATH topology
1YT0A 2XDLA 2XK2A 3Q5JA 2YE9A 1TC0A 2IORA 1BXDA 4E01A 4MBCA 4O04A 2WI6A 3GIEA 5F3KA 2ZBKB 2BU6A 1KZNA 2VCJA 2WI4A 2O1VA 1TIDA 2ESAA 4ZVIA 3OW6A 3GIFA 4YKXA 4V26A 1MX0A 3CRKA 2XDXA 3LPSA 2IWSA 1UYCA 3TZ4A 1YSRA 3C0EA 2CG9A 5C93A 2ZDXA 2C2AA 1YSZA 2BTZA 3B25A 4JAVA 5FNCA 2BYIA 3K60A 4BXIA 3VHDA 3CGYA 4EMVA 4FCQA 1I59A 5FNDA 5M4HA 4CE2A 2YEDA 2YKCA 4AS9A 3O6OA 4R3MA 5GGZA 2XHXA 4U93A 4KSHA 2QG2A 4FCPA 4HY6A 4XTJA 5IDMA 4URLA 1UY7A 1TH8A 4JQLA 4XCJA 4R3AA 2E0AA 2YI0A 3LNUA 3VHAA 4O0BA 1UYDA 3VADA 4LWGA 4AWPA 3INXA 1EA6A 1UY6A 4YKRA 1Y4SA 4EEHA 4HY1A 3RKZA 1UYKA 3A0ZA 4EGKA 4EFTA 3R4MA 2O1UA 1ZXNA 2YKBA 5J6AA 5CTYA 5CTUA 4GFNA 2XX2A 4LWFA 3U67A 1S16A 2Q8IA 2YE5A 2YE8A 4O05A 3ZM7A 4BQJA 2YEIA 2XHRA 5M4MA 4MB9A 4ASBA 4KSGA 4PRXA 2Q8GA 3OPDA 3QTFA 3A0XA 1YS3A 2YI5A 3D2RA 5F5RA 2JKIA 3B28A 3TUHA 1B3QA 2XD6A 4GEEA 3G7BA 3A0RA 4L94A 1JM6A 4GGLA 2YKJA 3K99A 5M4NA 4NH7A 1B63A 4CWRA 3MNRP 2YEJA 2YEFA 4U7NA 4DZYA 2WI2A 2Q8FA 1US7A 3A0WA 2YE6A 1QZRA 4CWFA 2YI6A 3T0ZA 5BODA 5M4KA 5IN9A 4EGIA 3T0HA 4V25A 4MPNA 1PVGA 4CWOA 2BU8A 1THNA 3Q5LA 2FXSA 4EFUA 4L93A 2IOQA 2CH4A 2YE2A 1ID0A 1GJVA 1UYIA 2GQPA 4KTNA 2YGFA 3OMUA 5J71A 4GQTA 3R4PA 4CWTA 4W7TA 4L91A 4XIQA 3VHCA 3TZ2A 4B7PA 2BU7A 4KQVA 1NHJA 1Y4UA 3T2SA 1H7SA 2BREA 2XX4A 2QG0A 5CTXA 3WQ9A 2XDKA 2YKEA 3QDDA 3GIGB 2YE3A 3BM9A 2YE4A 3NMQA 3PEJA 1U0ZA 2IWXA 2VWCA 4E00A 4URNA 4XCLA 3RLQA 2XCMA 4CE3A 3A0YA 2YEHA 4MP2A 4CWQA 2QF6A 4WUDA 3B26A 3C11A 2HG1A 1H7UA 3T1KA 4ZKIA 1MU5A 4GCZA 3R91A 2XDUA 4URMA 1YT2A 2CGFA 2O1WA 4MPEA 1TBWA 3R4OA 1ZXMA 4JAUA 2VCIA 2PNRA 2HKJA 2UWDA 4LWEA 4P7AA 5L3JA 2BT0A 3Q5KA 3ZXOA 2VW5A 2AKPA 3CGZA 4XDMA 1AM1A 3CRLA 3CWVA 3ZKBA 2IWUA 4LWHA 2Q8HA 2K5BA 3FV5A 2YEAA 2WI1A 1Y8PA 2BU2A 2FYPA 2FWZA 2XDSA 5BOCA 2CCUA 4CWPA 1B62A 4GT8A 1NHIA 4HXWA 3HZ5A 2BRCA 3EHJA 4LPBA 1Y8NA 3FT8A 2YI7A 3DGEA 1A4HA 1TC6A 2QFOA 4Q20A 1AJ6A 2YE7A 4L8ZA 1UYEA 4YKQA 5CF0A 4XKKA 2XJXA 1UYLA 3EKRA 3T10A 4ASFA 1EI1A 1UYMA 2XJGA 3HYZA 4XIPA 1Z59A 5CPHA 4HYPA 4O09A 3R4NA 2WEPA 4R1FA 1UY8A 4MPCA 2ZDYA 5D6QA 4XITA 2YK2A 1ZW9A 4EGHA 4QPKA 5IDJA 5D7RA 1QY8A 5M4PA 3FT5A 4PL9A 1KIJA 3EKOA 2IOPA 5D7DA 1R62A 2BZ5A 2BU5A 1UY9A 1YT1A 1GKZA 3PEHA 2CCTA 2H8MA 3B24A 2CCSA 3K97A 3OWDA 4XKOA 3D36A 4XD8A 4X9LA 4FMTA 2YKIA 1BGQA 4XKAA 4BIZA 3O0IA 4JASA 3B27A 4I3HA 3KE6A 3ZXQA 1I58A 5D7CA 3WHAA 3INWA 3R92A 4I5SA 1U2OA 4XC0A 1Z5BA 1YC4A 3O2FA 2YGAA 2FWYA 2YEGA 4H7QA 1S14A 1AMWA 4BIUA 3RLPA 4PU9A 2YK9A 3HHUA 1I5CA 1AH8A 3HEKA 1TILA 4ASGA 4H81A 2HCHA 1I5DA 4ASAA 3G75A 3U2KA 2YECA 1YETA 2XABA 4DUHA 4XE2A 1UYGA 1Z5AA 2WI3A 4L90A 1AH6A 3EHGA 4YKTA 4HXZA 3EHFA 1YC1A 3H4LA 3U2DA 4XIRA 2EXLA 1QYEA 4WUCA 5FWKA 2Q2EB 1Y8OA 3HYYA 2WEQA 1NHHA 3IEDA 2XX5A 2ZKJA 1Z5CA 5CTWA 1I5BA 2XJJA 5D6PA 3GIGA 4BQGA 4MOTA 5M4EA 4PRVA 4AWOA 4CWNA 1UYHA 2JJCA 4U7OA 2XHTA 4YKWA 2YJXA 1L0OA 4HZ5A 4KP4A 3G7EA 3SL2A 4E02A 1ZWHA 1BYQA 1I5AA 3K98A 4O07A 5FNFA 2H55A 2YEBA 3OWBA 4K4OA 4MP7A 3TTZA 1GKXA 1YESA 4HZ0A 1YC3A 2YJWA 3A0TA 4EM7A 2GFDA 4WUBA 4LWIA 4BAEA 4CWSA 4KFGA 1UYFA 3BMYA 4CE1A 3D0BA 3EHHA 4HYMA 4B6CA 4FCRA 4UROA 2WI7A 4LP0A 2YEEA 3TZ0A 4NH9A 4NH8A 3H80A 3HZ1A 2WI5A 1OSFA 4QPJA 3RLRA 4H85A 1YERA 4YKUA 2BYHA 2YGEA 3ZKDA 1BKNA 4YKYA 2WERA 4YKZA 4FPPA 3TZ5A 3JZ3A 4P8OA 4AWQA 2BSMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1YT0 A;  2XDL A;  2XK2 A;  3Q5J A;  2YE9 A;  1TC0 A;  2IOR A;  1BXD A;  4E01 A;  4MBC A;  4O04 A;  2WI6 A;  3GIE A;  5F3K A;  2ZBK B;  2BU6 A;  1KZN A;  2VCJ A;  2WI4 A;  2O1V A;  1TID A;  2ESA A;  4ZVI A;  3OW6 A;  3GIF A;  4YKX A;  4V26 A;  1MX0 A;  3CRK A;  2XDX A;  3LPS A;  2IWS A;  1UYC A;  3TZ4 A;  1YSR A;  3C0E A;  2CG9 A;  5C93 A;  2ZDX A;  2C2A A;  1YSZ A;  2BTZ A;  3B25 A;  4JAV A;  5FNC A;  2BYI A;  3K60 A;  4BXI A;  3VHD A;  3CGY A;  4EMV A;  4FCQ A;  1I59 A;  5FND A;  5M4H A;  4CE2 A;  2YED A;  2YKC A;  4AS9 A;  3O6O A;  4R3M A;  5GGZ A;  2XHX A;  4U93 A;  4KSH A;  2QG2 A;  4FCP A;  4HY6 A;  4XTJ A;  5IDM A;  4URL A;  1UY7 A;  1TH8 A;  4JQL A;  4XCJ A;  4R3A A;  2E0A A;  2YI0 A;  3LNU A;  3VHA A;  4O0B A;  1UYD A;  3VAD A;  4LWG A;  4AWP A;  3INX A;  1EA6 A;  1UY6 A;  4YKR A;  1Y4S A;  4EEH A;  4HY1 A;  3RKZ A;  1UYK A;  3A0Z A;  4EGK A;  4EFT A;  3R4M A;  2O1U A;  1ZXN A;  2YKB A;  5J6A A;  5CTY A;  5CTU A;  4GFN A;  2XX2 A;  4LWF A;  3U67 A;  1S16 A;  2Q8I A;  2YE5 A;  2YE8 A;  4O05 A;  3ZM7 A;  4BQJ A;  2YEI A;  2XHR A;  5M4M A;  4MB9 A;  4ASB A;  4KSG A;  4PRX A;  2Q8G A;  3OPD A;  3QTF A;  3A0X A;  1YS3 A;  2YI5 A;  3D2R A;  5F5R A;  2JKI A;  3B28 A;  3TUH A;  1B3Q A;  2XD6 A;  4GEE A;  3G7B A;  3A0R A;  4L94 A;  1JM6 A;  4GGL A;  2YKJ A;  3K99 A;  5M4N A;  4NH7 A;  1B63 A;  4CWR A;  3MNR P;  2YEJ A;  2YEF A;  4U7N A;  4DZY A;  2WI2 A;  2Q8F A;  1US7 A;  3A0W A;  2YE6 A;  1QZR A;  4CWF A;  2YI6 A;  3T0Z A;  5BOD A;  5M4K A;  5IN9 A;  4EGI A;  3T0H A;  4V25 A;  4MPN A;  1PVG A;  4CWO A;  2BU8 A;  1THN A;  3Q5L A;  2FXS A;  4EFU A;  4L93 A;  2IOQ A;  2CH4 A;  2YE2 A;  1ID0 A;  1GJV A;  1UYI A;  2GQP A;  4KTN A;  2YGF A;  3OMU A;  5J71 A;  4GQT A;  3R4P A;  4CWT A;  4W7T A;  4L91 A;  4XIQ A;  3VHC A;  3TZ2 A;  4B7P A;  2BU7 A;  4KQV A;  1NHJ A;  1Y4U A;  3T2S A;  1H7S A;  2BRE A;  2XX4 A;  2QG0 A;  5CTX A;  3WQ9 A;  2XDK A;  2YKE A;  3QDD A;  3GIG B;  2YE3 A;  3BM9 A;  2YE4 A;  3NMQ A;  3PEJ A;  1U0Z A;  2IWX A;  2VWC A;  4E00 A;  4URN A;  4XCL A;  3RLQ A;  2XCM A;  4CE3 A;  3A0Y A;  2YEH A;  4MP2 A;  4CWQ A;  2QF6 A;  4WUD A;  3B26 A;  3C11 A;  2HG1 A;  1H7U A;  3T1K A;  4ZKI A;  1MU5 A;  4GCZ A;  3R91 A;  2XDU A;  4URM A;  1YT2 A;  2CGF A;  2O1W A;  4MPE A;  1TBW A;  3R4O A;  1ZXM A;  4JAU A;  2VCI A;  2PNR A;  2HKJ A;  2UWD A;  4LWE A;  4P7A A;  5L3J A;  2BT0 A;  3Q5K A;  3ZXO A;  2VW5 A;  2AKP A;  3CGZ A;  4XDM A;  1AM1 A;  3CRL A;  3CWV A;  3ZKB A;  2IWU A;  4LWH A;  2Q8H A;  2K5B A;  3FV5 A;  2YEA A;  2WI1 A;  1Y8P A;  2BU2 A;  2FYP A;  2FWZ A;  2XDS A;  5BOC A;  2CCU A;  4CWP A;  1B62 A;  4GT8 A;  1NHI A;  4HXW A;  3HZ5 A;  2BRC A;  3EHJ A;  4LPB A;  1Y8N A;  3FT8 A;  2YI7 A;  3DGE A;  1A4H A;  1TC6 A;  2QFO A;  4Q20 A;  1AJ6 A;  2YE7 A;  4L8Z A;  1UYE A;  4YKQ A;  5CF0 A;  4XKK A;  2XJX A;  1UYL A;  3EKR A;  3T10 A;  4ASF A;  1EI1 A;  1UYM A;  2XJG A;  3HYZ A;  4XIP A;  1Z59 A;  5CPH A;  4HYP A;  4O09 A;  3R4N A;  2WEP A;  4R1F A;  1UY8 A;  4MPC A;  2ZDY A;  5D6Q A;  4XIT A;  2YK2 A;  1ZW9 A;  4EGH A;  4QPK A;  5IDJ A;  5D7R A;  1QY8 A;  5M4P A;  3FT5 A;  4PL9 A;  1KIJ A;  3EKO A;  2IOP A;  5D7D A;  1R62 A;  2BZ5 A;  2BU5 A;  1UY9 A;  1YT1 A;  1GKZ A;  3PEH A;  2CCT A;  2H8M A;  3B24 A;  2CCS A;  3K97 A;  3OWD A;  4XKO A;  3D36 A;  4XD8 A;  4X9L A;  4FMT A;  2YKI A;  1BGQ A;  4XKA A;  4BIZ A;  3O0I A;  4JAS A;  3B27 A;  4I3H A;  3KE6 A;  3ZXQ A;  1I58 A;  5D7C A;  3WHA A;  3INW A;  3R92 A;  4I5S A;  1U2O A;  4XC0 A;  1Z5B A;  1YC4 A;  3O2F A;  2YGA A;  2FWY A;  2YEG A;  4H7Q A;  1S14 A;  1AMW A;  4BIU A;  3RLP A;  4PU9 A;  2YK9 A;  3HHU A;  1I5C A;  1AH8 A;  3HEK A;  1TIL A;  4ASG A;  4H81 A;  2HCH A;  1I5D A;  4ASA A;  3G75 A;  3U2K A;  2YEC A;  1YET A;  2XAB A;  4DUH A;  4XE2 A;  1UYG A;  1Z5A A;  2WI3 A;  4L90 A;  1AH6 A;  3EHG A;  4YKT A;  4HXZ A;  3EHF A;  1YC1 A;  3H4L A;  3U2D A;  4XIR A;  2EXL A;  1QYE A;  4WUC A;  5FWK A;  2Q2E B;  1Y8O A;  3HYY A;  2WEQ A;  1NHH A;  3IED A;  2XX5 A;  2ZKJ A;  1Z5C A;  5CTW A;  1I5B A;  2XJJ A;  5D6P A;  3GIG A;  4BQG A;  4MOT A;  5M4E A;  4PRV A;  4AWO A;  4CWN A;  1UYH A;  2JJC A;  4U7O A;  2XHT A;  4YKW A;  2YJX A;  1L0O A;  4HZ5 A;  4KP4 A;  3G7E A;  3SL2 A;  4E02 A;  1ZWH A;  1BYQ A;  1I5A A;  3K98 A;  4O07 A;  5FNF A;  2H55 A;  2YEB A;  3OWB A;  4K4O A;  4MP7 A;  3TTZ A;  1GKX A;  1YES A;  4HZ0 A;  1YC3 A;  2YJW A;  3A0T A;  4EM7 A;  2GFD A;  4WUB A;  4LWI A;  4BAE A;  4CWS A;  4KFG A;  1UYF A;  3BMY A;  4CE1 A;  3D0B A;  3EHH A;  4HYM A;  4B6C A;  4FCR A;  4URO A;  2WI7 A;  4LP0 A;  2YEE A;  3TZ0 A;  4NH9 A;  4NH8 A;  3H80 A;  3HZ1 A;  2WI5 A;  1OSF A;  4QPJ A;  3RLR A;  4H85 A;  1YER A;  4YKU A;  2BYH A;  2YGE A;  3ZKD A;  1BKN A;  4YKY A;  2WER A;  4YKZ A;  4FPP A;  3TZ5 A;  3JZ3 A;  4P8O A;  4AWQ A;  2BSM A; 
#chains in the Genus database with same CATH topology
 1YT0 A;  2XDL A;  2XK2 A;  3Q5J A;  2YE9 A;  1TC0 A;  2IOR A;  1BXD A;  4E01 A;  4MBC A;  4O04 A;  3CYG A;  2WI6 A;  3GIE A;  5F3K A;  2ZBK B;  2BU6 A;  1KZN A;  2VCJ A;  2WI4 A;  2O1V A;  1TID A;  2ESA A;  4ZVI A;  3OW6 A;  3GIF A;  4E72 A;  4YKX A;  4V26 A;  1MX0 A;  3CRK A;  2XDX A;  3LPS A;  2IWS A;  1UYC A;  3TZ4 A;  1YSR A;  3C0E A;  2CG9 A;  5C93 A;  2ZDX A;  2C2A A;  1YSZ A;  2BTZ A;  3B25 A;  4JAV A;  5FNC A;  2BYI A;  3K60 A;  4BXI A;  3VHD A;  3CGY A;  4EMV A;  4FCQ A;  1I59 A;  5FND A;  5M4H A;  4CE2 A;  2YED A;  2YKC A;  4AS9 A;  2FTK A;  3O6O A;  4R3M A;  5GGZ A;  2XHX A;  4U93 A;  4KSH A;  2QG2 A;  4FCP A;  4HY6 A;  4XTJ A;  5IDM A;  4URL A;  1UY7 A;  1TH8 A;  4JQL A;  4XCJ A;  4R3A A;  2E0A A;  2YI0 A;  3LNU A;  3VHA A;  4O0B A;  1UYD A;  3VAD A;  4LWG A;  4AWP A;  3INX A;  1EA6 A;  1UY6 A;  4YKR A;  1Y4S A;  4EEH A;  4HY1 A;  3RKZ A;  1UYK A;  3A0Z A;  4EGK A;  4EFT A;  3R4M A;  2O1U A;  1ZXN A;  2YKB A;  5J6A A;  5CTY A;  5CTU A;  4GFN A;  2XX2 A;  4LWF A;  3U67 A;  1S16 A;  2Q8I A;  2YE5 A;  2YE8 A;  4O05 A;  3ZM7 A;  4BQJ A;  2YEI A;  2XHR A;  5M4M A;  4MB9 A;  4ASB A;  4KSG A;  4PRX A;  2Q8G A;  3OPD A;  3QTF A;  3A0X A;  1YS3 A;  2YI5 A;  3D2R A;  5F5R A;  2JKI A;  2C1G A;  3B28 A;  3TUH A;  1B3Q A;  2XD6 A;  4GEE A;  3G7B A;  3A0R A;  4L94 A;  1JM6 A;  4GGL A;  2YKJ A;  3K99 A;  5M4N A;  4NH7 A;  1B63 A;  4CWR A;  3MNR P;  2YEJ A;  2YEF A;  4U7N A;  4DZY A;  2WI2 A;  2Q8F A;  1US7 A;  3A0W A;  2YE6 A;  1QZR A;  4CWF A;  2YI6 A;  3T0Z A;  5BOD A;  5M4K A;  5IN9 A;  4EGI A;  3T0H A;  4V25 A;  2HHI A;  4MPN A;  1PVG A;  4CWO A;  2BU8 A;  1THN A;  3Q5L A;  2FXS A;  4EFU A;  4L93 A;  2IOQ A;  2CH4 A;  2YE2 A;  1ID0 A;  1GJV A;  1UYI A;  2GQP A;  4KTN A;  2YGF A;  3OMU A;  5J71 A;  4GQT A;  3R4P A;  4CWT A;  4W7T A;  4L91 A;  4XIQ A;  3VHC A;  3TZ2 A;  4B7P A;  2BU7 A;  4KQV A;  1NHJ A;  1Y4U A;  3T2S A;  1H7S A;  2BRE A;  2XX4 A;  2QG0 A;  5CTX A;  3WQ9 A;  2XDK A;  2YKE A;  3QDD A;  3GIG B;  2YE3 A;  3BM9 A;  2YE4 A;  3NMQ A;  3PEJ A;  1U0Z A;  2IWX A;  2VWC A;  4E00 A;  4URN A;  4XCL A;  3RLQ A;  2XCM A;  4CE3 A;  3A0Y A;  3S5T A;  2YEH A;  4MP2 A;  4CWQ A;  2QF6 A;  4WUD A;  3B26 A;  3C11 A;  2HG1 A;  1H7U A;  3T1K A;  4ZKI A;  1MU5 A;  4GCZ A;  3R91 A;  2XDU A;  4URM A;  1YT2 A;  2CGF A;  2O1W A;  4MPE A;  1TBW A;  3R4O A;  1ZXM A;  4JAU A;  2VCI A;  2PNR A;  2HKJ A;  2UWD A;  4LWE A;  4P7A A;  5L3J A;  2BT0 A;  3Q5K A;  3ZXO A;  2VW5 A;  2AKP A;  3CGZ A;  4XDM A;  1AM1 A;  3CRL A;  3CWV A;  3ZKB A;  2IWU A;  4LWH A;  2Q8H A;  2K5B A;  3FV5 A;  2YEA A;  2WI1 A;  1Y8P A;  2BU2 A;  2FYP A;  2FWZ A;  2XDS A;  5BOC A;  2CCU A;  4CWP A;  1B62 A;  4GT8 A;  1NHI A;  4HXW A;  3HZ5 A;  2BRC A;  3EHJ A;  4LPB A;  1Y8N A;  3FT8 A;  2YI7 A;  3DGE A;  1A4H A;  1TC6 A;  2QFO A;  4Q20 A;  1AJ6 A;  2YE7 A;  4L8Z A;  1UYE A;  4YKQ A;  5CF0 A;  4XKK A;  2XJX A;  1UYL A;  3EKR A;  3T10 A;  4ASF A;  1EI1 A;  1UYM A;  2XJG A;  3HYZ A;  4XIP A;  1Z59 A;  5CPH A;  4HYP A;  4O09 A;  3R4N A;  2WEP A;  4R1F A;  1UY8 A;  4MPC A;  2ZDY A;  5D6Q A;  4XIT A;  2YK2 A;  1ZW9 A;  4EGH A;  4QPK A;  5IDJ A;  5D7R A;  1QY8 A;  5M4P A;  3FT5 A;  4PL9 A;  1KIJ A;  1F51 A;  3EKO A;  2IOP A;  5D7D A;  1R62 A;  2BZ5 A;  2BU5 A;  1UY9 A;  1YT1 A;  1GKZ A;  3PEH A;  2CCT A;  2H8M A;  3B24 A;  2CCS A;  3K97 A;  3OWD A;  4XKO A;  3D36 A;  4XD8 A;  2C1I A;  4X9L A;  4FMT A;  2YKI A;  1BGQ A;  4XKA A;  4BIZ A;  3O0I A;  4JAS A;  3B27 A;  4I3H A;  3KE6 A;  5JEN A;  3ZXQ A;  1I58 A;  5D7C A;  3WHA A;  3INW A;  3R92 A;  4I5S A;  1U2O A;  4XC0 A;  1Z5B A;  1YC4 A;  3O2F A;  2YGA A;  2FWY A;  2YEG A;  4H7Q A;  1S14 A;  1AMW A;  4BIU A;  3RLP A;  3LMM A;  4PU9 A;  2YK9 A;  3HHU A;  1I5C A;  1AH8 A;  3HEK A;  1TIL A;  4ASG A;  4H81 A;  2HCH A;  1I5D A;  4ASA A;  3G75 A;  3U2K A;  2YEC A;  1YET A;  2XAB A;  4DUH A;  4XE2 A;  1UYG A;  1Z5A A;  2WI3 A;  4L90 A;  1AH6 A;  3EHG A;  4YKT A;  4HXZ A;  3EHF A;  1YC1 A;  3H4L A;  3U2D A;  4XIR A;  2EXL A;  1QYE A;  4WUC A;  5FWK A;  2Q2E B;  1Y8O A;  3HYY A;  2WEQ A;  1NHH A;  3IED A;  2XX5 A;  2ZKJ A;  1Z5C A;  5CTW A;  1I5B A;  2XJJ A;  5D6P A;  3GIG A;  4BQG A;  4MOT A;  5M4E A;  1IXM A;  4PRV A;  4AWO A;  4CWN A;  1UYH A;  2JJC A;  4U7O A;  2XHT A;  4YKW A;  2YJX A;  1L0O A;  4HZ5 A;  4KP4 A;  3G7E A;  3SL2 A;  4E02 A;  1ZWH A;  1BYQ A;  1I5A A;  3K98 A;  4O07 A;  5FNF A;  2H55 A;  2YEB A;  3OWB A;  4K4O A;  4MP7 A;  3TTZ A;  1GKX A;  1YES A;  4HZ0 A;  1YC3 A;  2YJW A;  3A0T A;  4EM7 A;  2GFD A;  4WUB A;  4LWI A;  4BAE A;  4CWS A;  4KFG A;  1UYF A;  3BMY A;  4CE1 A;  3D0B A;  3EHH A;  4HYM A;  4B6C A;  4FCR A;  4URO A;  2WI7 A;  4LP0 A;  2YEE A;  3TZ0 A;  4NH9 A;  4NH8 A;  3H80 A;  3HZ1 A;  2WI5 A;  1OSF A;  4QPJ A;  3RLR A;  4H85 A;  1YER A;  4YKU A;  2BYH A;  2YGE A;  3ZKD A;  1BKN A;  4YKY A;  2WER A;  4YKZ A;  4FPP A;  3TZ5 A;  3JZ3 A;  4P8O A;  4AWQ A;  2BSM A; 
#chains in the Genus database with same CATH homology
 1YT0 A;  2XDL A;  2XK2 A;  3Q5J A;  2YE9 A;  1TC0 A;  2IOR A;  1BXD A;  4E01 A;  4MBC A;  4O04 A;  2WI6 A;  3GIE A;  5F3K A;  2ZBK B;  2BU6 A;  1KZN A;  2VCJ A;  2WI4 A;  2O1V A;  1TID A;  2ESA A;  4ZVI A;  3OW6 A;  3GIF A;  4YKX A;  4V26 A;  1MX0 A;  3CRK A;  2XDX A;  3LPS A;  2IWS A;  1UYC A;  3TZ4 A;  1YSR A;  3C0E A;  2CG9 A;  5C93 A;  2ZDX A;  2C2A A;  1YSZ A;  2BTZ A;  3B25 A;  4JAV A;  5FNC A;  2BYI A;  3K60 A;  4BXI A;  3VHD A;  3CGY A;  4EMV A;  4FCQ A;  1I59 A;  5FND A;  5M4H A;  4CE2 A;  2YED A;  2YKC A;  4AS9 A;  3O6O A;  4R3M A;  5GGZ A;  2XHX A;  4U93 A;  4KSH A;  2QG2 A;  4FCP A;  4HY6 A;  4XTJ A;  5IDM A;  4URL A;  1UY7 A;  1TH8 A;  4JQL A;  4XCJ A;  4R3A A;  2E0A A;  2YI0 A;  3LNU A;  3VHA A;  4O0B A;  1UYD A;  3VAD A;  4LWG A;  4AWP A;  3INX A;  1EA6 A;  1UY6 A;  4YKR A;  1Y4S A;  4EEH A;  4HY1 A;  3RKZ A;  1UYK A;  3A0Z A;  4EGK A;  4EFT A;  3R4M A;  2O1U A;  1ZXN A;  2YKB A;  5J6A A;  5CTY A;  5CTU A;  4GFN A;  2XX2 A;  4LWF A;  3U67 A;  1S16 A;  2Q8I A;  2YE5 A;  2YE8 A;  4O05 A;  3ZM7 A;  4BQJ A;  2YEI A;  2XHR A;  5M4M A;  4MB9 A;  4ASB A;  4KSG A;  4PRX A;  2Q8G A;  3OPD A;  3QTF A;  3A0X A;  1YS3 A;  2YI5 A;  3D2R A;  5F5R A;  2JKI A;  3B28 A;  3TUH A;  1B3Q A;  2XD6 A;  4GEE A;  3G7B A;  3A0R A;  4L94 A;  1JM6 A;  4GGL A;  2YKJ A;  3K99 A;  5M4N A;  4NH7 A;  1B63 A;  4CWR A;  3MNR P;  2YEJ A;  2YEF A;  4U7N A;  4DZY A;  2WI2 A;  2Q8F A;  1US7 A;  3A0W A;  2YE6 A;  1QZR A;  4CWF A;  2YI6 A;  3T0Z A;  5BOD A;  5M4K A;  5IN9 A;  4EGI A;  3T0H A;  4V25 A;  4MPN A;  1PVG A;  4CWO A;  2BU8 A;  1THN A;  3Q5L A;  2FXS A;  4EFU A;  4L93 A;  2IOQ A;  2CH4 A;  2YE2 A;  1ID0 A;  1GJV A;  1UYI A;  2GQP A;  4KTN A;  2YGF A;  3OMU A;  5J71 A;  4GQT A;  3R4P A;  4CWT A;  4W7T A;  4L91 A;  4XIQ A;  3VHC A;  3TZ2 A;  4B7P A;  2BU7 A;  4KQV A;  1NHJ A;  1Y4U A;  3T2S A;  1H7S A;  2BRE A;  2XX4 A;  2QG0 A;  5CTX A;  3WQ9 A;  2XDK A;  2YKE A;  3QDD A;  3GIG B;  2YE3 A;  3BM9 A;  2YE4 A;  3NMQ A;  3PEJ A;  1U0Z A;  2IWX A;  2VWC A;  4E00 A;  4URN A;  4XCL A;  3RLQ A;  2XCM A;  4CE3 A;  3A0Y A;  2YEH A;  4MP2 A;  4CWQ A;  2QF6 A;  4WUD A;  3B26 A;  3C11 A;  2HG1 A;  1H7U A;  3T1K A;  4ZKI A;  1MU5 A;  4GCZ A;  3R91 A;  2XDU A;  4URM A;  1YT2 A;  2CGF A;  2O1W A;  4MPE A;  1TBW A;  3R4O A;  1ZXM A;  4JAU A;  2VCI A;  2PNR A;  2HKJ A;  2UWD A;  4LWE A;  4P7A A;  5L3J A;  2BT0 A;  3Q5K A;  3ZXO A;  2VW5 A;  2AKP A;  3CGZ A;  4XDM A;  1AM1 A;  3CRL A;  3CWV A;  3ZKB A;  2IWU A;  4LWH A;  2Q8H A;  2K5B A;  3FV5 A;  2YEA A;  2WI1 A;  1Y8P A;  2BU2 A;  2FYP A;  2FWZ A;  2XDS A;  5BOC A;  2CCU A;  4CWP A;  1B62 A;  4GT8 A;  1NHI A;  4HXW A;  3HZ5 A;  2BRC A;  3EHJ A;  4LPB A;  1Y8N A;  3FT8 A;  2YI7 A;  3DGE A;  1A4H A;  1TC6 A;  2QFO A;  4Q20 A;  1AJ6 A;  2YE7 A;  4L8Z A;  1UYE A;  4YKQ A;  5CF0 A;  4XKK A;  2XJX A;  1UYL A;  3EKR A;  3T10 A;  4ASF A;  1EI1 A;  1UYM A;  2XJG A;  3HYZ A;  4XIP A;  1Z59 A;  5CPH A;  4HYP A;  4O09 A;  3R4N A;  2WEP A;  4R1F A;  1UY8 A;  4MPC A;  2ZDY A;  5D6Q A;  4XIT A;  2YK2 A;  1ZW9 A;  4EGH A;  4QPK A;  5IDJ A;  5D7R A;  1QY8 A;  5M4P A;  3FT5 A;  4PL9 A;  1KIJ A;  3EKO A;  2IOP A;  5D7D A;  1R62 A;  2BZ5 A;  2BU5 A;  1UY9 A;  1YT1 A;  1GKZ A;  3PEH A;  2CCT A;  2H8M A;  3B24 A;  2CCS A;  3K97 A;  3OWD A;  4XKO A;  3D36 A;  4XD8 A;  4X9L A;  4FMT A;  2YKI A;  1BGQ A;  4XKA A;  4BIZ A;  3O0I A;  4JAS A;  3B27 A;  4I3H A;  3KE6 A;  3ZXQ A;  1I58 A;  5D7C A;  3WHA A;  3INW A;  3R92 A;  4I5S A;  1U2O A;  4XC0 A;  1Z5B A;  1YC4 A;  3O2F A;  2YGA A;  2FWY A;  2YEG A;  4H7Q A;  1S14 A;  1AMW A;  4BIU A;  3RLP A;  4PU9 A;  2YK9 A;  3HHU A;  1I5C A;  1AH8 A;  3HEK A;  1TIL A;  4ASG A;  4H81 A;  2HCH A;  1I5D A;  4ASA A;  3G75 A;  3U2K A;  2YEC A;  1YET A;  2XAB A;  4DUH A;  4XE2 A;  1UYG A;  1Z5A A;  2WI3 A;  4L90 A;  1AH6 A;  3EHG A;  4YKT A;  4HXZ A;  3EHF A;  1YC1 A;  3H4L A;  3U2D A;  4XIR A;  2EXL A;  1QYE A;  4WUC A;  5FWK A;  2Q2E B;  1Y8O A;  3HYY A;  2WEQ A;  1NHH A;  3IED A;  2XX5 A;  2ZKJ A;  1Z5C A;  5CTW A;  1I5B A;  2XJJ A;  5D6P A;  3GIG A;  4BQG A;  4MOT A;  5M4E A;  4PRV A;  4AWO A;  4CWN A;  1UYH A;  2JJC A;  4U7O A;  2XHT A;  4YKW A;  2YJX A;  1L0O A;  4HZ5 A;  4KP4 A;  3G7E A;  3SL2 A;  4E02 A;  1ZWH A;  1BYQ A;  1I5A A;  3K98 A;  4O07 A;  5FNF A;  2H55 A;  2YEB A;  3OWB A;  4K4O A;  4MP7 A;  3TTZ A;  1GKX A;  1YES A;  4HZ0 A;  1YC3 A;  2YJW A;  3A0T A;  4EM7 A;  2GFD A;  4WUB A;  4LWI A;  4BAE A;  4CWS A;  4KFG A;  1UYF A;  3BMY A;  4CE1 A;  3D0B A;  3EHH A;  4HYM A;  4B6C A;  4FCR A;  4URO A;  2WI7 A;  4LP0 A;  2YEE A;  3TZ0 A;  4NH9 A;  4NH8 A;  3H80 A;  3HZ1 A;  2WI5 A;  1OSF A;  4QPJ A;  3RLR A;  4H85 A;  1YER A;  4YKU A;  2BYH A;  2YGE A;  3ZKD A;  1BKN A;  4YKY A;  2WER A;  4YKZ A;  4FPP A;  3TZ5 A;  3JZ3 A;  4P8O A;  4AWQ A;  2BSM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...